2EINE

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully oxidized state
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 39
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2einE00
3ABLE 2Y69E 3ASNE 2DYRE 2OCCE 1V54E 3AG2E 5B1BE 2EIME 3AG4E 2EIJE 5IY5E 5B1AE 1OCZE 2DYSE 3AG3E 3AG1E 3WG7E 2EINE 2ZXWE 3X2QE 3ABKE 5B3SE 1OCCE 3ASOE 1OCRE 2EIKE 3ABME 1OCOE 1V55E 2EILE
chains in the Genus database with same CATH superfamily
2R17C 3UM3A 1G3NB 2J07A 3UT7A 5EX3A 1FT1A 3L6AA 2F8YA 3J5PA 4N5QA 4APOA 1UN8A 3MZLB 2CHXA 4B8CB 2AXZA 5JHAA 1OCOE 3UXGA 2WQ6A 1KPSB 4BSXA 4TUUA 3EJNA 3JYSA 1S63A 4UWLA 4XX5A 3J5QB 2J4DA 3ULYA 1PAQA 2V5QC 1D9SA 2XCBA 1BI8B 1N4QA 3CSFA 1BI7B 3DWLG 4J8EA 4Q69A 3PNLB 2QYUA 5CECB 4JC8A 5JHBA 1DNPA 4TUMA 4LERA 2VTBA 3B95A 1HX8A 3Q73A 2MHKA 3ZFWA 1TNZA 3CQCB 5AYWD 4FJYA 2LNIA 3QOUA 3E37A 4N3AA 4OYSA 2GRLA 2P58C 2XEHA 3B7TA 3QWPA 3LJNA 3O4ZA 3B7SA 5LCWJ 1H6PA 3VTXA 1EPUA 3B7UX 3F6QA 2H6HA 1JCSA 3D9NA 1N4RA 2BUGA 4IULA 1MYOA 4IYPA 3SI5A 2EILE 4ILIA 3PUJA 3KD7A 3TWRA 3G2VA 4J0UA 4JZYA 3ZYMA 3CVPA 3TWQA 2AXVA 4WWNA 2J4BA 2Q7FA 3CKBA 4FJZA 3MKQB 3RU0A 5DIZA 3CVNA 4NRHB 4DLOA 2KM4A 3GZ1A 1DVPA 3P2BA 4L9PA 2AJAA 3UX4A 1TJCA 3T5XA 2A5EA 3FUKA 4LG6A 4GTTA 1HG5A 2IF4A 1ELRA 1OWMA 1OXJA 5AN8A 1TN7A 3G2UA 4PDXA 4BSZB 4AJWA 2KXPC 4ILHB 3AG2E 4CZ2D 2WMOA 3PNTB 4G8LA 3IXEA 1O1TA 4WNGA 1XNFA 5G05J 1Q2ZA 1Y8MA 2ILRA 2EQXA 5EILA 2H6FA 2XS8A 2R5SA 5G2NA 3Q9UC 3BG0B 4KBQA 3KSQA 4GZDA 3CLJA 4J8YA 2PL2A 1KT1A 3K9IA 5BV0A 1AP7A 1FVFA 1DCQA 2M63A 1L5JA 3L82A 4QFVA 1IKND 4I9CA 2VSYA 2VGYA 2KBXA 3Q7FA 1UG3A 5CCMA 2VJ8A 3FH7A 2V8SE 2XCCA 5AIJA 1YA0A 1H2VC 4F53A 2XRZA 1H6OA 2I1JA 5DBKA 3ZNGA 3UMVA 3DPYA 4GMLA 3UIPC 5CMYA 4BT8A 2XPZA 5AQBA 2FO7A 1MJ0A 1Z3XA 3OXLA 3ZUVB 4L2LA 3FWVA 1N0QA 1E8XA 1S70B 2F0YA 2DZOA 3TJPA 3NAWA 2V4LA 3ZGQA 3CVXA 3ZYLA 3UT4A 5CBNA 5EKQD 3SBSA 1H0AA 4HVBA 1NA0A 4YNDA 1AWCB 3PEUB 1QYMA 4H7XA 4XKBA 4JL0A 3HYMB 3RO2A 3ESKA 4WNDA 4BX8A 2XGOA 3UM0A 3TG5A 4N5CA 1TJFA 3AG1E 3DSUA 2CG2A 3FEYA 4F6RD 2ONDA 3MJWA 4DRXE 2WXFA 3DEPA 4RSYA 2JEKA 2BKGA 2UWJG 1NFIE 5KWDA 2P2CP 3MKQA 1BU9A 3UQ3A 5BV1A 5T3RA 3C3QA 3TWSA 5T4YA 4I6GA 2KZTB 4PS8A 5D2MC 1YCSB 4APFA 2PQRA 3C3RA 2X6KA 4GCNA 4U07A 2X6JA 3C3OA 3PZDA 1KLXA 3SNXA 4L1BA 3D9JA 3ULQA 3ONKA 3AAAC 3U9WA 1E96B 3Q47B 5G55A 5LP0A 4LSZE 3CKCA 5EYLA 2BF0X 2FI7A 4TXRA 4GCOA 3KSLA 1QZ2A 5CMWA 3JQ1A 3LJ3A 2R05A 4HFGA 1WM5A 3RO3A 3HXFA 4D10C 3DPDA 3SGHA 3FUJA 4CT0A 2ZXWE 5FZQA 3ASOE 2XEEA 4GA0A 3T8MA 3O48A 2HM8A 4GPKA 3JUEA 1N4PA 2IOSA 1D8EA 3EUVA 4M7CA 2Y1LE 2CHZA 1TNBA 1OCZE 2XQ0A 3LS8A 4I9EA 3OTNA 1UN9A 2WXLA 4JHJA 4N2QA 3ASGA 2XRYA 3FTVA 1HXIA 1OT8A 4HOUA 2FULA 3HXEA 2E0IA 4J7WA 3FU3A 2BKKB 2J08A 3U66A 4A63B 4CDMA 2XPYA 2AW6A 4HRNA 3G2SA 1Y6IA 1TR4A 3FUIA 3Q79A 3SQVA 4U04A 4GMRA 1HS6A 2IONA 1K1BA 1S64A 4AM9A 5HRYA 4JB8P 4HNAD 4GA1A 4XIFA 3ZRHA 2XZTG 4ZFHA 1HU3A 2WQHA 4M3OA 3G2WA 4UWGA 3CVUA 3DRAA 2YQ8A 3R9AB 1NL4A 4LNGA 4FLHA 3CEQA 2A4ZA 4I2ZA 4I1MA 2NC9A 1NZNA 5LOZA 4LCTA 5BXOA 2LXMA 3QARA 3LDZA 5T8IA 5EYPF 3OXFA 3AG4E 4UWHA 5ENOD 4FP7A 1WDYA 2CG3A 4UWFA 4U95D 5EN5D 3CV0A 3CSTA 4KZ0A 3CVYA 3CVVA 2IJGX 2ZISA 4B0ZA 3SD5A 1H2TC 4XKCA 3LY7A 4G25A 1EDUA 5CCLA 5LFAA 2OEWA 1JWFA 3LEWA 5HKPA 4BETA 3HG0D 2CHWA 1UJKA 4U8HA 2HO1A 2P9UG 1IQUA 2I9CA 3JUIA 4YDOA 4C48B 3HIZA 2WMNA 4GYWA 3I4GA 4YDEA 4N2SA 2RFMA 1QBQA 4BY6A 4C9BB 2LAHA 4OVUA 3FUFA 3CHRA 4U96D 4BFRA 5B1BE 2V0PA 2H6IA 4B94A 3Q4AB 4AOFA 3ZPJA 1KT0A 3RSEG 3ML8A 2A5UA 4DI3A 4DJAA 5KNHD 3QDNA 4I17A 2OVFA 4GMJA 4GPMA 1IQRA 4BERA 4MBGA 1GW6A 4EPZA 4X8QA 2IOLA 5JJ6A 1FCHA 3QWVA 3AS4A 4K03A 1K8KG 3LPZA 4UI9C 3P1UA 4HRLA 2PM7A 3TL5A 3DSTA 2OEVA 3ASNE 2R03A 2EIME 3SO8A 3NZSA 2NSZA 2FO1E 1SA5A 1ZU2A 3R7RA 5KJNA 1HFAA 3E32A 3NOCD 2IFUA 3L17A 3DSWA 1PY1A 3Q75A 1A17A 3TWXA 3D9IA 4RQIA 2P9LG 2VSOE 1SW6A 5C1DA 1O5MA 1OWLA 1TN8A 4G2VA 4KZCA 1U3DA 3FHEA 4HS2A 3FTWA 3MV3B 4F3VA 3U4TA 1NP7A 4RVBA 3PS6A 1ZBPA 4FC8A 2ZGDA 3AG3E 1YYHA 4G11A 1KZOA 2ZIRA 3FTUA 2F8XK 3ABLE 3EHNA 3CHOA 3SFYA 4I1AA 3T9KA 3PZ3A 3JQ0A 3ZHEA 1OY3D 2X3MA 2HE0A 3CHQA 5ARGA 3D9OA 3DEOA 4WNEA 4G24A 4HOTA 2XGMA 4Z68A 5ANRA 3T8KA 3L08A 4EZJA 4I1OB 2B6CA 1UJJA 3EDTB 4J8SA 3KEAA 3SFZA 4URKA 4EHMA 4XI0A 4BTAA 5ENPD 4LUNU 4RLYA 3ZHEB 3QAQA 2QC9A 4GZ6A 4RG6A 4HQDA 4Y6WA 4AP2A 4U8VD 1H2UA 3HXCA 4MLPA 3ZKJA 1TEZA 3HXBA 5JMND 4GA2A 3NZUA 4UQZA 2E2EA 4WWOA 2Y4UA 4CEMA 2R2LA 4WWPA 4A3TA 3BU8A 3EIJA 1RZ4A 1JCQA 3S2AA 1N0RA 3TWVA 1MHQA 4KYOB 4RG9A 4WAFA 4PS7A 4Q94A 4DX6D 3Q78A 5ENTD 3JCKC 4FHKA 4OAUC 3FTZA 5D66A 4B89A 3ZXPA 1UW4B 2RKKA 2AWIA 4AVXA 3RKVA 2WXJA 5KJKA 3T5VA 4XE0A 2IEJA 2XS1A 4UUCA 4HOQA 3FUDA 5BUZA 1X81A 2B0OE 5G04J 3C72A 3DXKG 5D0OD 3QK0A 2IU1A 5M72A 2FEZA 1ELWA 4ANWA 5KBAA 4HI8A 5AQ7A 1OWNA 3MEKA 3ABKE 3TWWA 1XGWA 2WM9A 5KJMA 3LY8A 4TRQA 4MRUA 2CFUA 1QNFA 2C2LA 3PZ2A 4CGVA 3BUAA 2J9QA 5AENA 2UY1B 3SHFA 2EINE 4CCAA 5FQ7A 2X38A 2KZTA 5LCWC 2Y3AA 4HORA 4U0UA 2J49A 3N71A 2GW1A 3PEVB 4IN3B 3FUHA 4FHJA 2ETBA 2OCCE 3QKYA 5FQ6A 1HE8A 5E76A 4DX1A 1MZCA 5ENNA 4CRWA 2CFZA 3I3NA 2J8SD 3IEGA 3NBNB 1LTXA 4F7AA 3V2XA 4XZ4A 4E85A 4GU5A 2I2OA 3CK8A 2WVIA 3PH0C 3HDXA 3QWWA 1HZ4A 1JWGA 4GYOA 2PQNA 3SF4A 3FUNA 3SZ7A 3NOGD 4DX5D 2DVWA 5FINA 3FDHA 4JW1A 1N9AA 2BTDA 2P9KG 3IKOB 4UQYA 2WXPA 3CQGB 3EHRA 3PVLA 3AJIA 5ANLA 3UM1A 5CHEE 1OWOA 4BTBA 5KCMA 2AXUA 2WXNA 4K0RA 4JEUA 4NIKA 1P5QA 3UINC 2UY1A 3MV2B 3FP3A 2ZGGA 2MOWA 2XENA 2ETCA 2P9SG 3UTMA 4J8DA 3ASHA 1NI1A 3TG4A 2YHEA 4G26A 4JEHA 2Y69E 2LXLA 5CRVA 4CGWA 5ENQD 3RRMB 1HH8A 5FQ8A 5JJ7A 4N3BA 2DBAA 1IYGA 1IXVA 2YNQA 1KZPA 1U3CA 4E6HA 2KCKA 5FZRA 4F1SA 3B7BA 4PS3A 4ABNA 1IHGA 2KATA 3APCA 3DSXA 3VLDA 4ME2A 2WQ7A 3ISMC 4G23A 2XEVA 1DC2A 1INZA 2GROB 4DUIA 5EDSA 2R59A 5A7DB 3D3MA 3QB2A 5JA4D 3I4RB 3RIBA 2VSXE 1RW2A 2QY7A 4L7TA 3S7BA 4GYYA 1FVHA 3HXDA 4YVQC 2OOEA 3RAUA 5BNWA 1BLXB 1MX6A 3CHMA 4DX7D 1MQSA 3Q9NC 4V3IA 3ZYQA 2I6HA 3EU5A 3EIQC 1E90A 4O6FA 4OAVB 2DYRE 2IY0C 3IV0A 5G04C 3V79K 3RRUA 2LSVA 4N3CA 1QQEA 1N54A 1N4SA 3TWUA 2YHCA 2WB2A 4F1PA 1OWPA 1W3BA 3UKUG 1JCRA 4LNBA 4YDYA 3V31A 4DK5A 1Z3YA 2Y4TA 3LY9A 5BW8C 4NQ0A 2FF4A 3PE3A 3EHQA 5ENRD 4J6IA 2QZAA 3TGOA 1SA4A 5AARA 2OV8A 1H19A 2WXKA 4G8KA 4O1OA 4JXTA 5C2YA 3FEXA 3WG7E 3L22A 5CRUA 4KXKB 2V4HC 1N94A 2I1KA 4EBAA 3TAXA 3ESLA 3FH8A 2PNNA 3CHPA 4N39A 5HQ8A 2X6IA 3UI2A 2DZNA 4LEUA 3HVEA 3L54A 3S7DA 4CDRA 4EECA 3FTYA 3PREA 4FLBA 4GTRA 5A6CA 3TWTA 3ZXSA 4JVSA 3KAEA 3FU5A 3E34A 2YINA 3L13A 1WG0A 2H6GA 4MS6A 1WY6A 5FWQA 3E33A 3BG1B 2GRMA 1UOHA 3L9TA 4C0EA 2IQCA 3ASFA 4XEIG 3B7RL 3LCAA 3HRAA 4I2WA 3UT8A 3VLFA 5FT9A 3PZ4A 3JXJA 2WXHA 3NQPA 3EHMA 2MYOA 4JA7A 3RJVA 1HO8A 2ETAA 4I6EA 3ZW3A 1X5BA 3U3WA 5CEDB 1SVXA 5AAOA 3LXUX 5EIDA 3KEZA 2HR2A 4ANUA 1K3ZD 3CVLA 2NXPA 1TNOA 3S7FA 4UQXA 2RD0A 3E4BA 3CVWA 3ZIMA 4AIFA 4ANVA 4QQIA 3URZA 4AY5A 5FZSA 2QFCA 4A3VA 4GAAA 4OVVA 2FBNA 2JABA 4UI9K 2VGEA 4YDWA 3V30A 4I43A 3UPVA 1Z6TA 3WXXA 1YMPA 5EX0A 3SFXA 2P9NG 4HI9A 1TYQG 4ZHBA 3JXIA 4IRUA 4I6JA 2NYJA 4GZ3A 4NACA 4GTPA 1E7VA 4UI9J 3IBEA 2XHEA 3FUEA 5AQAA 3ULEG 2C0LA 2EIKE 4P29A 3QC1A 3APFA 1MX2A 5BPPA 4ACKA 3DXMG 1LD7A 4K5CA 1BPOA 4ILGA 4LRZA 4XI9A 3SY2A 4HB5A 3NF1A 4KVOA 2C0MA 3FULA 3BQOA 3Q49B 4ATZD 3PE4A 3MCXA 3DSSA 5FIOA 2VQ2A 4AXHA 5AJLA 4U0SA 3FFLA 3DSVA 2LO6A 3EU9A 4HXIA 1ZB1A 3DBSA 4CYMD 4A55A 2LUHA 4PH4B 3MYVA 2JLBA 3FTSA 3IHYA 2GRRB 4TXQA 3V2OA 4K5BA 1OUVA 5ARFA 4JHRA 5J90A 3W9GA 2MRIA 4FULA 3Q5MA 5CBOA 4WUYA 4GTOA 3I5PA 3FU0A 4KMOA 4FA6A 2KCLA 1EF1C 1E7UA 2L0IA 4BEPA 5KNGA 4CDNA 1WAO1 2WPVA 3ML9A 3D9LA 4G1TA 3RRNB 2OVBA 4O60A 3APDA 4EBAG 3UM2A 3MGBA 3X2QE 2GRQB 3U64A 2WXGA 4JD2G 2WXOA 3ZN3A 1V54E 4U63A 1FT2A 4GTMA 5E75A 5IY5E 1DCEA 2PZIA 3D9MA 3OAWA 3ZEFA 1OCCE 1U2VG 4DI4A 4MKTA 2IO2C 3LVRE 3ZYKA 5KJLA 3TXMA 4U7EB 3VTYA 3QJZA 2LSUA 3LKUA 2L6JA 3R9MA 3L16A 1N95A 3KS2A 4HOSA 2VTBB 3MKRA 4EZKA 4BESA 4JPSA 3G2TA 2HYZA 2QYJA 3CVQA 4LNUD 4EQFA 3S7JA 2P9IG 2X6HA 4O1PA 3AU4A 2V5FA 3CHSA 4BX9A 1LF8A 5A23A 4K5AB 4DX2A 3ENEA 3R7QA 4GB9A 3AS5A 1E8YA 1N11A 2LAIA 3HHMA 4KVMA 3FH5A 3GZSA 2DYSE 3CR3A 1FPPA 3ONLA 1VDYA 3CGHA 3ABME 3Q15A 5AQ9A 5JJTA 1LD8A 4HRMB 4GTQA 2AVPA 4JA9A 1NA3A 5EIBE 2L9BA 4C0MA 5D0QD 1BD8A 2XZDG 3BEEA 2KCVA 3GYZA 5ITZF 4Y6CA 4GTSA 2ZU6B 3LYAA 4DLQA 4HLEA 1ELKA 2VGXA 3QNKA 1JUQA 1TNUA 2WXMA 4FADA 4CT4A 1HF8A 4ACLA 1B89A 2GRPB 3GW4A 1SZAA 5B3SE 1S0PA 2IO3C 2RFAA 2WXQA 1O1RA 4NURA 4TV3A 2R02A 4L2YA 2L6BA 2RG8A 4BWRA 1IHBA 3D9HA 5BXUA 1JPLA 5FTPA 5BT1A 1TNYA 2F37A 3SBTB 1Z5SC 1E8WA 2GGFA 2XPIA 2Y0BG 4GTVA 3B13A 1D8DA 3PZ1A 4A1GA 3PRZA 5ENSD 3C5RA 3FUMA 4UWKA 2KC7A 3C98A 4EZLA 3RK6A 3HVEB 1A5EA 4B93B 4GZ5A 3CK7A 3PDNA 1MX4A 2EIJE 4H7YA 4Q96A 5FJYA 4AEZC 3LVQE 4JHKA 4HLLA 5CEAA 1SZ9A 3CK9A 4HBDA 4PUCA 4U0ZA 3NB2A 1N52A 2VSNA 1O1SA 5FQ4A 3IHVA 2L0TB 3UIOC 3OXGA 4DPRA 4W9RA 2DIWA 5LX8A 3Q7AA 5B1AE 2BEDA 2GRNB 3E30A 1SQMA 3D9PA 4U8YD 4BT9A 2J09A 4YVOA 4GZCA 3MA5A 4ANXA 2DCPA 2WXRA 4FU3A 5AJDA 3FTXA 5J08A 1E8ZA 2DWZA 3GZ2A 4TXPA 1TN6A 3ZU7B 3VLEA 3PUKA 4L23A 3MX3A 4J8FA 4R7LA 2P9PG 3AS8A 3FY4A 3ASDA 5HI7A 4B8AA 2XGSA 3UKRG 1PC2A 3CIAA 3FU6A 2VGXB 1K1AA 2VYIA 5G05C 2WXIA 4ATGA 1EYHA 4AY6A 2X6FA 1H6KA 4WNFA 4A1SA 5H7PA 3AU5A 3D9KA 3TXNA 2PM6A 3W9FA 3ZVVA 5CERB 1OCRE 4KT6B 5HS0A 4AV7A 3UUXA 1HG2A 1V55E
chains in the Genus database with same CATH topology
3ABLE 2Y69E 3ASNE 2DYRE 2OCCE 1V54E 3AG2E 5B1BE 2EIME 3AG4E 2EIJE 5IY5E 5B1AE 1OCZE 2DYSE 3AG3E 3AG1E 3WG7E 2EINE 2ZXWE 3X2QE 3ABKE 5B3SE 1OCCE 3ASOE 1OCRE 2EIKE 3ABME 1OCOE 1V55E 2EILE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABL E;  2Y69 E;  3ASN E;  2DYR E;  2OCC E;  1V54 E;  3AG2 E;  5B1B E;  2EIM E;  3AG4 E;  2EIJ E;  5IY5 E;  5B1A E;  1OCZ E;  2DYS E;  3AG3 E;  3AG1 E;  3WG7 E;  2EIN E;  2ZXW E;  3X2Q E;  3ABK E;  5B3S E;  1OCC E;  3ASO E;  1OCR E;  2EIK E;  3ABM E;  1OCO E;  1V55 E;  2EIL E; 
#chains in the Genus database with same CATH topology
 2R17 C;  3UM3 A;  1G3N B;  2J07 A;  3UT7 A;  5EX3 A;  1FT1 A;  3L6A A;  2F8Y A;  3J5P A;  4N5Q A;  4APO A;  1UN8 A;  3MZL B;  2CHX A;  4B8C B;  2AXZ A;  5JHA A;  1OCO E;  3UXG A;  2WQ6 A;  1KPS B;  4BSX A;  4TUU A;  3EJN A;  3JYS A;  1S63 A;  4UWL A;  4XX5 A;  3J5Q B;  2J4D A;  3ULY A;  1PAQ A;  2V5Q C;  1D9S A;  2XCB A;  1BI8 B;  1N4Q A;  3CSF A;  1BI7 B;  3DWL G;  4J8E A;  4Q69 A;  3PNL B;  2QYU A;  5CEC B;  4JC8 A;  5JHB A;  1DNP A;  4TUM A;  4LER A;  2VTB A;  3B95 A;  1HX8 A;  3Q73 A;  2MHK A;  3ZFW A;  1TNZ A;  3CQC B;  5AYW D;  4FJY A;  2LNI A;  3QOU A;  3E37 A;  4N3A A;  4OYS A;  2GRL A;  2P58 C;  2XEH A;  3B7T A;  3QWP A;  3LJN A;  3O4Z A;  3B7S A;  5LCW J;  1H6P A;  3VTX A;  1EPU A;  3B7U X;  3F6Q A;  2H6H A;  1JCS A;  3D9N A;  1N4R A;  2BUG A;  4IUL A;  1MYO A;  4IYP A;  3SI5 A;  2EIL E;  4ILI A;  3PUJ A;  3KD7 A;  3TWR A;  3G2V A;  4J0U A;  4JZY A;  3ZYM A;  3CVP A;  3TWQ A;  2AXV A;  4WWN A;  2J4B A;  2Q7F A;  3CKB A;  4FJZ A;  3MKQ B;  3RU0 A;  5DIZ A;  3CVN A;  4NRH B;  4DLO A;  2KM4 A;  3GZ1 A;  1DVP A;  3P2B A;  4L9P A;  2AJA A;  3UX4 A;  1TJC A;  3T5X A;  2A5E A;  3FUK A;  4LG6 A;  4GTT A;  1HG5 A;  2IF4 A;  1ELR A;  1OWM A;  1OXJ A;  5AN8 A;  1TN7 A;  3G2U A;  4PDX A;  4BSZ B;  4AJW A;  2KXP C;  4ILH B;  3AG2 E;  4CZ2 D;  2WMO A;  3PNT B;  4G8L A;  3IXE A;  1O1T A;  4WNG A;  1XNF A;  5G05 J;  1Q2Z A;  1Y8M A;  2ILR A;  2EQX A;  5EIL A;  2H6F A;  2XS8 A;  2R5S A;  5G2N A;  3Q9U C;  3BG0 B;  4KBQ A;  3KSQ A;  4GZD A;  3CLJ A;  4J8Y A;  2PL2 A;  1KT1 A;  3K9I A;  5BV0 A;  1AP7 A;  1FVF A;  1DCQ A;  2M63 A;  1L5J A;  3L82 A;  4QFV A;  1IKN D;  4I9C A;  2VSY A;  2VGY A;  2KBX A;  3Q7F A;  1UG3 A;  5CCM A;  2VJ8 A;  3FH7 A;  2V8S E;  2XCC A;  5AIJ A;  1YA0 A;  1H2V C;  4F53 A;  2XRZ A;  1H6O A;  2I1J A;  5DBK A;  3ZNG A;  3UMV A;  3DPY A;  4GML A;  3UIP C;  5CMY A;  4BT8 A;  2XPZ A;  5AQB A;  2FO7 A;  1MJ0 A;  1Z3X A;  3OXL A;  3ZUV B;  4L2L A;  3FWV A;  1N0Q A;  1E8X A;  1S70 B;  2F0Y A;  2DZO A;  3TJP A;  3NAW A;  2V4L A;  3ZGQ A;  3CVX A;  3ZYL A;  3UT4 A;  5CBN A;  5EKQ D;  3SBS A;  1H0A A;  4HVB A;  1NA0 A;  4YND A;  1AWC B;  3PEU B;  1QYM A;  4H7X A;  4XKB A;  4JL0 A;  3HYM B;  3RO2 A;  3ESK A;  4WND A;  4BX8 A;  2XGO A;  3UM0 A;  3TG5 A;  4N5C A;  1TJF A;  3AG1 E;  3DSU A;  2CG2 A;  3FEY A;  4F6R D;  2OND A;  3MJW A;  4DRX E;  2WXF A;  3DEP A;  4RSY A;  2JEK A;  2BKG A;  2UWJ G;  1NFI E;  5KWD A;  2P2C P;  3MKQ A;  1BU9 A;  3UQ3 A;  5BV1 A;  5T3R A;  3C3Q A;  3TWS A;  5T4Y A;  4I6G A;  2KZT B;  4PS8 A;  5D2M C;  1YCS B;  4APF A;  2PQR A;  3C3R A;  2X6K A;  4GCN A;  4U07 A;  2X6J A;  3C3O A;  3PZD A;  1KLX A;  3SNX A;  4L1B A;  3D9J A;  3ULQ A;  3ONK A;  3AAA C;  3U9W A;  1E96 B;  3Q47 B;  5G55 A;  5LP0 A;  4LSZ E;  3CKC A;  5EYL A;  2BF0 X;  2FI7 A;  4TXR A;  4GCO A;  3KSL A;  1QZ2 A;  5CMW A;  3JQ1 A;  3LJ3 A;  2R05 A;  4HFG A;  1WM5 A;  3RO3 A;  3HXF A;  4D10 C;  3DPD A;  3SGH A;  3FUJ A;  4CT0 A;  2ZXW E;  5FZQ A;  3ASO E;  2XEE A;  4GA0 A;  3T8M A;  3O48 A;  2HM8 A;  4GPK A;  3JUE A;  1N4P A;  2IOS A;  1D8E A;  3EUV A;  4M7C A;  2Y1L E;  2CHZ A;  1TNB A;  1OCZ E;  2XQ0 A;  3LS8 A;  4I9E A;  3OTN A;  1UN9 A;  2WXL A;  4JHJ A;  4N2Q A;  3ASG A;  2XRY A;  3FTV A;  1HXI A;  1OT8 A;  4HOU A;  2FUL A;  3HXE A;  2E0I A;  4J7W A;  3FU3 A;  2BKK B;  2J08 A;  3U66 A;  4A63 B;  4CDM A;  2XPY A;  2AW6 A;  4HRN A;  3G2S A;  1Y6I A;  1TR4 A;  3FUI A;  3Q79 A;  3SQV A;  4U04 A;  4GMR A;  1HS6 A;  2ION A;  1K1B A;  1S64 A;  4AM9 A;  5HRY A;  4JB8 P;  4HNA D;  4GA1 A;  4XIF A;  3ZRH A;  2XZT G;  4ZFH A;  1HU3 A;  2WQH A;  4M3O A;  3G2W A;  4UWG A;  3CVU A;  3DRA A;  2YQ8 A;  3R9A B;  1NL4 A;  4LNG A;  4FLH A;  3CEQ A;  2A4Z A;  4I2Z A;  4I1M A;  2NC9 A;  1NZN A;  5LOZ A;  4LCT A;  5BXO A;  2LXM A;  3QAR A;  3LDZ A;  5T8I A;  5EYP F;  3OXF A;  3AG4 E;  4UWH A;  5ENO D;  4FP7 A;  1WDY A;  2CG3 A;  4UWF A;  4U95 D;  5EN5 D;  3CV0 A;  3CST A;  4KZ0 A;  3CVY A;  3CVV A;  2IJG X;  2ZIS A;  4B0Z A;  3SD5 A;  1H2T C;  4XKC A;  3LY7 A;  4G25 A;  1EDU A;  5CCL A;  5LFA A;  2OEW A;  1JWF A;  3LEW A;  5HKP A;  4BET A;  3HG0 D;  2CHW A;  1UJK A;  4U8H A;  2HO1 A;  2P9U G;  1IQU A;  2I9C A;  3JUI A;  4YDO A;  4C48 B;  3HIZ A;  2WMN A;  4GYW A;  3I4G A;  4YDE A;  4N2S A;  2RFM A;  1QBQ A;  4BY6 A;  4C9B B;  2LAH A;  4OVU A;  3FUF A;  3CHR A;  4U96 D;  4BFR A;  5B1B E;  2V0P A;  2H6I A;  4B94 A;  3Q4A B;  4AOF A;  3ZPJ A;  1KT0 A;  3RSE G;  3ML8 A;  2A5U A;  4DI3 A;  4DJA A;  5KNH D;  3QDN A;  4I17 A;  2OVF A;  4GMJ A;  4GPM A;  1IQR A;  4BER A;  4MBG A;  1GW6 A;  4EPZ A;  4X8Q A;  2IOL A;  5JJ6 A;  1FCH A;  3QWV A;  3AS4 A;  4K03 A;  1K8K G;  3LPZ A;  4UI9 C;  3P1U A;  4HRL A;  2PM7 A;  3TL5 A;  3DST A;  2OEV A;  3ASN E;  2R03 A;  2EIM E;  3SO8 A;  3NZS A;  2NSZ A;  2FO1 E;  1SA5 A;  1ZU2 A;  3R7R A;  5KJN A;  1HFA A;  3E32 A;  3NOC D;  2IFU A;  3L17 A;  3DSW A;  1PY1 A;  3Q75 A;  1A17 A;  3TWX A;  3D9I A;  4RQI A;  2P9L G;  2VSO E;  1SW6 A;  5C1D A;  1O5M A;  1OWL A;  1TN8 A;  4G2V A;  4KZC A;  1U3D A;  3FHE A;  4HS2 A;  3FTW A;  3MV3 B;  4F3V A;  3U4T A;  1NP7 A;  4RVB A;  3PS6 A;  1ZBP A;  4FC8 A;  2ZGD A;  3AG3 E;  1YYH A;  4G11 A;  1KZO A;  2ZIR A;  3FTU A;  2F8X K;  3ABL E;  3EHN A;  3CHO A;  3SFY A;  4I1A A;  3T9K A;  3PZ3 A;  3JQ0 A;  3ZHE A;  1OY3 D;  2X3M A;  2HE0 A;  3CHQ A;  5ARG A;  3D9O A;  3DEO A;  4WNE A;  4G24 A;  4HOT A;  2XGM A;  4Z68 A;  5ANR A;  3T8K A;  3L08 A;  4EZJ A;  4I1O B;  2B6C A;  1UJJ A;  3EDT B;  4J8S A;  3KEA A;  3SFZ A;  4URK A;  4EHM A;  4XI0 A;  4BTA A;  5ENP D;  4LUN U;  4RLY A;  3ZHE B;  3QAQ A;  2QC9 A;  4GZ6 A;  4RG6 A;  4HQD A;  4Y6W A;  4AP2 A;  4U8V D;  1H2U A;  3HXC A;  4MLP A;  3ZKJ A;  1TEZ A;  3HXB A;  5JMN D;  4GA2 A;  3NZU A;  4UQZ A;  2E2E A;  4WWO A;  2Y4U A;  4CEM A;  2R2L A;  4WWP A;  4A3T A;  3BU8 A;  3EIJ A;  1RZ4 A;  1JCQ A;  3S2A A;  1N0R A;  3TWV A;  1MHQ A;  4KYO B;  4RG9 A;  4WAF A;  4PS7 A;  4Q94 A;  4DX6 D;  3Q78 A;  5ENT D;  3JCK C;  4FHK A;  4OAU C;  3FTZ A;  5D66 A;  4B89 A;  3ZXP A;  1UW4 B;  2RKK A;  2AWI A;  4AVX A;  3RKV A;  2WXJ A;  5KJK A;  3T5V A;  4XE0 A;  2IEJ A;  2XS1 A;  4UUC A;  4HOQ A;  3FUD A;  5BUZ A;  1X81 A;  2B0O E;  5G04 J;  3C72 A;  3DXK G;  5D0O D;  3QK0 A;  2IU1 A;  5M72 A;  2FEZ A;  1ELW A;  4ANW A;  5KBA A;  4HI8 A;  5AQ7 A;  1OWN A;  3MEK A;  3ABK E;  3TWW A;  1XGW A;  2WM9 A;  5KJM A;  3LY8 A;  4TRQ A;  4MRU A;  2CFU A;  1QNF A;  2C2L A;  3PZ2 A;  4CGV A;  3BUA A;  2J9Q A;  5AEN A;  2UY1 B;  3SHF A;  2EIN E;  4CCA A;  5FQ7 A;  2X38 A;  2KZT A;  5LCW C;  2Y3A A;  4HOR A;  4U0U A;  2J49 A;  3N71 A;  2GW1 A;  3PEV B;  4IN3 B;  3FUH A;  4FHJ A;  2ETB A;  2OCC E;  3QKY A;  5FQ6 A;  1HE8 A;  5E76 A;  4DX1 A;  1MZC A;  5ENN A;  4CRW A;  2CFZ A;  3I3N A;  2J8S D;  3IEG A;  3NBN B;  1LTX A;  4F7A A;  3V2X A;  4XZ4 A;  4E85 A;  4GU5 A;  2I2O A;  3CK8 A;  2WVI A;  3PH0 C;  3HDX A;  3QWW A;  1HZ4 A;  1JWG A;  4GYO A;  2PQN A;  3SF4 A;  3FUN A;  3SZ7 A;  3NOG D;  4DX5 D;  2DVW A;  5FIN A;  3FDH A;  4JW1 A;  1N9A A;  2BTD A;  2P9K G;  3IKO B;  4UQY A;  2WXP A;  3CQG B;  3EHR A;  3PVL A;  3AJI A;  5ANL A;  3UM1 A;  5CHE E;  1OWO A;  4BTB A;  5KCM A;  2AXU A;  2WXN A;  4K0R A;  4JEU A;  4NIK A;  1P5Q A;  3UIN C;  2UY1 A;  3MV2 B;  3FP3 A;  2ZGG A;  2MOW A;  2XEN A;  2ETC A;  2P9S G;  3UTM A;  4J8D A;  3ASH A;  1NI1 A;  3TG4 A;  2YHE A;  4G26 A;  4JEH A;  2Y69 E;  2LXL A;  5CRV A;  4CGW A;  5ENQ D;  3RRM B;  1HH8 A;  5FQ8 A;  5JJ7 A;  4N3B A;  2DBA A;  1IYG A;  1IXV A;  2YNQ A;  1KZP A;  1U3C A;  4E6H A;  2KCK A;  5FZR A;  4F1S A;  3B7B A;  4PS3 A;  4ABN A;  1IHG A;  2KAT A;  3APC A;  3DSX A;  3VLD A;  4ME2 A;  2WQ7 A;  3ISM C;  4G23 A;  2XEV A;  1DC2 A;  1INZ A;  2GRO B;  4DUI A;  5EDS A;  2R59 A;  5A7D B;  3D3M A;  3QB2 A;  5JA4 D;  3I4R B;  3RIB A;  2VSX E;  1RW2 A;  2QY7 A;  4L7T A;  3S7B A;  4GYY A;  1FVH A;  3HXD A;  4YVQ C;  2OOE A;  3RAU A;  5BNW A;  1BLX B;  1MX6 A;  3CHM A;  4DX7 D;  1MQS A;  3Q9N C;  4V3I A;  3ZYQ A;  2I6H A;  3EU5 A;  3EIQ C;  1E90 A;  4O6F A;  4OAV B;  2DYR E;  2IY0 C;  3IV0 A;  5G04 C;  3V79 K;  3RRU A;  2LSV A;  4N3C A;  1QQE A;  1N54 A;  1N4S A;  3TWU A;  2YHC A;  2WB2 A;  4F1P A;  1OWP A;  1W3B A;  3UKU G;  1JCR A;  4LNB A;  4YDY A;  3V31 A;  4DK5 A;  1Z3Y A;  2Y4T A;  3LY9 A;  5BW8 C;  4NQ0 A;  2FF4 A;  3PE3 A;  3EHQ A;  5ENR D;  4J6I A;  2QZA A;  3TGO A;  1SA4 A;  5AAR A;  2OV8 A;  1H19 A;  2WXK A;  4G8K A;  4O1O A;  4JXT A;  5C2Y A;  3FEX A;  3WG7 E;  3L22 A;  5CRU A;  4KXK B;  2V4H C;  1N94 A;  2I1K A;  4EBA A;  3TAX A;  3ESL A;  3FH8 A;  2PNN A;  3CHP A;  4N39 A;  5HQ8 A;  2X6I A;  3UI2 A;  2DZN A;  4LEU A;  3HVE A;  3L54 A;  3S7D A;  4CDR A;  4EEC A;  3FTY A;  3PRE A;  4FLB A;  4GTR A;  5A6C A;  3TWT A;  3ZXS A;  4JVS A;  3KAE A;  3FU5 A;  3E34 A;  2YIN A;  3L13 A;  1WG0 A;  2H6G A;  4MS6 A;  1WY6 A;  5FWQ A;  3E33 A;  3BG1 B;  2GRM A;  1UOH A;  3L9T A;  4C0E A;  2IQC A;  3ASF A;  4XEI G;  3B7R L;  3LCA A;  3HRA A;  4I2W A;  3UT8 A;  3VLF A;  5FT9 A;  3PZ4 A;  3JXJ A;  2WXH A;  3NQP A;  3EHM A;  2MYO A;  4JA7 A;  3RJV A;  1HO8 A;  2ETA A;  4I6E A;  3ZW3 A;  1X5B A;  3U3W A;  5CED B;  1SVX A;  5AAO A;  3LXU X;  5EID A;  3KEZ A;  2HR2 A;  4ANU A;  1K3Z D;  3CVL A;  2NXP A;  1TNO A;  3S7F A;  4UQX A;  2RD0 A;  3E4B A;  3CVW A;  3ZIM A;  4AIF A;  4ANV A;  4QQI A;  3URZ A;  4AY5 A;  5FZS A;  2QFC A;  4A3V A;  4GAA A;  4OVV A;  2FBN A;  2JAB A;  4UI9 K;  2VGE A;  4YDW A;  3V30 A;  4I43 A;  3UPV A;  1Z6T A;  3WXX A;  1YMP A;  5EX0 A;  3SFX A;  2P9N G;  4HI9 A;  1TYQ G;  4ZHB A;  3JXI A;  4IRU A;  4I6J A;  2NYJ A;  4GZ3 A;  4NAC A;  4GTP A;  1E7V A;  4UI9 J;  3IBE A;  2XHE A;  3FUE A;  5AQA A;  3ULE G;  2C0L A;  2EIK E;  4P29 A;  3QC1 A;  3APF A;  1MX2 A;  5BPP A;  4ACK A;  3DXM G;  1LD7 A;  4K5C A;  1BPO A;  4ILG A;  4LRZ A;  4XI9 A;  3SY2 A;  4HB5 A;  3NF1 A;  4KVO A;  2C0M A;  3FUL A;  3BQO A;  3Q49 B;  4ATZ D;  3PE4 A;  3MCX A;  3DSS A;  5FIO A;  2VQ2 A;  4AXH A;  5AJL A;  4U0S A;  3FFL A;  3DSV A;  2LO6 A;  3EU9 A;  4HXI A;  1ZB1 A;  3DBS A;  4CYM D;  4A55 A;  2LUH A;  4PH4 B;  3MYV A;  2JLB A;  3FTS A;  3IHY A;  2GRR B;  4TXQ A;  3V2O A;  4K5B A;  1OUV A;  5ARF A;  4JHR A;  5J90 A;  3W9G A;  2MRI A;  4FUL A;  3Q5M A;  5CBO A;  4WUY A;  4GTO A;  3I5P A;  3FU0 A;  4KMO A;  4FA6 A;  2KCL A;  1EF1 C;  1E7U A;  2L0I A;  4BEP A;  5KNG A;  4CDN A;  1WAO 1;  2WPV A;  3ML9 A;  3D9L A;  4G1T A;  3RRN B;  2OVB A;  4O60 A;  3APD A;  4EBA G;  3UM2 A;  3MGB A;  3X2Q E;  2GRQ B;  3U64 A;  2WXG A;  4JD2 G;  2WXO A;  3ZN3 A;  1V54 E;  4U63 A;  1FT2 A;  4GTM A;  5E75 A;  5IY5 E;  1DCE A;  2PZI A;  3D9M A;  3OAW A;  3ZEF A;  1OCC E;  1U2V G;  4DI4 A;  4MKT A;  2IO2 C;  3LVR E;  3ZYK A;  5KJL A;  3TXM A;  4U7E B;  3VTY A;  3QJZ A;  2LSU A;  3LKU A;  2L6J A;  3R9M A;  3L16 A;  1N95 A;  3KS2 A;  4HOS A;  2VTB B;  3MKR A;  4EZK A;  4BES A;  4JPS A;  3G2T A;  2HYZ A;  2QYJ A;  3CVQ A;  4LNU D;  4EQF A;  3S7J A;  2P9I G;  2X6H A;  4O1P A;  3AU4 A;  2V5F A;  3CHS A;  4BX9 A;  1LF8 A;  5A23 A;  4K5A B;  4DX2 A;  3ENE A;  3R7Q A;  4GB9 A;  3AS5 A;  1E8Y A;  1N11 A;  2LAI A;  3HHM A;  4KVM A;  3FH5 A;  3GZS A;  2DYS E;  3CR3 A;  1FPP A;  3ONL A;  1VDY A;  3CGH A;  3ABM E;  3Q15 A;  5AQ9 A;  5JJT A;  1LD8 A;  4HRM B;  4GTQ A;  2AVP A;  4JA9 A;  1NA3 A;  5EIB E;  2L9B A;  4C0M A;  5D0Q D;  1BD8 A;  2XZD G;  3BEE A;  2KCV A;  3GYZ A;  5ITZ F;  4Y6C A;  4GTS A;  2ZU6 B;  3LYA A;  4DLQ A;  4HLE A;  1ELK A;  2VGX A;  3QNK A;  1JUQ A;  1TNU A;  2WXM A;  4FAD A;  4CT4 A;  1HF8 A;  4ACL A;  1B89 A;  2GRP B;  3GW4 A;  1SZA A;  5B3S E;  1S0P A;  2IO3 C;  2RFA A;  2WXQ A;  1O1R A;  4NUR A;  4TV3 A;  2R02 A;  4L2Y A;  2L6B A;  2RG8 A;  4BWR A;  1IHB A;  3D9H A;  5BXU A;  1JPL A;  5FTP A;  5BT1 A;  1TNY A;  2F37 A;  3SBT B;  1Z5S C;  1E8W A;  2GGF A;  2XPI A;  2Y0B G;  4GTV A;  3B13 A;  1D8D A;  3PZ1 A;  4A1G A;  3PRZ A;  5ENS D;  3C5R A;  3FUM A;  4UWK A;  2KC7 A;  3C98 A;  4EZL A;  3RK6 A;  3HVE B;  1A5E A;  4B93 B;  4GZ5 A;  3CK7 A;  3PDN A;  1MX4 A;  2EIJ E;  4H7Y A;  4Q96 A;  5FJY A;  4AEZ C;  3LVQ E;  4JHK A;  4HLL A;  5CEA A;  1SZ9 A;  3CK9 A;  4HBD A;  4PUC A;  4U0Z A;  3NB2 A;  1N52 A;  2VSN A;  1O1S A;  5FQ4 A;  3IHV A;  2L0T B;  3UIO C;  3OXG A;  4DPR A;  4W9R A;  2DIW A;  5LX8 A;  3Q7A A;  5B1A E;  2BED A;  2GRN B;  3E30 A;  1SQM A;  3D9P A;  4U8Y D;  4BT9 A;  2J09 A;  4YVO A;  4GZC A;  3MA5 A;  4ANX A;  2DCP A;  2WXR A;  4FU3 A;  5AJD A;  3FTX A;  5J08 A;  1E8Z A;  2DWZ A;  3GZ2 A;  4TXP A;  1TN6 A;  3ZU7 B;  3VLE A;  3PUK A;  4L23 A;  3MX3 A;  4J8F A;  4R7L A;  2P9P G;  3AS8 A;  3FY4 A;  3ASD A;  5HI7 A;  4B8A A;  2XGS A;  3UKR G;  1PC2 A;  3CIA A;  3FU6 A;  2VGX B;  1K1A A;  2VYI A;  5G05 C;  2WXI A;  4ATG A;  1EYH A;  4AY6 A;  2X6F A;  1H6K A;  4WNF A;  4A1S A;  5H7P A;  3AU5 A;  3D9K A;  3TXN A;  2PM6 A;  3W9F A;  3ZVV A;  5CER B;  1OCR E;  4KT6 B;  5HS0 A;  4AV7 A;  3UUX A;  1HG2 A;  1V55 E; 
#chains in the Genus database with same CATH homology
 3ABL E;  2Y69 E;  3ASN E;  2DYR E;  2OCC E;  1V54 E;  3AG2 E;  5B1B E;  2EIM E;  3AG4 E;  2EIJ E;  5IY5 E;  5B1A E;  1OCZ E;  2DYS E;  3AG3 E;  3AG1 E;  3WG7 E;  2EIN E;  2ZXW E;  3X2Q E;  3ABK E;  5B3S E;  1OCC E;  3ASO E;  1OCR E;  2EIK E;  3ABM E;  1OCO E;  1V55 E;  2EIL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...