2EIUA

Crystal structure of a putative protein (aq1627) from aquifex aeolicus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
115
Chain Sequence
AIFTHEGKVEGVPGNYPLTAENLFRIGLALCTLWILEPTLSIPETNFVTLALSVGFMNAGGSVNVGGGDIKLFLQKGEIYVLEFQPLSETDIKKLESILFPIPKKTGEDIGSFKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Putative protein (AQ1627) from Aquifex aeolicus
rcsb
molecule keywords Hypothetical protein aq_1627
molecule tags Structural genomics, unknown function
source organism Aquifex aeolicus
total genus 35
structure length 115
sequence length 124
chains with identical sequence C, D, E, F, G
ec nomenclature
pdb deposition date 2007-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 2eiuA00
1LXTA 3UW2A 5F9CA 3C04A 2Z0FA 3I3WA 1KFQA 2F7LA 4QG5A 3RSMA 1C47A 2EIUA 2H5AX 2FKFA 3PMGA 1JDYA 3OLPA 1KFIA 1VKLA 1TUOA 2FKMX 1C4GA 5EPCA 1WQAA 2FUVA 2H4LX 4HJHA 1P5GX 3BKQX 1K2YX 3NA5A 2EHPA 4IL8A 4MRQA 5BMPA 5KL0A 5BMNA 5HSHA 1P5DX 1PCJX 1PCMX 5JN5A 1K35A 3PDKA
chains in the Genus database with same CATH superfamily
1LXTA 3UW2A 5F9CA 3C04A 2Z0FA 3I3WA 1KFQA 2F7LA 4QG5A 3RSMA 1C47A 2EIUA 2H5AX 2FKFA 3PMGA 1JDYA 3OLPA 1KFIA 1VKLA 1TUOA 2FKMX 1C4GA 5EPCA 1WQAA 2FUVA 2H4LX 4HJHA 1P5GX 3BKQX 1K2YX 3NA5A 2EHPA 4IL8A 4MRQA 5BMPA 5KL0A 5BMNA 5HSHA 1P5DX 1PCJX 1PCMX 5JN5A 1K35A 3PDKA
chains in the Genus database with same CATH topology
1LXTA 3UW2A 5F9CA 3C04A 2Z0FA 3I3WA 1KFQA 2F7LA 4QG5A 3RSMA 1C47A 2EIUA 2H5AX 2FKFA 3PMGA 1JDYA 3OLPA 1KFIA 1VKLA 1TUOA 2FKMX 1C4GA 5EPCA 1WQAA 2FUVA 2H4LX 4HJHA 1P5GX 3BKQX 1K2YX 3NA5A 2EHPA 4IL8A 4MRQA 5BMPA 5KL0A 5BMNA 5HSHA 1P5DX 1PCJX 1PCMX 5JN5A 1K35A 3PDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LXT A;  3UW2 A;  5F9C A;  3C04 A;  2Z0F A;  3I3W A;  1KFQ A;  2F7L A;  4QG5 A;  3RSM A;  1C47 A;  2EIU A;  2H5A X;  2FKF A;  3PMG A;  1JDY A;  3OLP A;  1KFI A;  1VKL A;  1TUO A;  2FKM X;  1C4G A;  5EPC A;  1WQA A;  2FUV A;  2H4L X;  4HJH A;  1P5G X;  3BKQ X;  1K2Y X;  3NA5 A;  2EHP A;  4IL8 A;  4MRQ A;  5BMP A;  5KL0 A;  5BMN A;  5HSH A;  1P5D X;  1PCJ X;  1PCM X;  5JN5 A;  1K35 A;  3PDK A; 
#chains in the Genus database with same CATH topology
 1LXT A;  3UW2 A;  5F9C A;  3C04 A;  2Z0F A;  3I3W A;  1KFQ A;  2F7L A;  4QG5 A;  3RSM A;  1C47 A;  2EIU A;  2H5A X;  2FKF A;  3PMG A;  1JDY A;  3OLP A;  1KFI A;  1VKL A;  1TUO A;  2FKM X;  1C4G A;  5EPC A;  1WQA A;  2FUV A;  2H4L X;  4HJH A;  1P5G X;  3BKQ X;  1K2Y X;  3NA5 A;  2EHP A;  4IL8 A;  4MRQ A;  5BMP A;  5KL0 A;  5BMN A;  5HSH A;  1P5D X;  1PCJ X;  1PCM X;  5JN5 A;  1K35 A;  3PDK A; 
#chains in the Genus database with same CATH homology
 1LXT A;  3UW2 A;  5F9C A;  3C04 A;  2Z0F A;  3I3W A;  1KFQ A;  2F7L A;  4QG5 A;  3RSM A;  1C47 A;  2EIU A;  2H5A X;  2FKF A;  3PMG A;  1JDY A;  3OLP A;  1KFI A;  1VKL A;  1TUO A;  2FKM X;  1C4G A;  5EPC A;  1WQA A;  2FUV A;  2H4L X;  4HJH A;  1P5G X;  3BKQ X;  1K2Y X;  3NA5 A;  2EHP A;  4IL8 A;  4MRQ A;  5BMP A;  5KL0 A;  5BMN A;  5HSH A;  1P5D X;  1PCJ X;  1PCM X;  5JN5 A;  1K35 A;  3PDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...