2EIUA

Crystal structure of a putative protein (aq1627) from aquifex aeolicus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
115
Chain Sequence
AIFTHEGKVEGVPGNYPLTAENLFRIGLALCTLWILEPTLSIPETNFVTLALSVGFMNAGGSVNVGGGDIKLFLQKGEIYVLEFQPLSETDIKKLESILFPIPKKTGEDIGSFKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein aq_1627
publication title Crystal Structure of a Putative protein (AQ1627) from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 35
structure length 115
sequence length 124
chains with identical sequence C, D, E, F, G
ec nomenclature
pdb deposition date 2007-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.120.10 Alpha Beta 3-Layer(aba) Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3 Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 2eiuA00
1C47A 3BKQX 3UW2A 1C4GA 1WQAA 2H4LX 3NA5A 1K35A 2FKFA 1JDYA 1KFIA 1KFQA 1K2YX 1VKLA 2EHPA 3I3WA 3PMGA 1PCMX 3RSMA 5HSHA 5JN5A 5EPCA 1P5DX 2FKMX 2H5AX 4IL8A 2FUVA 3PDKA 2F7LA 5BMPA 1TUOA 4QG5A 3OLPA 4MRQA 1PCJX 1P5GX 5F9CA 1LXTA 4HJHA 5KL0A 2Z0FA 5BMNA 3C04A 2EIUA
chains in the Genus database with same CATH superfamily
1C47A 3BKQX 3UW2A 1C4GA 1WQAA 2H4LX 3NA5A 1K35A 2FKFA 1JDYA 1KFIA 1KFQA 1K2YX 1VKLA 2EHPA 3I3WA 3PMGA 1PCMX 3RSMA 5HSHA 5JN5A 5EPCA 1P5DX 2FKMX 2H5AX 4IL8A 2FUVA 3PDKA 2F7LA 5BMPA 1TUOA 4QG5A 3OLPA 4MRQA 1PCJX 1P5GX 5F9CA 1LXTA 4HJHA 5KL0A 2Z0FA 5BMNA 3C04A 2EIUA
chains in the Genus database with same CATH topology
1C47A 3BKQX 3UW2A 1C4GA 1WQAA 2H4LX 3NA5A 1K35A 2FKFA 1JDYA 1KFIA 1KFQA 1K2YX 1VKLA 2EHPA 3I3WA 3PMGA 1PCMX 3RSMA 5HSHA 5JN5A 5EPCA 1P5DX 2FKMX 2H5AX 4IL8A 2FUVA 3PDKA 2F7LA 5BMPA 1TUOA 4QG5A 3OLPA 4MRQA 1PCJX 1P5GX 5F9CA 1LXTA 4HJHA 5KL0A 2Z0FA 5BMNA 3C04A 2EIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C47 A;  3BKQ X;  3UW2 A;  1C4G A;  1WQA A;  2H4L X;  3NA5 A;  1K35 A;  2FKF A;  1JDY A;  1KFI A;  1KFQ A;  1K2Y X;  1VKL A;  2EHP A;  3I3W A;  3PMG A;  1PCM X;  3RSM A;  5HSH A;  5JN5 A;  5EPC A;  1P5D X;  2FKM X;  2H5A X;  4IL8 A;  2FUV A;  3PDK A;  2F7L A;  5BMP A;  1TUO A;  4QG5 A;  3OLP A;  4MRQ A;  1PCJ X;  1P5G X;  5F9C A;  1LXT A;  4HJH A;  5KL0 A;  2Z0F A;  5BMN A;  3C04 A;  2EIU A; 
#chains in the Genus database with same CATH topology
 1C47 A;  3BKQ X;  3UW2 A;  1C4G A;  1WQA A;  2H4L X;  3NA5 A;  1K35 A;  2FKF A;  1JDY A;  1KFI A;  1KFQ A;  1K2Y X;  1VKL A;  2EHP A;  3I3W A;  3PMG A;  1PCM X;  3RSM A;  5HSH A;  5JN5 A;  5EPC A;  1P5D X;  2FKM X;  2H5A X;  4IL8 A;  2FUV A;  3PDK A;  2F7L A;  5BMP A;  1TUO A;  4QG5 A;  3OLP A;  4MRQ A;  1PCJ X;  1P5G X;  5F9C A;  1LXT A;  4HJH A;  5KL0 A;  2Z0F A;  5BMN A;  3C04 A;  2EIU A; 
#chains in the Genus database with same CATH homology
 1C47 A;  3BKQ X;  3UW2 A;  1C4G A;  1WQA A;  2H4L X;  3NA5 A;  1K35 A;  2FKF A;  1JDY A;  1KFI A;  1KFQ A;  1K2Y X;  1VKL A;  2EHP A;  3I3W A;  3PMG A;  1PCM X;  3RSM A;  5HSH A;  5JN5 A;  5EPC A;  1P5D X;  2FKM X;  2H5A X;  4IL8 A;  2FUV A;  3PDK A;  2F7L A;  5BMP A;  1TUO A;  4QG5 A;  3OLP A;  4MRQ A;  1PCJ X;  1P5G X;  5F9C A;  1LXT A;  4HJH A;  5KL0 A;  2Z0F A;  5BMN A;  3C04 A;  2EIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...