2EIXA

The structure of physarum polycephalum cytochrome b5 reductase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
KREPALNPNEYKKFMLREKQIINHNTRLFRFNLHHPEDVVGLPIGQHMSVKATVDGKEIYRPYTPVSSDDEKGYFDLIIKVYEKGQMSQYIDHLNPGDFLQVRGPKGQFDYKPNMVKEMGMIAGGTGITPMLQVARAIIKNPKEKTIINLIFANVNEDDILLRTELDDMAKKYSNFKVYYVLNNPPAGWTGGVGFVSADMIKQHFSPPSSDIKVMMCGPPMMNKAMQGHLETLGYTPEQWFIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-cytochrome b5 reductase
publication title Structure of Physarum polycephalum cytochrome b5 reductase at 1.56 A resolution.
pubmed doi rcsb
source organism Physarum polycephalum
molecule tags Oxidoreductase
total genus 67
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2007-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2eixA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2eixA02
1UMKA 1Q86D 3VNVA 3WBKA 1F20A 1QH0A 4YHBA 1JNYA 4TMVA 4TMTA 3E20A 3CXCB 1QX4A 3P26A 2NPFA 4B3XA 4G5GA 4QFMA 3CMEB 4Y9UA 1S72B 3I55B 2FX3A 4YAWA 1FDRA 4RD4A 1YI2B 1YIJB 3VMFA 3CCSB 1TUIA 2R6HA 1VQOB 1BQEA 1KC8D 3ZZ0A 4B4DA 1QUFA 4YALA 5JBQA 3AGQA 2B7CA 1YHQB 3FJOA 2OTJB 3W2IA 4P3YA 1D2EA 1K8AD 4HE6A 1JJ2B 2E1RA 4RD6A 1Q82D 2BGJA 1AMOA 3CC4B 3VNUA 1JA1A 1I7PA 3CMAB 1ZM2A 3OW2B 3QFSA 4M0LA 1F60A 5HXBA 1N8RD 1FNDA 1KK2A 1SM4A 1KRHA 4RD1A 4TMWA 2DERA 1Q81D 1QGYA 2HCJB 3E1YE 3U2QA 1FRNA 2X3UA 2YWEA 1DARA 2QN6A 2XNCA 4G1BA 1VQLB 1EFCA 2GPJA 1ZM4A 1KTVA 1ZM3A 3G6EB 3OZVA 2D74A 2CNDA 4K1XA 1N0VC 2BN4A 1VQ7B 1KK1A 1H42A 1GR1A 4NBSA 1IJEA 1VQPB 2EFGA 3CCUB 4RD0A 3CB4A 4LBZA 3LO8A 2VNIA 3U6KA 1B23P 1KJZA 3V76A 2DETA 3CCRB 3CD6B 1YJNB 1R5OA 4IW3B 4WQMA 2PMDA 1B2RA 1A8PA 3JQPA 3B82A 1QGAA 1E63A 2DEUA 2HMAA 2YWHA 4B44A 5EMNA 1VQKB 1EFUA 1QVFB 3ZBUA 2RC6A 1VQNB 3WBJA 1QFZA 4PC2A 3U6BA 1EP3B 4TMXA 2DCUA 1N0UA 2BM1A 3AVYA 1ZM9A 4ACBA 3MMPA 1VQ5B 4HE5A 4H9GA 3CCMB 3QFTA 3QE2A 4DQKA 1VQ9B 2BV3A 3JQQA 1G7CA 1BJKA 4ZCLA 2GQFA 3AVVA 1QFYA 5AN9A 3W5UA 4N3NA 1E64A 3SJZA 1KK0A 2B7BA 3LVBA 4BPRA 2AHOA 4TN1A 4AF6A 3G71B 1VQ8B 1JA0A 2BPOA 3JQRA 1FNMA 3VO1A 1CQXA 4FK8A 2BSAA 3CCEB 3CPWB 4RCZA 2YWFA 4RD3A 4PGOA 4J0QA 4ZGQB 1R5BA 2VZLA 2XEXA 1GAQA 4RD2A 5TV2A 3PENA 3AVWA 2OK8A 5FA6A 3W2FA 5TR9A 4PC6A 3G4SB 4DQLA 1W2BB 2C77A 4C43A 2BM0A 2ZITA 2HDNB 1E62A 1D1NA 3AGPA 2VNHA 1J9ZA 1EP2B 3WXMA 1GO2A 1QGZA 3WNDA 1QUEA 2EIXA 4YAUA 3ZZTA 1QFJA 5H59A 3CCLB 1W34A 3CRZA 3QFRA 1U2RA 3I1FA 3OJWA 3WY9A 4NCNA 1OB2A 4ZCIA 4B47A 4TMZA 1H85A 2QMUA 1IJFA 3ES9A 4P6VF 4M2LA 1K9MD 1G7RA 2VNJA 1FNBA 3W5HA 3W2EA 2YWGA 5TY0A 4B48A 4AF7A 1YJ9B 3P27A 3B8HA 4M53A 1VQMB 1W35A 4M4SA 4Q7JB 1DDGA 1IB0A 3CCVB 1VQ4B 1W87A 1M1KD 1ZUNB 2DY1A 3W2HA 2OTLB 3W2GA 1KQSB 1OGIA 4R71A 2QDXA 4Y7CA 4ZV4A 2PIAA 1S0UA 4AC9A 3I56B 3CC7B 1JB9A 3ZC3A 3J81k 1CNEA 3A1FA 3OZUA 1CNFA 3ZBTA 4Y9RA 1AIPA 2CRVA 4F7DA 3FPKA 2J7KA 4PC7A 3W5VA 4ZCMA 3WNBA 3AVTA 3CW2A 1G7SA 1R5NA 1EXMA 2RC5A 2OK7A 1TVCA 4MYUA 1BX1A 1EFTA 4QHYA 4YAFA 1OGJA 3QSYA 3ZZUA 1SKQA 2QEXB 4G1VA 1ELOA 3B78A 3OJXA 1KK3A 4FWTA 1OB5A 1YJWB 1K73D 5KSWB 1G7TA 3OZWA 5H5JA 1TTTA 2C78A 4UAJA 3WYAA 4U9UA 2BGIA 3CCQB 4EH1A 1WDTA 1XE1A 4PC3A 4RCYA 4LBWA 1YITB 1NJID 3LYUA 5GV7A 4ACAA 2B5OA 2QA4B 4LC0A 2VYQA 2BVNA 2XNJA 3WNCA 5GV8A 1FRQA 1GJRA 1DG1G 1D8TA 1FNCA 5DSZA 3VO2A 4M1KA 4FN5A 4C0SA 5THXA 1Q7YD 2VNKA 3CCJB 3QFCA 1NDHA 1DDIA 1QG0A 1GVHA 3MHPA 3MCAA 1VQ6B 1QVGB 2BMWA 1HA3A 2QTLA 3AVUA 4N3GA 4LBVA 1GAWA 1EP1B 2BF4A 2PLFA 4PC1A 2QTZA 4YAOA 4B43A 1BX0A 3CC2B 1EWYA 1XB2A 4LBYA 1M90D 1TLLA 1KD1D 4MYTA 3AVXA 3LRXA 4RJLA 4ZGNB
chains in the Genus database with same CATH superfamily
1UMKA 1SG6A 2WF9A 2Q49A 4Z0TA 3LV8A 2YHAA 5L46A 4R98A 1F20A 4MKXA 1UINA 1ZIPA 3P2MA 1B6RA 1FQKA 2J6IA 1AM4D 3QPDA 4KQXA 2OKGA 3KHUA 4C04A 5IABA 5AICA 5DLQC 5LOVF 1MG0A 5K6RA 2AEFA 1M6EX 3P26A 2JCBA 3T99A 4C14A 2OSVA 4RDXA 1USGA 1X80A 4M1ZA 1V1MA 3CE6A 4M6WB 1TRHA 1C3XA 1U7XA 1QIEA 5CB4F 1RWXA 4RZ2A 4E2YA 3L8YA 1S2LA 5A0TA 2W2LA 2WU3A 3U7FB 3MRSA 4BV8A 3PA1A 3HI6A 2PD4A 5CFOA 3U4QA 2G9RA 1PEAA 2IXGA 2NVBA 2Z1MA 5GWXA 1A69A 3ENNA 4TZKA 3S81A 1M33A 2FZ5A 3QIAA 5JNSA 1RKQA 1VPWA 1QHXA 2I7TA 2P4HX 1DTSA 1VBMA 3PF9A 1NAIA 4RYDA 2R6HA 4L02A 1NN1A 2VDVE 2Z1DA 1NWCA 1MX5A 2FZEA 2VP4A 1KC1A 2VBGA 3JYPA 5EC8A 4J0CA 4BYGA 4KR9A 1NA5A 1PS8A 3O0DA 1GFZA 4U3JA 1I80A 2DOKA 5FL7D 1M8KA 3TX2A 4ED9A 3WFJA 3BXGA 1R3UA 1XLTA 3TLCA 3B1KA 4BKRA 3G5UA 2PGDA 1YS4A 3FNIA 2YV4A 4RFSA 3HUEA 3S2SA 1FTNA 2V0NA 1EI9A 5JBQA 4PABA 4O2BF 2FN3A 3I0ZA 3WDMA 3LIPA 1E5VA 1ZK4A 2X8WA 4Q7LA 4IDBA 4C4RA 1U2GC 2H7CA 3A9UA 5LFAA 3TMAA 2R7AA 4GMXA 2PS1A 3OU7A 4OFZA 3TTVA 3CTPA 3AVQA 1G5TA 1OJLA 3B5IA 1XELA 2RIPA 4KODA 4ZAGA 3T9CA 3VPFA 1FYDA 3KWFA 1WLYA 2NVWA 4IHAA 4B0PA 1GGKA 1T8WA 1WXXA 4FSXA 2QWXA 3VXKA 5BQXA 4DCVA 1LSOA 3OIUA 3T34A 3WC4A 5J3JA 2IEBA 5IYZB 4RV5A 5C5DA 1VKRA 2CZCA 1NQWA 3PV0A 1PIWA 3U26A 3PG5A 1R88A 4BQRA 1B15A 4RK4A 1F0YA 2UZ4A 4RADA 1Q1ZA 1FDOA 2WT8A 4KAJA 5K0LA 4ZHQA 2GEDA 4N7BA 1JQDA 3CC8A 2IXEA 1VA4A 3BGIA 4P35A 1OBFO 3OIVA 2ERCA 2JIZA 4B3FX 4A82A 4EVRA 5AWFC 3KYJB 5CJ2A 3S3TA 1JB1A 2VT3A 1HLDA 4DR3B 3AYXB 3THXB 3V2UA 1CZLA 3L1UA 3CEHA 3VKFA 1SWVA 4DVGA 4ID3A 2P41A 3WK5A 5HEKA 3U7QA 3GMSA 1Y48E 3SR0A 4KNVA 5CR9A 4ZZIA 1XL0A 2LP4Y 2V97A 2YJ6A 1FRNA 4F56A 2JGKA 4QYWA 2GJAA 4RF5A 4YJDA 1ZLXA 5K0CA 4JC5A 1D4AA 2EQBA 3H8JA 2PUTA 3LQYA 3Q0EA 5HM8A 4YP0A 4L8VA 2ZB8A 4PR3A 1ULUA 1ZRNA 3NM5A 1MZVA 3PXGA 4TTQA 4JI4B 3KAQA 3JVUA 4F71A 1W96A 4AS1A 1GRVA 1M0TA 5DOVA 1THGA 2WZDA 3UATA 3NCTA 4LCJA 5BWNA 4TPKA 4UOZA 2D74A 4MXDA 1ZX1A 2ON6A 3DBHB 4EI8A 3VVMA 5DYYA 4X20B 3LECA 4WY2A 3ODPA 5GP1A 2Z2JA 1YOVA 4YCCA 1KK1A 3ET4A 1G6KA 2PA3A 3K5HA 2J9FA 3P9QA 1MQAA 3OQ6A 2WAYA 4AO8A 1N6OA 4HP8A 3OLQA 1SQGA 3HB4X 5DHAA 2W6OA 4W7HA 4C03A 5HF5A 2Y1GA 4UMFA 2HM7A 3I37X 4HH0A 5HBGA 1E2HA 2XDQA 1LDGA 4MPTA 4YPVA 5HIIA 4RTMA 4AU1A 4BV9A 1R15A 1SK9A 3G0DA 4BHTA 3NKFA 2WWIA 3AONB 3L49A 1DU4A 3W77A 2OQ2A 3L7JA 3CD6B 3PLNA 5K3AA 4YPFA 3SQMA 4CM6A 3BFXA 3ZHXA 3CF6R 3NBXX 2VJKA 2NAFA 2VHVA 1WMEA 4NYJQ 5IVDA 5C1IA 2Q4OA 5KC9A 2A0UA 1UXOA 2XADA 1CB7A 4PLTA 5EMNA 1ZY2A 1X74A 4EPRA 1T8SA 3UCFA 4AJPA 1QVFB 1E2FA 4DQDA 2XMCA 2GK6A 3I73A 2ADFA 3UN1A 5A1JA 3USCS 5TPWA 3UTCA 2IV3A 2Q6OA 4Z4EA 1RYFA 4FSDA 1ZNXA 2NVOA 1G0NA 3G2LA 3TFOA 1UBNA 3A1EA 1PFWA 4QGBA 2OYNA 3AO0B 2O7QA 3HVIA 1UDBA 4PC2A 2NO7A 1IYZA 3LVRE 1GZDA 5CNJA 4AUMA 2PT5A 1BH2A 2CNLA 4V39A 3PHGA 4G81A 5LA6A 5LP6F 2Q6VA 2YY7A 1NXPA 2A84A 2ZE6A 4HQ0A 4J8PA 2O2ZA 1ACLA 3MWLA 4HADA 3SC2B 4QVJA 3FDZA 1L7VC 4EO9A 3W5DA 4OQEA 4RK0A 2NQ8A 2VYCA 4P7KA 3VUFA 3PJEA 1TZCA 3CSUA 3GW8A 5D1HA 4EGFA 4Q9DA 1NW6A 2D4HA 4JUIA 5I51A 1VLYA 4MQLA 7AT1A 1Z4MA 4QAJA 5LIRA 4CW7A 3JR7A 5BPHA 3F2VA 4V2UA 2HXSA 3AVVA 3VZSA 3CESA 4Q4LA 5A06A 10MHA 4C6TA 5F5LA 4JI3B 4A9AA 2IUYA 5F2OA 1FFXB 3HNOA 3GD7A 4K9RA 3T0FA 1CR0A 2O0JA 2TMGA 3PQ5A 4FFSA 4C05A 1LH0A 1RAAA 1K06A 1WZEA 2ZAYA 1N6RA 4KPFC 1SA0A 5B58T 1AY0A 3VYUB 3MCTA 2XZTA 3D0KA 2BFWA 5KVAA 1QGOA 3I09A 2CHUA 2C94A 4K5QA 4N65A 1HTBA 4EUKA 2KX7A 1F48A 2PDAA 3ESCA 1RT9A 1QH1B 4DOMA 8MHTA 3ILYA 1KYIA 3QWFA 2UXCB 3EXEB 1SUEA 4CKZA 4MUAA 1ZOIA 4Z8YA 3FTCA 5EUMA 3KDSE 4X7CA 2C2WA 3RIEA 2VQ6A 2HO4A 4NAVA 2QVZX 3N8KA 2R4TA 1I51A 1T5BA 3D3KA 3HU2A 2O05A 2W0MA 4ND7A 4QE3A 1T9GR 5K8IA 1AXRA 3CUKA 3FHLA 2Y2UA 5TV2A 3N8HA 1P1FA 3UMFA 1ZR4A 3OQJA 1I2ZA 4W5OA 3EIEA 4MQFB 3A0UA 1NW5A 4I9UA 1KP3A 3ICVA 3IJ5A 4O4IA 1RXWA 3ZWQA 2VDKB 3WTCA 4PLVA 3MAGA 3EWAA 5AVKA 5DXFA 1XXLA 2F1MA 3TW4A 5KNBA 3FSEA 3K16A 3KWJA 3THYB 1RWNA 4J1NA 3MJFA 4ME6A 4L3OA 3TFWA 4B6JA 2NO5A 3DO6A 1ODIA 3GLFB 3QXSA 4ZCTA 2V7WA 1B0ZA 2XMPA 3JZFA 4NESA 1VE3A 1NTRA 1HFJA 1HXHA 1FP7A 2WKWA 2C4WA 4O08A 5A62A 1P8JA 3CCLB 4PY2A 4X3PA 4PAOA 1LV7A 3GVJA 3IP7A 5COBA 1A97A 1EMDA 3M6VA 4RHUA 1WKBA 4C7VA 1TEHA 2E18A 3H18A 1PJ3A 3KU4A 3EQ7A 3W4JA 5JAZA 5KKCA 2D2FA 2HIHA 1X87A 1FMTA 4HVTA 5ALKA 2X4GA 3DVAB 2WWGA 5IYWA 2BMDA 1K0UA 2X9GA 1I8TA 1ZG3A 1XJCA 2Y68A 3IIIA 2RKWA 4WCDA 4XUCA 5BRJA 3RRXA 2QMUA 3BGDA 3ZCRA 3GCWA 2HB6A 2X4IA 2ZIWB 5DPMA 3RFXA 2RAPA 3WLRA 5BNIA 1JDPA 4PAQA 2QL6A 1G7RA 3V7UA 4QXRA 4BO3A 1U2GA 2OHGA 3AU8A 3IIEA 1Z8DA 2LPMA 2GZSA 4UVGA 1LNZA 1T9ZA 3VTAA 1OLSB 3KYDB 3ANMA 4WXHA 1IL0A 3R9KA 5KSOA 1SKBA 2Z0MA 3ORSA 2OENG 5CT8A 1MAUA 2R6ZA 2VWHA 1OBHA 1K7XB 4MWTA 5EIAA 3L79A 1SMKA 5FWXA 2JH8A 1XVVA 3P32A 5AVTA 4GKJB 2WJHA 2ENUA 2P6UA 3O1HB 5EPOA 1TJ5A 2POQX 3NEAA 1EU1A 4N49A 3FJ1A 5KU7A 1WQ4A 4MICA 3U1TA 5IDVA 4EFNA 3UB3A 2YYSA 2P65A 2RHTA 2P3SA 1QNFA 4EF5A 5I3ZA 2UZ1A 2QR2A 2BFOA 3O3CA 2NZ8A 2I8LA 3SJBA 5DHFA 2RHMA 2WW8A 1HOTA 3GCDA 1LSJA 3KAKA 3MJEA 3N0VA 4JLPA 4Y7CA 1GTMA 4PO8A 3LUKA 5DGIA 1NBIA 1J8FA 2D2IA 1Y42X 2J3EA 5LQUA 3CVYA 4QOJA 5EOVA 4ZAYA 5KTNA 1FBTA 4WK4B 5GOTA 5KYGA 1EFVB 3KOOA 2EVWX 1T4CA 4QUIA 3EXIB 4R1NA 4UEOA 5LBUA 2VDWB 4BX0A 4D9IA 2KI5A 4P26A 1EP9A 3KJQA 2PEYA 4G8BA 3HJHA 3O4FA 4NBVA 3E5MA 5KHLB 2JD1A 3K5PA 1J2JA 4G0PA 4FS8A 3RROA 2O2JA 4LZJA 1I3OA 1U1FA 4B31A 3LQRA 1YDGA 4IXNA 1G5FA 4DKJA 2PJRA 5JS2A 3KQUA 4TVOA 2GN8A 3IMEA 1O6ZA 2EFCB 1Z2NX 2VJMA 1M34E 2O3JA 3I76A 3SF8A 3Q8LA 2GCGA 1P45A 3AM1A 3G17A 2Z6BD 2H7YA 2QSJA 2WKQA 2AB0A 2AFIA 2IY8A 2PBZA 2XUAA 1NBMA 5JEEA 4BB9A 4B3RB 1GZHB 1H8ED 1NF9A 2NAPA 3I6YA 5LZ8A 5T4FA 1H66A 1DC6A 4IIYA 5AM1A 2UXDB 3JALB 4HC4A 4O2AA 4G5QA 1JHUA 4OK5A 1XTZA 1G5RA 4AROA 1HKHA 3SQLA 1TQHA 1AA6A 4B6OA 1UF9A 3PNKA 4WZBE 2IU6A 3EPJA 1Z0ZA 5L3QA 4JCCA 4G89A 4Q4HA 4WKPA 4W1PA 4ALJA 1UWLA 1KK3A 1QPZA 2F1HA 3PQ8A 4FWTA 1ZMXA 3GGPA 3JYLA 2A3RA 2CSUA 3TTWA 2DHRA 2TS1A 5KZMB 1JYSA 3GJYA 4DB2A 4LNUB 3N0TA 1NKVA 2CDNA 2IHUA 1K9SA 1PBTA 3BDVA 5G40A 3TLMA 3ZLUA 1U2SA 2X15A 3C43A 2F48A 5EZYB 3ZWVA 3V7AA 1HORA 2FGKA 4TKVB 3DMYA 3KPYA 1IBCA 1ZM7A 4N7RA 4X63A 4UAJA 4BJ6A 4ZYUA 5JI3E 3G1TA 1U8XX 2RIRA 1VYUA 3BC1A 3G9XA 3HJRA 5CYPA 1TM3E 3I9NA 3L6EA 4JLBA 1EG2A 3AL0C 1H2RS 2EZTA 1N5OX 5FWAA 1RHJA 4EH1A 4RA6B 3T3EA 4IIJF 4X64B 5BN3B 3NBFA 2VS1A 4A0FA 4Q9LA 4P1VA 1L7XA 1LD3A 1LF5A 5CEFA 4BP3A 4GMGA 2JHPA 4POAA 3TQRA 1MPTA 4P3IA 1P7YA 1GNPA 4BLUA 1B3BA 1ZFNA 2E82A 4N47A 3TTUA 1OH8A 3DDUA 3UXMA 5HKKA 5I48A 3MPUA 3H2BA 2QYOA 4H08A 2DLDA 3KZXA 1G2IA 4E5SA 2GXAA 2VYQA 1GITA 4FDUA 2I71A 1MO6A 3FCEA 4L4SA 2WOJA 2FQQA 4EJMA 5TSDA 4EKIA 4FQ8A 1DZIA 2H2DA 5C18A 5JZOA 1VG1A 5HGXA 3FTQA 3OQ1A 2ZYSA 4ZOLF 2XQVA 4B4OA 4B3IA 3NUQA 1DV2A 2DFVA 2NYUA 4D8VA 4COKA 4XE5A 2BGNA 4EUHA 1FNCA 3ND6A 4BQNA 2RI0A 4DJ5X 4FUTA 2IODA 4F6RA 5LZ5A 2EJBA 5L6MB 1KAEA 2ZSHA 2BCEA 3FSGD 3PWKA 4JHXA 1NI5A 2FWBA 4FEEA 4XIYA 5DCYA 4A8PA 4HUTA 3FGPA 3D3WB 2CW5A 1KBOA 1RXCA 2HJVA 2OT3B 2V98A 1ORIA 3CZCA 1U5BB 3LBYA 4LJKA 1V95A 4P54A 5JBIA 3KB8A 3E9NA 3G8BA 3ZE9A 4JLMA 2D1QA 2PFSA 3O84A 1A7AA 2QTLA 3H04A 3WLJA 1B43A 1Q3TA 2JGDB 4AX8A 1V9CA 3KUDA 5AIAA 1T2DA 1UBGA 3T5PA 4R2LA 4GVLA 4ER0A 2UYCA 4DG5A 1G41A 5CLGA 2BF4A 2PLFA 1WZNA 3HJGA 4U7WA 2W11A 4X7EA 4HAVA 2QVLA 4I6EA 1GUZA 4RLFA 2OHXA 1QTNA 5IRCD 4YJ3A 1Z5PA 4XQGA 2IU3A 2JLXA 2W2QA 1MNAA 4LZWA 5GZ6A 1Y63A 2P1RA 4DR2B 1YZYA 1OMOA 2FXVA 3Q0IA 2H4HA 2IX3A 4LBYA 1ODFA 1X7WA 2RHGB 4K2HA 1ZJJA 4YO7A 4PAAA 3KTAB 2D9RA 1AN9A 5FJIA 5I7SA 3AIOA 4PNEA 5H02A 3EFOB 4NFYA 4IEIA 4US2R 3ORHA 2X58A 2F2TA 1B93A 2ZYAA 2A58A 3GGCA 4W1SA 4JJ4A 3L7AA 3DVRX 5THQA 1CKEA 4QBFA 4YFVA 3RD5A 4OQNA 1NI4A 1G17A 2NV6A 3F6BX 1BIFA 1U9IC 3R0XA 4CR7A 3D64A 4ZT7A 5JNLA 1KDOA 3WTBA 5LDHA 1I3KA 1H2HA 1NUUA 2Z3VA 1AZLA 1JXAA 2OHJA 4P7BA 1QX4A 1G2PA 3IPRA 2XUGA 4WLNA 1Z0DA 1O9HA 4K9OA 4NCBA 5JECA 3HKDA 2VJNA 3K31A 3OCVA 4RMNA 4WZKA 3CNEA 5K8UA 1MABB 4JXZA 5CCBA 4DG8A 1QHSA 5AKIA 2SECE 3KKPA 1E0JA 2VOJA 2WZNA 1C3JA 2YV3A 4ZQCB 1QVRA 2IYRA 4UVEA 4EOGA 2V96A 1N8TA 3R8CA 4CETA 3F73A 4TUYA 4D8XA 1FFHA 3SLDA 4MUYA 5F23A 3QVVA 4IDQA 3IPYA 3M6XA 2JH9A 4Y98A 2GPWA 2FVYA 3HGQA 3LBAA 3I55B 4Z9XA 5TQJA 4YAWA 1T9GS 3QENA 4BS9A 5J2UF 4GEGA 4OK3A 3DOUA 4P5PA 1KJ9A 3OH8A 1L5LA 3GEHA 1OU4A 3HCDA 1YKSA 1ZCBA 4L74A 1PS9A 5DBHX 4AD8A 3QEBZ 2VP6A 1H2YA 1V4BA 1YCGA 2GRJA 3L82B 4J0KA 4AJKA 3QKSB 1DC7A 2OZVA 2R11A 1Y6RA 3G8YA 4CEJA 1OW3B 4CI9A 4OQDA 5C32A 2GJ4A 3FFTA 2FLKA 2V6JA 3AG6A 1SG0A 3A9SA 3AW8A 13PKA 3TGWA 3F1KA 3OHPA 4IYJA 1ZVMA 3S27A 5I9BA 4DCPA 1P6QA 3VSCA 2J7PA 4E03A 2KB0A 2I6FA 5BW6B 2I2CA 3QNUA 4X1IA 1UBJS 2EW1A 5BSEA 3F2IA 3B3QA 3DXFA 1IATA 2HBYA 3IEXA 1I36A 1WCIA 2O14A 4HEQA 4NWIA 2B37A 4MRAA 3ZU3A 5C4MA 4F92B 1C1DB 1UP4A 4IJKA 3O8CA 2QX8A 4S2EA 4BV3A 4RK5A 4OHOA 2JAXA 4RV4A 2ZSDA 2JKVA 2PD6A 2KBEA 4XW2A 2KYRA 3TRFA 2QDKA 3JCZA 4C2UA 1Y7HA 5D3KA 2XDAA 1KQNA 3IQEA 4OM8A 3AJEA 2IUTA 4UBKA 3TDMA 1JU4A 3H97A 4EA6A 4WV3A 5K3FA 1Z35A 1P2UA 3IP8A 2ZTHA 1IJBA 2DERA 4QO7A 4DYHA 4RVFA 3C6KA 3KPJA 3ZN2A 1HYBA 2OBSA 3A4YA 4NTZA 2JVIA 4M0FA 4LOJA 1O5TA 3O9ZA 5LP6C 2VTEA 1IRXA 1T3HA 2C0PA 4CDRA 4RPIA 1AGPA 2MWMA 2O8NA 3GYBA 4EKEA 1HEIA 4X8LA 3TQQA 1N5DA 1Z28A 4OHRA 4OX9Y 4MRVA 1KJJA 4EEZA 3DEYX 2VJIA 3TZBA 1HQDA 4BO0A 1BG6A 2VH5R 3SJCA 4L5CA 1YA6A 2OVFA 2VDQB 4EJ0A 1SFRA 3IFSA 4ZVOA 5EKUA 2VJDA 4KRGA 4L78A 4CEHB 5JASA 4I55A 2BLNA 1QE0A 2XMDA 1C1YA 2DF8A 1YT5A 2PANA 4XOPA 3RSSA 4F6CA 2NXNA 2CNDA 2HTEA 3MBKA 3QE9Y 4R8KA 1NW8A 1U8ZA 1PV2A 5JJIA 2OBXA 4BMPB 4ID9A 1ORVA 2LKCA 3FKQA 3O4HA 4P2GA 4EMSA 1K66A 3TMKA 5DTJA 1TX4B 2ZRGA 3U44A 1GR1A 2IL1A 1KI2A 2B8EA 2RJOA 3IVAA 3KKMA 3QPCA 1FSSA 4REQA 1IJEA 1VQPB 2WP0A 2ZSIA 3EBLA 5DI3A 3HCBA 3L6OO 4YR9A 3CNHA 2YDYA 1A9TA 5COQA 4EG6A 1JDJA 1NL3A 2F3QA 3IKLA 1EBFA 4TLEA 1SIWA 2FXIA 3OE7D 4RL4A 3SE7A 3PGMA 1GPAA 2QT0A 1OV6A 2V5AA 3ONFA 2F59A 3I4FA 1TW2A 5L3SB 1USIA 4OXKA 1ODSA 3CCRB 2BGRA 3CONA 3K0FA 5KVSA 1R00A 1TMYA 4G1UC 3AB8A 4H7KA 3H5AA 3CJRA 3H5RA 4DIBA 1WU8A 4PZ0A 3DLPX 3SKXA 4ECAA 5AVVA 2H1OA 4KMSA 2ROQA 4DBZA 4ZVPA 2ZR0A 4U7GA 1F4PA 1KE1A 4OJYA 3OPXA 4W1RA 1EFUA 1Y5NA 1DZ3A 1JWBB 1KFKB 3MGGA 1FFWA 4Y9DA 3D7NA 3HJUA 4R05A 3E9QA 2ZSFA 2VNSA 3TUJC 3JARB 1W75A 3F3MA 3QQ5A 3UY4A 2XKBA 5LOVA 3HU1A 1NW7A 4MVJD 3UWOA 3ZVKA 4MZDA 4YRNA 2A5YB 4NBKA 3WLQA 4FGLA 4JYMA 2JGRA 4PYOA 3ZDFA 2H57A 2YV2A 4D25A 4HQRA 1XRRA 4ZYYA 1F2DA 2POCA 2ZSUA 4LTDA 4AZTA 2VYVA 2EX1A 4DHEA 2EKBA 4NPAA 1QFXA 3UVEA 4I66A 4P4SB 1HYEA 1NKSA 2ESRA 2MSCB 2ZWIA 3PUYA 1H2XA 4LRTB 3K5IA 1SHJA 3B9QA 3GJ7A 4Q4DA 4YCDA 5THKA 3VU9A 2ZW9A 4M9SA 4ARUA 2J87A 4NBWA 3VYTB 2YY6A 3BE8A 2Y6UA 4MWZA 4CLOB 3WMGA 2ZJ3A 3CEPB 2P4UA 1VMIA 3TS1A 1QZXA 3GLHE 3PPYA 2B94A 3DT9A 5L3VA 2QUKA 2YJZA 3FMOB 4P86A 3UMMA 4KVZA 4DRXB 1G7CA 5IDQA 3DZBA 4XXHA 1N0IA 4CMAA 2E3JA 5EPUA 1VLLA 5M34A 4HTFA 4I5IA 4E3WA 5HCUA 1NFRA 2MDTA 3UUFA 5AUOB 1LDYA 4E12A 1KOGA 3D54D 3NNSA 2AOTA 3ICCA 1JAIA 4Z0PA 2IZ6A 3E5RA 3ZY4A 4HNAA 2WD7A 4O2BA 2BI7A 4XGIA 1YB7A 2VXCA 4JIGA 4GYYA 3FTNA 3IOEA 2ZJ6A 4XPIB 5C7IO 2B6NA 4DNPA 3HY3A 3AZOA 4Q4JB 5FTMA 4FK8A 1I4LD 2BSAA 3IYLW 4V0RA 5JXWA 5LMCA 2DU8A 4EG8A 3I2GA 2QMEA 1W5AA 1I4WA 1ISMA 3WGVA 1RWBA 3CB2A 3L43A 4DR1B 3K92A 3SYTA 2Y66A 4JOBA 3F8TA 3GN1A 4U63A 3CZQA 4O2RA 4FIZA 1O94C 1V8BA 1W2WB 2VBCA 3HXKA 2WYIA 3MW8A 3NHKA 1QO0A 3PFWO 4IMJB 1IUKA 1V5GA 2M1XA 4KB5A 4Q7EA 3VR2A 5FO1A 3DHEA 1QJ4A 1NU6A 1T36B 1U2ZA 4RD2A 4U7JA 4YMTA 4NG5A 2KMLA 2B0CA 5FXMA 4JYAB 2RONA 3E3LA 4X6YA 4IKPA 4RZSA 4PLHA 4P08A 2SBTA 1U9IA 1G21A 1JDTA 2GAOA 4LGVA 3O8LA 2CKDA 3D3NA 3OZDA 4YBZA 521PA 3R3YA 5KYUA 2BZ0A 3A37A 5EKTA 5TQ0A 2DUJA 1JBEA 4M0MA 3SM3A 3NR2A 4ITRC 4E31A 4Q1EA 2Z8XA 3ABQB 1H5QA 3U7EB 4BASA 1TT5A 5JPDA 3MLBA 3OSUA 4KVAA 4QXMA 1HVXA 5AHWA 5IG2A 1U7DA 1ZZEA 1A4RA 2JI8A 2JLAA 3DBLA 4KQFA 1DMSA 4PIVA 6ADHA 1EXVA 5T4BA 4ZIRB 1KBQA 2IIPA 2VRBA 3GAFA 3TOXA 1CF4A 1GR0A 1U99A 2A5LA 4O4JA 2FEKA 4U0KA 1T9KA 2BFAA 2BJWA 4JJKA 1K97A 4Z0HO 5LWHA 2KVOA 4EPWA 4ARIA 2JHFA 1DHRA 4DV5B 1QUEA 4WZEA 4LHSA 1QG4A 2DY0A 3NGXA 4BB5A 4CT0A 4D6XA 5AVSA 3S8EA 1DRJA 1NHWA 3O92A 5IN5A 3SXJA 4G4GA 5ABPA 1ZEJA 2I55A 3ISTA 4NCJA 3VAAA 2JFFA 5FNVA 3LK7A 4QDJA 3A3NA 2PTHA 4D0RA 5G53C 4V0KA 3R3SA 3QWAA 3I2HA 3V5NA 3HLYA 1M5TA 9ATCA 1FVFA 2QBYA 5JLJA 1M1ZA 2JAWA 2FZLA 5FULA 4C4ZA 1RI2A 4Z4CA 4XYBA 1PFYA 1Q91A 3HA3A 4RMJA 1EHYA 1E6MA 3WYCA 4TLLB 4PGFA 3C3DA 3F96A 3WYDA 2H8KA 2BP7A 3WRYC 1C30A 1BWQA 1PL7A 5JPCA 4YK7A 3V4FA 2XNKA 4W99A 2J3DA 4ZV9A 3I83A 5CT5A 2ODBA 3FOAA 5BQ5A 1J23A 4G0YA 4CG1A 4RANA 2YY5A 2C1XA 4U1RA 1POWA 2WR8A 2F1KA 3LY9A 4C0HA 4CM4B 4EW1A 5CU7A 1E2KA 3K7EA 2XRMA 4TYYA 3WJ7A 5TQ2B 1F0PA 3DF9A 3QF4B 5AK4A 2H16A 3HCNA 2OL4A 1ADFA 4NBTA 4UUMA 5KOHB 1OI3A 4G07A 1IN5A 1WSAA 4J16C 2QEQA 2BZGA 4WBNF 1J7JA 3GFRA 1C1XB 2AD5A 1KQSB 4R71A 4FMDB 1RWVA 2QVBA 2QUAA 3L6DA 4FMCF 5T7BA 3BMXA 3BCUA 2FMFA 4MO2A 3SHWA 5BYAA 4NZNA 1P2FA 1SXHA 4HPXB 5LP6A 4IBOA 3AM5A 1FTSA 1H0SA 1V71A 2ZSBA 2BFMA 3FMPB 3H84A 5T3YA 3ZV4A 1PU2A 1U8UA 2WIBA 2I3BA 3DO8A 3ICWA 4QT0A 5IJZA 1LXCA 1PZNA 4Y9RA 1D2GA 2J85A 3C7KA 1C41A 5CFMA 1QRTA 3NNDA 4OI2A 5AW3A 3EX7C 1YRLA 4LXHA 1S7CA 4MW4A 4CG0A 3SG0A 2WBLC 3CW2A 3FVVA 1SC1A 3GDGA 5CD1A 4R2JA 4LYGA 1HQCA 4NAHA 1SUFA 1UBSB 4DHWA 1YHYA 1FUEA 3AKYA 3I9KA 2YCLA 3WYFA 4DCSA 1E7QA 4GR4A 2ZIXB 2PT9A 5EJMA 4EQZA 4QICA 4AZWA 3IVRA 4HMPA 3QTLA 4ZQFA 3FLEA 3QM1A 1ECLA 2XWBF 3PJDA 4OHWA 2BUCA 3RV3A 4F9FA 4IIHA 4IIFA 2C0QA 3SYNA 1YXMA 1QHHA 5K8JB 1DEXA 1XL1A 3OM1A 3T15A 2C95A 3EULA 3TZHA 2C2GA 3OJXA 1YL5A 3C5WP 2IIQA 3W2TA 4JX9A 4HNRA 1BRMA 5F21A 1K5DA 2IZZA 2IWHA 1OSNA 2R97A 1DO8A 1NFFA 2PLWA 5FWNA 3I8XA 4DCCA 3IRVA 5LDDC 1WXHA 2E4YA 3SZLA 1IXRC 1BMFA 2EX0A 1JSZA 2JDID 1XTSA 2I91A 4MRRA 3SXPA 4L9SA 3R0JA 4X8HA 3T4EA 4F9TA 2D6FA 5J2TF 3WYAA 1EFPA 1PFKA 3EDYA 4FJ2A 4PO9A 4Y18A 1A2OA 2R44A 1VGVA 5FOVA 1IPEA 3PVSA 4NE7A 3HB0A 4DYVA 4DJEC 2FSVC 1IHOA 2AQIA 4ZKEA 1ONOA 2Q5FA 1NMQA 3GJZA 2IZ0A 1FCJA 3SQOA 5SYAA 3UWSA 3NRBA 3L3BA 5KEIA 2XXAA 5JDCC 3VR6A 2F9FA 3SEJA 5ES4B 3TSCA 1OE0A 1YITB 4BQFA 2OZLB 1JVNA 1WX1A 3ZWCA 1YNSA 1ZXXA 4KIWA 1GL3A 3ASVA 1DTWA 5IM4F 2FOLA 4L6AA 3RVBA 3E35A 1AQ6A 3E82A 4IZIA 3VI3B 2X76A 3EEIA 4ZOQI 2FSUA 3JPWA 3NDIA 1UKVY 2W5UA 4OHPA 7ADHA 2FMTA 3O7WA 2P9BA 2JHAA 3V4SA 4TZ6A 2DBYA 3VHXB 4N54A 2B69A 4KHZA 3GGOA 2IYWA 2VF8A 2EG9A 5DNEA 2PX2A 2VPZA 3CKKA 2HR1A 3ETCA 4DK1A 3L6BA 1EUZA 3C8HA 5KYVA 4UPEA 2VK4A 5IT4A 1I14A 3LD9A 3WQBA 2O6LA 2JGNA 2ZIFA 4FMBB 2ETVA 2XCTB 1J8DA 2WKSA 1UMDA 1XRJA 2XGSA 1Q95A 2ZXFA 1MEEA 1Q7YD 3E7PA 4XYEA 5B4UA 4AP9A 3CCJB 1ZK0A 4ETIA 1KVSA 4MKHA 3Q6IA 2NO9A 1N25A 4GXRA 4M1OA 4KIJA 4W9NC 5EMHA 1ZN2A 5G0TA 3S55A 2C83A 1GTJ1 3G7SA 4XWOA 1BU8A 1EUCA 3LUDA 3MCAA 1TCBA 4RIFA 1E79D 2B5VA 3ZHCA 1PKXA 4GOKA 4UCQA 3N7UA 2BMAA 4TS4A 3C45A 4D6PA 3CGWA 4O8CA 4IICA 1OLXB 4UHDA 5D3ZA 1GPDG 2R8EA 3B3AA 5H3LA 2V9CA 1A77A 6Q21A 1A1VA 2YXEA 7MHTA 3L0BA 4PC1A 1V7QA 2GHIA 3VVLA 1JHOA 1A9OA 1GWNA 4RTQA 1AMNA 5EPEA 1O94A 1UC5B 3BL6A 4B7CA 3ZY2A 4NXNB 4TSFD 1ZI9A 2JJ2D 4JBWA 3GQBB 1FMLA 3F74A 2GZHA 2I9KA 1BW9B 3GFOA 1PNTA 1K5GA 4GSKA 2G0TA 2HIGA 4ZO7A 3RYIA 4C0LA 5CVCA 3UGTA 4PHFA 2XVMA 3R3ZA 2L19A 3ONWA 1MJHA 3VKWA 4F96A 4BL5A 5KWIA 3EUFA 1E3XA 4PZDA 2IY9A 3W5CA 3AKDA 2E4UA 4EMTA 1LW7A 3SZUA 3ILXA 2CLKB 1C2TA 4OPVA 2D5AA 2ID9A 2R5WA 3RS9A 2Z5FA 4DUZB 6YASA 1JKJA 1SD2A 1Z0KA 4KBGA 1JNYA 1QYXA 2PMBA 3BOSA 3PQEA 5FUMA 1XEXB 4U6NA 1UCFA 1AZTA 3ELDA 1CP2A 3CCFA 3UWPA 3GT3A 1R0BA 5FI5A 3L8CA 1K7EB 2NXJA 4MQEB 1B00A 5DYTA 1QB7A 1DQRA 4QFMA 2WAXA 3GXOA 5DNDA 3ESZA 4BVGA 4BOYA 3BMNB 4BTEA 1O97C 1H8HD 3D7MA 2C9CA 1EBUA 1TAQA 2ZYUX 4ALNA 5MFPA 1Z16A 1GP2A 3PDIB 4X1YA 4YRPA 1T8PA 4ZGBA 1TUEA 2F8SA 3MTJA 2BGWA 5EYPB 4YQZA 5G3YA 4D82A 4E07A 4WLFA 4AMYA 5EZ6B 5IJXA 2OMKA 3KG2A 2XTMA 3EQ8A 2H2HA 3O03A 4D5EA 4NYMR 5LWQA 5I7HA 2QMQA 1OD6A 1WD5A 1SUWA 5FBKA 3AHIA 1OXVA 5KJCA 3SBOA 5YASA 2E85A 5AOVA 3VRHA 2E1BA 3IP6A 4ILKA 4EX6A 3WRYA 1XVAA 5CA1B 2FZVA 4LHVA 3PUKA 5B36A 4CJXA 2CDBA 2P0YA 3K1ZA 3UJCA 2PLRA 2DWQA 2RJNA 4WE3A 4JC8A 4KHPB 2VTBA 2W6PA 3EVGA 4GMKA 1T3ZA 1M72A 5E0KB 4RVUA 1CY6A 5ARDA 2RGGA 1YHQB 1M1YE 2OTJB 3GLUA 4QXAA 1WZCA 4H7EA 1FYEA 5B4VA 1D2EA 2P1DA 4QNMA 1H1LB 4Y1RA 2ZJZA 4PCAA 5DT9A 3NP7A 2G0AA 3CUSA 2JJQA 4EGQA 3PXDA 4YRMA 1VBNA 1SOMA 2FFHA 3DT8A 1ECJA 2R84A 4MWOA 1T29A 4J16A 3DAPA 3O82A 4KE7A 1JA1A 4AP6A 1QCDA 1RC0A 2N75A 2VHCA 4HNHA 1I24A 4V38A 2HDWA 3TD2A 4M9CA 3KUUA 1NPDA 3UWDA 4EMUA 3EMDA 2Y0BA 1GYPA 2FRDC 4QGSA 1Z5NA 1V8OA 1Z73A 2OHOA 3MTIA 5HA5A 4D44A 1VE9A 3CX3A 3T7AA 2E7ZA 3T7TA 2HQ1A 4CTKA 2HLHA 1I3NA 1I7NA 4DANA 4JNKA 3FVTA 2P8JA 2RCNA 1HL3A 2WFAA 4AZ0B 4L5BA 2M9MA 3DMNA 1DX6A 3HKEB 3OCYA 5CG2A 3C14C 1CJCA 1F5NA 3RU7A 4MWSA 1Z74A 2WNIA 4WOPA 1IMOA 3D6JA 3VAZA 1Q50A 1FSFA 1QV9A 2PUWA 1UBLS 3HBFA 3HDQA 2BELA 1JG7A 4EFMA 2IH2A 2HUPA 3K2IA 4G09A 3N2NA 4P4NA 2P2CA 4CMEC 4RY0A 3TSYA 3WGTA 1MO3A 7REQA 4BKMA 3JWHA 3A7DA 1JDSA 5JWHA 1G3QA 3NHZA 2CUZA 3O38A 1VE5A 4G2TA 4MVJE 3MTAA 1L5GB 1QKJA 4G7WA 1S02A 1RFLA 1KJWA 1M0SA 2P3LA 2VCYA 4B4WA 2VDPB 4R41A 2FRVA 3G6WA 4OJKA 1TYDE 2YN4A 1ULTA 5J43A 3CB4A 2OCLA 5JAUA 1GFIA 2NV4A 2VNIA 2AE1A 3OEWA 1QCZA 3CUTA 2VKQA 3JRXA 1Y4AE 3UAVA 1NONA 2B1IA 2ZYHA 4MYRA 1ONSA 2FWPA 1SVNA 3BRCA 1WSDA 4MUFA 2O1WA 2WD8A 3V4ZA 4G8CA 1BEEA 2BHNA 3A11A 1YBVA 4RM0A 4F2DA 2CXQA 1NZDA 4X06A 5D3MA 1CUYA 1UBHS 2XZPA 5DW0A 2Z2IA 3DF7A 4MW2A 1YE3A 1Z6ZA 4MRMA 5JD3A 2BBWA 3WL5A 3UMSA 2FSVA 1L0BA 1OH6A 2LR0A 4X07A 1W29A 1UPCA 3JPYA 1CR1A 1MX9A 3KE8A 3FYHA 2W83A 2R7NA 2YWHA 5EIBD 1UPUA 3JS5A 4OG2A 3PRHA 5JDCA 1WE2A 2XLCA 2ZAIA 2XAUA 2JBHA 3BN3A 1LRKA 5D86A 3ZU2A 2VUTA 4BB6A 1QP7A 4UCWA 1L7NA 4J2TA 2IKSA 3SDBA 1U3TA 3R9XA 1EZZA 2FZKA 1VDZA 1A9SA 5TVGA 3AESA 1LA2A 1YVPA 3DTVD 4UU1A 4Z7JA 3BWXA 3ZHSA 4LZLA 4QU9A 1T5IA 1L4EA 3C7CB 3MQFA 1ZMRA 5B12A 1KAQA 2BFBA 3O4JA 3PYXA 4B2LA 2C04A 2LZJA 4IDGA 4M0UA 2HN9A 4C4AA 421PA 1ZNYA 3LHDA 4XTCS 2ECOA 3S1SA 3DL4A 1LLCA 3KQKA 5K1ZA 3TTXA 3LL4A 5EHQA 1REQB 4MPJA 4L5IA 4M1EA 2ECQA 1O8BA 3OQIA 2UXBB 3F3KA 4H9GA 1M66A 3FZNA 3HRIA 1OXXK 2FX2A 2OP0A 2WJZB 1KEZA 2ZU6A 1BHSA 1T8UA 2QT1A 4YN3A 4UJ5A 1O95C 1NBEA 1V11B 2HL6A 1JHDA 3OOCA 1JZSA 3HACA 4KDFA 4W9NA 3VHRA 4Z3KA 2VTDA 2HXGA 4BNWA 4L2IA 4DMRA 1A9PA 1RADA 3QX7A 1F06A 2PJUA 2QZJA 1GHTA 3LDHA 4RF3A 5ADVA 1CS4C 5HRUA 4EVQA 1ID8A 3S99A 1KK0A 3HY6A 4PQRA 1RJEA 2RARA 5B7NA 4WXEA 2YYYA 2ZT8A 1HDYA 2B30A 3BTOA 1EYZA 2WYWA 5AI5A 4A03A 5EP4A 3HFRA 4KUGA 4B3CA 4E2XA 4AFNA 3NZEA 3REFA 3KVRA 2VWGA 1B6SA 2OBRA 5CBPA 1EGHA 1Z8NA 4YT4A 4Z51A 1L1EA 4R0NA 4Y1EA 2H08A 5T5QA 3GLGB 2AW5A 2GPYA 1L4NA 4KYTA 4JX8A 5LQNA 5BVGA 3CVWA 5F78A 3OQNA 3FE2A 2ZUTA 3QBDA 3V46A 4QWMA 1TU3A 3E9YA 4N18A 4W1QA 3UOGA 1U11A 2PZMA 3B20A 1UKCA 1S2MA 4PGOA 4JJGA 4QODA 5DK6A 2ARKA 4JQZA 3TCXB 1MJGM 2Z4RA 4G63A 4ARSA 3AP1A 1Z6XA 1DT3A 1YI1A 2A1TR 1SQFA 2E4ZA 2GN4A 3BBPA 2E4XA 1ISGA 1C8VB 1UKBA 2EBHX 3QJGA 4FHFA 1H2FA 5HS6A 2OFFA 3U4AA 3AVWA 5IVPA 3GLKA 4FT4A 5FA6A 1EM6A 2HDOA 1RJDA 1BKYA 2HMUA 2QN7A 3KBOA 4HVAA 4JI7B 2E1PA 4G0MA 5JSQA 1KQFA 3L04A 1D6JA 3KKZA 3M83A 3TRIA 3HEMA 3L41A 3WNZA 3I4CA 2NV0A 4MRNA 3BMCB 5JNWA 4MPDA 2CXRA 1SVMA 2VJOA 1QDUA 2Q29A 3NOVA 4IGKA 1G20B 5DTRA 1BXKA 5DTEA 3MJVA 1XZLA 2HQSA 1XA4A 4Q82A 3AGPA 2CVPA 2DPGA 4IDAA 4URXR 5KQGA 5IVKA 1LBEA 4FYJA 1BKDR 2EYQA 3HRHA 2IOYA 4ZAWA 4E2WA 1EE2A 5BURA 4JUDX 3UK1A 9LDBA 4MLZA 4TN5A 1KU6A 3DGFC 3I05A 3A36A 3D0RA 4NE9A 4DJAA 2G3YA 1V5EA 1P0PA 4QVIA 1UPAA 2NZJA 3SFZA 1E6KA 4JHLA 2YV1A 2J3LA 1V5FA 1ZMBA 3DEHA 5CH3A 2DXIA 2WTAA 1N3YA 1LLDA 3NS7A 3C3BA 1P1IA 2FEXA 3VSEA 4HKTA 2BMEA 3THWB 1MDFA 1QHIA 2AOWA 4B47A 3VJLA 3KSBC 3PPXA 4L28A 1QLHA 3JATA 2ZVPX 3E7DA 4M60A 5AM0A 5GJCA 1J21A 1YKGA 5BP7A 3PU6A 1CNMA 2YTZA 3COZA 4GU5A 4J94A 5A71A 5HJ5A 5HR5A 1FVXA 2G9VA 5FR2A 1U8CB 2IYXA 4D92A 4C4TA 3PRYA 1IBRA 2JARA 2UUPA 3DAGA 3WBBA 1V4VA 4FW9A 4M86A 1PVOA 4M89A 3HZHA 4M53A 2VA8A 3LU1A 4R0MA 3ROQA 1VBFA 8OHMA 2OCYC 1JQBA 5K05A 3ZV3A 3EG9A 1KPIA 5KYXB 2GHTA 3NHFA 4GBMA 5P21A 5ALNA 3FIJA 4KV7A 4BGVA 1RABA 4J91A 4P53A 4ZI5A 1ESDA 1RKBA 4RULA 4C3UA 1U28C 4F1JA 3WR5A 1AKMA 3TKYA 3SDZA 4CV2A 1XC7A 2FRDA 2P2NA 4BU1A 1F51E 1K6IA 1KIMA 3RT9A 5J23A 4PRZA 1JS1X 3K15A 4QFCA 4TWRA 5KTMA 4LJRA 4BE4A 1ZD1A 1RWMA 1WOMA 2Z83A 3M6UA 1X8XA 4MVJH 1HT1E 1GL7A 2V7XA 3HWRA 4AC9A 3CC7B 1GDDA 1NTOA 1TC2A 4NX2A 1P2GA 3UV6A 4BQPA 5C5IA 1LI7A 3BA6A 5CLFA 5FV4A 4RH0A 2WPDD 1X0VA 1W46A 1PS0A 4DLRA 2CE7A 3HABA 4HHEA 3OZUA 4YELA 2ZUDA 4IIXA 4OQMA 4QDKA 4R2WA 1P29A 3SY8A 5I4CA 2FLWA 1Y4UA 3ZIAD 4XM3A 2A0WA 1ZL2A 4URZR 1N2HA 2HY7A 1PP4A 3PRKE 2C58A 1FTYA 2J7KA 4HX9A 4PN7A 1KZGB 3ER9A 1UZMA 3OVMA 3P2KA 4N5HX 5ALDA 3LPMA 2VTVA 4O63O 3WYGA 4CL3A 4C3OB 3GB9A 1AB6A 1CR6A 1YU9A 3VTZA 3Q7PA 4X44A 2YBDA 1M8GA 1KZLA 1T13A 4R0VA 4K3UA 1MN6A 4A1FA 4W6QA 2GJRA 3EYAA 3ZCUA 3JASA 1OI7A 4BYMA 3NUZA 4N8EA 2P3MA 3FI9A 4ZEWA 2WPNA 5KYYB 3T1YB 3NVKI 2IXBA 3KD2A 4G0XA 5A3QA 1IZ8A 2AA3A 1XMOB 4M6WA 2Q07A 3ZK8A 1QO7A 3MWDB 2KE5A 4CUKA 3VPGA 1A7JA 4YROA 5A89A 2HSWA 2WABA 4X6UA 3ZDRA 2IPNA 4XVCA 4EW2A 1VMAA 2ORIA 3KQVA 3QVWA 3IDZA 5DLPA 3VV2A 3WICA 2ZAGA 1V16A 1IN6A 2B0JA 1AUPA 2I54A 3TF5A 1LDBA 4NMXB 4DSZA 4EITA 2QK4A 1XTVA 2JVKA 3A3PA 4HUJA 3HSYA 4G4SP 5LIPA 4H1UA 4MJ3A 3HDJA 5KYKA 4ZRMA 4IG4A 1RM5A 4NFLA 4AJNA 5TT1A 2ZETA 3DV2A 1I4TD 5AM3A 3NB0A 5EIOA 5A6SB 2YL2A 1R4NA 3ICPA 4HFMA 4N3AA 3SFTA 2BUBA 4LRXA 2GM5A 1J1ZA 4R2MA 1C3LA 4RKYA 2HYIC 1FL9A 1P1JA 3U0VA 5HZBA 2TMKA 1ZWKA 3QKRB 4ROXA 1A88A 3TOVA 3G2HA 2JK0A 4GWGA 2HRQA 1G6HA 1L5SA 2NT4A 4CL8A 3VNBA 2QA4B 3PA2A 2ZI6A 3AUSA 1HYGA 4A8TA 5JAIA 3NAQA 1KP2A 2VZEA 1YO6A 3O73A 4MGZR 4UHJA 2WU0A 5F35A 4AZVA 3ZCSA 5IYZA 3LOQA 3OQMA 4AIRA 1QC5B 3AX6A 1TQ8A 1IQ0A 1CEQA 2QF7A 1T0UA 3BWEA 4YH1A 3LGSA 5F9MA 4N76A 2XNJA 3AF2A 3VDMA 1T9HA 1QH8B 1QV7A 1Q9SA 1MC5A 4GS5A 5BRAA 4XLFA 1GJRA 3ZZMA 1O95A 1A96A 1M2VA 1LLFA 2UYGA 5EWJA 4G84A 3RS7A 2PD3A 4P0PB 1QWSA 1M2JA 3MZ0A 4C0SA 3F8WA 4DDVA 4E51A 4Z4IA 2C84A 4CBVA 2OCGA 3KVVA 5BWLA 1MEOA 1DIOB 1ODJA 2C8VA 2DUNA 5HS4A 1B8PA 1H9AA 4P3NA 1YGPA 1GNSA 1EWQA 3QSGA 4NMMA 4RNCA 3TMYA 4IDOA 5JCXA 1Y1KE 1GVHA 1WUJS 3MD0A 4NYIQ 3RWBA 4ZVKA 1XVIA 1T9DA 2ZSKA 4FDVA 4QIHA 3MA0A 4D4KA 5M3BA 4DMKA 1Z0IA 2AFRA 4OLBA 4KLZA 2VAVA 1NSYA 2E0IA 3DMHA 4FR2A 3RK4A 1E7SA 3QG1A 3QLEA 4IGAA 4U7HA 3GT4A 2JBAB 3EFHA 5H4HA 5FUXA 3DBHA 8LDHA 2BMVA 4YAOA 2X8AA 2ZJOA 4X20A 4FZ5A 1E77A 4MRSA 4DR7B 1A4IA 1KSGA 1XZNA 1K3FA 3BIWA 3KTFA 3EZ6A 4ND3A 4GQAA 2ADMA 1KOJA 4Q3AA 4K81B 5FFNA 1YS9A 4ES6A 4ICIA 5LM3A 2YC4C 4TXHA 3IEPA 2PQ0A 5TNXA 2C7PA 2UUBB 1O9GA 1ZJ4A 2W6MA 4XVHA 2W2LD 5CNKA 1OFIA 3G8CA 3FLBA 3IOBA 4OL0A 4WY5A 2WC1A 5A5FA 2JI6A 3ZK9A 1H6DA 3TLYA 1XF1A 4G0UA 3V1MA 4UQLA 1XU4A 2X40A 4NHEA 5DRYA 2C5EA 4P5DA 1FFAA 1XRPA 5BWOA 4CN9A 4B79A 6ABPA 1YC5A 3GBVA 3NIFB 3QPAA 2GWHA 3ZD9A 1HTTA 2EX4A 3IELA 1EDOA 4PZYA 2B1JA 4OXYA 3GFQA 2IFTA 1AX9A 3BRQA 5I9MA 3SDSA 1OROA 3UV7A 4C0QC 3BQNB 1PDVA 1FU8A 4JDUA 5L7YA 3QVOA 3W9UA 1H9BA 1TFUA 3PVCA 2QTTA 3A1PA 2CJFA 1DC5A 4LE0A 4Y9UA 1S72B 1DXYA 3C6QA 1BQ3A 1NC1A 4F4FA 2AR7A 4LHZA 4FMDF 4E32A 1RACA 2Y77A 4KL8S 4EHBA 2FX3A 2A1TS 2GA9A 4RQUA 4GLOA 5FB3A 1E6UA 5C80A 4BTLA 2Q7XA 3EPPA 1DQSA 1KC8D 4YRDA 1R6VA 2IDKA 2H1FA 2VHWA 5KU1A 2GPSA 3WLEA 1JBQA 1ML3A 3SC2A 1XLUA 2NP7A 1FUIA 1N5IA 1NJ8A 1OV4A 1Z15A 1BMTA 1F5SA 1CPYA 4HXYA 4IKEA 5FWYB 4COOA 4DLAA 1NVKA 1UT8A 1JG1A 3H87A 1AF7A 1KNQA 3DGEC 1JEQB 1OX6A 2JGFA 4D9BA 2JIZD 5J3OA 3K0AB 4H0CA 3AGQA 2X13A 4RWZA 4IDEA 5HNKA 2YFYA 3QY9A 2B7CA 1L4HA 2X0JA 3OFNA 2GF0A 1EXDA 1OB0A 5JI2E 1SQ5A 1E1LA 3ND5A 4LV8B 2CUTA 2DBZA 3E1GA 5J2TA 4DTIA 1B1AA 4UUOA 3O95A 3QYFA 4PWZA 5AVRA 1WBJB 1U28A 2YFKA 2EP8A 2ZBEA 4KQKA 1X15A 3AEZA 3NORA 4RJIA 3PQFA 4WI1A 1ZGGA 5ARCA 5JG7A 3SYLA 4KO8A 4BJ3A 4QU0A 3CMAB 4ZVLA 4BX2A 2Q9UA 3CLRD 3FNRA 2G80A 3JZAA 1NF3A 1H65A 1L4MA 4M0LA 4TQGA 4XUDA 1XHFA 3C1TA 3TLBA 3FCAA 2VXBA 4L6IA 4YUXA 2O8EB 4GRIA 1TF7A 3MB8A 3N53A 1J1UA 2WB4A 1KQOA 4KXLA 1QH1A 3G9ZA 1R5JA 1Z45A 4AS3A 4BLRA 5IM4A 4XCXA 4K9NA 2JJ1A 3OCJA 3PA8A 5H80A 2PVCA 3I5UA 5C1BA 2CYAA 4RDIA 3WRXC 4KQWA 2I7XA 3IIKA 2GKOA 2PTGA 4R9NA 3E1YE 4MDHA 3KQNA 4MKGA 1NM5C 4EGCB 3GVIA 2G09A 2ZIEA 3KOZA 4X93A 2FUG1 3D5TA 2O2YA 2X8JA 4MQFA 121PA 2YWEA 5ILQA 2JZCA 2OFXA 3OOHA 1M54A 3IAHA 2H2WA 1RAEA 3EB9A 4WXRA 3D6AA 3OTHA 3NTVA 1YQQA 1T6YA 1EFCA 3PITA 2IYAA 3IUNA 4F84A 3AF0A 1S8FA 5T8KC 3ZYZA 4BNVA 3CIOA 3MLEA 3BFPA 2PWZA 4Q1FA 3WOHA 4NPHA 3PICA 1FNSA 3THYA 1N0VC 1J42A 1C0PA 1P60A 2JZNA 2FN4A 1U0NA 3H16A 4ZYVA 4O1MA 2QA5A 3E8MA 2P4SA 3T06B 4QKQA 4MB6A 3GLFA 4P0QB 1Y4DE 3AP3A 3FNHA 3RNOA 4YDQA 2FAXA 1U81A 4NXMB 3H9NA 1NQVA 1Z3CA 5IN4A 3MUNA 2QMYA 3AUAA 3Q8XB 3NBUA 4OSOA 4RHCA 4XONA 1NXVA 2A5DA 3OFSA 5BW5A 1B14A 1S2GA 4B4KA 1JVBA 4JZKA 2B98A 5ECDA 3HL4A 3WQZA 1OOEA 2QVXX 1RSZA 2YVKA 1VSTA 4RUKA 1RJWA 2AK2A 2QM0A 3MT0A 3UKJA 2ZRIA 3FPCA 1MORA 2QXUA 3SZRA 3CZRA 1YR1A 2QTWB 3OD1A 2WAAA 3LP8A 1Z37A 4YCMA 4XQ9A 3T4XA 2PFGA 4KQGA 1ILEA 1G8PA 1WXQA 4REMA 5HZAA 5B55A 3VVCA 5KTYA 4PG4A 3T5AA 3F7NA 1LTHR 1W4ZA 4K7JA 3PFGA 4MV8A 1CUCA 4MV4A 1XA3A 2RH4A 2O3UA 1SCKA 2QMHA 1KY3A 4MPPA 5LLSA 3B6EA 5IT9A 4B44A 1MT0A 2NTNA 5ERGB 1VL6A 1PSWA 3KYDA 1VYVA 3WB2A 2XA2A 3DR3A 4HN9A 4F04A 3MJDA 3RSOA 5KYNA 5EE5B 4NEGA 5DV9A 3T9AA 3E9MA 2YZMA 2ZYTX 2QJRA 2BIFA 2WKRA 3SIRA 4A2QA 4K9PA 3R75A 1MH9A 1GZVA 4TS3A 1CJMA 1GRCA 4MVYA 4U7PB 3WK8A 3WVNA 2RE8A 3DFFA 2XGJA 1SXGA 1GL9B 4BRSA 4G0NA 4QTZA 3V6LA 4AJHA 4CIYA 3JQ9C 3PUZA 1UT6A 1TXGA 4FOSA 1MQSA 3RUAA 2P5SA 3L7OA 3GF4A 3PBKA 4HB0A 1X8JA 2X6TA 4HAZA 4P4UA 2YJ4A 4KXNA 5G4KB 3IVXA 5D87A 2GR9A 1ZM9A 1PFQA 4D98A 1Z82A 2X7HA 5K8VA 3RVSA 3UT6A 2QQFA 3C97A 4JKOA 1OT3A 1B3RA 5AQEA 4ZA2A 5JYEA 3Q3GE 2J3QA 5ELXA 2Y71A 1T8YA 4A6XA 4R8SA 2NG1A 2CLDX 4BUJA 3TECE 1HEUA 4FWBA 3KDPA 3AWDA 4AQ7A 3EXIA 2F8TA 2F3PA 4JXJA 2JKYA 3EQZA 1D0VA 3DS8A 3CURA 3K9WA 3N6XA 4JBGA 3QG5A 1KJNA 2A14A 1XXHE 3GRUA 3IP5A 3PJFA 3R7AA 4QPPA 4AUEA 3D4NA 1SU8A 3BNWA 3UJNA 1EDZA 2CHVA 2X9QA 1D9ZA 1J2EA 3G89A 4TN1A 4XJSA 3S2GA 1MOSA 1P44A 1ABFA 1P17A 2YZKA 1VQ8B 1JTEA 1KYYA 3N1UA 1RCFA 3GO4A 1EGVB 4DDHA 4MDFA 1LQUA 2H2GA 2QQEA 1ZWLA 4UAGA 5EKXA 3SXUB 3T7IA 5FPKA 1X7XB 3LA6A 3TLXA 1QU3A 2ZAOA 1XTKA 3TUIC 4B75A 1T1JA 5IC6A 3QLTA 2F64A 2JAUA 5KNBD 1XQWA 2G70A 1E3SA 4QU8A 3E48A 2ZVQX 3F78A 3JQ7B 3E3MA 4P3PA 4ARZB 5JH7F 1EGAA 2C3UA 3U4CA 1NAHA 3QYJA 1Q17A 3T54A 4WUTA 1PD1A 2RB5A 2GD2A 2VZLA 2XEXA 3NC1C 3H4MA 4GP7A 4I50B 4CZ2A 3DVQX 2G9QA 3N8DA 1Z2EA 1DX4A 2W2TA 4IHQA 2OCXA 1FA9A 2AUNA 2EWMA 4Q93A 3TIFA 3RSCA 3Q3HA 3QXCA 1LPBB 1I8DA 3NEJA 1KZHA 3RADC 2HCRA 1MKYA 3BFVA 3C3KA 1CUWA 3PWZA 3ESBA 4NCIA 3HH8A 3SQDA 3ZGYA 3ZG6A 1FJXA 1Z0FA 3QNWA 4LWOA 2KW5A 4TX1A 2OCAA 3HCFA 4YT8A 2A92A 1ZCAA 1JU9A 4ZDWA 3LQEA 1E1CB 2GFHA 4TKVA 1LGYA 1MAVA 1JDZA 4OUKX 2VPXA 4ERNA 4YAKA 3TQHA 5LXTB 1G8FA 4RAQA 2O3RA 4Q4AA 2N9UA 3C3AA 2H9YA 2QLMA 3IBYA 4RA6A 2O6HA 4NBLA 2BJVA 3UUEA 5BN3A 3OT1B 1GO2A 2JJYA 2VYND 3ZHTA 3K9LA 1SHLA 4EA9A 5K3CA 3K8YA 1QZ3A 4JB0A 3DW1X 3PR1A 4JSYA 2WYUA 4X7FA 3ZZTA 2MYNA 3EZNA 4XUEA 2Z5VA 3E4DA 5CYOA 4BWFB 5CVDA 5BOVA 3WNQA 3PC8C 4C2BA 5E6TA 4ZOBA 5H9VA 2BSXA 4BFYA 2FKAA 1DWPA 5BO5A 3P1JA 4LOHA 3ROEA 4DAOA 4MHTA 5SV2A 2D00A 2JGAA 5BQ3A 5KQLA 1HR0B 4N5MA 1KEEB 3PQ7A 2J0SA 1LC3A 4U2KA 1S2OA 3RRJA 3RSLA 2J3IA 1IJFA 3KOYA 1ECPA 1P33A 4M3NA 3Q5GA 4TTIA 1PG0A 3SBDA 1DKNA 2WB2A 4RZQA 3GJ6A 1NLUA 3SEFA 4J75A 4YONB 2YR0A 2JIPA 1DAFA 3IMFA 3LPLA 4CF4A 4DLKA 4X91A 1X1CA 2FMIA 1W4CA 2J0EA 2PL3A 5DBIA 4ZTUB 2A30A 2EZ8A 3TLGB 3NHBA 3GP5A 2BKUA 3CH7A 3B8HA 5ADHA 2D0IA 2HT6A 1W35A 3RAFC 4ITVA 3REQA 4JLVA 5J9FA 1U5BA 4Q7JB 1E20A 2QZSA 4R01A 5T4HA 1DCFA 3FHOA 1QOZA 3EHDA 4PHCA 4ZMBA 3UOWA 5GTDA 1Q7TA 5LL6P 2FR1A 3UICA 1MA0A 1WUYA 2IF0A 4YLEA 4UVHA 3NDRA 3AFMA 2PUEA 1N6IA 3ZQUA 1PJ7A 1UK6A 3CINA 1DNPA 3BX1A 4QXOA 1PBNA 3PDUA 3P45A 3RF6A 4U7DA 3K1JA 1X7YA 4MAFA 1J20A 4XDYA 4PSUA 2ANBA 3JWGA 4B76A 1Y6ZA 1Y98A 2ODPA 3FF1A 3O8NA 1FF9A 4LHWA 3BS4A 4RIHA 1TVEA 1NBMD 1ODKA 1PNOA 2EKLA 3WRXA 1PZHA 3OTGA 5CDFE 3RUDA 3NC0C 1CYDA 1FX0B 4D26A 1AGNA 1NM5A 4LXTA 1E9RA 3EIHA 1T26A 4YJGB 4JVMA 1RLOA 2JGEA 4YIHA 3KCNA 1A71A 4CQMB 1CNFA 3ILVA 4XCQA 1YDEA 3ETEA 4GGMX 4HIZA 4N7JA 3RS5A 5AR1A 3H19A 4GI1A 5L8VA 2FDCA 2EJCA 2PO7A 3AI7A 5GQSA 3QWIA 3LSYA 4ZCMA 1UBFA 3G82C 3IAXA 4UXJA 2YHIA 4DUPA 5T8KA 1O0SA 2VDMB 4HPJB 5CPFA 5E6RA 5BQFA 2XCLA 4PLPA 5KVCA 3ESQA 3MWEA 3G8DA 1RMQA 3FZQA 4D46A 3P2EA 3OZRA 5LQRA 2Z57A 1R5NA 1J0AA 4FFBA 5DKFA 3ELUA 1YLOA 1MTZA 3BJIC 4L7QA 3SCZA 3IODA 5HJ7A 3U60B 2C2OA 2YZNA 2IK8A 1NMEA 4MA5A 2X6QA 3QPVA 4KN5A 4REOA 3WISA 3B7GA 3ZU5A 4YP1A 4L4ZA 4ZN6A 3WLIA 2Z8ZA 1ZICA 4C2TA 4TTRA 3NWOA 1MV8A 2ZJ2A 3ETGA 3PNVA 4KR0A 3K9GA 5JS1A 4FFPA 1OGJA 1Q7RA 3A9WA 3CQ9A 5HP4A 1JTVA 2Q0HA 1J5PA 3GVPA 2OV1A 2XUFA 5AKZA 1L7QA 4C08A 4D3ZA 3AEUB 3I2FA 1W4AA 4IIGA 4WZZA 1FQWA 2A57A 2H3EA 1SXJB 3BAFA 1OBVA 2CL7X 3KALA 3O1JC 3O94A 4JQOA 1FXSA 3CFYA 1KHHA 4N4AA 1S1MA 5JFGA 2WJWA 3FB4A 3O93A 4L6CA 1BHO1 4RSGA 5E6SB 2VXYA 3EIXA 3ZCVA 2RKBA 3HDTA 1ZPDA 4IF6A 2XT6A 3ILSA 3SHQA 4W6ZA 3CZ5A 1AHPA 1X39A 1L4BA 1MX3A 4N6OA 4FFWA 3E5NA 4XGNA 1E5TA 1NE7A 3QKSA 4MW5A 4B9EA 5BVHB 1XTJA 3CISA 3REOA 5KVVA 4FEYA 4U9UA 3VKHA 1DDOA 2AGVA 1K1EA 1Y1RA 1RD4A 2EDAA 4J6EA 5IJWA 3ZJ4A 4TQ9A 4CFYA 1CUIA 1HRKA 3PUNA 2G1UA 2LE0A 4TV8B 3IKVA 4EIWA 1RJ9B 3LQ6A 2A5GA 4G3XA 2YVAA 4LY3A 4FM9A 3AHEA 1NJID 4P7FA 1YJXA 2C3YA 3E18A 4HDCA 5CCDA 3JQ9A 2YFQA 5MDHA 1C8KA 3WL6A 1R0SA 4ESVA 1X7ZB 4Y2VA 4WFJA 1YD7A 4WW0A 1C1DA 3L46A 1VP3A 1ZOLA 1GV1A 4ZK2A 2VO1A 4XEUA 4PZEA 1OAAA 2CF6A 2HGZA 2QD3A 1D4FA 3WHIA 4HBGA 2E21A 1JAHA 3TAXA 1DFGA 4B7XA 4OQFA 3HYCA 4ZVMA 1Q1QA 2FHPA 3WWDA 4F3KA 5JARA 3M5PA 3IX7A 3U4IA 1WKCA 1XNHA 2H4WA 5AIBA 1WSBA 3P0JA 1EQUA 2PWAA 3DBIA 4YWJA 1PWXA 2BHLA 2C88A 4NHOA 4O33A 3I45A 1G5PA 3GA0A 1DWUA 2IYUA 4J9UE 3IV7A 3HRKA 1TPZA 5BSMA 1IONA 1P8AA 2WKPA 3MFQA 3TL2A 4V0OA 1R6UA 1HC7A 1G8YA 1I0LA 1KMHB 1Y89A 3DEAA 2WSSD 3P97A 4P2BA 5FOUA 1EUDA 5CTJA 1QIFA 2IRWA 2R8ZA 5C52B 3RRZA 5AHRA 5KDOA 4K6KA 4YO8A 1XZJA 5LU9A 1VKZA 4X6LA 1EKXA 3GIRA 4N3GA 2ID4A 5JC1A 1O0BA 1W5EA 1YQGA 1PQWA 1E9BA 4GPEA 4L8WB 1ZXLA 2F67A 4ZJYA 5K09A 4CEHA 3RHSA 2VCEA 1II0A 4RL6A 4Q34A 1TYZA 2ZYGA 1L1FA 2O54A 1PR1A 3P96A 2CEKA 5E7QA 2QY6A 4JU9A 1PV4A 2FPGA 3PVZA 1KGSA 4YJ2B 2A9RA 3PD1A 4L7VA 4URWR 5IM5A 4BEWA 1M67A 4EO4A 2RGAA 3N0RA 1RQRA 2OQIA 2BKVA 5DVZA 2GK3A 4Q5IA 3ECAA 3AT1A 5I9LA 3R6LA 1G8AA 2ICAA 3R77A 4NJMB 1HETA 2GTHA 4UOQA 1R0ZA 2C9BA 4TXNA 3DXXA 5AW1A 4HQLA 3I2JA 4MR7B 1EVIA 4RJLA 2AZ4A 4TWAA 1JN0A 3LYLA 1JLMA 2XBUA 3GX1A 3IAUA 4X1OA 3T0GA 3UMCA 1ZHHA 1BZYA 5A0FA 2PAAA 1N2JA 1X80B 5L3SA 4DLYA 1V1MB 2PUGA 1II8B 1FYXA 2V1XA 3U48A 3IPAA 4CPDA 3L4JA 2Y1FA 2DFTA 3QUSA 3R7WB 2QRHA 4KWHA 3ZJTA 2ZDQA 3K9NA 3K73O 3EAGA 1R18A 3L92A 5K20A 3L7DA 4E0FA 2FF5A 3DUWA 4MUKA 1XALA 1N06A 2PE3A 1E1QA 2D62A 5I7FA 2HK7A 3OTQA 4LYHA 1RXUA 2HPZA 4L73A 3CMEB 1EEXB 4OGGA 4D0LB 5TPZD 3STUA 1NY6A 4QQRA 1QR2A 3I6MA 4TKOB 3PC8A 1NYQA 4ZT4A 2QHXA 1Q0UA 3JARA 1ODCA 4OHMA 5IYNA 4WERA 3ZWMA 1KAMA 2J7PD 1J33A 3UHJA 4ABYA 3ASSA 4IIVA 3I1IA 3IJPA 4JIMA 4NABA 3URKA 2HF7A 1WUKS 2ZVDA 5B7PA 1UKAA 2PSJA 4OUDB 5EJGA 4N41A 1T24A 3G5AA 3H8SA 4GNKA 1DQNA 3L7NA 3CHYA 2XITA 1LQ2A 1JHXA 3MOIA 3SKYA 1U7ZA 2AE2A 3L6UA 5CP8A 4RIGA 4M0EA 3P94A 5L53A 2B1RA 1GZSA 4LHXA 5JFTA 3B6ZA 2WJ3A 4MWDA 4EBBA 3Q41A 4G0QA 2P5YA 1YMUA 2IOHA 1EGMB 4DLZA 4K46A 4EI7A 4ZHQB 4BKUA 4WJZA 3FOZA 3MWFA 1WXDA 4D81A 2X9NA 4HMQA 4CKYA 1XJWA 2AN9A 2HMVA 4DRXA 4EY6A 2BL4A 2FFQA 5GM2A 2OBBA 3FJOA 5HE9A 1KJQA 2DWOA 2X7JA 4L0CA 1ZA1A 1CETA 2GYWA 2WIAA 1SCJA 3ZWAA 4PYNA 3USZA 3N5KA 3L9XA 3HUUA 5K8LA 1NVMB 3ID6C 4GI5A 5G02A 2BGJA 3E5HA 3HVJA 3KOUA 5LD2C 5IARA 1I7PA 4B81A 2JJMA 4MUGA 1JKIA 3QFSA 1YQEA 2LKDA 3TNYA 1TCVA 3MYYA 3LW8A 4N0PA 4Q4JA 1JDNA 4ZVUA 3V8RA 4ZYXA 5LZ7A 5HXBA 5D5QA 4RO0A 2LV8A 1RZRD 5AJYA 2HT1A 2FFJA 3A10A 3OWOA 2YUTA 1ZOPA 2QD2A 2OWDA 4UEJA 4GAEA 3L7BA 5T6BA 1QQAA 1CQIB 3DWGA 3N8NA 3RG2A 1MJFA 3ONYA 4ILEA 4RS4A 4C6HA 2ZJAA 3FAKA 3G3EA 3L05A 5CM9C 1PJBA 3BXOA 4D42A 1Y1QA 2YYAA 4HRAA 5BSKA 4QG3A 3OKAA 3DFUA 3FCOA 4MV5A 1T36A 4NS1A 3I2KA 3NPMA 3TCNA 3ANYB 4YXWA 3CLTC 4GSYA 2WWHA 4HSGA 4LX0A 5F33A 2GVNA 3RABA 3X1YA 2AN4A 3VJKA 3E81A 3IHLA 5TIIA 4DQVA 5HIAA 1RI4A 4YUZA 5IKMA 1LWOA 4Y67A 4EEKA 3A8JA 2X6RA 3EZXA 4OA5A 2GPJA 3STWA 1ZCFA 1ILWA 3TRJA 4QQKA 3U4HA 2ZWVA 4GF5A 2ACEA 5C37A 2VQSA 4C7OA 1LI5A 2Z5GA 2M2IA 5J1SB 3JRWA 3KR0A 4UULA 3B48A 2FZGA 1O7JA 1G2OA 2GO7A 3ABSB 1QG6A 1LJUA 1NJGA 2IX9A 3AFGA 4UAVA 2OXIA 5KJ6A 1F8XA 4M1MA 4B87A 2IUEA 4PPGA 3PXBA 4ZQIA 5KCZA 1QFMA 1FLNA 2PXAA 3BE4A 3AJDA 2Y76A 1R16A 2JFYA 1BVYF 1NJ5A 2EFGA 3IILA 3TEMA 4ZV7A 3LO8A 3A2NA 3DTYA 3UXYA 2J48A 5KWEA 2VYFA 2VSXA 2XMSA 3R8XA 3OPYI 4ZVQA 3P9KA 4L57A 4QSMA 2CV2A 1DC3A 4UBJA 4NENA 3OD5A 3DMGA 5CMLA 3RIMA 2VYVD 1Y0YA 4BO8A 5CCEA 1N2CE 3I6IA 4CQLB 1GEEA 3I6ZA 1YJNB 2PY6A 4DV3B 5FF9A 2NLOA 1VF7A 4N3BA 1L5HA 3ZWXA 1B2RA 1EFRA 5JALA 3WQQA 1H4SA 4BRUA 3HCPA 2VP5A 1G3IA 3PUIA 2Q3EA 3DHVA 2AK3A 1GPMA 3QUAA 4HS4A 4IJQA 3CCCA 1WW8A 4K6GA 4ZZ3A 3R9IA 4AN4A 4QARA 1PFGA 4ZD6A 3AINA 5C53B 3BK7A 2XSZA 3LIIA 2PRSA 1DGQA 5LA6B 4MW9A 1U4SA 3CZAA 1E58A 1ZESA 2MYTA 1DINA 5D5PA 1QS0A 5ALIA 1Z07A 3BWDD 4S2UA 3O9MA 4LF4B 3IBGA 1HT2E 1IMJA 3I12A 2PUAA 5EJAA 2WMYA 1AURA 3A6GA 1F0NA 1UFQA 3M7IA 2PPLA 1LNQA 5TQ2A 1GQFA 1URPA 5KOHA 2ZT7A 2GJKA 1Q3KA 4WZAA 3MBOA 1I94B 2BM1A 2ORWA 1ZU4A 3SC3A 4JBNA 3WKAA 3SFVA 1X38A 2K4MA 3RF7A 5JTUA 4TXJA 4OQPA 2ZPUA 3ONUA 1H4TA 2FSHA 1VQ5B 1C1XA 3CZ9A 3DZGA 3FA2A 4DWVA 1RMYA 3JQGA 3EEOA 1QBKC 3V4VB 1G9SA 1VQ9B 1IEQA 1SBTA 1DKOA 4F86A 2Y0CA 4AW9A 3AL3A 1XHEA 4X54A 2VP2A 5DCUA 2OAP1 1CK4A 1KKLA 1ZSVA 1SA0B 3SBXA 1L5KA 1GKYA 2PRKA 4RIIA 4KR2A 1T10A 3STVA 4P7JA 3VR2D 1L7MA 4DPLA 3W5UA 2Q50A 1KA9H 2G9NA 5KCMA 4KTVE 5IUNC 1JHVA 4M1TA 3QU4A 3IEMA 2B7BA 2FUCA 2AX3A 3E22B 3ADBA 4LYFA 2AHOA 5JCPA 4B6PA 2EATA 2LCIA 5F1OA 5JZMA 2DPXA 4PPFA 3CO5A 5BV1A 4MV0A 1JJFA 1Z7WA 4Y9TA 1CQXA 1Z5WA 4W5WA 3TN7A 1ZUD1 2YHUA 3PEEA 5FLYA 1N6NA 1MG5A 5LDGA 1WUTA 3CPWB 1B6GA 2FFRA 3SP1A 1UT5A 1PTJC 4RD3A 1GNQA 1TEXA 1RQ7A 3B60A 3C3CA 1DWOA 1E1YA 3WLSA 2QTRA 3KEWA 4LN1A 3H9EO 4G01B 1QBGA 1DXHA 4E2FA 3MELA 3QLVC 3CE9A 4TTSA 2E49A 1ATIA 3KSRA 3QU2A 2XMGA 4DQXA 3N2YA 3HA2A 2FG6C 3MT9A 2W8BB 1A8IA 2D5CA 2OK8A 1YHNA 1BO6A 4DJJA 2X8BA 1PQYA 2Y05A 4KQ2A 5L4NA 4F5YA 3G4SB 1E3QA 1HE5A 4XLLA 2IV7A 1AU9A 2V65A 5SZHB 1I1QB 1OPRA 4YWHA 4CM8B 4YYEA 1CFJA 1FS5A 2WTEA 2GHQA 3DCIA 3ORRA 2W2OA 4KBFA 2MR5A 3IQHX 1UANA 5K3DA 2JFHA 5ALPA 1KIFA 3LC7O 1S3SA 4U2BA 4UU7A 3F9RA 3GJ5A 4CM9A 4DRZA 1OT5A 2G7ZA 4JUBA 2V7PA 1V96A 2JFPA 1TK3A 3N6RA 4PPYA 4TQAA 1I3LA 4WA8A 3BT7A 3LJKA 4C4YA 3W8NA 1K68A 1DAPA 1DEKA 1OXUA 1MB9A 2D2EA 2FP3A 5ALRA 2MCFA 3QU9A 4XJVA 3TNJA 5IC4A 3EC2A 4IV8A 4CEIA 1IXZA 1L7DA 1QAQA 2CNNA 1I3CA 1T2FA 1WCYA 5JO0A 2C97A 1T0IA 3K70D 4ZZ1A 3DM5A 4GZ6A 5TGDA 2AFIE 2XOEA 1NBME 2D06A 2FE4A 5TXGA 3LQQA 1MTOA 3NTXA 4PLZA 3RUCA 1JV2B 4AMGA 1XPRA 1A76A 4TTAA 1W1WA 1EM8B 1GU1A 3LUBA 1JEYB 3VHXA 4EHAA 1LX7A 1ESZA 1YSCA 3OZCA 5LJLA 1M1XB 2SCUB 3E2MA 1ESCA 1SKUA 1ZMTA 2C4MA 3N2KA 4G24A 2QW1A 2YH2A 3C0KA 4RHEA 3E7FA 4F2WA 1CFZA 3VC1A 4RXUA 4TV9B 4C88A 5DHQA 5FWXB 4LRSB 1ZHOA 3TD9A 1ORHA 2WTBA 3GRVA 4MS3B 4NL4H 3D02A 1C2YA 2X3FA 3LE8A 3NAMA 3P9NA 3BCSA 3NHUA 4GBJA 1LCIA 2IEYA 1W48A 4QEKA 4YUVA 3UA3A 1RWKA 1JU3A 5ITZB 2HHHB 3AEQA 4KO4S 5MN4A 2D5IA 4UVDA 3AR7A 1RU3A 1R74A 1XEFA 1SVLA 2C2HA 4FOOA 4UNPA 4X9XA 1AK1A 5I7OA 1DIHA 4MVJG 4BLOA 4PBTA 5A04A 3ZJUA 3DLTA 1Y6FA 2IDZA 4NU6A 4JP1A 1KJIA 4IZ6A 5DN6A 1ZH2A 5JJLA 4RVSA 2JI7A 3BWVA 2RGXA 1HH4A 1PCXA 3KTDA 5CH5A 3TDNA 1CQJB 1KWKA 3ZIUA 2VHQA 3UJ9A 4B3JA 1HKUA 3G59A 2OZEA 3HPQA 4OXIA 5EQJB 5JCZA 3LF2A 5T6MA 2YC2C 1XCGB 5IVHA 3P9SA 2I6GA 2WWRA 3WFZA 4DLPA 2I66A 3GQBA 1XSEA 3IPCA 5EJ7A 2M6LA 3FN4A 2X6WA 2O5EA 2CUNA 4I4IA 4FGUA 4L85A 3WS7A 3LCUA 4E94A 1SN7A 2EERA 4Z7OB 2AQHA 1KE2A 3G0BA 3BTUA 1COZA 5HXAA 3UHFA 2K7FA 3K8QA 3WHPA 2F62A 4TKMA 1UC9A 2QD4A 3WKDA 3DXYA 1SUAA 5EE9A 4W9RA 3RARA 4PYRA 2HHAA 2YWRA 3DNFA 2ZT6A 3L01A 3E9CA 3PQCA 3GJXC 1CZKA 2X5NA 4KLCA 9GPBA 2FX5A 5K4GA 3EBPA 4CTMA 2ISSD 1LZLA 1RHKA 4MVWA 2QTMA 5E2IA 1C14A 1EG7A 1BMFD 1XEXA 1Z56C 3IT3A 1JR3D 2AF4C 2VP9A 1R8XA 1ZW6A 1ZO8A 4L51A 1Q0PA 2P8SA 4XB2A 5FT9A 5AW2A 1C9JA 4FMPA 5A3VA 1QHFA 2P7HA 2NSYA 4WK2B 4HX2A 3TI9A 1WDWB 3BMNA 5C1OA 4X62B 4F4IA 2Y27A 3QUQA 1YR9A 1QV6A 4K05A 3CRMA 2A0XA 3INRA 4FZJA 2PVPA 2ES4A 2A4KA 2Z1NA 1ZK1A 1GPBA 3EEQA 2PWYA 2ZTLA 4XDZA 1LPPA 2EGGA 1GDTA 3L1VA 3ETLA 5EYPA 4MYCA 1EVYA 4URUR 1EBBA 2WY2D 3D6FA 3SSAA 2G8NA 4YUYA 5HUJA 4KQJA 2C00A 3H5LA 3TR6A 4D41A 1JG6A 2OKCA 1I0ZA 1JR2A 4FFLA 4HBZA 1P61B 1WXWA 4K6MA 2XY4A 1R37A 3EBOA 4ZI2A 2QYSA 5JYDA 3PB3A 4BTVA 3LFHA 4UMEA 3U3KA 2GJ8A 5M2QA 5CA1A 2OHVA 4H6VA 2RH9B 1GGNA 4G5FA 5COAA 3DAHA 3SQWA 2RKOA 3GD5A 1R0YA 3JAKB 5HMLA 4XVRA 3UJ7A 3ACBA 5CX4A 3AKZA 1IVYA 1F38A 1ZD3A 2V7TA 1XU7A 1KARA 5CHYA 1GTSA 4KZPA 3GH3A 1W5FA 3HP4A 1CTQA 1IPFA 3HFSA 4P84A 3WLOA 5EJ2A 1EXNA 3HBAA 3CPXA 4DREA 2R2GA 3QKWA 4ROTA 1H1LA 1VL5A 3AOGA 2DTEA 3W5AA 8ATCA 4AY2A 4FGZA 1FRZA 4LI0A 3KQLA 4RU1A 2PUFA 5CGQB 1J90A 4KYVA 2IYSA 3BSSA 4B71A 1ICEA 1YQTA 2VBUA 2P67A 4HS9A 4UQOA 5IXYA 3WMRA 2O2DA 1R27A 2D0PB 2QSYA 4EHHA 4AY4A 4F6RB 4EZIA 3RFVA 2QZZA 2MINA 2D7CA 1WXEA 5JAHA 2C5AA 4DIOA 4P3XA 2WE8A 5FRDA 2WHRA 2M98A 1DQPA 2PYIA 2IH4A 4FZ3A 1W8DA 2TECE 1NUAA 1QO9A 2JB9A 3NQ41 4M8KA 3EPLA 1TK2A 4LJ5A 4TRNA 1O94D 4E1VA