2EJCA

Crystal structure of pantoate--beta-alanine ligase (panc) from thermotoga maritima
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
280
structure length
280
Chain Sequence
b'MRIIETIEEMKKFSEEMREKKKTIGFVPTMGYLHEGHLSLVRRARAENDVVVVSIFVNPTQFGPNEDYERYPRDFERDRKLLEKENVDCIFHPSVEEMYPPDFSTYVEETKLSKHLCGRSRPGHFRGVCTVVTKLFNIVKPHRAYFGQKDAQQFRVLRRMVRDLNMDVEMIECPIVREPDGLAMSSRNVYLSPEERQQALSLYQSLKIAENLYLNGERDAEKIKEEMIKHLSRFDKVKIDYVEIVDEETLEPVEKIDRKVIVAVAAWVGNARLIDNTILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantoate--beta-alanine ligase
molecule tags Ligase
source organism Thermotoga maritima
publication title Crystal Structure Of Pantoate--Beta-Alanine Ligase (panC) From Thermotoga maritima
rcsb
total genus 102
structure length 280
sequence length 280
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2ejcA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2ejcA01
1XJQA 1G8HA 3FY4A 4YP7A 1KH2A 1PFWA 4JXXA 4MUFA 1QQTA 3Q12A 1T9GR 4DLPA 5FO1A 3MLAA 4MUHA 1O97D 1J1UA 4KKVA 1VBKA 1U0BB 1K4KA 2GM3A 3FWKA 1JGTA 1GPMA 3FH0A 3G5AA 3PNBA 4CDMA 3HV0A 5F23A 2DERA 1I2DA 4KR6A 1UFVA 4RUKA 1K4MA 1TYBE 1NUUA 4YMIA 4I6EA 2E18A 1RQGA 1N78A 4JFAA 3UC5A 4EG5A 4PY2A 4NDAA 4MUJA 1N3LA 1O96B 4ZT7A 1KQOA 1S4MA 1NUSA 1KKUA 1KAMA 3F3MA 1OWOA 4XFDA 2QJTA 5KHAA 1M8KA 4P2BA 1EJ2A 4DJAA 2D13A 3CLTD 1GZUA 3AFHA 2DEUA 1TEZA 3CLTC 4HPWA 4Q16A 3X1MA 1VL2A 1EE1A 3VRHA 4JZYA 5TEVA 4KR9A 1GLNA 4HK4A 1F9AA 1K97A 4MW4A 3P52A 2Z09A 4R2LA 1JMVA 1JZSA 2H2AA 2ZP1A 1GAXA 1GN8A 4EG6A 3UY4A 2OQ2A 1I6MA 4YP6A 2YXNA 4MUKA 1YIAA 3H9CA 3AKZA 4EG7A 3PXUA 4KPUA 4QBTA 5LLTA 1PG2A 3IODA 1OD6A 3N9IA 3FHJA 3GMIA 3AG5A 3NV7A 4MLPA 1PFUA 2IJGX 2DETA 3P0JA 2NSYA 2QUIA 3RK0A 1N75A 4L2IA 3IVGA 2CV2A 2QTRA 3ZXIA 3ZXSA 1I6KA 3DO8A 3IVXA 3CLSD 5TEWA 3CVUA 4EG8A 4JYZA 4MUNA 4MW2A 3A4IA 1IH8A 4MVWA 3RFFA 3ZJTA 3ND5A 4YP5A 5K0TA 4K03A 3Q10A 1TYAE 2XRYA 3TQOA 1U7XA 3RHSA 1WXIA 1WQ3A 3SDBA 4GU5A 2PZAA 1YUNA 4WNYA 3VGJA 3L92A 4MW0A 3KT3A 4CQNA 1LW7A 1WKBA 3DLAA 3RJZA 1CT9A 4I6GA 4WSOA 2D54A 3L93A 1H3NA 1N2EA 3QE4A 1N2HA 2CYAA 2WQ6A 2CT8A 1DNPA 1KORA 1NUPA 2QUJA 4NX2A 4MVYA 2ZUFA 4ND6A 5H7XA 2A1UA 3ZJVA 3H99A 4MVXA 4DE5A 1NZJA 1O95C 2AKEA 1WXGA 4J76A 1XNGA 5H16A 3MUEA 1KH1A 1COZA 1IFXA 2J08A 1G59A 4E1AA 4MULA 1O6BA 1H1TA 3KFLA 3JXEA 4MUEA 1KR2A 1T6XA 1NURA 1X6VA 3K32A 4MW5A 4FZJA 1G8FA 2YY5A 3NBKA 3IMGA 2E21A 3MXTA 4PBTA 2WB2A 2XRZA 1YULA 2CYBA 1JEEA 1TQ8A 3AL0C 3K9WA 1JZQA 1O94C 3TNJA 2YWBA 4U63A 3LCJA 4CDNA 1EXDA 1IQRA 5EKDA 3QTBA 1J1ZA 4JXZA 3IVCA 3RBAA 2D5BA 3COZA 2JANA 3HFJA 3A04A 3S3TA 1QU2A 3N05A 1LI7A 1TFUA 1NSYA 1JECA 1M8GA 1N2BA 1IVSA 4A91A 4ZT6A 1NI5A 2PXHA 1N2GA 1HYBA 1JIIA 1BS2A 1M8JA 3HMQA 4ZCPA 4DDHA 5LM3A 1JHDA 1LI5A 1H3FA 3ZIUA 2QJFA 4MUGA 3FNRA 2A88A 3IUEA 4HJXA 1F7UA 1MRZA 3P0HA 3CLSC 4I6JA 1EFVB 5IHXA 1I6LA 1N2IA 1T9GS 1VLHA 1WJGA 1VBNA 3FOCA 4AS1A 1QRTA 4KR7A 2E89A 2CV1A 4ND7A 2Z3VA 3TZEA 3FDXA 1A8HA 4UZEA 3SEZA 1KP2A 1R6TA 3HGMA 3X1JA 4ZCQA 4Q93A 2DR2A 1QU3A 4MW6A 1J20A 2EJCA 2X3FA 1ZH0A 4DDKA 3ND6A 3G59A 4BWVA 5LFAA 2JA2A 4ZT3A 3SZGA 1FYDA 2OV4A 4U7JA 1ULHA 1NP7A 3IMCA 4U8HA 4EF6A 1NUQA 3SEQA 1J70A 3Q4GA 3ND7A 3TS1A 5JBNA 1KQPA 2CYCA 3FIUA 2GKSA 1WY5A 3UK2A 1M83A 4DNXA 5AHWA 5KCMA 2QUKA 1O0BA 3RK1A 1EUQA 2BTEA 2WQ7A 4NAUA 2CV0A 4AQ7A 1MB2A 3PNVA 2A4MA 5DASA 3ILVA 1IQ0A 1N1DA 5HUHA 1O96A 3FG9A 4ZCRA 4DDMA 1MAUA 3LE8A 3DV2A 1JIKA 5J58A 4F4HA 5DB4A 1QRSA 2E0IA 5DK4A 1O97C 3P0IA 4ARIA 1JILA 1V8FA 1M1ZA 4EG1A 4KPUB 3IOCA 1K92A 2A1TR 2CSXA 3TQIA 1KH3A 3COVA 3NBAA 2GOYA 2O8VA 5HUJA 1R6UA 1F7VA 1KQNA 4RPIA 2BYTA 3CLUC 5TGTA 3PNYA 5BNZA 4OJMX 3HL4A 1WQ4A 4MWBA 1G8GA 1PFVA 4L2IB 1TYCA 1QTQA 1OWPA 1X8XA 2X1LA 1WXEA 2I1LA 4H3SA 3A2KA 3QTTA 3N2YA 2J4DA 1MBZA 3PRHA 3CR8A 5IJXA 1O0CA 3KT6A 4MWCA 1EUYA 1B6TA 1Q77A 1R6XA 3CLRD 1U7DA 1J21A 3CVWA 3OTWA 2QUHA 1WXFA 1PFYA 5J5AA 1WZ2A 2A1UB 4MQ6A 2QJOA 2CFOA 1H3EA 3D6UA 3H05A 1MOPA 3ZGZA 2DUMA 2JAXA 2PFSA 1GTRA 4G5YA 2B7LA 3CVYA 1NYLA 1OWMA 5HG0A 2NZ2A 3UOWA 4QREA 2DLCX 1MC1A 2J07A 3AIIA 1OWLA 1GTSA 2WSIA 3TZLA 3SYTA 2CUZA 3GLVA 1TYDE 3MMXA 2AZXA 4EGAA 1O5TA 1KAQA 1IHOA 1YUMA 1F4LA 2DPLA 3IDFA 1MAWA 3CA8A 1QJCA 4MW1A 4XSVA 3ZUGA 1M8FA 5FO0A 1T6ZA 5FNZA 2R5WA 2PIDA 4R2MA 1N2OA 1VBMA 4GRIA 1ILEA 3I05A 2H29A 1YI8A 4OUDA 3UMVA 3GUZA 3VU8A 1V47A 4ARCA 3IOEA 2V0CA 3AG6A 2IP1A 2A7XA 3COYA 4NZPA 2O5RA 3U1VA 2X1MA 2V0GA 1Q15A 4J75A 1M8PA 3A05A 3MLBA 3IOBA 2PZ8A 1O94D 1EFPB 4MAFA 5J59A 3SP1A 4G5FA 1SURA 4OUDB 4QRDA 2VTBA 4K0RA 1Q19A 3COWA 4NATA 4F3RA 1OBHA 3ZJUA 4ZT2A 2X0KA 2Z08A 2J09A 2VXOA 4PBSA 2RE8A 1YIDA 3BL5A 1IQUA 1WXHA 3H97A 3CLUD 2QTNA 4NAHA 1O95D 4MUIA 3IUBA 1FFYA 4ZT5A 3D6VA 4X0EA 1P7PA 1U3DA 2HGZA 1QRUA 3FI0A 2A86A 1XNJA 4ZCSA 3OP1A 4UZFA 5TS2A 4XFJA 5DEOA 1ZH6A 2IELA 1U3CA 3IMEA 1OWNA 3ISJA 3H9BA 4PBRA 3SZ3A 3LOQA 3CLRC 5K0SA 2AG6A 1JIJA 3E27A 5KWVA 3FETA 2PZBA 1JEDA 2A84A 1J09A 4ZCTA 4MWDA 2ZUEA 1NUTA 4G6ZA 4HJRA 1N2JA 3DPIA 1ZJWA 1T6YA 2YWCA 2G36A 2EL7A 1MB9A 3HZRA 2HZ7A 3X1KA 2C5SA 3IH5A 4YBRA 4MVCA 2VTBB 2DXIA 1KP3A 1PG0A 1ZUNA 1EFVA 4S1OA 1N77A 1XNHA 2TS1A 4EG4A 1WOYA 1QNFA 3C8ZA 2RD2A 3KT0A 3INNA 1Q11A 3CVXA 4MW9A 3KT8A 4ZT4A 3ELBA 4CT0A 1IRXA 3G6KA 4MW7A 2J5BA 3N8HA 1OBCA 3M5WA 1MJHA 2HMAA 1Y42X 4EFKA 2PG3A 4MWEA 3CVVA 1EFPA 1D2RA 4TS1A 4R0NA 4EG3A 2A1TS 2QTMA
chains in the Genus database with same CATH superfamily
3FKSD 2I1WA 5IAEA 4ZOBA 5KWIA 1N6LA 4EFNA 4JXXA 2RHDA 2AF3C 2X1HA 3DEAA 3UMJA 1QQTA 3ZOZA 4FYPA 1IATA 1OZAA 4X1YA 1YTLA 3MD9A 4POOA 3O1LA 5KTSA 1YAJA 2O52A 2QN8A 2SKDA 3DMNA 4U7TB 3UUEA 4ZV4A 4EKGA 1AKRA 4G1VA 5CB0A 1J1UA 1SG9A 3S2GA 1UJMA 3RRFA 2WJ3A 1RABA 3H2KA 1Z7YA 1ZAYA 3IIEA 2IX3A 4ZIRA 1EWRA 1DWPA 1O57A 3RAEC 4ZTUB 2PQ2A 4ENSA 4O1IA 3ZWOA 1SCJA 2H85A 2FLWA 2YHAA 1UFKA 3M4YA 3PDJA 3PE3A 4PYKA 4RS4A 5CT4A 3S5UA 5IJWA 5KMGA 1R8JA 1Q83A 5A3SA 1S7CA 1A9QA 2FP4A 3LECA 2XVXA 3PIRA 2D0DA 1HE3A 3VYUB 1LDGA 3NHPA 3TN7A 4WUVA 2W7TA 5TARA 3TI7A 5C8YB 1EX7A 4OM7A 1Z4JA 5FRDA 621PA 2WT9A 2QQ0A 2YWDA 2O0JA 3ZHBA 2DE0X 3CNNA 1ZOPA 5KYWB 4H17A 3KJHA 4KXLA 5BN5B 1CU1A 4GUAA 1XMJA 1HPLA 1XZFA 1AS2A 3AKEA 3FYHA 4RJTA 3PX3A 2Q3JA 4JEHA 1A72A 3PPYA 1E98A 1Z34A 2DFNA 4A2CA 1WLSA 2YC4C 4RHUA 4UEJA 3T3DA 3HY4A 1ACJA 1NAIA 5K0BA 2FU5C 2PWAA 2YR0A 4AUNA 4DMGA 3MJVA 4K6GA 1XMOB 1M2VA 1XIVA 1FOEB 1I6MA 2H2WA 2YTZA 1X42A 3UYLA 3ZU3A 1D4OA 2XTMA 5DBOA 4A5OA 4DANA 4TKUA 4MEAA 3UT5A 5C80A 1GRQA 4PNZA 3KYCB 2G9ZA 3FRIA 2WG0A 3IODA 4R54A 3ZHQA 1R0LA 4GKAA 1OT5A 3IJEB 2JJ2A 3ROFA 1NN1A 2J41A 2BEJA 4WK4B 3SXPA 1S0UA 1V3VA 2XYVA 4JYMA 4RHTA 3VVCA 1PWEA 2DETA 3W78A 1PJLA 2RHGB 4R1PA 1PFQA 1HFWA 3RK0A 3DVAB 2ZM5A 3EEBA 4A6DA 5EFOA 5CW1A 5BV0A 4G0VA 4B3FX 5IT0A 3BICA 2IHNA 3CVUA 1E7WA 4IYJA 3QJ5A 4TTAA 3DQPA 1OUMA 2SKEA 5IAKA 4H1VA 2ACVA 2LTAA 4MW2A 4UMDA 1J0BA 3TTYA 2RAPA 3PX7A 4MVWA 2ZI9A 3FFBA 1KYYA 3PUIA 4IY1A 3C7AA 4RK1A 4AO7A 1CUXA 5E1OA 4X24A 2GILA 5EXSA 3PWZA 1T1SA 3C39A 4IEFB 3LLSA 4MWTA 3TQOA 5A0TA 4Q7LA 1ESMA 2CUKA 4MX8A 1XHFA 4DQLA 1GL7A 1ZH8A 4JV5B 4GU5A 3NIDB 3CKKA 1FFSA 3AVOA 3L92A 1JVSA 1JVNA 1GTVA 2O20A 1P1HA 1Y8QB 3VYWA 2ENUA 2PUCA 4YJKA 1EUCB 3EXHB 5FI3A 3JQGB 1PK8A 2WP0A 1GFSA 3ITDA 4CKBA 4NV3A 3LPLA 1FDIA 2VF8A 4WVLA 5DF1A 1KEKA 3HO8A 2J45A 2AK3A 4YV2A 2PKQP 1AURA 2OCAA 3TZQA 2CYAA 1ELOA 4FVTA 3OHMA 4QXOA 1WVIA 4JVLA 5F7ZA 4MICA 2CFRA 4GQIA 1ODLA 3AO0B 1DNPA 1M1NB 1ZEMA 3FSRA 4U2EA 3EVFA 4LTDA 3R7LA 2VUHB 5KYGA 4YQZA 4LRSB 4NX2A 2XXBA 4HLUA 3RYCB 1YQWA 2WNSA 3WLQA 3DG9A 4ND6A 4ER3A 4BGDA 1W30A 4CWAA 1XZAA 5AW1A 1ESDA 1NQWA 3CTMA 2R68A 3IAFA 3WBKA 4DG9A 4EW2A 1UFQA 3D8RA 3O8OB 2XUOA 4HNVA 3KWJA 2G82A 1HGXA 5AIAA 1L5OA 1XNGA 4PO8A 1H6BA 5HFNA 3EZ9A 4HDKB 1Z0JA 1FU4A 4DUPA 4PTLA 4O4IF 2I91A 2JFFA 2YQZA 1C3JA 2Q1YA 3LC2O 2XE8A 3BQMB 1ZD2P 3PC4A 5KYTA 2QAGC 3UWDA 4QVIA 2F8MA 1LBIA 4TLBA 5CJPA 2PD4A 5ALDA 1N0UA 3TJRA 2ZKLA 3BWYA 3QVVA 1G8FA 4FIDA 3SHWA 1U2RA 1SFRA 1R74A 2JAQA 1VP3A 2MYPA 3NAQA 2WT8A 3OQHA 4A9AA 4N3AA 4DM7A 2FYTA 4S2UA 3DM5A 4WPGA 3DDOA 2XRZA 4RD2A 3AL0C 3LBIA 4CIAA 1SCAA 4TTIA 3AT1A 4YV0A 2K4MA 3UJPA 2QL5A 1B3BA 2QZSA 2X5KO 3GG2A 3CUKA 2GK3A 3E9CA 3ZHOA 1NX6A 3ETEA 4RAQA 3V55A 3VU1A 3KZMA 1EDDA 3RBAA 3FVQA 3COZA 1NU6A 4ZPXA 2V6GA 1H2FA 1FFEA 1QU2A 4Y2HA 4GXNA 2PPVA 4F71A 2W5UA 5IMBA 3AVQA 3MK31 5FORA 5TMEA 2XMCA 4V2UA 3TXXA 1OX4A 4BTLA 4DCJA 1ZICA 1DFHA 5JSZA 1GPWB 2I2CA 2R1ZA 5BSMA 5TV2A 3NBMA 1LPSA 5LM3A 2FZCA 1D2AA 4JNKA 1Q3KA 1FJHA 4HGRA 4IDFA 4RANA 2YWXA 4LE0A 3JYLA 1BMQA 3L49A 3M1YA 2ZIFA 2J30A 4NMMA 4X1KA 4Y9TA 4HJXA 2H5JA 3TB6A 3RABA 4AB1A 1LH0A 5KTRA 4B85A 3CLSC 1FXWA 3R6DA 3RBXA 5TC4A 4GI7A 1L7XA 2QN6A 3LP5A 4IW3B 5F1PA 5FOWA 4NENA 4F6CA 3RARA 3HTXA 3LUCA 1X7WA 5KQPA 4AS1A 3AERB 4JENA 4X00A 2E89A 3OPXA 1B0UA 2W6ZA 2G09A 4KH0A 3OF3A 3BYZA 1S2MA 4UZEA 3B9QA 5IAAA 3ST7A 3DNMA 4ZCQA 3RJTA 4ND8B 3RKUA 2HSJA 2GTIA 4BNJA 5I7HA 2DR2A 4B73A 4FD2A 4GOXA 3TSZA 5ED4A 2X3FA 1L7NA 2IPLA 4DDKA 1LLFA 2AKAB 2P1RA 4Q1AA 2QYHA 4RVNA 5FFFA 1M9NA 4K81B 5B53A 1AKMA 3T9EA 3QIAA 3DMYA 3X44A 3WL7A 4EYSA 2E1RA 3TRJA 4C2TA 5JD3A 1G18A 4NYJR 4K6CA 5SZJA 1EYZA 4C4YA 1ULHA 2QN9A 4A2WA 3HRIA 2XGOA 3O92A 2GW4A 3KJIA 4JXKA 4Z3DA 4BFXA 4N54A 1BHQ1 2O3UA 1P7WA 3QX8A 2IV3A 1NRXA 1PV2A 4KEAA 4XUGB 9ABPA 2WU3A 3PUYA 3FDZB 3KU4A 3K6SA 2QUKA 3O74A 1JDJA 1KI6A 3EQ7A 4N8EA 1CJTC 1T8SA 1T9DA 1TUBB 1W4RA 1MB2A 1TTPB 3LT1A 1VPEA 1X1EA 3OPMA 4JL5A 4N5LA 4OP1A 4QBGB 3CZRA 3UJ6A 4Y6RA 3WLKX 2ZWVA 4Q9HA 3SHFA 4ZAGA 4AYWA 3LUFA 5CT5A 2XZOA 4I1IA 2QLTA 1N1DA 1UPBA 1QIIA 2OV6A 4ZCRA 4M1YA 2BKAA 2OE2A 4FZ5A 3V1YA 1UMDA 3U3XA 2ACEA 4I14A 3FCXA 1K0UA 4JUAA 1USIA 5TMDA 2QE7D 1H2XA 2C99A 4HYTA 5DB4A 3JQ6A 5G0TA 4GPIB 2HSEA 3DKRA 2Y9MB 3IOCA 1HRDA 2I29A 3WIDA 1KH3A 1QB8A 1CY6A 3NBAA 5DRTA 4ALKA 5I7UA 2JIPA 2FN8A 2XQVA 2KJQA 2QBYA 1XNQB 2ATXA 5ALHA 2BGUA 2EFDB 4EFLA 3IQDB 2ZRLA 5AW3A 2PD6A 5BYJA 5EE1A 1U1FA 2VBGA 2JDID 3WQHA 1IN7A 5KQGA 1KOGA 1G20B 2YS7A 2I4LA 3UH0A 5DI3A 4UOEA 2BW0A 2R87A 3DW1X 4Y2TA 1PFVA 4JYCA 4ZI7A 1FNBA 2IPXA 2H0AA 1UC9A 1ZRMA 2J32A 4HH1A 4QSMA 3BJRA 4CTJA 3K35A 1E77A 1U7PA 3DE3X 1V26A 3TLKA 3BDAA 4D6XA 5A4KA 3MQ4A 3KDAA 4UTNA 2FPOA 4IWYA 1EKXA 1Q77A 4N18A 1R6XA 2Q5IA 5EWJB 3KR2A 4GPEA 2DOKA 2ABWA 2FRDC 4J1NA 4R40A 3PQCA 4DV1B 2QM8A 1M72A 2MMGA 3PGJA 1NP6A 2CW5A 2CLEB 4OMFG 1I36A 1RHKA 2R1VA 4JB2A 5CX4A 1XAHA 3RWMB 2FSSA 2H6EA 3AB3A 1QQ6A 4EEXA 1LX7A 1KYVA 1PLJA 1E3SA 2OLJA 4B6FA 1POXA 3AHJA 3IHKA 4L22A 2IV7A 1SOMA 4E09A 4JLSA 2I2BA 3UUFA 1ESZA 3WK7A 5HG0A 2MJLA 4NCJA 4KPYA 2PMDA 1UQTA 3DZBA 1E9RA 1VKZA 1G17A 1UZUA 4NU8X 2E55A 1ZCAA 2DBZA 3SNKA 1L5LA 1BCRA 1XHEA 1FTYA 3D2LA 4HQ6A 1CJBA 4HXYA 4KUGA 2Y99A 1CY7A 2CUTA 3F2VA 3FJ1A 5FQNA 1L5YA 5LD2B 4NV0A 4U5QA 2WI8A 5G2FA 2WF5A 2XZPA 3E81A 1EJ0A 1WF3A 2ZRGA 4GPBA 1XVTA 4X7PA 1D2MA 2ZYVX 4DPKA 4BQNA 4WX2B 1QFMA 2OOKA 1N8TA 2XX3A 3FNIA 1SBQA 4Y9SA 4DB2A 4NAVA 5FJIA 1SQ5A 2BIFA 2YMPA 1QHHB 2GAOA 4ZMRA 5KNLA 2BGKA 1NY6A 5CCXA 5BPHA 4AJIA 2V7QA 1BXZA 3I05A 4JLMA 3IGFA 4WZAB 2Q6IA 3P9KA 4ZQCB 3FYUC 1A27A 1E2MA 4C7VA 5EMLA 1GGFA 1HLDA 1TPYA 2MINA 4XX0A 3UMVA 3W5IA 1M1YA 5C51B 3HVIA 4JVMA 4QFMA 4ZO4A 1U0TA 2ADFA 3ESCA 5DN6A 4BEWA 2SCUB 4QUGA 3UHJA 1QQ5A 2ETXA 4UUOA 5K51A 1QO7A 3JD2A 3CGWA 3USCS 2WPDA 1NNI1 1QO0D 2W2NA 3BL8A 3KSMA 4KMMA 1HE2A 3L7YA 3T3OA 5BSFA 2GJAA 3UJ9A 1KYIA 1M67A 1LTQA 1SB8A 3BH7A 4L8YA 2AUTA 2PTHA 2XUKA 4TSRA 1CQWA 2QRLA 2WE7A 3CRMA 4M83A 3BD8A 4EHDA 2RG1A 3AY7A 4BJ3A 2V98A 3FOWA 5JDCA 1PK7A 4CCYA 3NC1C 3R6WA 2E3JA 2I2DA 2VTBA 2XNCA 4CMIA 4CNQA 2GR9A 2PT7A 4UD6A 2P91A 4G5XA 2GPBA 4C7XA 3ZJUA 3CZCA 1ZM9A 4X8OA 3SKXA 4HNAA 2AV6A 1J8MF 3DWEX 5FBLB 1KMHA 4PZCA 2P1ZA 2ZB2A 2NW6A 3U6BA 1D0SA 4FUQA 2IODA 2WTUA 4HXEB 1DWUA 3OETA 4IKEA 2AOWA 2IZ5A 2PVSA 3F96A 4WCFA 3WO1A 2JGMA 3AVWA 4CPDA 1C3LA 4K3UA 5H68A 4AYTA 3ENVA 3HO6A 1V37A 3VR3A 2E9SA 3TUIC 1RI5A 4KP7A 4MGKR 3FTNA 1XZQA 5EJ9A 4MYRA 1Z33A 2HD4A 4BBZA 2WJYA 1N32B 2GPSA 2Y0DA 4O4LA 5LDDC 3AZOA 1M2JA 2WTEA 3BWBA 3DM9B 4GO1A 1T2NA 1U3CA 2W4QA 5KQLA 1JKFA 3LQQA 1K9SA 1Y3FE 3H9BA 1WD5A 3WQQA 1GYRA 1TF7A 1CNFA 3EWAA 3SZ3A 4YDSA 2YHSA 3TMAA 5EUMA 3MILA 3FMIA 1E7QA 1GAQA 4KVGA 4BQQA 3ADBA 3EX7C 2Q4TA 4ZVKA 1UWLA 4DBLC 1V16A 2WQZA 1Q0QA 3N6RA 2C8KA 4KMRA 4QGGA 3TFQA 1N6IA 3A4LA 1P0MA 2EJWA 3PNSA 2ZUEA 3QKUA 2C9ZA 2NXNA 5ALPA 1ZOOA 3CRZA 4I4NA 4OKSA 4CEHA 3S7ZA 2B4AA 1YVUA 3H5RA 1OJLA 4KTVE 1G6KA 1TZCA 3EOBI 4P4SB 3PRJA 2EL7A 2HNBA 1TKBA 3HPRA 3OMWA 3QHQA 4S1NA 4ZEWA 1R88A 1XXHB 1RXWA 1HI9A 4O59O 1UCFA 1V5EA 2BPOA 2XMPA 1U7TA 4L57A 4EJSB 4C7JA 1E2DA 5BSKA 5BWCA 2EW8A 2TMDA 2FEOA 4GZLA 3DE7X 2AX4A 1NBMA 3OC6A 4GP9A 1A4IA 1GLVA 2PZEA 2A3NA 3A1EA 3BDVA 4Z4FA 3W8EA 4UVHA 3TLYA 3AESB 2OHHA 2CVOA 1PCXA 1EUDA 2BRUC 1LPAB 1T3LA 2P2ZA 2VK4A 3NTUA 3NHMA 4EJ2A 1B76A 6Q21A 4W1SA 1ZLYA 2QY9A 2UUOA 1MR3F 3D3NA 5KJCA 4RK4A 5FTMA 1OLUB 3I9JA 2IXEA 1NY5A 2VPZA 4AY5A 2J5KA 2A3RA 4K05A 3RKSA 5JG7A 1QHHA 1L4FA 1V1RA 2CZQA 3FRHA 3UA4A 1F3LA 4N7RA 1G8SA 3SZMA 2FW6A 5AHOA 2QK4A 3DTTA 1F2DA 5GINE 2A1TS 1BGVA 6ADHA 5FB3A 3SFVA 1L1FA 3A36A 3B6EA 2NTJA 3DZKA 3ZWCA 1L7VC 1QQBA 2DU8A 4QQFA 2QR5A 5C1IA 1GPYA 3CJQA 3KR9A 3RS5A 1QOPB 4YJHB 3VA7A 2F1JA 3FW1A 4AK9A 4ERNA 3VOTA 1O6CA 1UIMA 4R16A 4PSKA 3D3EA 5EJFA 1VBKA 3CNBA 3IAS1 3JYOA 2BBOA 5TQ0A 2NUBA 3FWKA 2Q6TA 1KZ6A 4KK3A 5F23A 3JAKB 5EJEA 4Y6QA 2XUHA 4CKWA 1V6CA 2IKSA 2YN4A 3JQ7B 4O4HA 4TTTS 4RPJA 4YMIA 4UVDA 7MDHA 5JS7A 1O03A 1Q44A 1WVGA 3Q5EA 1TIBA 1OMOA 1MO2A 1XCPA 1SHKA 4D4KA 3QVGA 1FVHA 1HE8B 4QQKA 4MUJA 1M6VA 4TTRA 3VTKA 4MO2A 2X8BA 5L51A 1GPJA 4MARA 4XFDA 4OX9Y 1TVCA 1RXEA 1V5IA 4PRLA 3TTVA 1ML3A 4TVKA 5FNVF 3CRVA 2BZ0A 2AN9A 3OZSA 4G4GA 3LWBA 1K7EB 4HPWA 4K28A 1LS1A 2DGDA 4UPVA 4BDSA 1EE1A 4OBEA 1AKYA 2AR9A 5FFMA 2AOXA 2HMYB 2J9YB 3RYIA 4CG1A 3O73A 2ZSBA 3EN0A 3HYLA 3RAJA 3T1HB 2B20A 2RHHA 1SC3A 2A6PA 2XW6A 2Z09A 3PF9A 4FYMA 3RD5A 1PO7A 5JANA 1JEQA 3JZIA 2V7BA 3CNHA 1TQ2A 1W35A 3E9ZA 3GDGA 2AC7A 3HU3A 4KBYA 2FEAA 3RTGA 3WWDA 5BOSB 1KZ7B 3UY4A 1C4XA 2JCVA 4J0CA 5C8XA 1C7FA 3I0ZA 4B4VA 3AXTA 1AK2A 3GJ3A 1DJOA 3I9FA 5CG2A 4ND8A 3E4DA 1YJXA 4NBSA 2OZEA 2XB4A 5L9AA 2AJBA 1E5DA 1TCBA 3PRYA 3SM3A 4IF6A 4UARA 5CXQA 3SK0A 5CDFA 2H1WA 3N0VA 4O4JB 4OBXA 4LXYA 4RKWA 3OPYA 2X22A 3BN3A 3GJ7A 5CURA 1X13A 3H7AA 4MRRA 3IB6A 3MJSA 3N3BC 4JA0A 4JDPA 4O4JA 5LP6B 4WADA 3W5BA 1HORA 1PIWA 1XWFA 3GBPA 4PTYA 3S1LA 2I6QA 4RVSA 5LA6B 3LXRA 1KYZA 5LXTF 1F2TA 2ZVDA 3ZXSA 2COKA 2OYSA 4A3SA 4J0EA 3JV7A 4C1BA 3THYB 3LF2A 3V3KA 4MVJM 3HDHA 5ALSA 1HK7A 3KX2A 3N3AC 1DQZA 4JYPA 1ZD4A 3IUNA 2QT0A 2I7VA 5CK4A 1C1DA 1NOKA 2BL4A 2BY4A 1CUCA 2J3LA 3DEYX 2C2ZA 4JLOA 3ND5A 4XIYA 5LCXA 3VI3B 4DL9A 3A3OA 1K3FA 1L1RA 2PX0A 2XE7A 1F4VA 1RBYA 2VWGA 1TYAE 3MD0A 5AK0A 2O2GA 2XD4A 5C31A 3F74A 1QGDA 4JQSA 3GJRA 3IEKA 3C3PA 4QULA 3NCHA 4WNYA 4Y7DA 2CDNA 4R2IA 3D0QA 1YDWA 2REXB 4RLSA 1UP4A 4KBGA 1SRQA 4U6QA 2QTBA 1NXVA 4WKPA 3CRW1 5MDHA 4WLOA 5AM4A 2ONKA 5E4FA 4M7WA 4Q4AB 5JQGB 2Y1GA 3H6HA 5B58T 3EVZA 4EY7A 3EW7A 2AI3A 3DBLA 1X0XA 1YRQA 2HPZA 3AF4A 3NEAA 1AQIA 2P9CA 5JXGA 2DUNA 2WA1A 4Z9AA 1ODIA 2PGOA 1WKCA 1XTUA 3GCXA 2W2LD 3RRMA 4D6PA 3AR7A 4BN4A 1R64A 5SY4A 4R3WA 3QI2A 3P32A 4K6KA 2A9FA 3VNAA 1THZA 2XXAA 3SYLA 2J5XA 4GH5A 1OFUA 2V7UA 3J81A 3VR2D 4DE5A 5BMVF 3PXGA 5FWDA 4UTOA 4P9NA 3FTCA 4U2KA 1AJEA 2XF8A 1I1NA 2ZYSA 2QUBA 3ONEA 2OXCA 1JLLB 3L7DA 5LYYA 3V46A 3WTCA 1JKJA 3GFTA 5SYNA 4E1AA 2IF2A 2CDAA 2JFUA 2GERA 5BSGA 5A5FA 1NW9B 3CUSA 5KHOC 3UG7A 5LZ7A 1VA5A 1DT3A 4H0NA 4HXGA 4EW3A 3GFSA 1NURA 1U1CA 1XEXA 1X1TA 1X6VA 5CHYA 5DNEA 4IM7A 3WL3A 1O8BA 1RU3A 2GM9A 3IMGA 4CTKA 4XJXA 5JJKA 1H0RA 4M1ZA 4Z4GA 2OAQ1 3DAFA 3OCVA 5GJBA 4KXWA 1HOXA 2H0RA 3LNCA 4QD3A 4RSRA 3VR3D 3FWNA 3VM6A 2P3OA 1WCIB 4IHQA 1Y6JA 2C5LA 1SZPA 1QH8A 3RYFA 4JXZA 2YWGA 4MIOA 3ZGOA 3NC0C 5A9SA 1OIWA 3DHEA 3LBHA 3THWA 1WSBA 5CM9C 3C4VA 3ZJ4A 4IVPA 4N01A 3RNLA 2AFHE 3E9YA 1JJIA 4D3SA 5LD2C 4PGGA 4B4UA 1XVLA 4JN6B 4ID3A 4MJLA 6LDHA 3TI9A 1RMQA 4EELA 3ZKWB 1BIFA 3DBOB 4JUIA 5DH9A 5AUPB 2QIOA 4QU5A 5H8WA 3V4OA 5D1HA 2W2TA 3U7HB 4ON9A 3JRNA 2ZI3A 3SJAA 1QGUA 3B7GA 5B2EA 4QOSA 1HRKA 2EGGA 3Q0IA 4OOFA 5CVEA 4NWIA 4JQYA 1B26A 1GARA 1E9BA 3DV9A 2A88A 1T8UA 4QRIA 1LWNA 3VSEA 3PUKA 4J3NA 2B78A 1P9NA 2QN2A 3OZTA 1NIPA 3GFOA 1QO0A 2WPDD 3I72A 1KVSA 3NPAA 3QJYA 3A10A 4IGKA 3AR6A 3MGGA 1NYTA 4XGKA 2IYVA 4EUEA 3T5TA 1V3QE 3O21A 3DEJA 2CEAA 3B89A 3I8OA 2BGRA 2DMRA 5AKIA 1N8NA 3G2KA 3FZYA 1KSJA 4CM9D 4JT9A 3K09A 1DBPA 2ZAYA 2FUNB 3SEZA 2FKAA 4WCDA 4H7JA 2HU5A 4MLDA 3UT5B 3KG2A 4Z9FA 1IQPA 4LV8B 1JIVA 1ZQ1A 1GUDA 2J7PD 2PH7A 3CB4A 3K0AA 1VIDA 2EJCA 3KQVA 4G8BA 1WV0A 4IMJB 4TS9A 1KOLA 1RVV1 4MYSA 4E7OA 4TKVA 1JLLA 2DSNA 2PUEA 1CRPA 1ULBA 1XTJA 3AHEA 4PPNA 2ODEA 1JEOA 1S8AA 2RKOA 2WSLA 2J87A 3MJRA 4LBWA 3WLOA 4YRPA 1S1MA 2QUZA 1ADJA 1XMVA 2DLDA 3F5QA 4FK8A 1PTJA 4JL6A 1F5SA 4CMIB 3PTAA 1NR7A 2JI7A 2F48A 3FPCA 4F2PA 2IHYA 2O8EA 3R4CA 4A0FA 1ZM4A 1TCVA 3SJBA 2UUBB 3PA6A 4MHSA 4YCSA 1U63A 2BCEA 2HNKA 1KAEA 3HYTA 2J5RA 1ZNWA 2D6FA 3N87A 4E21A 3VTZA 1FX0B 2QZPA 5U9CA 4HVCA 1ZN7A 2N46A 1XDGA 3GUUA 3N76A 3TOXA 1U5BA 4KR3A 3KS9A 1QYVA 5BN4B 1G8PA 1M73E 5CK5A 4NULA 5B58C 5HKOA 3I6IA 2PE5A 3OOYA 4UTXA 1WUHS 1E3TA 4FD3A 4JUDX 3D2BA 4WY2A 1YZGA 3QUTA 4AMBA 2JJMA 4JLJA 2LXNA 4PU0A 3H9GA 4MS3B 5LA6F 3RUHA 3NAGA 2IXAA 1O0SA 3P9IA 2CEKA 4DMKA 2CKMA 1G6Q1 2XODA 4F4HA 2BCJQ 4Q6WA 1O97C 3KWFA 4Q9NA 1W88A 4RA6B 5FJJA 4DIFA 1RBZA 1Y80A 1N6OA 2Q46A 1P2TA 2QX7A 4LDAA 4UM8B 2R6ZA 1Y48E 2YZ7A 1JN0A 4EQ6B 1L5WA 4EBBA 2BI7A 1P6QA 3UNXA 1HNZB 1O6ZA 4HI0E 1KFJB 5CVTA 3TEFA 2FH5B 1D3AA 2IYYA 2OAEA 3KQWA 3ZJYA 3HK2A 3ANYB 2R48A 3G5UA 3G5LA 4QVKA 4B3CA 2RGNA 3BIFA 4L2IB 3SOPA 3FOFC 1X8XA 2HDOA 2OBMA 3A25A 1F1BA 1LNSA 5EJ4A 2P9YA 3K1AB 4K9QA 2CWWA 3N2YA 2J4DA 3A28A 4ZI7F 1R0YA 5J4KA 3L0SA 3UK7A 4V02A 3EARA 4NZOA 1UADA 2YNMC 4ERXA 5IAGA 1NW4A 1G5HA 4PINA 3I01M 1UBKS 4YJ3B 3PQ4A 4ZQEA 3PXBA 2CNDA 2JS7A 3D0RA 3JVVA 3U1TA 4HQOA 5ADUS 4W6ZA 3D6HA 4KLRA 1NVBA 5KNBD 1A7AA 1XLUA 2PL9A 1MO5A 2BGTA 1Q91A 2SKCA 3AFMA 4V0NA 3BXPA 2QP4A 4IOJA 4E12A 1JFVA 3NLLA 3PICA 1V4BA 3H5AA 1IM2A 5B37A 3TZ6A 5BSHA 5BT9A 3NYQA 2Z9DA 4LWOA 2RKWA 3HU5A 3RIHA 4A0QA 2VG8A 4RD4A 3NFYA 1JEYA 2CFIA 4B76A 2QKYA 3U44A 4GKBA 2ECPA 4HMPA 4ZMBA 1PV4A 1GTSA 2FSHA 1NBAA 2FSFA 2R7LA 4IXTA 3AHGA 1T10A 2G71A 4YRCA 5J63A 3VZBA 1ATIA 2R47A 4HN4B 3K0KA 2ISSD 2PA0A 1IUPA 4MDEA 2H2GA 1LVHA 3KPJA 2A78A 4DCNA 1KJWA 4F6RA 1SUCA 4UAGA 3SJCA 3EC7A 4H6PA 4PLHA 3HYSA 5DM2A 5AW8A 5KINB 5KZMB 2JG3A 2HMWA 2GPNA 2QP3A 4FOOA 1FQOA 2DT5A 4IGIA 3CBGA 4E2FA 1IJKA 3H3XA 3CZ4A 2Q6VA 4TTPA 3L43A 4IVRA 4P1ZA 4R7TA 3JAKA 4EO4A 5IZ4A 4WA7A 2PO5A 2DHQA 1UMKA 1A9XA 4A8HA 5IDVA 4ARVA 1E4YA 1AQYA 3VBCA 4QDKA 4PN3A 3DTNA 1ZD3A 3C6BA 4DSOA 2OR3A 5FI1B 5AVQA 2GK7A 4PQRA 2YWRA 3DBHB 2Q2QA 1V47A 4Z86A 4EGJA 2BP7B 5EZ5A 3CE6A 4EWLA 4RMNA 4PZDA 3OLVA 1CEEA 5GJVC 2A7XA 5EIFA 3I23A 4DY4A 3KSUA 2AS0A 2FSGA 4NCHA 4LFBB 2EZ9A 1OFTA 4XWWA 1T25A 4QDTA 5HX7A 5IP5A 1JFRA 1UK6A 3SGLA 4GWGA 2C9YA 1CUDA 1V6AA 4CIDA 3JAWB 4WDQA 1F3OA 1U8YA 4I2VA 3A6HA 4IJ5A 4FBMA 4JJ6A 5EIAA 3E22B 3HNOA 4Y6GB 4HFRA 2NU8B 3ADKA 1XRPA 3HFSA 4JP8A 4QGHA 5AI5A 5FPPA 2YJ6A 5FBQB 1NM5C 4PZ0A 2O0LA 1ISJA 3OE5A 3U7IA 4BYMA 3QMMA 5DZSA 4G89A 1G4HA 2IK8A 1TF2A 4J90A 2X13A 2W2VA 1QKJA 3D7KA 3L8GA 1XVUA 2X86A 4JSYA 4P33A 1VTKA 2WJAA 1IK4A 1WULS 2RE8A 4YUWA 1VSVA 1NMSA 2ZK7A 3G8DA 4K6OA 2VDWB 4MI1A 2RGYA 4Y6LA 1PEAA 3GF4A 3ZCPA 3UAZA 2GD0A 1ZH4A 1ZN8A 1GOTA 2HGZA 2OORA 2QTFA 4LNUB 3FCUB 2AX3A 4QUAA 5B1SA 1QRUA 2BR3A 4MNTA 1V0JA 2RC6A 1BVRA 4UZFA 5BVHA 1NULA 2CLMB 2CZGA 4Q9JA 4FONA 5SY9A 3AM4A 3AP1A 5IAOA 4JI8B 4NJMB 2QD5A 1EFLA 5SZKB 4QUHA 5IC5A 3U60B 4FNMA 2X5XA 3QUSA 1V3UA 2JASA 1YA6A 5J4YA 4BP3A 2ODNA 4FR5A 3T8YA 2A30A 2XSZD 1D6SA 5AVRA 3L8EA 4QXQA 3KYJB 3I5MA 3HLTA 1QF9A 4XYLA 1EGHA 3G8YA 4JI4B 3U7QB 4YRAA 4Y3UA 3N86A 3SE7A 1E1RA 3L05A 1TT5A 4RWZA 4KJZA 4FXOA 1X39A 1WXQA 1FSZA 5LSAA 2NVWA 4G1FA 1BEZA 2PKWA 3DTVA 3GLHB 5KSOA 4YP1A 4QNRA 4CF4A 4R6WA 2ZUTA 5H59A 4BKMA 3FYUA 2P62A 2NO1A 3N39C 1L7MA 1Z62A 2V9PA 3KTFA 3L8HA 4LZAA 1CVRA 3T4PA 2OTCA 3OBIA 4DUZB 3B5JA 1N77A 4CI9A 1Y7LA 5CA1F 3FKQA 3RUDA 2D7JA 4C43A 1F8FA 1X1SA 2RKBA 3BPSA 4BDTA 4MVJH 2J0SA 1T36A 2G9QA 1MF7A 3FCCA 3K6RA 1E3WB 2HX1A 2QV0A 3HJNA 5MFPA 1J5XA 4BN5A 1NPYA 1SCBA 2ODPA 4RMIA 5KX5F 4EVRA 1F9EA 1VJCA 2DKOA 2NAPA 2IU3A 1TLLA 3CWZA 3OSZA 5FPQA 3U4AA 2RK6A 3JZFA 4TGLA 5I5GA 4JOBA 3UFXA 3VH4A 2ZJ1A 3MOSA 1L8OA 2A8YA 1XJ0A 4U4AA 4BQFA 1YA8A 2ORYA 4P82A 3WSVA 1TJYA 2PUAA 1H9CA 3V2HA 4D8WA 1BEUB 3ZZUA 4EEZA 4Z7NB 3ZJ5A 1B43A 4DUYB 2R86A 1VFPA 2X9GA 3WS7A 5I7FA 5ALUA 4QUEA 5EYPB 4YRNA 2G6BA 3CBQA 1GZHB 1ULZA 3G89A 3H9QA 1QPGA 3JPYA 1AN0A 1YDEA 3K72B 3UPDA 3VYSB 4ETMA 2XUIA 2BFNA 3K05A 5AVYA 2CNOA 1O77A 3REQB 2W8BA 4FFSA 4I3FA 3DBHA 3DMDA 4NZMA 2WHQA 4UFOA 2C5EA 4KE9A 2AD5A 2JGDB 2JD1A 3N5CA 4C2BA 3TX6A 2WJ4A 3O9VA 1ZP6A 4JP2A 4IGFA 4TN5A 1EXVA 5G3YA 5IVKA 3FMFA 4CYMA 5KYNA 3LTNC 3HV0A 5AJTA 1CHNA 3PE4A 4PAOA 4KR6A 2JGRA 5JAPA 3SF0A 4RVUA 2F3RA 1NUUA 2JCXA 1YZHA 5CJJA 1XZBA 1KVQA 4GZMA 1NATA 1AHPA 4ZHQF 4IJVA 3PR3A 4J0KA 3DFFA 1N3LA 1O96B 1Q57A 3D2AA 2XD9A 4UXIA 4DCCA 4QPJC 1XPUA 2V3WA 1MQ8B 1PZHA 2A5LA 3G0BA 2PR2A 4P4TA 2ZI7A 2QGZA 3A1CA 3U4DA 3RR2A 5FA8A 4D5EA 1YMUA 4O5OA 4OFWA 2HU8A 3K92A 4D96A 3PLNA 3RANA 1VL2A 2ZIUB 2ZSFA 4FHGA 1C1XA 1T5IA 2GAAA 2Y71A 2G07A 2Q07A 2IEIA 3AY0A 4MV7A 2WTNA 1J23A 4G1BA 3TIVA 3JU3A 4C7BA 3NM4A 1SY7A 2Q9BA 2WD8A 3I9MA 5AKLA 4EUFA 4HLCA 4ZO8A 2P2DA 4Z0PA 4EGQA 5B6JA 1VZ2A 2PANA 3QBTA 3CIOA 4B3MB 3D3QA 4HGPA 1PVDA 1H23A 2FFRA 3CM0A 3KB1A 1YIAA 3ACCA 4KQHA 3BFVA 2CVPA 1NL3A 4QBTA 3HHPA 2EARA 4M36A 2V97A 4AP9A 3LX8A 3PVZA 2DUWA 4S1TA 1D9ZA 1E2NA 4M89A 3OQOA 2IFTA 3KXIA 2Q28A 2QQFA 5JAOA 3WXBA 3G2MA 4ZI2A 2ZSIA 1Q22A 4TXNA 2YCBA 2B4KA 3TM5A 5BR8B 3ZTTA 1N2CB 4RH0A 2OG2A 3JQ7A 4O4HB 1N9KA 2DKFA 1RRGA 2IU6A 4IIYA 2VJDA 2HLNA 3DCYA 5JSQA 1Y4DE 3DO8A 3OZGA 3KTAB 4R1NA 3PZBA 4MRNA 1R6AA 2YINC 4JYZA 1P3JA 1U8UA 3PTZA 3WKEA 4YCBA 2HRCA 1E69A 4KDEA 3CH6A 2IEDA 3AJRA 2UV8A 3ZJTA 1PR6A 1YB4A 2CXXA 3IUPA 1FDSA 2QW8A 1OC4A 3MWEB 1W5BA 3OUZA 3PQ8A 3QF7A 4Q7JB 4PG8A 4Z49A 5CFOA 4R8SA 4B40A 5JSKA 3KXLA 2QTWB 1IMOA 2RH8A 2G2SA 2WY2D 4D9GA 3FMGA 4KODA 1ULSA 5G53C 1J7KA 4LJKA 1Z2NX 4DMRA 3VGJA 4NXMB 1I94B 2ZJZA 4ZREA 2NU6A 1JDBC 2XPCA 2H0QA 1PNQA 4LXUA 5H83A 2Q1TA 4GWKA 4BRZA 1YQDA 3DLAA 4R51A 1LCIA 3AJ8A 4PCUA 4X6UA 4IR7A 4N39A 4PLCA 5A6VA 2XZLA 4TMTA 2UXDB 3IUSA 1FP6A 3IE0A 4WKCA 4Y9DA 1ECFA 1FFCA 2EHJA 3LC0A 4GSKA 3DHWC 1DLIA 2OHIA 2RAFA 1GL9B 4G26A 3L6BA 5TT0A 4IJQA 1JQJC 1VE5A 3BMNB 3D31A 2WWYA 13PKA 4TV9B 4E5PA 1FFDA 3CH4B 3Q11A 4G4SO 1AXEA 3EFHA 1TZJA 5HS6A 5LNK1 4DV3B 3I39X 2HTEA 4KX5A 2A9QA 2HSZA 3TGPA 1P2VA 3KUXA 4C6TB 1WM1A 3FROA 1NMQA 1CUFA 1XRRA 2BFDB 16PKA 5DCWA 4MS4A 5EJMA 2O8FA 4RNCA 5H16A 2FWPA 3U13A 1TCCA 2E1PA 2F4NA 1J6UA 4OBWA 1VMKA 5JV5A 4MKFA 4P3XA 4AMYA 9ATCA 5KIAA 3ILXA 1UMDB 2WIJA 3GN2A 3PQ6A 3GLIE 3TLMA 3EXFB 5C2JB 4EPVA 5KVCA 5LZ5A 1MPTA 5HQJA 1E9CA 1F2UA 4PZEA 3IJPA 1Y34E 3IRUA 2ZRAA 4P2GA 4QELA 4FFNA 2BBWA 1UBOS 3UMBA 5BYAA 3U7GA 1FIUA 2V58A 1NKTA 2OUIA 4Q3NA 2P1DA 3K31A 2L0XA 4I1PA 1YULA 2ZQYA 1BVUA 4WWHA 4QYTA 1BROA 1CS4C 1JZQA 1Y3CE 2GD6A 2UZ1A 1VBFA 4QFBA 1UAYA 4DYDA 1JDVA 1KI8A 5IVDA 4W5TA 1JBKA 2A5JA 3AK4A 1RQLA 4AMUA 3ETLA 4XWTA 3NRBA 4B7UA 4MQBA 4DQ0A 2CGEA 1F8GA 1GT91 5B7QA 3ONDA 4ZO9A 1XCLA 3A04A 1P1FA 4IV5A 4OD0A 4L50A 3SHTA 3OKFA 2G08A 2MSCB 3VR5D 2XKAA 5CUQA 4B48A 4FWIB 4JBLA 1RKUA 2Y66A 3BE4A 4ZAFA 4A91A 4LC0A 2V7EA 2G1PA 3E5MA 4C5BA 2OCKA 1TO6A 4EO7A 3A9RA 2OCDA 4GX2A 3TWOA 4MV8A 5KTMA 1Z4QA 2H07A 1ABEA 1Z5NA 3GEHA 2WIDA 3UGQA 3UTCA 1T43A 2VTDA 2F3SA 2SBTA 5C18A 1B15A 2XA9A 5L4SA 4Q3AA 3TSCA 4UPEA 4TWRA 4GI3A 2NSLA 5E7IA 4AZ3B 5AHXA 4FNGA 3L7MA 3R7WA 1VRCA 2WIBA 5TR9A 1NBME 2FK8A 4JT8A 2X41A 1OZFA 1FTWA 2X3YA 4R1QA 1P1IA 4CFZA 1YK0A 3B6ZA 2OBYA 2QG9A 3A7EA 3DBLB 3JYHA 3OQPA 2QTVB 3P9XA 4CM9A 3EZFA 2P77A 5JH7A 3DTVD 4P3NA 3HP4A 4KSCA 4D9BA 4KFCA 2ONJA 2RIPA 3ZD8A 4E88A 1ZXBA 1CUUA 4YT5A 2F00A 4UVEA 2I1VB 5FPKA 1KP2A 2ZT7A 1WDTA 2K87A 5I9TA 5HKLA 4MW6A 3IKLA 1RM4A 4J7XA 2PA3A 3PFNA 5HUQA 1JE1A 4O8CA 3LX6A 1NN0A 5GAJA 3RCBA 1DBWA 2H1VA 3LPMA 4LA4A 1EMDA 2C2OA 1NVWQ 1JXAA 3NT5A 4XA8A 1VE9A 4TLDA 1AM4D 1AKQA 5ABPA 3L84A 5A0VA 1E32A 3KBOA 4P93A 1CIJA 2HWUA 5EYPA 3RIXA 5DTIA 2TECE 3IMCA 3F7OA 2I8LA 3WL4A 1R4NB 2DX7A 2HO5A 5JNUA 1H6AA 3O3NB 2B36A 4WNAA 5JBNA 2PBRA 2BJVA 2AVDA 2WHRA 1TCUA 3RUCA 2HF8A 3PCRB 1QP0A 3RS9A 4BO8A 1BCRB 3V48A 4AZWA 1C30B 1WY5A 1X1AA 3ZZ1A 2ZSUA 1XXLA 4LDPA 2HRBA 5AHWA 5ECDA 3VPSA 1WWKA 2BTEA 3VOAA 2EWMA 1SBIA 1Y4UA 4HPXB 4EI7A 4BMYA 2H3HA 1T9CA 3R6LA 4QPCA 4R8VA 1CUAA 2GPYA 4TMWA 4JVSB 3UHFA 3CFIA 1GHTA 1PBNA 4ZEOA 4RA9B 1H05A 2RK3A 1KSFX 2ZWMA 3O03A 1PLKA 3P5SA 3TM4A 3KJEA 1M6YA 4HVTA 2JFXA 4AZ3A 4X41A 3ZOKA 4Q4JB 2ISQA 1GN9A 1M5RA 4Y2JA 3R3VA 3PDCA 4H7IA 3A6ZA 5BY2A 4TVBA 1A71A 3F97A 3P0IA 4GMGA 1V8FA 2JAOA 3JQFA 3NPMA 4MKIA 3VR6H 4EG1A 4V1CA 1OFIA 1EFUA 1UPTA 3B1WA 1NAHA 2JZOA 3ESZA 5C8VA 4DBVO 4ZVTA 2YH2A 1R3UA 4B4OA 4RQAA 3PL5A 3HV2A 2DCMA 4CLHA 1XT6A 4KQXA 1ECJA 3PDIA 2W37A 3AKDA 1KQNA 4UHEA 3SXUB 4CETA 4ZI7B 3SQDA 4YXWD 7MHTA 1EX6A 2G28A 2Q1SA 1SIOA 1TA4A 5LUBA 5BSVA 4QXAA 2VNSA 4YUXA 2B8NA 1U0JA 4MINA 3OT5A 2YJGA 3EZ2A 4WLNA 3F5FA 2FPGB 3N2GB 4NEGA 4UHDA 3A2KA 3H9JA 1E7MA 3QTTA 3PC7A 3U37A 4AIRA 4P22A 4E5DA 3G2QA 2DY0A 4AROA 2R4TA 2JC3A 3V8MA 4WZBE 1OAKA 2LCIA 3CF4A 3KCNA 3KT6A 1B6TA 1GVNB 4LISA 2QMZA 1QFJA 1Z15A 1RJ9B 1XZMA 1BCSA 3H4IA 4EY4A 4RDXA 1AQNA 1KJIA 3HVUA 2MYUA 3F78A 4J03A 5ICMA 4DRZA 1ECGA 1S5PA 3UVEA 1GGHA 4RZHA 4WNCA 1XDBA 2HJVA 1RJGA 1YVEI 2XAAA 1NXQA 1Z82A 4GPTA 4RIIA 4MQ4A 5EXDA 4C30A 3BT7A 1P5JA 2GDZA 4ITRC 4ENWA 2DWOA 4G5YA 2XWBF 3HY3A 1C0PA 2PR7A 4W7SA 3CRRA 1PQ4A 4DCGA 3ND9A 5K0CA 2QX4A 1Q0SA 2P8JA 3CW8X 3F3YA 3W6UA 2OGWA 2JRCA 5IG2A 3TZLA 1G8YA 4J4BA 4X44A 1EHIA 3QOWA 3QXXA 4HTFA 4LDRA 3I5XA 3CJRA 2AC2A 4TM8A 4YVFA 4DRXA 4UTVA 2GZ1A 3HN6A 6CHYA 3ZGLA 3ZLJA 3HB1A 3WKBA 3MWDA 2EFJA 1KQGA 2C04A 5F9HA 1DPFA 3V4PB 4ZC1A 3KJGA 2OZLB 3Q2OA 1LZKA 1ZK0A 2IUSA 2R5WA 4RFSB 4AL4A 1CZHA 1XI2A 4GD3Q 5AKJA 4ANFA 2GBIA 5BSWA 4EZIA 2R66A 2VDUE 4B2PA 3USES 5DNCA 1S2NA 1TF5A 1IN4A 5AM5A 1W85A 3SYKA 3T5DA 1UK7A 3TW4A 4ER0A 1UDXA 3WMFA 5I4KA 1E1QD 4JMPA 5AXCA 1M2KA 1P5RA 1MEJA 3FM9A 1I2ZA 1M7HA 1BMTA 2O06A 3MAGA 4AKIA 1PUIA 3P9RA 1BDHA 2BEKA 2LBPA 2YHIB 4F97A 5B7NA 1AQJA 3COYA 4LXGA 5C5EA 4UHBA 4JLWA 1T9KA 3AVXA 3F0TA 2VZ9A 3RSQA 4M1MA 4UMVA 2FQ1A 2Y2VA 4BVHA 4EX7A 3P9SA 2IHBA 2PRYA 1XTKA 4G0NA 3F9IA 1JJFA 1I14A 1EFPB 5DT2A 1IHDA 2PM8A 3HUFA 1HKUA 2HEGA 1V8ZA 3G2OA 1YBMA 4MS3A 3O8QA 3D6MA 1FP1D 4YC7A 3T9AA 2V03A 4JSRA 1OBHA 1I5RA 2V9CA 2PGAA 4OO3A 4B43A 5JFGA 4OPMA 3V2GA 1HMYA 4P7KA 5KTPA 3EJ6A 1O1YA 3G8BA 4NBRA 2Z08A 1F5NA 1CIVA 5LPNA 3LQYA 4KWHA 4PQGA 3HBJA 3KOOA 4PBSA 3G0OA 1EP2B 3MWGA 1GTG1 1IHPA 2CHVA 3HDVA 1F38A 3Q2IA 2P9BA 2C9CA 1T0HB 2ZJ5A 3D4IA 3EB9A 2OXTA 4B87A 4DT1A 4M1KA 2I55A 1U3DA 3MN1A 2IWHA 1GG5A 3NBQA 4HBGA 3JZDA 5K0NA 4EUHA 3Q98A 3W1VA 5B7PA 2FFQA 2CJWB 5HRAA 3CSUA 4OLFA 3PHIA 4LYFA 1H9AA 3LHSA 3NO4A 4OYHA 1QQ7A 1EXNA 3D4BA 3NOXA 3QVGB 3HWX1 4JKIA 2QMEA 2ZIAA 4UEWA 1E9SA 2JZNA 2XWPA 3EG5A 3HYRA 5ICCA 4BB6A 4HMOA 4X66B 4V0QA 4P38A 1JPUA 1FSSA 1SK8A 5JH7F 1DG9A 1VE7A 3NFRA 4I5DA 2JIOA 3G68A 1MGPA 4TKLA 3EVGA 4UCWA 1P5ZB 3ZDAA 2ZANA 4W5HA 2HK6A 3GFFA 5CNIA 1YQ9A 1TVMA 5DYIA 4DC9A 2YMQA 3FPJA 4LDJA 4KRFA 1JALA 2XZDA 3LDHA 5AO9A 5NLLA 3ZD6A 1VIVA 4YBRA 4RQTA 2I9KA 2DTXA 3IDSA 1M1YB 4OQPA 1YFLA 4CGZA 5E4TA 1KP3A 1CERA 3ANMA 5JZMA 2EJVA 4FX2A 5CLQA 4QWWA 5GGYA 5H9WA 3RU7A 1ILWA 1NFFA 1KS2A 2Z8YM 2C3MA 1T3SA 3PHCA 2ZSJA 1O89A 3QX7A 1DAKA 1HE1C 2W8BB 4MW9A 2B94A 4G1CA 4HNAB 3REGA 2ONCA 2GXUA 4X7BA 4EABA 3JPWA 5BWMA 4IUYA 2WD9A 1B1AA 3NVAA 1L5GB 2UZ4A 3B13B 3GX1A 2G04A 3RBVA 1Y42X 3DNPA 3OESA 1VL0A 4AF8A 1NW3A 3OZBA 1ISMA 3VBEA 3ZLVA 1EP9A 4E2WA 2DFDA 1XZGA 1T0UA 1O4WA 4M54A 5HMMA 4DAOA 1DHRA 2VRCA 4PFJA 3W04A 2FG7C 1H69A 2V7WA 4NZNA 1NJ2A 4GOND 4UQLA 5FF9A 1P61B 1G8HA 4QAJA 1BE8A 1ZISA 4PLVA 2XWQA 4YJ3A 3HP1A 1G0OA 2PL5A 1ECPA 2AR7A 4MRVA 1DDOA 2Y93A 4QECA 1E0DA 5EIBD 1QHIA 1QHNA 3T12A 4FGWA 1U0GA 4TMVA 5CA0F 1Z4KA 2EP8A 1Z5UA 4NFYA 1P19A 1L6RA 3N2KB 5FO1A 1W76A 1L5SA 4B44A 5JYBA 2H1HA 3JYQA 4AG6A 4IIFA 3OX2A 4DXDA 4L0DA 4KH1A 3VDNB 4BGEA 3AY6A 1FP2A 3EZ7A 1K4KA 4G0YA 5C1OA 2EKLA 4CIYA 4HG2A 4LHZA 5BXYA 1JHAA 1UJ5A 3B6IA 1UBLS 4KDRA 1VKNA 3T1VA 5CT8A 4WOPA 5LKAA 5GJWC 2NO5A 2ILTA 5J43A 3OQVA 5JSHA 5JRZA 2LKCA 5ISMA 2C4UA 3OIDA 1OX4B 4GICA 5DNAA 2QMOA 3SJUA 1YC5A 2RHRA 4UBMA 4G9GA 1W0JA 3D02A 5ALXA 1NYRA 3EZ6A 3WJ2A 2VA8A 3RH0A 3B1KA 3GGDA 1F8XA 2OCGA 3X1MA 4R3NA 3GPLA 4YP9A 2GVZC 5TEVA 2YC2C 3PFCA 2CMFA 5L3SA 2YN2A 4A1FA 3EOAI 3MJDA 1UL1X 3UHPA 2VK2A 5BSEA 2FLVA 3AIMA 1MO6A 4G0MA 3N07A 4LQDA 4UASA 4I50B 3UHOA 1M7BA 3E3LA 5KSYA 1GDTA 2ZE6A 1U94A 4MUKA 1ZVMA 2RAVA 3HBAA 1XZIA 4LJ6A 3AKZA 3CEPB 1DQSA 3EFBA 3I6MA 4UCFA 4XIJA 3VSBA 5IMSA 1LZLA 3H6GA 3QVOA 1MXFA 3UMFA 4F4CA 2QR3A 4K3VA 4XVUA 3N9IA 3L8FA 4OXXA 4Z0NA 1D1SA 3EVTA 2A0WA 2HK9A 2Q49A 1TOAA 4BQOA 4MUBA 4AAYA 3SZOA 1Y5MA 1WMDA 3T7CA 4NKRA 2I66A 4YECA 1FFAA 3E22A 3VQTA 3T06B 2XNHA 4QJ5A 5ESDA 3IPXA 2G17A 2ZVJA 4BFZA 5B4TA 2G0NA 3F98A 5IBRA 5TEWA 2FQWA 2AFIE 3CC8A 4P3OA 3QUQA 4EGFA 3PYXA 2VRNA 1JKJB 4ALMA 5D85A 3D8TA 2O5CA 1PWZA 1D09A 3L1JA 2V5AA 1LUAA 3OU7A 1JYFA 4YUZA 1VJTA 1GY8A 1D2HA 1X77A 4YDQA 2ZUWA 1Y8RB 1U7XA 5A02A 1P77A 3SE0A 5C32A 4KXFB 2WJPA 1HEIA 1QS0A 4N03A 1MMFB 2JIRA 2E4ZA 2VFAA 1MW8X 4II3A 3WLEA 4QAQA 1S89A 5KYUA 5DSXA 2VJQA 3PU6A 2WUWE 5F7JA 2FG6C 3G9UA 4UMFA 1GILA 5HE8A 4F60A 5IWCA 3ICCA 1GV1A 3BZBA 1E4EA 2PH1A 1ZMBA 1G21E 2Y0CA 4OJYA 5K0FA 3HO1A 3SICE 4RE5A 3U40A 1QZZA 4KN8A 1WBBA 3ROEA 2FKNA 4AJ1A 3VR4A 4NCAA 2O1EA 1VSUA 3RIEA 2HT6A 2ILVA 2XUGA 3QUCA 3QE4A 3QWAA 4D82A 4MSUA 4R0VA 4D3XA 2D2IA 3BMQA 5IF9A 4OI0A 1M5UA 1OCEA 4UJ5A 4DMLA 5CB8A 3FVVA 4QPDA 1U3GA 4IIJB 2BE9A 2V0NA 4QUIA 4IZHA 3F5MA 3ETJA 4NYIQ 2EGHA 2YQ5A 1GD1O 1HQCA 2C2YA 2X0IA 4OREX 3URMA 3RB8A 4D41A 4MVXA 4D46A 1BG6A 4DABA 4BNKA 4ZOQI 1L8AA 5A3JA 3BMXA 1A1VA 1ITZA 1GKLA 2H4YA 3AEKB 1DXQA 3I1JA 2WKWA 3FAZA 1KAOA 3ZCQA 2GCNA 2IA5A 4F4IA 4EHIA 4N3NA 2X5NA 1PR0A 1R15A 2N47A 4ZOLB 4GKKB 2Z9BA 1CUZA 2MR5A 3DJFA 4PFSA 1O6BA 1YZQA 5TGZA 1H1TA 4TT8A 4LW8A 4D0NA 4LECA 3E7FA 3JASB 3I53A 5ANRB 2G4LA 3S29A 1Z45A 3H11A 1KDRA 4H0CA 3L0BA 3TAUA 8ABPA 1REQA 1K8ZB 5JARA 1YZLA 2CXHA 5JXWA 3Q15C 1UJ6A 3QKSA 3N70A 1NJ5A 3UAYA 5KUTA 2JLBA 1KZ1A 5CXUA 4CVNA 2X9NA 2YJNA 4YDHB 4PLPA 1AVTA 4ECEA 2CL7X 1F2VA 3IP6A 5I47A 3C8UA 1T0IA 3ITEA 4RADA 4KAXA 1U90A 2I2FA 4N5NA 4XQ9A 4CM4B 1EUZA 3JWPA 3Q6NA 4NU6A 5IBPA 1OJ7A 4II2A 5C81A 2G0TA 4NEQA 4WIAA 2RGNC 4QTZA 3WVNA 3TLJA 1W5AA 3IQWA 3RUAA 1E2JA 1FNNA 1NLFA 3RE1A 1XQ6A 3PT9A 4NOMA 5BQXA 5JS1A 3P9CA 1YKGA 4YLYA 3PUWA 1XTRA 2VUIB 3IQIX 3L1VA 3HN7A 1JIIA 5G1PA 1XN1A 3GV0A 2JRLA 2OZLA 1NDQA 3L8CA 1E6UA 4I1RA 4DDHA 1C50A 1X7DA 1YCDA 2GA9A 3CTPA 4H77A 3KUCA 3U80A 1EUDB 3KO8A 1GCAA 1RI4A 3ZCSA 1JIUA 3ZIUA 2BFEB 2QJFA 4O6VA 2VH1A 3ZY5A 4RAOA 2H4HA 4V0RA 2WINI 3JQRA 3PXAA 2A35A 3LW7A 2QRMA 2WFLA 4GM4A 3HI6A 1XZLA 4A8TA 3EZLA 1AHIA 3ZU4A 3ROTA 3G0DA 2CNLA 2D4HA 4KXMA 4XTRA 1SM4A 1PJZA 1VLHA 1VBNA 2ZYTX 3SU8A 4KR7A 3C4QA 3P27A 4EL5A 1DG3A 3D59A 4BVAA 3GAZA 2QMQA 4JLDA 4NQZA 2G7MC 3F2IA 3FDXA 2I87A 1K8YB 1WCWA 4XQGA 4YREA 4YUYA 2XT9A 3UT0A 1WP9A 3SM9A 5A3QA 4Z3OA 5GZ1A 2DQKA 1BE1A 3QE0A 5BT8A 2ZIXB 4LCEA 5CA0A 1R12A 4JJEA 4GUDA 4YN3A 3EPHA 1EEHA 1GA4A 3THYA 5IPFA 3Q8XB 1U0HC 5KNBA 1Y3IA 5ESRA 3K9NA 5IFLA 4JMLA 3W2EA 2R6AA 3GPCA 1DBSA 4FYYA 1RR6A 4YCDA 3DXYA 3RS4A 4ZGWA 1RCUA 4M7RA 1EBUA 3NVMB 4JI5B 3LDFA 3RK4A 3TQHA 3O7WA 4FKMA 1UPFA 3U31A 1YZYA 1ZEJA 5KQRA 3NKLA 1ZXXA 2ZBUA 1KAHA 1BKYA 3C98A 3IPYA 5E7JA 1JKMA 2ATCA 1A4RA 1LPMA 1CTQA 4I9GA 4DNXA 4G9BA 4C76A 4JUFA 2OT3B 2RHOA 4N47A 1FDUA 1DAIA 4QU9A 4BMOB 1TMKA 2PQMA 2DWQA 1KYXA 3K4HA 2I7XA 2B1IA 2IUEA 3QP9A 4A92A 2QS9A 2RBGA 5B1DA 2LWIA 2D06A 3II6X 2RJOA 3K9FC 4U7GA 1AA6A 4WINA 1WOMA 4P92A 3PC8C 2I6GA 1EVLA 1OIXA 1NLZA 3O1IC 1K06A 3CX4A 2PN1A 3IEUA 1Q0LA 1U0EA 1V5WA 2D5AA 2IXTA 3QEMB 4RZSA 4DTCA 2YKGA 1NGSA 3DV2A 1Q0PA 1SD2A 3MAAC 3MTIA 4Z54A 3OFND 3MOIA 4ILKA 2D0PB 3IALA 5EJ2A 2E0IA 1JPVA 3D6JA 4L3WA 4GM1A 2IW1A 2W4IA 4ICIA 4M9RA 2FR8A 1EPUA 4ER7A 4WUTA 5I9LA 3LT5A 1A5ZA 5ES3A 3D8HA 1C9JA 3G2IA 1OT3A 3M1LA 3OQ6A 4WBXC 3BWDD 4QFDA 4PHHA 1BRMA 1KI4A 3MRTA 1R6UA 4HLDA 2CLHB 1RIFA 2PQ6A 4BNDB 5A7GA 2VT3A 5IJ0B 1RWXA 4QGBA 1D2EA 5ALJA 5E6RA 3BULA 2BFCA 3BEOA 3P26A 5CEEA 3IVMA 5TQVA 1MJFA 1AMUA 4CV2A 3BD7A 2I80A 4TRMA 1IOLA 1RP7A 2WW8A 4NYJQ 2FEXA 2R7NA 2ZT8A 4J94A 3OCYA 1S2OA 2PZKA 3B36A 3L4SO 1V2GA 2FF7A 1FF9A 1G66A 3KJFA 3ZDCA 3VKGA 3KL2A 1EUYA 3RQIA 1MOSA 4Z9XA 3VVMA 3FDIA 4YRQA 3CLRD 3EBOA 4TXLA 5AXDA 3ZW7A 1XEXB 3OVMA 2P0YA 5ERYA 4DLSA 3IXMA 1NV8A 4Q7EA 1D04A 2CXPA 4N0MA 4N6OA 2C94A 1WZ2A 3JYPA 4NPAA 1VSQA 2OPBA 1AXGA 3T5BA 3Q7IA 2JD0A 1Q2UA 1K89A 3GLIB 1A8QA 2XIJA 4PHTA 3PDWA 1U0RA 2EG9A 1MOPA 2XWJI 5HQTA 3IXQA 5DTMA 5ELMA 5JSFA 1HLGA 2OO5C 3ORYA 4DNOA 1NYLA 4TLMB 2AJTA 1Z0ZA 3O7MA 2OESA 4ZDIA 5JECA 3EIOA 3K5HA 5FBKA 3AIIA 3GGSA 5HF9A 1BWPA 5AJYA 3BWMA 3QWFA 1W2WB 2XHEA 2ID9A 2AZXA 2IYTA 4KUHA 1A8IA 1O5TA 3AJAA 2JGJA 4F8JA 1H4VB 1VPTA 4FB4A 1NVMB 3K6JA 4G97A 4A0SA 2MT9A 2JAPA 1F20A 3T7KA 1KRHA 2RHWA 2XY4A 4OAQA 4E22A 4RPHA 4F2DA 3L4JA 1QC5B 1B6SA 3TEMA 4DQUA 2PS1A 4E1BA 2Z8YA 1BHSA 5CLJA 3BQNB 1RAHA 1U2DC 4ZYYA 4R8LA 3EFEA 3QE3A 3LUKA 2OHVA 3LA8A 3EQZA 4L28A 1OGJA 2H1LA 3KHKA 5BSUA 3B6KA 2CDBA 2FEPA 3NRCA 2HA6A 4GT1A 3B1VA 4L4YA 2O3RA 4OL9A 4YV1A 1P2GA 1XG5A 3GFQA 1OROA 3DEKA 3JALB 4BKRA 2HQBA 3KSZO 3QXGA 1NW8A 4TMXA 1X3SA 1YZFA 1P2FA 2J9GA 2PSJA 3CSSA 3KYDB 5HIIA 1JYEA 1Q3TA 3UWPA 5M2QA 5D86A 3SIRA 5KOHA 5AW2A 3LKDA 2HRQA 1QPBA 3HA7A 4D98A 5IT5A 1I3MA 3DVRX 4I55B 3PFFA 4XEUA 3PLAE 2UXBB 2X1MA 2W00A 1R8QA 4RACA 4JFRA 1ZESA 3LK6A 2FR1A 1DIAA 1N5RA 1SQ6A 4BZQA 3JARB 3ZHVA 2CC2A 3A05A 4JT2A 4QYMA 3DGEC 3RU3A 4A0RA 1F14A 1KIMA 1XVIA 1N6KA 4HZUA 2WM2A 3ZBTA 4UOZA 2KQUA 1GJRA 3DB1A 2OWEA 1LDEA 1B2LA 3CF0A 3H5OA 4J1TA 3O8RA 2GQ0A 3PVSA 4PYRA 1ZGZA 5FXMA 3MINB 1JAZA 1F12A 4NATA 2J3IA 2C9BA 1XQVA 2JLUA 4KV7A 1FSGA 2XDQA 4ZU6X 2QRHA 2UDPA 1Z16A 5D3MA 1DDIA 1X0VA 1A0OA 3CPEA 3R44A 4MQMA 3C3JA 4XYEA 5JAUA 2B61A 1STOA 1E9EA 3OJOA 4LVCA 5TSDA 1S2DA 4CV0A 1ZKMA 2IZ1A 5EHZA 5BXQC 1BGWA 3L1HA 4CQLA 3P2MA 1RYEA 2J4CA 3HDQA 3WMEA 1VOTA 2HADA 3WHKA 4C6RA 5GIPE 4Z7JA 1IK6A 1DAEA 3HCBA 1TQ4A 5BSRA 5A62A 3FNEA 4ZCSA 5BOSA 3ZE1B 3HM9A 1G2OA 5I4BA 3IKMB 3U44B 2XEDA 2BBTA 4A2PA 4M1EA 1X94A 5DYTA 3VDRA 1ZH6A 3GD7A 3I9V6 2WNHA 1EFAA 3C45A 4KC0A 2PKRA 2XOXA 3VPFA 3HKCA 3OCZA 2GETA 2JEOA 1CWUA 5KQSA 1PQYA 4OGGA 3OTOB 1FZTA 4OB7A 3K8OE 1SKUA 3SJZA 1G291 1QOQB 5TVKA 3E27A 4Q4DA 2QM7A 3TW6A 5IFKA 3VPHA 3RC1A 3JVUA 2XTZA 1QTNA 4BVBA 4AY6A 4R9VA 1OFHA 1OLXB 1YR6A 3E61A 1K8RA 3AYZB 5IJAA 1XXHA 5C35A 2H18A 5CB4A 2NU9A 2CJFA 4OMCA 1IJFA 3GRYA 4Y98A 3RIMA 3TQQA 1E2LA 2RBEA 4LOLA 1ZM7A 2GYVA 3WO0A 3C6QA 2E4WA 2I3ZA 1SVOA 4DR4B 2W98A 3BGDA 2WYWA 4OHXA 5C5IA 1XNHA 1J39A 1M34E 2TS1A 3DZCA 3G2PA 3RWOA 1JNXX 1TAQA 1Y6RA 2QI9C 4FT2A 1RCTE 3NBYC 5TPZA 1Z0AA 2QX8A 3ROGA 4S05A 3K70B 2WG2A 4XYBA 2FGJA 2C0PA 2E6UX 4ZCLA 5HJ7A 2E85A 3EISA 3I6QA 3OU2A 4OHFA 4P4LA 3CINA 4ABYA 5DM60 4XE5A 4G63A 4GG1A 1EM8B 1V96A 4RFSA 1DADA 1GZDA 4MCIA 4DRYA 3ZDBA 2FOLA 4YFVA 5LU9A 1D2RA 1LPBB 3GOQA 1XD2B 2WD7A 5HBGA 2FPKA 3EF1A 1BDIA 3OX3A 4RY2A 1WF6A 2ZXEA 3VKWA 1U2SA 2B34A 3P9YA 4NK5A 2QTMA 3T7SA 1PX0A 2JFZA 2P6PA 3NWOA 4MITA 1L5KA 1EHCA 4MUFA 3I5AA 4B5LA 3KYDA 4DMHA 4UC0A 3LCRA 1Q1BA 2QZZA 3V8QA 2HMSA 2JLVA 1W6UA 1VIYA 1XR3A 4NXNB 4XI9A 3BTUA 1CRZA 2WMNB 3IX7A 4JLNA 4NS4A 5JLJA 1P7ZA 4AC9A 1RMTA 2C78A 1U8FO 4PX3A 2ORWA 2QLLA 4K5QA 5F4ZA 4V03A 5CAEB 5BR7A 4B3GA 1QYDA 1WTCA 3TRKA 1H6CA 2ZTVA 1TU3A 2WTXA 1E2FA 4RM3A 4I6EA 4B0PA 2GN1A 2I22A 3QUBA 4P4SA 3UC5A 1C7IA 3MPOA 3NM5A 5P21A 3GVCA 3SR0A 1H4QA 4NV1A 3S8EA 1H6DA 1NBEA 4BVGA 5CM8B 4DJEC 3IUMA 3AR9A 4F7WA 2GHTA 1E60A 3ENNA 2HN9A 1NBOA 2JK0A 5JD6A 1TUIA 1WUIS 2XNSA 5E7QA 3ZHUA 1Y98A 2YZNA 3HQ4O 4ISCA 1BJTA 1C1HA 3F5SA 3NORA 2BMEA 2GFIA 3BXZA 5D6OA 1ABFA 1PS8A 3EMDA 3PGA1 3ZE0B 4B32A 4PC3A 1QCDA 4NCKA 2J67A 1TZBA 4ACAA 4BV9A 1PT9A 3S8MA 2XVMA 5H0IA 4IV0A 5CFMA 4JBXA 5WRFA 1Q0TA 3LTEA 1CY4A 4FYJA 3OURA 5DV9A 3VAZA 2NLOA 2ZP1A 3RTDA 4AP6A 3N75A 1FJ2A 4NNJA 2DSTA 4Z4EA 1VLVA 3STWA 1ZVQA 3K7EA 4TQAA 2WRZA 4IRUB 4GW3A 3VPBA 3WRXC 3UKJA 4C2UA 4ZFNA 4ARZA 4RWEA 5CEJA 2PJRA 1Z2DA 2DP4E 4X8MA 3PXUA 1PI3A 3D8SA 2C5GA 4OFZA 3D8UA 4TXMA 1NFRA 5EJ6A 1RTTA 2JEZA 3PQEA 2CMHA 3LX5A 5K3OA 1UFOA 3BGSA 5H4GA 5CIYA 2C98A 4QICA 5K3SA 3ORQA 5JZ9A 2CNKA 1T26A 4HNSA 3I9NA 3H6KA 4EJSC 3ESYA 1E8NA 3OY7A 2D2VA 3NV7A 2E5FA 1WHSB 5EIEA 4U9IS 1C3OA 3T5CA 3ZE6A 4NK4A 4PIMA 3L02A 3OD1A 4DILA 4B75A 3IQZA 3T0GA 1XZCA 4EPWA 4RHFA 1T4CB 2LVBA 3ROQA 3SHOA 4I55F 2GYWA 4O4JF 2P5UA 2PZGA 3A1UA 2CLCX 1N1EA 1HFKA 2YXEA 3IQXA 4P86A 2A0UA 2M6LA 3WZLA 2COEA 5D7NA 2WNIA 5FBRB 2OVFA 2AOVA 3LD9A 2H59A 4FYXA 1C8VB 1V6SA 1Y5IA 3G85A 2QTVA 3TIFA 4ENRA 2FPSA 4U2GA 3RC8A 1RHJA 1A9PA 1C1YA 2B8TA 3FCAA 2EZUA 1AU9A 1K7SN 2IYUA 4BRWA 3O4GA 4G2TA 4JOCA 2B1GA 3RFFA 2VP9A 3GR6A 1C29B 2WLSA 3QLUC 4GR9A 1ONBA 1KNQA 3JQBC 3SYNA 5H82A 4B6OA 4BWYA 5C5DA 2M9MA 2R6FA 4HB2A 4M9CA 3FDFA 5CT6A 3ETDA 3T1OA 3SF8A 1FUKA 3CX3A 3TO5A 3JVDA 4DV0B 2OBNA 3RKRA 1YUNA 4LKOA 5AD1A 3AW9A 3VPCA 1EVYA 4JLPA 2ZBEA 4C0KA 3RAFC 3G2HA 4CQNA 4E2XA 3ZHTA 2YCLA 1DUIA 1NN5A 1OZ0A 1UXOA 1TUGA 2VPXA 1QE3A 2FE4A 5KJFA 2FSPA 1XNRB 4YMLA 5T3YA 3D7SA 1YBAA 5FBZA 2PSFA 1WEKA 2EEPA 2VJBA 1JR3A 1II0A 3RSZA 4JI0B 2WIFA 4NJOA 3ZW8A 1MA0A 1NVAA 3HC7A 3EULA 1TQDA 2WZDA 1KI3A 3Q3JB 3L5OA 4H4EA 1HLFA 3GJ6A 5AW5A 4COKA 1G3RA 4NSNA 3DOCA 2AN4A 2OLEA 2PUVA 4AY3A 2JPDA 3VUFA 1TTQB 2Y1XA 4E6EA 1FP7A 2P3SA 3JWHA 3H99A 4ZK2A 4A36A 1M66A 2ZVPX 3FFTA 5JVDA 2HQSA 4L75A 4H1WA 1XA3A 2QL9A 4P84A 8AT1A 1WXGA 1IZ9A 3SFZA 1XZJA 1AO3A 2AFIB 2OHXA 2VCHA 3R0IA 4TZTA 2AZMA 2H2HA 4GL4A 2B1RA 4RYDA 4YDRA 4MULA 1ZHHA 1X9GA 3I73A 4E4TA 2GESA 2P9ZA 4ZAVA 4QUBA 2O5EA 5ITZA 1E1RD 3IA2A 1T6XA 5A6SB 3PXCX 1PT6A 3BCHA 3NUZA 3WLFA 3UPUA 2XOKD 2CY0A 2I4TA 5PGMA 1BH2A 2YY5A 3V5NA 5HVNA 4ZVMA 4B3RB 1H94A 2OHGA 2Z5VA 3JWJA 4D79A 3HM2A 4YK7A 5FI0B 1S2LA 1P39A 1U28C 2CYBA 2VAPA 2X8JB 2ZYRA 3BWEA 3QJGA 4GMHA 4KG7A 1TQ8A 1NHGA 2DFTA 3G9TA 3PNQA 3LMKA 1P74A 1HUQA 5DBGA 3M9WA 5EIOA 3SIWA 4B47A 1YS4A 2YVUA 4C0XA 4CLXA 2VJYA 2G4VA 4L9AA 4QASA 2XCUA 2V4UA 4J1SA 5LOVF 2CZCA 4AI6A 4X64B 1US8A 3CX7A 3GJTA 2A5GA 2UYYA 2RGEA 4Q12A 3E2PA 3MTDA 4OHPA 4Q02A 5EHIA 4UOQA 4R2JA 3HBLA 3LIPA 4BEBA 2GAIA 2FE1A 1CXZA 4L8LA 3WE7A 1SRRA 2RONA 1Y1KE 2VTEA 4EKYA 3LYUA 1NNEA 2XUJA 2IE0A 2ZBRA 4GSYA 4YGYA 3GEGA 2DWPA 2Q0SA 2Z4TA 3G6WA 2O7VA 1UOEA 3K3PA 3K96A 1SG0A 5J5CA 1DIOB 5DIZA 1T1RA 2FZKA 3BXFA 3I2FA 1YOVA 4UDYX 1T5HX 1WE2A 4HWGA 4LQ4A 5EVCA 2CFSA 1PN3A 3JQGA 4N8DA 2PY6A 2IVFA 3V1KA 3AU8A 1FQKA 1V1MB 5EUBA 3FNFA 3W90A 3BAZA 5IHXA 4PLZA 1RWPA 1KSGA 3VTFA 4M55A 1JEYB 3FOCA 3KLPX 5LJLA 2VDRB 1RXVA 4BNIA 2E4VA 4EFMA 4RZ3A 4YYZA 1UBUS 4YJ2F 2VDNB 4H35A 2HWXA 5FLKA 3QELA 5H3LA 3ET5A 1LPNA 5IANA 3H5IA 2OC4A 1DRWA 5DJ5A 4D3FA 2UYQA 4X3OA 3WJ1A 2XOEA 4HAWA 1Z36A 3QZUA 1HQDA 1BXRA 2LV8A 3GYBA 5CNKA 3OLCX 4BWVA 1R4MB 3EZYA 4K9PA 5E3JA 3MNFA 3SZGA 1E18A 3LUHA 3T3GA 2V1XA 3S81A 2YRXA 2OGUA 3J7TA 4YEDA 5EEGA 2P78A 2JFBA 3GJQA 1LVUA 2GN8A 4DWOA 4U7JA 1MRSA 1KJ9A 1NF9A 1NJSA 1Y1PA 4Y1GA 4RTMA 2G7ZA 3OECA 3RG2A 1TGYA 3Q4GA 4HMQA 2Z3ZA 4MCAA 3V7FA 1BN7A 1X7YB 1WCV1 3TS1A 5IX8A 1OU0A 3O38A 5BUCA 4FDMA 4LYYA 5DRYA 4QT4A 2Q2OA 4OF4A 3UK2A 5KS2A 1F17A 1UANA 2NZWA 1DUSA 3S27A 5CB4B 4EF5A 4CQLB 4IJWA 4JQOA 3ESAA 1WHSA 1I9GA 5BURA 1YE5A 5KYXA 4B6GA 3HEBA 3DFUA 5HGJA 1YBHA 4HL6A 2QAGB 5CDSA 1VDMA 3EGDB 4FHEA 1C7QA 4N3BA 1ZQ9A 2ZJOA 3PQFA 2I2XB 5A04A 1QVVA 3PRKE 1SXJA 1P0PA 1YS6A 3AGPA 1MAUA 5JFOA 1U9IC 4Z8YA 2XB2A 2WDPA 1G6HA 2Y27A 3ZWMA 3L9WA 3KKQA 2OFFA 2V0GA 4YAGA 1USWA 2A1TR 5F4BA 2O8NA 3TW0A 4P7GA 2EAUA 3AL3A 1QDUA 1ZDMA 4JBHA 5JCPA 1XTVA 2X4LA 1U7ZA 4G5QA 4PGHA 4HNQA 4S24A 5A0FA 4IEEA 3RFVA 1TU4A 1PGNA 2VDVE 5F76A 3WMWA 3ZI7A 5EXXA 5TGTA 3DXFA 1T2CA 5BNZA 3DYIA 2ZOSA 3QVJA 1TEHA 3CO5A 1QP7A 3DGFC 1CFJA 1WQ4A 3ITKA 4ZVNA 1JFFB 2QL7A 2Y05A 4TYPA 5HSGA 1TYCA 5KNDH 1XMIA 4CKEB 5KU1A 4B6SA 1WXEA 1YCHA 1N25A 3R75A 5IU6A 3TE6A 1JQLB 2Q7OE 5K8JB 1N5MA 4TRJA 3ZGVA 2EXXA 2QG4A 3L6OO 5CJ2A 5LQUA 3PPVA 3LH5A 4P58A 5KPDA 1M2WA 1Z6XA 4IZOA 5C34B 4UE3S 1QBKC 1GGNA 4RTRA 1FRVA 1W87A 3DWFA 2AHOA 2Z6QA 1H2RS 1QNLA 5IW8A 4DLZA 4AJOA 2GWHA 1TD9A 1QXSA 2Z1MA 3LQ4A 5TMBA 1EE2A 1MLDA 1PRYA 1S3IA 1WG8A 4IUBS 3WBBA 1OTXA 5JQWA 5HDQA 2CFOA 1WL8A 1CQZA 3KPYA 4BB0A 3EYAA 3H05A 4NG4A 3UCXA 4XB1A 1UKBA 2C7VA 2QI9F 1AZLA 1J0XO 2GSWA 1HY3A 3LWNA 5KTKA 4H18A 3EDMA 4F2GA 1R0XA 2QVYX 4BX3A 4FR2A 4C07A 4ZQFA 1T1IA 1I13A 3VZCA 3A6LA 4Q3LA 1RQXA 4PIPA 3RYHB 3ZDDA 4F1KA 3M70A 3QY9A 3T3NA 3ZQ4A 3NALA 4AY2A 3MMXA 3QNUA 1ENZA 3IAUA 1LFDB 1Q1AA 1PSDA 5BOVA 3RYHA 3VJMA 5K3EA 5C4MA 2XGJA 1JHZA 2GF9A 1HE5A 2BVNA 4JQCA 2GBGA 7GPBA 5IT4A 1K9VF 4QC2A 3PIIA 3W05A 1KYWA 1P2SA 3KDSE 1INLA