2EJFC

Crystal structure of the biotin protein ligase (mutations r48a and k111a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
NVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
total genus 12
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ejfC00
1E2VA 1E2WA 1H9RA 1H9KA 5K36G 4OO1G 2E74C 1GUTA 2AUJD 5C0XG 3T51B 1OXVA 1E2ZA 1Q1EA 4XTCS 1OXTA 3OPOA 3AB9A 5KNCA 1HQMC 3T56B 4BA2I 2A68D 3H94A 1IYVA 4DK0A 4IFDH 3PUZA 1TKWB 3A7LA 2NN6G 4IQZA 2BDOA 2D2CC 3OOCA 1GUSA 3PUWA 2JEBI 3N6RA 3ND8A 5JEAH 1DXMA 2AWOA 1QJOA 4KMUC 4TQUS 1TU2B 3VR6A 2BE5D 3EQLC 1Y8OB 3L7ZC 2A6EC 2F1MA 1VDZA 3QIAA 4L8JA 4OGQC 3QJYA 4TKOB 4H13C 3IKJA 2B8FA 2O5IC 1G291 3A7AB 3LNNA 1OXSC 1Z6HA 2A69D 1ZKOA 1VF7A 1V43A 1FR3A 2EJFC 3GQBA 4OO1H 2PPBC 5BN4A 4KN4C 2EJMA 1O78A 3I73A 1DCZA 1GUGA 2A6HC 2E75C 2KA7A 2K32A 2ZT9C 3MFYA 3PUXA 3VR4A 1VF5C 2JXMB 1LACA 1Y8PB 2PNRC 3PUVA 5A35A 5KNDA 2O5JC 2CW0C 3DXJC 3PV0A 3PUYA 4LJZC 1HPCA 4KHZA 4KI0A 4KN7C 3ND9A 1EWHA 5JEAG 1O7LA 2YYZA 4GZYC 3CRKC 2KCCA 2NN6H 1GHJA 4IFDG 2IT1A 4H0LC 1Y69U 1Z7TA 3OW7A 1ONLA 1A6XA 1DD2A 3LWUA 1OXXK 3VA7A 5C0XH 4G7ZC 2A6ED 1GHKA 3HGBA 2A69C 3T53B 1CI3M 3A8IE 5K36H 2JE6I 1VCIA 3M7NA 2V4DA 1K8MA 4G7HC 2R6GA 1IW7C 2E76C 3VR2A 2A6HD 1HTPA 3VR3A 3P20A 4HR7B 3TZUA 1I6VC 5BN3A 2JEAI 1Q90A 1GJXA 1LABA 2K33A 3SDZA 2AUKA 3CRLC 1HCZA 3W3AA 4JK1C 2EJGC 2DNEA 1IYUA 3BDOA 1Q1BA 3RLFA 1K8OA 1SMYC 4I7ZC 1V8QA 1H9MA 4RCNA 1YNJC 4XIGS 2BA1A 2BA0A 3IFTA 1B9NA 3A8JE 4DNRB 1Y8NB 3D31A 4BA1I 3FPPA 1Q12A 4KKSA 1PMRA 1BDOA 1OXUA 3GD7A 4DK1A 1H9JA 1GUNA 4LK1C 2EVBA 2DN8A 2LMCB 2QF7A 5KNBA 4H44C 2A68C 4DNTB 3M85A 3M4YA 3A8KE 4KKTA 1IW7D 2K7VA 4JBWA 2NN6I 3MXUA 2BE5C 1YNNC 1CTMA 3D4RA 3KLRA 2B8GA 1H9SA 2D62A 1GUOA 1ZYRC 3WDNA 1FYCA 3SE0A 1T5EA 5BN5A 3I4LA 1B9MA 1CFMA 2EDGA 2D5DA 2PCFB 3BG3A 3NE5B 3I72A 3U9SA 1H9SB 3FMCA 4PV1C 3QG1A 2L5TA 4KKUA 2Q8IB 3VR5A 4G7OC 2DNCA
chains in the Genus database with same CATH superfamily
1PA6A 5FJ8G 5JJIA 3I4MB 1PZKD 2D9UA 3GTPB 4JOIC 3BU2A 1AW7A 1SYDA 4K2KA 5JEAH 2AWOA 4KMUC 1LTAD 2NZ1D 2YU9B 3S16B 3SR1A 3H09A 5LHY1 5IP7G 1Y1WG 1QUQA 1F9RA 2MGSA 1YNJD 4ZUJA 1K73C 3ND8A 3A7AB 1CZGA 4LF7Q 4A3KH 4YIJA 1TWHB 4DPGA 1RDPD 4QCLA 1CT1D 5HGQA 1I5FA 3I55A 2KA7A 4C56C 1JWUD 3G48A 2BH8A 2KCMA 3PUVA 2OT2A 2CW0C 1HZAA 3VYTA 4OIKA 1IHZA 1Z47A 1N33L 3FEWX 3W1BA 1W3SA 2R7FA 3GTLB 1Z7TA 2R3ZA 2E2HB 2ICEC 3NTHA 3A55A 4MNOA 3VYSA 4A3BB 2QILA 5IP7H 1Y1WH 3P75A 1LTGD 2ZXRA 1WTQA 3S15B 1HFGA 3T4AC 4DR2L 1A62A 2F0TA 1VCIA 1SNMA 2TSSA 2KHSA 4LNQA 1SE3A 2QGQA 4V0BA 4BY1B 3TP5A 1JC7A 1SSOA 2K1BA 2FJ2A 2B2VC 3K5MA 3I4NG 2K33A 4L5TA 2AUKA 1W6KA 3W3AA 1PH5A 5FO9B 2IPKD 5ELDA 3AFQA 1KNAA 4YHHQ 4C3JB 4X3SA 3TQYA 4KKSA 2NWGA 4X6AH 1H9JA 5IWAQ 4QUCA 4LK1C 2EVBA 5KNBA 2FXQA 5M5XB 4I65A 1NTGA 2F0LA 3GTGH 4JI2L 3S1RB 5IWAL 4R8NA 3I2ZA 1S5BD 1A2UA 4BY7G 1FGUA 1CTMA 5K5PA 3BS1A 2E2DC 3KUPA 1VS0A 1RTNA 4C2MH 4DV0L 1EL0A 4FXKC 4HIKA 1KDBA 3D8GA 3TMEA 3BVMA 5BN5A 3UDXA 1SJED 2D5DA 3S2HH 3KF6A 1SNPA 4JPBW 1FJGQ 2EYPA 1GUTA 1N36L 4A3GB 4ME3A 2PW5A 3W2DA 1JWSD 4A3IG 2VQFQ 2VNUD 1E2ZA 4A3JB 3OPOA 2UUBQ 2UUCQ 3OHXC 1Q46A 4PQXA 4R4CA 3D4WA 3J81i 3OOCA 4JV5Q 2JEBI 3HEJA 1TU2B 2B2YC 1L0XB 1QILA 1AZPA 5CBAE 5E7NA 4A93G 1W6JA 1RTOA 1SROA 4FP5D 1YJWA 2XWBB 1JQYD 3HOVG 1WVLA 2IX0A 1S5ED 2O5IC 3T1HL 1IYJB 2UUAQ 1WFQA 1ILQA 1M4VA 2UXBQ 5KIXA 1GUGA 2A6HC 4A3DG 4NP5A 2JA5G 4PMBA 1VF5C 2MUYA 3PF5A 1A63A 2F0OA 4RAUC 5AJ3L 3J80L 3DHQA 3HKZG 4JBMA 4C1NK 3TEHB 3VYUA 4DF7A 2L55A 1D8LA 3AEVA 1J5EL 4EQPA 3CCLA 1B50A 1F9QA 3S1NH 2B63G 3MA2B 1EFID 1SJHD 3L2PA 3BVGA 3TP6A 1F2MA 2A19A 3NQIA 1FL0A 2M2LA 4CHTB 2F0PA 1I50B 4B3TQ 5I6YA 1E24A 1Y14B 4AYBG 4DR6Q 1VQ9A 2DNEA 1FD7D 1LTRD 3HRZC 2J0TD 4F88A 2WB1G 4Y7NB 2GVBA 1B70B 4XIGS 1WD1A 4NXML 5J22A 4XQJA 2ALYB 5C3EH 3KLSA 1KTKA 2VUMB 3HOVB 4JI8L 1PMRA 3GD7A 5DM73 1HUMA 1LTLA 1SFOH 4N9TA 4CDCC 3GTKH 3GTLH 1RHPA 1LYLA 1MSGA 2X69A 2QEJC 3BDLA 4JG2A 2F0GA 2G9HD 1BOSA 1I6HB 4P71A 5C4ZA 2K5DA 3NXWA 1QVGA 2FMCA 1EZ8A 1SFOB 2EDGA 1NY4A 2QKIC 1XYIA 1EQRA 1B8AA 3NBHB 4A3KB 1WOCA 4DV4Q 3CC4A 2H4OA 3PSIA 1Q8IA 2Q8IB 3F2CA 4A3MG 5IGCA 1AH9A 2RVLA 1E2VA 3W1GA 3HFZB 5DLQE 4DA2A 5I9PA 4RWSC 2JQOA 3IFDA 4DR5Q 1N32Q 2N55A 1PTOH 2VL6A 2YU9H 4A3LG 1L1OA 1IXRA 4JI0Q 5C4JH 1TKWB 5C3XA 4A3GH 3Q22A 4GKJQ 2K6AA 1DXMA 4QQBX 1KABA 5LMUL 1EU3A 1TWCB 2KENA 3KBGA 4A3LH 2YTYA 1WTWA 2RDFA 5JPNC 1TR5A 2E2JH 1G291 3D3RA 1LM0A 2B2TA 3PO3H 1TS5A 3N52A 1VQ8A 1GOZA 4K5XA 2R93B 1HR0W 5T1GA 4YCWA 3AQQA 4GNXB 1TVXA 4IOCA 2RQXA 1HNZQ 1Q8KA 3HKZE 4XXEA 1EZ6A 3AFPA 1DOKA 3CCVA 3J7AF 2JA6G 1HXYD 3CCRA 4WJ4A 4WRDA 3PIOA 4IUVA 4GLAC 3LGJA 3HGBA 4GLVB 5C3EB 2UXBL 2Q2TA 3UDIA 3M7NA 4CJ0B 1N34L 1TXYA 3A0JA 1MKHA 3EJIA 2A6HD 4BS9A 2JEAI 4A3CG 1E1TA 3IRBA 3H0GB 1GO3E 5F2DA 3OWEB 2EJGC 1JT8A 5M3MG 5IGFA 1KAAA 4G4KA 1C0AA 2L0CA 4Q0FA 2Z4HA 5CC4A 4DNRB 1PZJD 3Q23A 4IO9A 4L63B 1YJNA 3WOEA 3ER0A 4A3MH 1L1OC 3KDFA 2IHFA 4YCVA 1K3BC 4MTKA 4LF6L 1FNWA 5IP9H 1IW7D 5M5YH 1HNXL 3EROA 1ENCA 1PLFA 4OX9Q 3HOYH 3M4PA 1QWYA 2K04A 1D7QA 2ASBA 3BDCA 4A3MB 4UDUC 4PZ8A 3SE0A 4R9WA 2C5CA 3ITPA 3E0EA 5FK9C 3EIVA 2ID0A 1AFPA 3OSOA 2I5MX 3S16H 1X3GA 1SXTA 4APVA 2XRQD 5K36G 1STGA 1GD7A 1AP0A 2AQ2B 3E9HA 2NVXH 2UXCQ 4MTNA 2WIIB 1IYVA 1VQJA 4A93H 1EY7A 2E2IB 1IBML 2BDOA 3CCSA 4EQOA 3T16A 5I2XA 2K01A 3LX0A 1UUPA 1VDZA 2QA4A 4TKOB 3IKJA 1GXDC 4UHVA 4B9WA 2AQ3B 5AJ3Q 2UXDQ 1E3PA 1PH3A 2B63H 2HQLA 2AMCB 2PPBC 3GTMH 4KD4A 2E75C 1IL2A 4R4OA 3EVQA 4JVZA 4DV3L 1Y8PB 4QMGA 4JI5Q 2F0SA 3BZKA 3PV0A 4L5RC 3PO2G 3J7AV 2N8NA 4QF4A 1BKBA 2AQ1B 4IFDG 2JSOA 1Y69U 3TP8A 4IPGA 2MPMA 5L37A 3M3YH 1CKNB 1NE3A 2ZJPA 3G71A 5CYUA 2OQKA 1S72A 3OYYA 4KY6A 2UUCL 1LTID 2Y0SG 3CW2C 3DEPA 4N8FA 5NUCA 2LXJA 1X9NA 4LF7L 1N36Q 1ML0D 2UXDL 4QJFA 1R9TB 4S3SA 1K8GA 3Q8DA 1IW7C 2EZVA 5EJWA 2UU9Q 1I6VC 5EKIA 2E8GA 2SEBD 1VQKA 4IFDI 1F9PA 1QOHA 4DV3Q 2EYLA 3UI2A 1MJEA 3GTQH 3NELA 2HIXA 1V8QA 5J1ZA 1EIFA 1SR3A 3STBC 4RCOA 2PZUA 3GTMB 1BXTA 2LXKA 3D31A 1K8AC 2A8VA 1C48A 1OXUA 4NW2A 1M90C 1TWFB 1IKLA 1HJPA 2CFMA 4HN7A 2RA4A 1BBXC 1TWGH 4F87A 2BE5C 1WYDA 4BY1H 2R7ZH 2OCEA 1HA5A 3K5LA 2K05A 3VYRA 4R4TA 5M9OA 2LFNA 2XVSA 3WDNA 3PIP3 1EYCA 3OTOL 2VW9A 3FVQA 2PO4A 1D5ZC 1H9SB 4PV1C 3KLWA 3PMFA 1VMPA 1AE3A 4LW1A 1STNA 5C4XB 1H9KA 3P7JA 1HTLD 3MVVA 2K5HA 5IYCG 1MJCA 3JC66 5IIFA 1KL9A 5DNFA 5A2QE 3AB9A 4NPSA 2SNMA 4BA2I 3H94A 1STHA 1D6EC 2K03A 4H02A 4IQZA 1RCVD 2A1AA 2XTIA 1A2TA 1DJRD 4K8IA 1PFNA 5JVG3 3FP9A 1EY0A 4IURA 4OONA 3I56A 4L8JA 2NVQH 4DAYB 1A3TA 1SYEA 4IJLA 4QUFA 2GVAA 2Y0SB 3PIO3 3K7AB 5DM63 4JV5L 3KOJA 3I73A 3R2IA 1LUZA 3VR4A 3ULPA 3RLOA 4QIWB 3H0GH 4KN7C 3E5SA 3T13A 1M1KC 1QZHA 1XX8A 3NTIA 1VQGA 2IT1A 1N34Q 2D0OA 5EPLA 4WFN3 3BYTB 1TWAH 3JAML 3CC7A 3VA7A 5ELNA 1KC8C 3TSSA 3O13A 4NB3A 3CCJA 3AMUA 2R6GA 2K14A 5BN3A 1BBWA 1YZ6A 3R2TA 1EIGA 3GV3A 4IUUA 4IUTA 4JI3Q 5E4WC 5HY6A 1EQVA 4IZ8A 2F0KA 3TP7A 3V2TA 3DLLA 4RFBA 3FKIB 5IE8A 2KEDA 1PFSA 2JYOA 1SE8A 1H9MA 2WV6D 1VQAA 2BA0A 2F3VA 4IFDJ 2ZTDA 1I4PA 2NVTH 5KRUA 4C3HB 4A3FG 2WKDA 4AYBE 1XMOQ 4HMIA 1QVCA 1PVOA 1CHPD 3SK5A 1NNXA 4KKTA 1U5KA 1K28A 1PZID 2HDMA 4HIOA 3F2UA 1DOMA 1BBUA 2N3SA 5EKLA 2OTLA 2KECA 5DAUA 1KDCA 5GAEC 2XSCA 2BOSA 1SNOA 3NE5B 1A15A 2VS1A 1VQCA 2MO0A 4R4IA 2RBMA 1E2WA 1ENFA 1KLUD 2E74C 2MFIA 3K81C 5M3FH 3K8AA 4FF4A 3QB3A 3QOLA 4JI8Q 3FKIH 1RL2A 2A73B 1S5DD 1B44D 4DN4M 2F0VA 4A3FH 1A3UA 1GUSA 4HJ5A 5D65A 1QJOA 4OL7A 3EQLC 1PDQA 2FHTA 4WJWA 2MQHA 3NK9A 4DAPA 5FLMH 5ISRA 1CKOA 1I94Q 5C4HA 1KAWA 4A3BH 1KIXA 1X3FA 1ZKOA 1VF7A 1HQRD 4BBSB 3NQTA 4HJ8A 1TWAB 2IX1A 2NVQB 2XIWA 3KK7A 3S17H 1PH9A 4J15A 2PQAA 2JXMB 4Q5VA 5ELFA 2F0DA 3SK4A 3ND9A 1I50H 1B3AA 1BNZA 4KY5A 3C3LA 4K6LA 3HOUB 4H0LC 4B08A 4A3EG 1UE7A 4NXNL 1LV9A 4RGTA 1U9RA 4DV7L 4C3IH 2KEEA 2PQAB 1SMXA 2JA6H 2E2HH 3I91A 4P2CB 2F0UA 4DV5Q 2L4NA 3CMAA 2EY2A 1V1QA 4KJOA 4CGYB 5I9OA 1SE4A 3VR2A 3VR3A 3CMEA 1YI2A 4BBRB 2RHQB 5KEEA 1EWCA 1LABA 3B6YA 3PQIA 3PO3G 2R7ZB 4RKLA 1PXUA 2R7DA 2J4XA 4RMFA 2B2UA 2VB3X 1DYQA 3PIPA 3L9AX 3MWYW 1NCVA 3L0OA 4X64L 3URYA 1VQNA 3RUZA 5CV9A 5JAVA 5G3LF 3PGZA 3M4YA 3MZ5A 2FFKB 3FRPB 5IYCH 4L5QA 2KHIA 1PRTF 4CBVA 2L15A 4X64Q 1KRSA 5HURA 4JC0A 1Y1VB 3F2BA 5FLXE 1JE5A 4GNXA 3NPPA 2Z6KA 2UUBL 1YNND 5IGBA 4DR1Q 2C9OA 2VQFL 4K0KL 3NHHA 4IOAA 3I4LA 4GLXA 1TS2A 1STEA 3UE0A 3KF8A 4YWMA 3U9SA 3E9IA 1E7ZA 3CCQA 3EBEA 4A4IA 4DK6C 4BY1G 4P73A 2EYHA 1G51A 4PNYA 4A3EH 4A76A 2R93H 5IOCA 2EYJA 4J1MA 5EBDA 3H3VC 1VQOA 3HOZH 3C1FA 1X3QA 3D6WA 5IGEA 3MEFA 1JR0D 4LF9Q 3TZDA 4B3SL 2F0QA 1YBYA 4M8AA 1Z9FA 4OO1I 4OGQC 4Y52H 4ABNA 1EY5A 3J80i 2IWHA 3ULLA 1OXSC 4B9XA 3GQBA 1WTPA 3HOUH 3DEOA 3M3YB 3OIQA 4JYAQ 2IL8A 2Q2HA 2IW3A 1PH7A 1LACA 5KNDA 2K4KA 2RDGA 3KBXA 4KHZA 1VQEA 3MTSA 2NBFA 2UU9L 1N33Q 3BZDB 4HAEA 2EYMA 1NR2A 1KRTA 3A54A 5D3IB 5ELEA 3S15H 3BZCA 3T53B 4ALPA 3ONAB 5CGKA 4DV2Q 2ZTCA 4JBJA 2JA8H 5CV5A 1IBLL 4OIJA 2Z1CA 2Q8RE 4GNXC 2Z6KC 4A3DH 5FKAC 4UAIA 1SNQA 1XXGA 1SYBA 2QCPX 1GVPA 3UE1A 3OIPA 4DUZQ 1IBMQ 1LT3D 2EXZA 3S24A 4QL5A 2CH4A 1RKNA 5GAHC 2YV5A 5J3BA 3KFUA 2CH4W 3RMHA 3K80C 2I5LX 4H44C 1HNWL 1EQTA 1SN8A 4LUOA 3CD6A 5FO7B 3HKZB 2AHOB 1XMOL 1G6ZA 4ME5A 2JN4A 1X6OA 1ET6A 1F77A 1EY6A 1HUNA 2R92H 4O42A 1SMYD 4H7BA 4OX9L 1CFMA 3I4MH 2JA7B 1MHWC 3BG3A 5C4XH 3I72A 2JA5B 4JI3L 3E6ZX 4LMQD 3FDTA 1E0BA 3CU7A 5FLXL 2XRSD 1CQVA 2AKWB 4ZYSA 1CHQD 1TS4A 2I5HA 2KUMA 3T51B 5HGTA 3RZDB 3T56B 3J7A5 4DR3L 1EYAA 5IY0A 1O7ZA 2CQOA 3PUWA 4KHPQ 3VA5A 2BE5D 3MAQA 4A3JH 4FF3A 4KV6A 3H0GG 1SE2A 1RF2D 2E5LL 2O2LD 5JJLA 2K28A 5M3MH 3RNUA 3CPWA 3TRZA 4BWGB 3S2HB 4CDDC 1KLGD 3HOWB 4JCVE 4JI1Q 2R92B 4A93B 1Q81C 3HKSA 2PYKA 1VQ6A 2F3IA 3PO2B 2VZAA 4O2DA 3G4SA 1EWHA 3CRKC 2MJ8A 2F0MA 2WAQG 4C3JG 3CKIB 1JOQA 4LF4Q 3K7UC 1RIPA 1ONLA 3MXPA 5EPKA 3ZYYX 3LWUA 1D5MC 1OXXK 2JA6B 4IUNA 4DV7Q 2OF1A 5E1FA 1UE6A 3SVMA 2NYZD 3KF6B 1YITA 3W5OA 3AYHB 2SOBA 1G6PA 4U68A 1HNZL 5C44H 5GROA 1YIJA 3X3NA 2R7ZG 1K0RA 1HH2P 3GTOH 1XMQQ 4RCNA 1YNJC 3KYHC 1CUKA 1YNXA 4BXXG 4LF5Q 4LF8L 4KK7A 1PH6A 3LWEA 3GDEA 1GUNA 2DN8A 1ET9A 4LFCQ 5LL6S 2PW7A 3A8KE 4TSSA 1U4PA 1EFWA 3NBIA 3J81c 2V1CC 5IYDH 3TBIB 4CDFC 2X6LA 1JICA 4B3RL 2JK8A 4A3IB 2WACA 2DNCA 2Z4IA 1ICFB 4DAYA 1B53A 2HT1A 1BCPF 4Y7NH 1Q1EA 1N9WA 1QE6A 1F2YA 5KNCA 2EY1A 4GN5A 4CKBA 4IFDH 3A7LA 3GTKB 3PO2H 1PTOC 5C3EG 1G91A 4TQUS 2HDLA 2HHHQ 4OWWB 4RKBA 4AQYL 2DY7A 4FF1A 1HZBA 2CWAA 4H13C 2ZJRA 3LNNA 2L12A 3R93A 4B3SQ 3CCUA 2LS01 1PTOD 4DR4Q 1K83H 1SLJA 3NUCA 2KBNA 1XPUA 2K5WA 1XNRL 1STAA 1ZEQX 4ILWA 3CCMA 4FYDA 3MFYA 2ZT9C 3PUXA 4JI6L 3FPUB 4K2LA 3R3OA 1CA6A 1NJIC 4B3TL 2JA7G 2B63B 4FXDA 2WAQE 2GA4B 2F0FA 4KHVA 1CSPA 3FKIG 1GKHA 4HSPA 3SK6A 4XDXA 3KDFB 3HOXG 2B39A 2VUMG 1PFBA 4LFBL 2NUCA 2A69C 5K36H 2BH2A 1SNDA 4L5SA 5EGTA 3OW2A 4GOPB 2QDLA 5M3MB 4GN3B 1R4QB 4DR4L 5CR3A 2UUAL 2E2IH 2PNHA 2VXWA 4FDBA 1VQDA 1AN8A 1DGSA 4DNIA 1WTXA 1Q90A 3RZOB 4PMCA 1NUCA 2EIFA 4JK1C 4JI4Q 3BDOA 2DUDA 3RLFA 2IHEA 3HOVH 1O7IA 2YTXA 4OHJA 4DR1L 4DAVA 4ZKCB 1XWEA 5IYDG 1K83B 2CHBD 2JA7H 4KLKA 2HCIA 1Y8NB 1Q12A 1BDOA 1F9SA 2R61A 4TRDA 5LL6X 2WAQB 4HJ9A 2MP1A 2A74C 4DR7Q 2D62A 4A3DB 1L0WA 3CF5A 2XNAC 1QNUA 1VQHA 2DJGC 2L11A 4X3UA 3NP8A 4EVOA 5M5XH 1HA6A 2L5TA 1HR0L 1XPOA 1WTRA 1FJGL 5M5WB 3H15A 3WOFA 3ULJA 1SYGA 4ZK9B 2AUJD 4HEDA 2PZTA 2FMMA 4DK3C 1OXVA 3QO2A 4EGVA 5M5YB 4XTCS 4WJ3M 1I6HH 4NKLA 1TIID 4YHHL 5C0XJ 2DGYA 1H95A 3N6RA 1TWGB 2YTVA 1KD1C 2PQEA 2OWOA 4GN4B 2DJFC 1IBKL 1HNWQ 2CCZA 1D2BA 1EIYB 4IPDA 1KQSA 4C3JH 1KHIA 4HIMA 3QR8A 4RHRA 4YWKA 3I4NH 2IY5B 2XN9C 3JAMi 4JI0L 2KJXA 3RLNA 3UDFA 5C44B 1UAPA 1X32A 4M1UB 4LAAA 3HOZB 4LF4L 2K5NA 4A3EB 4GZYC 2SDFA 4A3GG 4BXXH 2CW0D 1B7YB 2B2VA 2HHHL 1RD9D 1I4HA 1FNVA 1II3A 1V9PA 1G2SA 5H1SE 1X3PA 1K3RA 1NSNS 4RHSA 4DV2L 4A3JG 5C44G 3A8IE 4P74A 5DEHA 1S5CD 3R8BA 1PYWD 2EPBA 2QW7A 4DV6L 4DAMA 4JBKA 2WP8J 3BYYB 1PHJA 2GN5A 3CCEA 4UP9A 3H91A 2CVRA 4A3KG 2E5LQ 4B3RQ 1CK1A 3CRLC 4O0AA 4KHPL 1GUWA 5EQ0A 3MHBA 4PZ7A 4UPAA 4DKAC 3OMCA 1P8LA 2R92G 4DGZA 1EU4A 3STBD 1Q82C 3HS0C 1HZ9A 3GTPH 3DUZA 3GTJH 3S9WA 4LF9L 2B2WA 2K7VA 4CJ2C 3CPFA 4DXGA 4DXFA 5D3DA 5FJ8H 4LF5L 4LF8Q 4HCSA 1J9OA 4GOPA 2F0WA 4ZAIA 3Q0AA 2RCNA 2Z9HA 3G7LA 5E4XA 1QVFA 2IJ0A 5IT9E 5ELOA 1HHVA 1QZGA 4IJHA 2F0JA 3I7FA 1WD0A 1JOOA 1WCMB 4POFA 1N8RC 4IUPA 4OO1G 1Y1VH 3MEHA 3E3XA 3ERSX 4R1JA 2F4VQ 1JJGA 1OO9B 4BBRH 1C9OA 5IYBG 2K75A 3HOXB 3K0YA 5CV4A 4BY7B 1VQBA 2H1EA 2Z0SA 1J6QA 1RJTA 4RGOS 3VR6A 2ZM6L 1M8AA 2A6EC 1K9MC 2K5VA 3EN2A 4FVMA 3KJPA 1S5FD 2JA5H 1D1IA 3S2DB 3G6EA 4RGNA 4DV1L 1Y1VG 4X66L 2PMZE 1LTTD 2B2WC 4ZLTF 4B3ML 4OO1H 4GOPC 3HP3A 1NMFA 1X56A 3DXJC 1EY4A 3PUYA 2Z6BA 3T1HQ 4UP8A 3DWPA 2EY5A 4FXGC 2I0QA 4RGMA 2RF4A 4BBSH 2KHJA 5IGDA 2RSOA 2CQAA 1JB3A 5GQOA 4ZKBB 5I4DA 1FVIA 3E0JA 5BR8Q 2F0IA 2NZHA 4DV0Q 1NR4A 1BQQT 1QCBD 5JVH3 2G9DA 2V4DA 4X65L 3CQZB 3P20A 1STYA 1ILPA 1SYFA 3Q24A 2X6GA 3D4DA 3MXNB 3VDYA 3I90A 5J39A 1SMYC 2B2TC 2BCOA 4ZCKA 5IP9G 1YHQA 4BBRG 2B29A 3I70A 1LT4D 4XT1B 5M5WH 3NTKA 4BA1I 1B3QA 2NVYB 1ASZA 1U4LA 1C4QA 1QUQB 3M85A 4A3FB 1TY2A 4X62L 1VQ5A 4X65Q 3D4RA 3KLRA 3HOUG 2VB2X 1H9SA 3ERQA 1PRTC 5C5MA 1EY9A 4QY7A 3M9BA 5GAGC 1X65A 2NVYH 3SEBA 4DR7L 3U4ZA 5BR8L 1B4OA 1HZCA 1CSQA 5I6WA 3T1YL 2OTJA 1YJ9A 1YVCA 2M9VA 2MO1A 2OQ0A 4C3HG 4HJ7A 3HOZG 5E3FA 4AH6A 3K5OA 1PH1A 1PTOF 4DV6Q 2K52A 3P1HA 4JI5L 1OXTA 1JMCA 4ID6A 3CQZH 1BCPC 1Y8OB 1PFMA 2WB1E 2F1MA 3QIAA 2KCNA 3EFXD 3X3MA 1Z6HA 1V43A 3HOWG 5C3WA 4NXMQ 1BCPD 4K5VA 5C6AA 3J7YW 3H3VH 2Q2IA 2EJMA 1ESFA 4LFBQ 4CKCA 1U4RA 1LO5D 1KNEA 2QEXA 1BVSA 4KI0A 1BR9A 1EUJA 5JEAG 2YYZA 1DZ1A 1Q86C 3I8ZA 1XTCD 4L6TB 4LFAL 1IBKQ 4DUYQ 1DD2A 5FLMG 3D0FA 3HG9A 2A6ED 4DU9A 1XNRQ 1C7YA 4UY8C 3RR5A 1J5EQ 3HZXA 1GM5A 1O80A 2E76C 1I94L 4QGUA 3U58A 4HR7B 1KDAA 4YY3L 3RZOH 2ZTEA 3NWSA 3SDZA 2WB1B 5CV7A 1I4XA 1VQIA 1EEID 3KF8B 3SHLA 1Q1BA 1PYBA 2K5QA 1O7YA 2EY6A 3A74A 3QOJA 1WCMH 5C0XI 5KYLA 1LT5D 1AE2A 1AEXA 1AZQA 1KXLA 4K6DA 2QF7A 1V1PA 1XNQQ 4IALA 4YWLA 3M4OB 2O4XA 1UWVA 3HOXH 1L2FA 3GTQB 1SDFA 1E22A 4JBWA 5EKKA 3SXHA 5FO8B 3I3CA 2N78A 1EOVA 2ES2A 1P16A 3K59A 4A3BG 5LMNW 5JJZA 1I3QH 4EX5A 5ELBA 1TWFH 4XQQA 4F8MA 3NENA 2JJQA 2E2JB 4G7OC 4J8QA 3F8TA 4QB4A 4DV5L 3T1YQ 2NTSA 1NAPA 4C2MB 3Q6SA 1WTHA 3NSWA 1VQLA 2RKSA 2TMPA 4NXNQ 4YCUA 1DM0B 1S40A 2HQEA 4MN3A 3KJOA 1JORA 5A2QL 5JOBA 5EAYA 2WKCA 2A69D 2EJFC 2EYFA 5BN4A 3A5ZB 1PH4A 2A5HA 3ZJYC 1XTDA 2F03A 1IL8A 1B1ZA 1JWMD 4J6HA 1R9TH 3GTGB 3S1MB 1PTOB 1BO0A 4EQNA 4R4QA 2NTTA 1DONA 2KCCA 2NN6H 4RH6A 3J80c 1JE4A 2HCCA 4K8JA 4K14A 4DV4L 4A3IH 4K5WA 1FGBD 1YEZA 1ESRA 4DR2Q 1S4ZA 4GKJL 2XGTA 3UDGA 5CV6A 3DM3A 2ZXOA 3BJUA 4E6IA 1CZWA 2BDNA 4PMWA 3CAMA 3GP7A 4ZRZA 4POGA 3H6MA 5IODA 3K57A 1TQOA 1HCZA 3QWNA 1PRTB 2NVXB 5JEAJ 4ZUIA 3M7GA 3K7AH 1B9NA 3CC2A 4X3KA 5KGUA 4JI4L 3S1NB 2F3WA 4UP7A 4C3IB 5IGGA 2IX3A 2WFWA 1W2BA 3L3OC 1I4GA 4KD3A 4DNTB 2L9HA 4LFCL 3AU7A 4KJNA 2F0HA 3MC0B 1BUVT 1Q3LA 3A56A 1D1KA 1ZYRC 3K5NA 4C3HH 1XMQL 2G5DA 2HIVA 2RHSB 3S17B 3TN2A 4EQ5A 4JW0A 4LUVA 3MXNA 3FMCA 4HCEA 1ICWA 2JP1A 4OWXB 2EXDA 1VMCA 2KOLA 3PF4A 4IPCA 1L0YB 3OWFA 2XWJB 1BF4A 4P72A 1HQMC 4HTHA 3PUZA 2H5XA 2I07B 4NDXA 3S1MH 2NZOA 4O1NA 5ELCA 3MXGA 1CKMA 4LUZA 1F2ZA 4MIUA 3EA6A 2MHVA 2JA8B 3PO3B 1EQQA 2AWNA 2B2YA 2RCFA 3J7ZC 4G57A 1RODA 4V190 4IUQA 1O78A 4CDEC 2ZJQA 1QG7A 1SYCA 2K50A 1EOTA 4MHEA 4C1NI 1UNSA 1QB5D 5A35A 1IKMA 1UEBA 3JAMc 3TREA 1HPCA 2F0EA 3RN2A 4DFAA 1JOKA 2NB0A 3C1EA 5CV8A 2VQEQ 3OW7A 4XQNA 4G7ZC 3DM1A 1TWCH 4WORA 1ZXTA 4BBSG 1TT2A 5LMNL 4DR3Q 2EQSA 2JE6I 3V96A 1WI5A 3J80E 5FOBB 1IZ6A 1K8MA 3J81E 4HSVA 4X62Q 1EEFD 3TZUA 4AIMA 3I4OA 1OTCA 1X55A 3S14B 1K8OA 4I7ZC 1A8VA 1I4QA 1NMGA 1PYSB 2BA1A 3D6CA 2OXPA 3DMUA 1UEAB 2HUGA 3FPPA 3KLSX 2JA8G 3U4VA 1ZYRD 3M4QA 1Y1WB 4KTAA 2LMCB 5C4XG 2CWPA 1UE5A 3K0XA 3I4MG 5IYBH 1LTSD 2ICIA 4FNFA 1WTOA 4NMZA 2NN6I 2ATWA 1EYGA 4K0KQ 3F2DA 4ZQ3A 4R8IA 2F0NA 2JA9A 5LMNQ 1SNCA 1T5EA 1A3VA 1B9MA 3DWAA 4DR5L 1HNXQ 1TWHH 2B3GA 4KKUA 4LF6Q 4N9PA 4RA8A 1XPRA 2F4IA 5C0XG 1JB7A 4IN3A 3RD4A 1IBLQ 2LY7A 5I2YA 3MFGA 2B2UC 2A68D 5IT9c 2VY3A 2QDBA 5T1IA 3HOYB 3M4OH 1MD2D 1NBWA 1WJJA 2D2CC 1JJCB 1X54A 4U673 1U0LA 3NEMA 3L7ZC 1TS3A 1WCMG 2VQEL 2R93G 1T5XD 4P75A 4X66Q 3CP0A 1XNQL 2M00A 2ENBA 2DY8A 2KCTA 3HOYG 1VQPA 2P5ZX 1ENAA 4IPHA 1PV4A 1B2TA 2N49A 4JYAL 1PH8A 4GKKQ 3IL8A 2PNRC 3OMGA 4DR6L 4LJZC 1EY8A 1V1PB 4FF2A 3RZDH 1GHJA 4A75A 1C8CA 2Q2UA 4PZ6A 2EYOA 1ASYA 2RSNA 3GV6A 3JAME 2I46A 2OEOA 1U4MA 1GHKA 1CI3M 1MIUA 4HIDA 1JJ2A 5IT9L 1STBA 1T9HA 4A3CH 1G2TA 1L1OB 5KYIA 2UXCL 5EBCA 1VQMA 4LFAQ 1VQ7A 1EYDA 1TY0A 3GTJB 1HTPA 4AQYQ 1K0SA 3A5UA 1GJXA 4HJAA 4PG3A 3HOWH 2J7ZA 1IYUA 1EWIA 4JI6Q 2WINB 4GKKL 5FLXc 4LWCA 5M3FB 2MNAA 3ICEA 3A8JE 3J81L 4DUZL 1G8ZD 2SNSA 1N32L 2KQ3A 4X3TA 1SBBB 4DK1A 3TDQA 4ULLA 1HRJA 5TSSA 1LLRD 1YHBA 4C3IG 3CHBD 5AFWA 3C2PA 2Y0SE 3PCOB 1GUOA 1S3OA 1VQ4A 3S1RH 1SAPA 4F7XA 1FYCA 4JOIA 3RN5A 4RG1A 4ODGA 4XYQA 3I4NB 2LSSA 3SGIA 2PI2A 4JI7L 4MZ9A 1E1OA 3NBHA 5G3LD 4OXPA 1H9RA 5JJKA 1FNUA 3S1QB 1QNKA 4Z9CB 4HMJA 1Q7YC 4DK0A 5CBEE 4N8X1 1MGSA 2NN6G 1WTVA 2PZWA 1SEBD 3IAYA 1F2LA 1DOLA 4JI2Q 1R4PB 2L1BA 2Z8LA 4I7AA 1MI2A 4TVAB 3S1QH 3QJYA 1UE1A 1CM9A 1X3EA 2B8FA 1LT6D 2N88A 1EIHA 2RDHA 5M3FG 1FR3A 3TS2A 2EOTA 3V05A 3S2DH 4KN4C 1JCKB 4XT3B 1DCZA 3GTOB 1MSHA 2K32A 3C46A 4KY7A 3S14H 3J81j 2O5JC 1MBYA 4GS3A 3WWVA 1BCPB 1PRTD 2C35B 1YHAA 1O7LA 4XYOA 4AYBB 4OWTB 5LMUQ 4JI7Q 1HR0Q 2VUMH 5CMDA 1LTBD 1A6XA 5C0XH 3U50C 4CJ1B 3U9OA 1A0IA 5C4JB 4G7HC 2F52A 1HFNA 3TS0A 2PMZB 3FHWA 5JPMC 1V1OA 3DWQA 3K58A 2ZM6Q 2FINB 1PH2A 4CKEA 2Q8TA 3G6JB 2HD3A 2NVTB 4JI1L 2LKVA 3IFTA 4FO2A 4B3MQ 1I3QB 1XJVA 3K6OA 4OEMB 4DV1Q 2A68C 5GADC 2CKZB 2EE1A 4BY7H 1CA5A 5D14A 3NWTA 3MXUA 1YNNC 5C5LA 5CORA 2B8GA 3OTOQ 1D5XC 3H3VI 4QIWE 2KVMA 1CKNA 1I4RA 3BVZA 5COYA 5EPJA 2F4VL 2PI2E 2ZXPA 3SK8A 1SRUA 2PCFB 1J8IA 4DUYL 1VQFA 3QG1A 3CXCA 3GO5A 4YY3Q 4OELB 1CQFA 3VR5A 3F1ZA 2D0PA
chains in the Genus database with same CATH topology
3I4MB 1PZKD 2D9UA 3GTPB 1AW7A 1SYDA 4K2KA 5JEAH 2AWOA 4KMUC 1LTAD 2NZ1D 2YU9B 3S16B 3SR1A 3H09A 5LHY1 1F9RA 2MGSA 1YNJD 4ZUJA 3ND8A 3A7AB 1CZGA 4YIJA 1TWHB 1RDPD 4QCLA 1CT1D 2KA7A 4C56C 1JWUD 3PUVA 2OT2A 2CW0C 3VYTA 4OIKA 1IHZA 1Z47A 3FEWX 3GTLB 1Z7TA 2R3ZA 2E2HB 2ICEC 3NTHA 3A55A 3VYSA 4A3BB 2QILA 3P75A 1LTGD 2ZXRA 1WTQA 3S15B 1HFGA 3T4AC 2F0TA 1VCIA 1SNMA 2TSSA 2KHSA 1SE3A 4V0BA 4BY1B 3TP5A 1JC7A 1SSOA 2K1BA 2FJ2A 2B2VC 3K5MA 2K33A 2AUKA 1W6KA 3W3AA 5FO9B 2IPKD 5ELDA 1KNAA 4C3JB 4X3SA 4KKSA 2NWGA 1H9JA 4QUCA 4LK1C 2EVBA 5KNBA 5M5XB 4I65A 2F0LA 3S1RB 4R8NA 1S5BD 1A2UA 1CTMA 5K5PA 3BS1A 2E2DC 3KUPA 1RTNA 1EL0A 4FXKC 1KDBA 3D8GA 3TMEA 3BVMA 5BN5A 1SJED 2D5DA 1SNPA 2EYPA 1GUTA 4A3GB 2PW5A 3W2DA 1JWSD 2VNUD 1E2ZA 4A3JB 3OPOA 3OHXC 4PQXA 3D4WA 3OOCA 2JEBI 3HEJA 1TU2B 2B2YC 1AZPA 1L0XB 1QILA 5CBAE 1W6JA 1RTOA 4FP5D 2XWBB 1JQYD 1WVLA 2IX0A 1S5ED 2O5IC 1ILQA 1M4VA 5KIXA 1GUGA 2A6HC 4NP5A 4PMBA 1VF5C 2MUYA 2F0OA 4RAUC 3J80L 3DHQA 4C1NK 3VYUA 4DF7A 2L55A 4EQPA 1B50A 1F9QA 3MA2B 1EFID 1SJHD 3BVGA 3TP6A 1F2MA 3NQIA 2M2LA 4CHTB 2F0PA 1I50B 5I6YA 2DNEA 1FD7D 1LTRD 3HRZC 2J0TD 4F88A 4Y7NB 4XIGS 1WD1A 5J22A 4XQJA 3KLSA 1KTKA 2VUMB 3HOVB 1PMRA 3GD7A 5DM73 1HUMA 4N9TA 1RHPA 1MSGA 2X69A 2QEJC 3BDLA 2F0GA 2G9HD 1BOSA 1I6HB 5C4ZA 2K5DA 3NXWA 2FMCA 1EZ8A 1SFOB 2EDGA 2QKIC 1XYIA 4A3KB 2H4OA 2Q8IB 1Q8IA 5IGCA 2RVLA 1E2VA 4DA2A 5I9PA 4RWSC 3IFDA 2N55A 1PTOH 1TKWB 5C3XA 3Q22A 2K6AA 1DXMA 1KABA 1EU3A 1TWCB 3KBGA 1WTWA 2RDFA 5JPNC 1TR5A 1G291 3D3RA 2B2TA 1TS5A 3N52A 1GOZA 4K5XA 2R93B 5T1GA 1TVXA 2RQXA 4XXEA 1EZ6A 1DOKA 3J7AF 1HXYD 4WRDA 4IUVA 3HGBA 5C3EB 3M7NA 4CJ0B 3EJIA 2A6HD 4BS9A 2JEAI 3H0GB 5F2DA 3OWEB 2EJGC 5IGFA 1KAAA 4G4KA 2L0CA 4Q0FA 2Z4HA 5CC4A 4DNRB 1PZJD 3Q23A 4L63B 3WOEA 1FNWA 1IW7D 3EROA 1ENCA 1PLFA 1QWYA 2K04A 3BDCA 4A3MB 4UDUC 3SE0A 4R9WA 2C5CA 3ITPA 5FK9C 2ID0A 1AFPA 3OSOA 1SXTA 2XRQD 5K36G 1STGA 1AP0A 2AQ2B 2WIIB 1IYVA 1EY7A 2E2IB 2BDOA 4EQOA 3T16A 5I2XA 2K01A 3LX0A 1UUPA 1VDZA 4TKOB 3IKJA 1GXDC 4B9WA 2AQ3B 2PPBC 4KD4A 2E75C 3EVQA 1Y8PB 4QMGA 2F0SA 3PV0A 3J7AV 4QF4A 2AQ1B 4IFDG 2JSOA 1Y69U 3TP8A 2MPMA 5CYUA 4KY6A 1LTID 3DEPA 5NUCA 1ML0D 1R9TB 4S3SA 1IW7C 2EZVA 5EJWA 1I6VC 5EKIA 2SEBD 4IFDI 1F9PA 1QOHA 2EYLA 3UI2A 1V8QA 5J1ZA 4RCOA 2PZUA 3GTMB 1BXTA 3D31A 1C48A 1OXUA 4NW2A 1TWFB 1IKLA 4HN7A 2RA4A 1BBXC 4F87A 2BE5C 1HA5A 3K5LA 2K05A 3VYRA 5M9OA 2LFNA 2XVSA 3WDNA 3PIP3 1EYCA 3FVQA 2PO4A 1D5ZC 1H9SB 4PV1C 3PMFA 1VMPA 1STNA 5C4XB 1H9KA 3P7JA 1HTLD 3MVVA 5IIFA 5A2QE 5DNFA 3AB9A 2SNMA 4BA2I 3H94A 1STHA 1D6EC 2K03A 4IQZA 1RCVD 1A2TA 1DJRD 4K8IA 1PFNA 5JVG3 1EY0A 4IURA 4L8JA 1A3TA 1SYEA 4QUFA 2Y0SB 3PIO3 3K7AB 5DM63 3I73A 3R2IA 3VR4A 4QIWB 4KN7C 3E5SA 3T13A 1XX8A 3NTIA 2IT1A 5EPLA 4WFN3 3BYTB 3JAML 3VA7A 3TSSA 3O13A 3AMUA 2R6GA 5BN3A 3R2TA 1EIGA 3GV3A 4IUUA 4IUTA 5E4WC 1EQVA 4IZ8A 2F0KA 3TP7A 3V2TA 4RFBA 3FKIB 2KEDA 2JYOA 1H9MA 2WV6D 2BA0A 2F3VA 4IFDJ 1I4PA 5KRUA 4C3HB 2WKDA 4HMIA 1CHPD 3SK5A 4KKTA 1PZID 2HDMA 3F2UA 1DOMA 5EKLA 2KECA 5DAUA 1KDCA 2XSCA 2BOSA 1SNOA 3NE5B 1A15A 2RBMA 1E2WA 1ENFA 1KLUD 2E74C 4FF4A 3QB3A 3QOLA 2A73B 1S5DD 1B44D 4DN4M 2F0VA 1A3UA 1GUSA 5D65A 1QJOA 4OL7A 3EQLC 1PDQA 2FHTA 4WJWA 3NK9A 4DAPA 5ISRA 5C4HA 1ZKOA 1VF7A 1HQRD 4BBSB 3NQTA 1TWAB 2IX1A 2NVQB 2XIWA 3KK7A 2JXMB 4Q5VA 5ELFA 2F0DA 3SK4A 3ND9A 1B3AA 1BNZA 4KY5A 3C3LA 4K6LA 3HOUB 4H0LC 4B08A 1LV9A 4RGTA 1U9RA 2KEEA 3I91A 4P2CB 2F0UA 2L4NA 2EY2A 4CGYB 4KJOA 5I9OA 1SE4A 3VR2A 3VR3A 4BBRB 5KEEA 1EWCA 1LABA 2R7ZB 4RKLA 1PXUA 2J4XA 2B2UA 2VB3X 1DYQA 3L9AX 3MWYW 1NCVA 3URYA 3RUZA 5CV9A 5JAVA 5G3LF 3M4YA 3MZ5A 2FFKB 3FRPB 1PRTF 4CBVA 5HURA 1Y1VB 5FLXE 3NPPA 1YNND 5IGBA 2C9OA 3NHHA 3I4LA 1TS2A 1STEA 3KF8A 3U9SA 2EYHA 4PNYA 5IOCA 2EYJA 4J1MA 5EBDA 3H3VC 3C1FA 1X3QA 3D6WA 5IGEA 1JR0D 3TZDA 2F0QA 4M8AA 4OO1I 4OGQC 4ABNA 1EY5A 2IWHA 1OXSC 4B9XA 3GQBA 1WTPA 3DEOA 3M3YB 3OIQA 2IL8A 2IW3A 1LACA 5KNDA 2RDGA 3KBXA 4KHZA 3MTSA 2NBFA 3BZDB 4HAEA 2EYMA 1NR2A 3A54A 5D3IB 5ELEA 3T53B 3ONAB 5CGKA 5CV5A 4OIJA 2Z1CA 2Q8RE 5FKAC 4UAIA 1SNQA 1XXGA 1SYBA 2QCPX 3OIPA 1LT3D 2EXZA 1RKNA 3RMHA 4H44C 1EQTA 5FO7B 3HKZB 1G6ZA 4ME5A 1ET6A 1F77A 1EY6A 1HUNA 4O42A 4H7BA 1SMYD 1CFMA 2JA7B 3BG3A 3I72A 2JA5B 3E6ZX 4LMQD 3FDTA 1E0BA 3CU7A 5FLXL 2XRSD 1CQVA 4ZYSA 1CHQD 1TS4A 2KUMA 3T51B 5HGTA 3RZDB 3T56B 1EYAA 1O7ZA 3PUWA 3VA5A 2BE5D 3MAQA 4FF3A 4KV6A 1SE2A 1RF2D 2O2LD 2K28A 4BWGB 3S2HB 1KLGD 3HOWB 2R92B 4A93B 2PYKA 3PO2B 1EWHA 3CRKC 2MJ8A 2F0MA 4C3JG 3CKIB 1JOQA 3MXPA 1ONLA 5EPKA 3ZYYX 3LWUA 1D5MC 1OXXK 2JA6B 4IUNA 2OF1A 5E1FA 3SVMA 2NYZD 2SOBA 4U68A 3X3NA 4RCNA 1YNJC 4KK7A 3LWEA 1GUNA 2DN8A 1ET9A 5LL6S 2PW7A 3A8KE 4TSSA 1U4PA 3NBIA 3TBIB 2X6LA 1JICA 4A3IB 2WACA 2DNCA 2Z4IA 4DAYA 1B53A 1BCPF 1Q1EA 1QE6A 1F2YA 5KNCA 2EY1A 4CKBA 4IFDH 3A7LA 3GTKB 1PTOC 1G91A 4TQUS 2HDLA 4RKBA 2DY7A 4FF1A 4H13C 3LNNA 2L12A 3R93A 2LS01 1PTOD 3NUCA 2K5WA 4FYDA 1STAA 1ZEQX 4ILWA 3MFYA 2ZT9C 3PUXA 3FPUB 4K2LA 3R3OA 1CA6A 2B63B 4FXDA 2GA4B 2F0FA 4KHVA 4HSPA 3SK6A 4XDXA 2B39A 1PFBA 2NUCA 2A69C 5K36H 1SNDA 5EGTA 5M3MB 1R4QB 5CR3A 2VXWA 1AN8A 1WTXA 1Q90A 3RZOB 4PMCA 1NUCA 4JK1C 3BDOA 3RLFA 4OHJA 4DAVA 4ZKCB 1XWEA 1K83B 2CHBD 2HCIA 1Y8NB 1Q12A 1BDOA 1F9SA 2R61A 4TRDA 5LL6X 2WAQB 2MP1A 2A74C 2D62A 4A3DB 2XNAC 1QNUA 2L11A 4X3UA 3NP8A 4EVOA 1HA6A 2L5TA 1WTRA 5M5WB 3WOFA 1SYGA 4ZK9B 2AUJD 4HEDA 2PZTA 2FMMA 1OXVA 3QO2A 4EGVA 5M5YB 4XTCS 4NKLA 1TIID 5C0XJ 3N6RA 1TWGB 2PQEA 1D2BA 4RHRA 2XN9C 2KJXA 5C44B 1UAPA 1X32A 4M1UB 4LAAA 3HOZB 4A3EB 4GZYC 2SDFA 2CW0D 2B2VA 1RD9D 1I4HA 1FNVA 1II3A 1G2SA 1X3PA 1NSNS 4RHSA 3A8IE 5DEHA 1S5CD 3R8BA 1PYWD 2EPBA 2WP8J 3BYYB 3H91A 2CVRA 1CK1A 3CRLC 1GUWA 5EQ0A 3MHBA 3OMCA 4DGZA 1EU4A 3HS0C 3DUZA 3S9WA 2B2WA 2K7VA 4CJ2C 4DXFA 4DXGA 5D3DA 4HCSA 1J9OA 2F0WA 4ZAIA 3Q0AA 3G7LA 5E4XA 2IJ0A 5IT9E 1HHVA 2F0JA 1WD0A 1JOOA 1WCMB 4OO1G 4IUPA 3MEHA 1OO9B 3HOXB 3K0YA 5CV4A 4BY7B 2H1EA 1RJTA 4RGOS 3VR6A 1M8AA 2A6EC 4FVMA 1S5FD 1D1IA 3S2DB 4RGNA 1LTTD 2B2WC 4ZLTF 4OO1H 3HP3A 3DXJC 1EY4A 3PUYA 3DWPA 2EY5A 4FXGC 4RGMA 5IGDA 2RSOA 2CQAA 1JB3A 4ZKBB 5I4DA 3E0JA 2F0IA 1NR4A 1BQQT 1QCBD 5JVH3 2G9DA 2V4DA 3CQZB 3P20A 1STYA 1ILPA 1SYFA 3Q24A 2X6GA 3D4DA 3I90A 5J39A 1SMYC 2B2TC 2BCOA 3I70A 1LT4D 4XT1B 3NTKA 4BA1I 2NVYB 1U4LA 1C4QA 3M85A 4A3FB 1TY2A 3D4RA 3KLRA 2VB2X 1H9SA 3ERQA 1PRTC 5C5MA 1EY9A 3SEBA 1B4OA 5I6WA 2M9VA 4C3HG 5E3FA 3K5OA 1PTOF 3P1HA 1OXTA 4ID6A 1BCPC 1Y8OB 1PFMA 2F1MA 3QIAA 2KCNA 3EFXD 3X3MA 1Z6HA 1V43A 5C3WA 1BCPD 4K5VA 5C6AA 3J7YW 2EJMA 1ESFA 4CKCA 1U4RA 1LO5D 1KNEA 4KI0A 1BR9A 5JEAG 2YYZA 1DZ1A 3I8ZA 1XTCD 4L6TB 1DD2A 3HG9A 2A6ED 4DU9A 3HZXA 1O80A 2E76C 4HR7B 1KDAA 3NWSA 3SDZA 2WB1B 5CV7A 1I4XA 1EEID 3SHLA 1Q1BA 2K5QA 1O7YA 2EY6A 3QOJA 5C0XI 5KYLA 1LT5D 1AEXA 1AZQA 4K6DA 2QF7A 1V1PA 4IALA 3M4OB 2O4XA 3GTQB 1SDFA 4JBWA 5EKKA 3SXHA 5FO8B 3I3CA 3K59A 5JJZA 5ELBA 4XQQA 4F8MA 2E2JB 4G7OC 4J8QA 4QB4A 2NTSA 1NAPA 4C2MB 3Q6SA 3NSWA 2RKSA 2TMPA 1DM0B 2HQEA 4MN3A 1JORA 5A2QL 5JOBA 2WKCA 2A69D 2EJFC 2EYFA 5BN4A 2A5HA 2F03A 1IL8A 1B1ZA 1JWMD 4J6HA 3S1MB 3GTGB 1PTOB 1BO0A 4EQNA 2NTTA 1DONA 2KCCA 2NN6H 4RH6A 1JE4A 2HCCA 4K8JA 4K14A 4K5WA 1FGBD 1ESRA 1S4ZA 5CV6A 2ZXOA 4E6IA 1CZWA 2BDNA 4PMWA 3GP7A 4ZRZA 3H6MA 5IODA 3K57A 1TQOA 1HCZA 3QWNA 1PRTB 2NVXB 5JEAJ 4ZUIA 3M7GA 1B9NA 4X3KA 5KGUA 3S1NB 2F3WA 4C3IB 5IGGA 2IX3A 3L3OC 1I4GA 4KD3A 4DNTB 2L9HA 3AU7A 4KJNA 2F0HA 1BUVT 3MC0B 1Q3LA 3A56A 1D1KA 1ZYRC 3K5NA 3S17B 3TN2A 3MXNA 3FMCA 4HCEA 1ICWA 2JP1A 1VMCA 2KOLA 1L0YB 3OWFA 2XWJB 1BF4A 1HQMC 4HTHA 3PUZA 2I07B 4NDXA 4O1NA 5ELCA 3MXGA 1F2ZA 4MIUA 3EA6A 2MHVA 2JA8B 3PO3B 2AWNA 2B2YA 4G57A 1RODA 4V190 4IUQA 1O78A 1QG7A 1SYCA 1EOTA 4MHEA 4C1NI 1UNSA 1QB5D 5A35A 1IKMA 1HPCA 2F0EA 4DFAA 1JOKA 2NB0A 3C1EA 5CV8A 3OW7A 4XQNA 4G7ZC 3DM1A 4WORA 1ZXTA 1TT2A 2JE6I 3V96A 3J80E 5FOBB 1K8MA 3J81E 4HSVA 1EEFD 3TZUA 3S14B 1K8OA 4I7ZC 1I4QA 2BA1A 3D6CA 2OXPA 3DMUA 1UEAB 2HUGA 3FPPA 3KLSX 1ZYRD 1Y1WB 4KTAA 2LMCB 1LTSD 2ICIA 4FNFA 1WTOA 4NMZA 2NN6I 4ZQ3A 4R8IA 2F0NA 1SNCA 1T5EA 1A3VA 1B9MA 3DWAA 4KKUA 4N9PA 4RA8A 2F4IA 5C0XG 4IN3A 3RD4A 2LY7A 5I2YA 3MFGA 2B2UC 2A68D 5T1IA 2QDBA 3HOYB 1MD2D 2D2CC 4U673 3L7ZC 1TS3A 1T5XD 2M00A 2ENBA 2DY8A 1ENAA 1B2TA 3IL8A 2PNRC 3OMGA 1EY8A 4LJZC 1V1PB 4FF2A 1GHJA 1C8CA 2EYOA 2RSNA 3GV6A 3JAME 2I46A 2OEOA 1U4MA 1GHKA 1CI3M 5IT9L 1STBA 1G2TA 5KYIA 5EBCA 1EYDA 1TY0A 3GTJB 1HTPA 1GJXA 2J7ZA 1IYUA 2WINB 5M3FB 3A8JE 3J81L 1G8ZD 2SNSA 2KQ3A 4X3TA 1SBBB 4DK1A 3TDQA 4ULLA 1HRJA 5TSSA 1LLRD 4C3IG 3CHBD 5AFWA 3C2PA 1GUOA 1SAPA 4F7XA 1FYCA 4ODGA 4XYQA 3I4NB 3NBHA 5G3LD 1H9RA 1FNUA 3S1QB 1QNKA 4Z9CB 4HMJA 4DK0A 5CBEE 1MGSA 2NN6G 1WTVA 2PZWA 1SEBD 3IAYA 1F2LA 1DOLA 1R4PB 2L1BA 2Z8LA 1MI2A 3QJYA 1CM9A 2B8FA 1LT6D 2N88A 1EIHA 2RDHA 1FR3A 2EOTA 3V05A 4KN4C 1JCKB 4XT3B 1DCZA 3GTOB 1MSHA 2K32A 3C46A 4KY7A 2O5JC 1MBYA 1BCPB 1PRTD 1O7LA 4AYBB 4XYOA 5CMDA 1LTBD 1A6XA 5C0XH 4CJ1B 3U9OA 5C4JB 4G7HC 1HFNA 2PMZB 5JPMC 1V1OA 3DWQA 3K58A 2FINB 4CKEA 2Q8TA 3G6JB 2NVTB 2LKVA 3IFTA 4FO2A 1I3QB 3K6OA 2A68C 2EE1A 1CA5A 5D14A 3NWTA 3MXUA 1YNNC 5C5LA 5CORA 2B8GA 1D5XC 2KVMA 1I4RA 3BVZA 5COYA 5EPJA 2ZXPA 3SK8A 2PCFB 1J8IA 3QG1A 3GO5A 1CQFA 3VR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2V A;  1E2W A;  1H9R A;  1H9K A;  5K36 G;  4OO1 G;  2E74 C;  1GUT A;  2AUJ D;  5C0X G;  3T51 B;  1OXV A;  1E2Z A;  1Q1E A;  4XTC S;  1OXT A;  3OPO A;  3AB9 A;  5KNC A;  1HQM C;  3T56 B;  4BA2 I;  2A68 D;  3H94 A;  1IYV A;  4DK0 A;  4IFD H;  3PUZ A;  1TKW B;  3A7L A;  2NN6 G;  4IQZ A;  2BDO A;  2D2C C;  3OOC A;  1GUS A;  3PUW A;  2JEB I;  3N6R A;  3ND8 A;  5JEA H;  1DXM A;  2AWO A;  1QJO A;  4KMU C;  4TQU S;  1TU2 B;  3VR6 A;  2BE5 D;  3EQL C;  1Y8O B;  3L7Z C;  2A6E C;  2F1M A;  1VDZ A;  3QIA A;  4L8J A;  4OGQ C;  3QJY A;  4TKO B;  4H13 C;  3IKJ A;  2B8F A;  2O5I C;  1G29 1;  3A7A B;  3LNN A;  1OXS C;  1Z6H A;  2A69 D;  1ZKO A;  1VF7 A;  1V43 A;  1FR3 A;  2EJF C;  3GQB A;  4OO1 H;  2PPB C;  5BN4 A;  4KN4 C;  2EJM A;  1O78 A;  3I73 A;  1DCZ A;  1GUG A;  2A6H C;  2E75 C;  2KA7 A;  2K32 A;  2ZT9 C;  3MFY A;  3PUX A;  3VR4 A;  1VF5 C;  2JXM B;  1LAC A;  1Y8P B;  2PNR C;  3PUV A;  5A35 A;  5KND A;  2O5J C;  2CW0 C;  3DXJ C;  3PV0 A;  3PUY A;  4LJZ C;  1HPC A;  4KHZ A;  4KI0 A;  4KN7 C;  3ND9 A;  1EWH A;  5JEA G;  1O7L A;  2YYZ A;  4GZY C;  3CRK C;  2KCC A;  2NN6 H;  1GHJ A;  4IFD G;  2IT1 A;  4H0L C;  1Y69 U;  1Z7T A;  3OW7 A;  1ONL A;  1A6X A;  1DD2 A;  3LWU A;  1OXX K;  3VA7 A;  5C0X H;  4G7Z C;  2A6E D;  1GHK A;  3HGB A;  2A69 C;  3T53 B;  1CI3 M;  3A8I E;  5K36 H;  2JE6 I;  1VCI A;  3M7N A;  2V4D A;  1K8M A;  4G7H C;  2R6G A;  1IW7 C;  2E76 C;  3VR2 A;  2A6H D;  1HTP A;  3VR3 A;  3P20 A;  4HR7 B;  3TZU A;  1I6V C;  5BN3 A;  2JEA I;  1Q90 A;  1GJX A;  1LAB A;  2K33 A;  3SDZ A;  2AUK A;  3CRL C;  1HCZ A;  3W3A A;  4JK1 C;  2EJG C;  2DNE A;  1IYU A;  3BDO A;  1Q1B A;  3RLF A;  1K8O A;  1SMY C;  4I7Z C;  1V8Q A;  1H9M A;  4RCN A;  1YNJ C;  4XIG S;  2BA1 A;  2BA0 A;  3IFT A;  1B9N A;  3A8J E;  4DNR B;  1Y8N B;  3D31 A;  4BA1 I;  3FPP A;  1Q12 A;  4KKS A;  1PMR A;  1BDO A;  1OXU A;  3GD7 A;  4DK1 A;  1H9J A;  1GUN A;  4LK1 C;  2EVB A;  2DN8 A;  2LMC B;  2QF7 A;  5KNB A;  4H44 C;  2A68 C;  4DNT B;  3M85 A;  3M4Y A;  3A8K E;  4KKT A;  1IW7 D;  2K7V A;  4JBW A;  2NN6 I;  3MXU A;  2BE5 C;  1YNN C;  1CTM A;  3D4R A;  3KLR A;  2B8G A;  1H9S A;  2D62 A;  1GUO A;  1ZYR C;  3WDN A;  1FYC A;  3SE0 A;  1T5E A;  5BN5 A;  3I4L A;  1B9M A;  1CFM A;  2EDG A;  2D5D A;  2PCF B;  3BG3 A;  3NE5 B;  3I72 A;  3U9S A;  1H9S B;  3FMC A;  4PV1 C;  3QG1 A;  2L5T A;  4KKU A;  2Q8I B;  3VR5 A;  4G7O C;  2DNC A; 
#chains in the Genus database with same CATH topology
 1PA6 A;  5FJ8 G;  5JJI A;  3I4M B;  1PZK D;  2D9U A;  3GTP B;  4JOI C;  3BU2 A;  1AW7 A;  1SYD A;  4K2K A;  5JEA H;  2AWO A;  4KMU C;  1LTA D;  2NZ1 D;  2YU9 B;  3S16 B;  3SR1 A;  3H09 A;  5LHY 1;  5IP7 G;  1Y1W G;  1QUQ A;  1F9R A;  2MGS A;  1YNJ D;  4ZUJ A;  1K73 C;  3ND8 A;  3A7A B;  1CZG A;  4LF7 Q;  4A3K H;  4YIJ A;  1TWH B;  4DPG A;  1RDP D;  4QCL A;  1CT1 D;  5HGQ A;  1I5F A;  3I55 A;  2KA7 A;  4C56 C;  1JWU D;  3G48 A;  2BH8 A;  2KCM A;  3PUV A;  2OT2 A;  2CW0 C;  1HZA A;  3VYT A;  4OIK A;  1IHZ A;  1Z47 A;  1N33 L;  3FEW X;  3W1B A;  1W3S A;  2R7F A;  3GTL B;  1Z7T A;  2R3Z A;  2E2H B;  2ICE C;  3NTH A;  3A55 A;  4MNO A;  3VYS A;  4A3B B;  2QIL A;  5IP7 H;  1Y1W H;  3P75 A;  1LTG D;  2ZXR A;  1WTQ A;  3S15 B;  1HFG A;  3T4A C;  4DR2 L;  1A62 A;  2F0T A;  1VCI A;  1SNM A;  2TSS A;  2KHS A;  4LNQ A;  1SE3 A;  2QGQ A;  4V0B A;  4BY1 B;  3TP5 A;  1JC7 A;  1SSO A;  2K1B A;  2FJ2 A;  2B2V C;  3K5M A;  3I4N G;  2K33 A;  4L5T A;  2AUK A;  1W6K A;  3W3A A;  1PH5 A;  5FO9 B;  2IPK D;  5ELD A;  3AFQ A;  1KNA A;  4YHH Q;  4C3J B;  4X3S A;  3TQY A;  4KKS A;  2NWG A;  4X6A H;  1H9J A;  5IWA Q;  4QUC A;  4LK1 C;  2EVB A;  5KNB A;  2FXQ A;  5M5X B;  4I65 A;  1NTG A;  2F0L A;  3GTG H;  4JI2 L;  3S1R B;  5IWA L;  4R8N A;  3I2Z A;  1S5B D;  1A2U A;  4BY7 G;  1FGU A;  1CTM A;  5K5P A;  3BS1 A;  2E2D C;  3KUP A;  1VS0 A;  1RTN A;  4C2M H;  4DV0 L;  1EL0 A;  4FXK C;  4HIK A;  1KDB A;  3D8G A;  3TME A;  3BVM A;  5BN5 A;  3UDX A;  1SJE D;  2D5D A;  3S2H H;  3KF6 A;  1SNP A;  4JPB W;  1FJG Q;  2EYP A;  1GUT A;  1N36 L;  4A3G B;  4ME3 A;  2PW5 A;  3W2D A;  1JWS D;  4A3I G;  2VQF Q;  2VNU D;  1E2Z A;  4A3J B;  3OPO A;  2UUB Q;  2UUC Q;  3OHX C;  1Q46 A;  4PQX A;  4R4C A;  3D4W A;  3J81 i;  3OOC A;  4JV5 Q;  2JEB I;  3HEJ A;  1TU2 B;  2B2Y C;  1L0X B;  1QIL A;  1AZP A;  5CBA E;  5E7N A;  4A93 G;  1W6J A;  1RTO A;  1SRO A;  4FP5 D;  1YJW A;  2XWB B;  1JQY D;  3HOV G;  1WVL A;  2IX0 A;  1S5E D;  2O5I C;  3T1H L;  1IYJ B;  2UUA Q;  1WFQ A;  1ILQ A;  1M4V A;  2UXB Q;  5KIX A;  1GUG A;  2A6H C;  4A3D G;  4NP5 A;  2JA5 G;  4PMB A;  1VF5 C;  2MUY A;  3PF5 A;  1A63 A;  2F0O A;  4RAU C;  5AJ3 L;  3J80 L;  3DHQ A;  3HKZ G;  4JBM A;  4C1N K;  3TEH B;  3VYU A;  4DF7 A;  2L55 A;  1D8L A;  3AEV A;  1J5E L;  4EQP A;  3CCL A;  1B50 A;  1F9Q A;  3S1N H;  2B63 G;  3MA2 B;  1EFI D;  1SJH D;  3L2P A;  3BVG A;  3TP6 A;  1F2M A;  2A19 A;  3NQI A;  1FL0 A;  2M2L A;  4CHT B;  2F0P A;  1I50 B;  4B3T Q;  5I6Y A;  1E24 A;  1Y14 B;  4AYB G;  4DR6 Q;  1VQ9 A;  2DNE A;  1FD7 D;  1LTR D;  3HRZ C;  2J0T D;  4F88 A;  2WB1 G;  4Y7N B;  2GVB A;  1B70 B;  4XIG S;  1WD1 A;  4NXM L;  5J22 A;  4XQJ A;  2ALY B;  5C3E H;  3KLS A;  1KTK A;  2VUM B;  3HOV B;  4JI8 L;  1PMR A;  3GD7 A;  5DM7 3;  1HUM A;  1LTL A;  1SFO H;  4N9T A;  4CDC C;  3GTK H;  3GTL H;  1RHP A;  1LYL A;  1MSG A;  2X69 A;  2QEJ C;  3BDL A;  4JG2 A;  2F0G A;  2G9H D;  1BOS A;  1I6H B;  4P71 A;  5C4Z A;  2K5D A;  3NXW A;  1QVG A;  2FMC A;  1EZ8 A;  1SFO B;  2EDG A;  1NY4 A;  2QKI C;  1XYI A;  1EQR A;  1B8A A;  3NBH B;  4A3K B;  1WOC A;  4DV4 Q;  3CC4 A;  2H4O A;  3PSI A;  1Q8I A;  2Q8I B;  3F2C A;  4A3M G;  5IGC A;  1AH9 A;  2RVL A;  1E2V A;  3W1G A;  3HFZ B;  5DLQ E;  4DA2 A;  5I9P A;  4RWS C;  2JQO A;  3IFD A;  4DR5 Q;  1N32 Q;  2N55 A;  1PTO H;  2VL6 A;  2YU9 H;  4A3L G;  1L1O A;  1IXR A;  4JI0 Q;  5C4J H;  1TKW B;  5C3X A;  4A3G H;  3Q22 A;  4GKJ Q;  2K6A A;  1DXM A;  4QQB X;  1KAB A;  5LMU L;  1EU3 A;  1TWC B;  2KEN A;  3KBG A;  4A3L H;  2YTY A;  1WTW A;  2RDF A;  5JPN C;  1TR5 A;  2E2J H;  1G29 1;  3D3R A;  1LM0 A;  2B2T A;  3PO3 H;  1TS5 A;  3N52 A;  1VQ8 A;  1GOZ A;  4K5X A;  2R93 B;  1HR0 W;  5T1G A;  4YCW A;  3AQQ A;  4GNX B;  1TVX A;  4IOC A;  2RQX A;  1HNZ Q;  1Q8K A;  3HKZ E;  4XXE A;  1EZ6 A;  3AFP A;  1DOK A;  3CCV A;  3J7A F;  2JA6 G;  1HXY D;  3CCR A;  4WJ4 A;  4WRD A;  3PIO A;  4IUV A;  4GLA C;  3LGJ A;  3HGB A;  4GLV B;  5C3E B;  2UXB L;  2Q2T A;  3UDI A;  3M7N A;  4CJ0 B;  1N34 L;  1TXY A;  3A0J A;  1MKH A;  3EJI A;  2A6H D;  4BS9 A;  2JEA I;  4A3C G;  1E1T A;  3IRB A;  3H0G B;  1GO3 E;  5F2D A;  3OWE B;  2EJG C;  1JT8 A;  5M3M G;  5IGF A;  1KAA A;  4G4K A;  1C0A A;  2L0C A;  4Q0F A;  2Z4H A;  5CC4 A;  4DNR B;  1PZJ D;  3Q23 A;  4IO9 A;  4L63 B;  1YJN A;  3WOE A;  3ER0 A;  4A3M H;  1L1O C;  3KDF A;  2IHF A;  4YCV A;  1K3B C;  4MTK A;  4LF6 L;  1FNW A;  5IP9 H;  1IW7 D;  5M5Y H;  1HNX L;  3ERO A;  1ENC A;  1PLF A;  4OX9 Q;  3HOY H;  3M4P A;  1QWY A;  2K04 A;  1D7Q A;  2ASB A;  3BDC A;  4A3M B;  4UDU C;  4PZ8 A;  3SE0 A;  4R9W A;  2C5C A;  3ITP A;  3E0E A;  5FK9 C;  3EIV A;  2ID0 A;  1AFP A;  3OSO A;  2I5M X;  3S16 H;  1X3G A;  1SXT A;  4APV A;  2XRQ D;  5K36 G;  1STG A;  1GD7 A;  1AP0 A;  2AQ2 B;  3E9H A;  2NVX H;  2UXC Q;  4MTN A;  2WII B;  1IYV A;  1VQJ A;  4A93 H;  1EY7 A;  2E2I B;  1IBM L;  2BDO A;  3CCS A;  4EQO A;  3T16 A;  5I2X A;  2K01 A;  3LX0 A;  1UUP A;  1VDZ A;  2QA4 A;  4TKO B;  3IKJ A;  1GXD C;  4UHV A;  4B9W A;  2AQ3 B;  5AJ3 Q;  2UXD Q;  1E3P A;  1PH3 A;  2B63 H;  2HQL A;  2AMC B;  2PPB C;  3GTM H;  4KD4 A;  2E75 C;  1IL2 A;  4R4O A;  3EVQ A;  4JVZ A;  4DV3 L;  1Y8P B;  4QMG A;  4JI5 Q;  2F0S A;  3BZK A;  3PV0 A;  4L5R C;  3PO2 G;  3J7A V;  2N8N A;  4QF4 A;  1BKB A;  2AQ1 B;  4IFD G;  2JSO A;  1Y69 U;  3TP8 A;  4IPG A;  2MPM A;  5L37 A;  3M3Y H;  1CKN B;  1NE3 A;  2ZJP A;  3G71 A;  5CYU A;  2OQK A;  1S72 A;  3OYY A;  4KY6 A;  2UUC L;  1LTI D;  2Y0S G;  3CW2 C;  3DEP A;  4N8F A;  5NUC A;  2LXJ A;  1X9N A;  4LF7 L;  1N36 Q;  1ML0 D;  2UXD L;  4QJF A;  1R9T B;  4S3S A;  1K8G A;  3Q8D A;  1IW7 C;  2EZV A;  5EJW A;  2UU9 Q;  1I6V C;  5EKI A;  2E8G A;  2SEB D;  1VQK A;  4IFD I;  1F9P A;  1QOH A;  4DV3 Q;  2EYL A;  3UI2 A;  1MJE A;  3GTQ H;  3NEL A;  2HIX A;  1V8Q A;  5J1Z A;  1EIF A;  1SR3 A;  3STB C;  4RCO A;  2PZU A;  3GTM B;  1BXT A;  2LXK A;  3D31 A;  1K8A C;  2A8V A;  1C48 A;  1OXU A;  4NW2 A;  1M90 C;  1TWF B;  1IKL A;  1HJP A;  2CFM A;  4HN7 A;  2RA4 A;  1BBX C;  1TWG H;  4F87 A;  2BE5 C;  1WYD A;  4BY1 H;  2R7Z H;  2OCE A;  1HA5 A;  3K5L A;  2K05 A;  3VYR A;  4R4T A;  5M9O A;  2LFN A;  2XVS A;  3WDN A;  3PIP 3;  1EYC A;  3OTO L;  2VW9 A;  3FVQ A;  2PO4 A;  1D5Z C;  1H9S B;  4PV1 C;  3KLW A;  3PMF A;  1VMP A;  1AE3 A;  4LW1 A;  1STN A;  5C4X B;  1H9K A;  3P7J A;  1HTL D;  3MVV A;  2K5H A;  5IYC G;  1MJC A;  3JC6 6;  5IIF A;  1KL9 A;  5DNF A;  5A2Q E;  3AB9 A;  4NPS A;  2SNM A;  4BA2 I;  3H94 A;  1STH A;  1D6E C;  2K03 A;  4H02 A;  4IQZ A;  1RCV D;  2A1A A;  2XTI A;  1A2T A;  1DJR D;  4K8I A;  1PFN A;  5JVG 3;  3FP9 A;  1EY0 A;  4IUR A;  4OON A;  3I56 A;  4L8J A;  2NVQ H;  4DAY B;  1A3T A;  1SYE A;  4IJL A;  4QUF A;  2GVA A;  2Y0S B;  3PIO 3;  3K7A B;  5DM6 3;  4JV5 L;  3KOJ A;  3I73 A;  3R2I A;  1LUZ A;  3VR4 A;  3ULP A;  3RLO A;  4QIW B;  3H0G H;  4KN7 C;  3E5S A;  3T13 A;  1M1K C;  1QZH A;  1XX8 A;  3NTI A;  1VQG A;  2IT1 A;  1N34 Q;  2D0O A;  5EPL A;  4WFN 3;  3BYT B;  1TWA H;  3JAM L;  3CC7 A;  3VA7 A;  5ELN A;  1KC8 C;  3TSS A;  3O13 A;  4NB3 A;  3CCJ A;  3AMU A;  2R6G A;  2K14 A;  5BN3 A;  1BBW A;  1YZ6 A;  3R2T A;  1EIG A;  3GV3 A;  4IUU A;  4IUT A;  4JI3 Q;  5E4W C;  5HY6 A;  1EQV A;  4IZ8 A;  2F0K A;  3TP7 A;  3V2T A;  3DLL A;  4RFB A;  3FKI B;  5IE8 A;  2KED A;  1PFS A;  2JYO A;  1SE8 A;  1H9M A;  2WV6 D;  1VQA A;  2BA0 A;  2F3V A;  4IFD J;  2ZTD A;  1I4P A;  2NVT H;  5KRU A;  4C3H B;  4A3F G;  2WKD A;  4AYB E;  1XMO Q;  4HMI A;  1QVC A;  1PVO A;  1CHP D;  3SK5 A;  1NNX A;  4KKT A;  1U5K A;  1K28 A;  1PZI D;  2HDM A;  4HIO A;  3F2U A;  1DOM A;  1BBU A;  2N3S A;  5EKL A;  2OTL A;  2KEC A;  5DAU A;  1KDC A;  5GAE C;  2XSC A;  2BOS A;  1SNO A;  3NE5 B;  1A15 A;  2VS1 A;  1VQC A;  2MO0 A;  4R4I A;  2RBM A;  1E2W A;  1ENF A;  1KLU D;  2E74 C;  2MFI A;  3K81 C;  5M3F H;  3K8A A;  4FF4 A;  3QB3 A;  3QOL A;  4JI8 Q;  3FKI H;  1RL2 A;  2A73 B;  1S5D D;  1B44 D;  4DN4 M;  2F0V A;  4A3F H;  1A3U A;  1GUS A;  4HJ5 A;  5D65 A;  1QJO A;  4OL7 A;  3EQL C;  1PDQ A;  2FHT A;  4WJW A;  2MQH A;  3NK9 A;  4DAP A;  5FLM H;  5ISR A;  1CKO A;  1I94 Q;  5C4H A;  1KAW A;  4A3B H;  1KIX A;  1X3F A;  1ZKO A;  1VF7 A;  1HQR D;  4BBS B;  3NQT A;  4HJ8 A;  1TWA B;  2IX1 A;  2NVQ B;  2XIW A;  3KK7 A;  3S17 H;  1PH9 A;  4J15 A;  2PQA A;  2JXM B;  4Q5V A;  5ELF A;  2F0D A;  3SK4 A;  3ND9 A;  1I50 H;  1B3A A;  1BNZ A;  4KY5 A;  3C3L A;  4K6L A;  3HOU B;  4H0L C;  4B08 A;  4A3E G;  1UE7 A;  4NXN L;  1LV9 A;  4RGT A;  1U9R A;  4DV7 L;  4C3I H;  2KEE A;  2PQA B;  1SMX A;  2JA6 H;  2E2H H;  3I91 A;  4P2C B;  2F0U A;  4DV5 Q;  2L4N A;  3CMA A;  2EY2 A;  1V1Q A;  4KJO A;  4CGY B;  5I9O A;  1SE4 A;  3VR2 A;  3VR3 A;  3CME A;  1YI2 A;  4BBR B;  2RHQ B;  5KEE A;  1EWC A;  1LAB A;  3B6Y A;  3PQI A;  3PO3 G;  2R7Z B;  4RKL A;  1PXU A;  2R7D A;  2J4X A;  4RMF A;  2B2U A;  2VB3 X;  1DYQ A;  3PIP A;  3L9A X;  3MWY W;  1NCV A;  3L0O A;  4X64 L;  3URY A;  1VQN A;  3RUZ A;  5CV9 A;  5JAV A;  5G3L F;  3PGZ A;  3M4Y A;  3MZ5 A;  2FFK B;  3FRP B;  5IYC H;  4L5Q A;  2KHI A;  1PRT F;  4CBV A;  2L15 A;  4X64 Q;  1KRS A;  5HUR A;  4JC0 A;  1Y1V B;  3F2B A;  5FLX E;  1JE5 A;  4GNX A;  3NPP A;  2Z6K A;  2UUB L;  1YNN D;  5IGB A;  4DR1 Q;  2C9O A;  2VQF L;  4K0K L;  3NHH A;  4IOA A;  3I4L A;  4GLX A;  1TS2 A;  1STE A;  3UE0 A;  3KF8 A;  4YWM A;  3U9S A;  3E9I A;  1E7Z A;  3CCQ A;  3EBE A;  4A4I A;  4DK6 C;  4BY1 G;  4P73 A;  2EYH A;  1G51 A;  4PNY A;  4A3E H;  4A76 A;  2R93 H;  5IOC A;  2EYJ A;  4J1M A;  5EBD A;  3H3V C;  1VQO A;  3HOZ H;  3C1F A;  1X3Q A;  3D6W A;  5IGE A;  3MEF A;  1JR0 D;  4LF9 Q;  3TZD A;  4B3S L;  2F0Q A;  1YBY A;  4M8A A;  1Z9F A;  4OO1 I;  4OGQ C;  4Y52 H;  4ABN A;  1EY5 A;  3J80 i;  2IWH A;  3ULL A;  1OXS C;  4B9X A;  3GQB A;  1WTP A;  3HOU H;  3DEO A;  3M3Y B;  3OIQ A;  4JYA Q;  2IL8 A;  2Q2H A;  2IW3 A;  1PH7 A;  1LAC A;  5KND A;  2K4K A;  2RDG A;  3KBX A;  4KHZ A;  1VQE A;  3MTS A;  2NBF A;  2UU9 L;  1N33 Q;  3BZD B;  4HAE A;  2EYM A;  1NR2 A;  1KRT A;  3A54 A;  5D3I B;  5ELE A;  3S15 H;  3BZC A;  3T53 B;  4ALP A;  3ONA B;  5CGK A;  4DV2 Q;  2ZTC A;  4JBJ A;  2JA8 H;  5CV5 A;  1IBL L;  4OIJ A;  2Z1C A;  2Q8R E;  4GNX C;  2Z6K C;  4A3D H;  5FKA C;  4UAI A;  1SNQ A;  1XXG A;  1SYB A;  2QCP X;  1GVP A;  3UE1 A;  3OIP A;  4DUZ Q;  1IBM Q;  1LT3 D;  2EXZ A;  3S24 A;  4QL5 A;  2CH4 A;  1RKN A;  5GAH C;  2YV5 A;  5J3B A;  3KFU A;  2CH4 W;  3RMH A;  3K80 C;  2I5L X;  4H44 C;  1HNW L;  1EQT A;  1SN8 A;  4LUO A;  3CD6 A;  5FO7 B;  3HKZ B;  2AHO B;  1XMO L;  1G6Z A;  4ME5 A;  2JN4 A;  1X6O A;  1ET6 A;  1F77 A;  1EY6 A;  1HUN A;  2R92 H;  4O42 A;  1SMY D;  4H7B A;  4OX9 L;  1CFM A;  3I4M H;  2JA7 B;  1MHW C;  3BG3 A;  5C4X H;  3I72 A;  2JA5 B;  4JI3 L;  3E6Z X;  4LMQ D;  3FDT A;  1E0B A;  3CU7 A;  5FLX L;  2XRS D;  1CQV A;  2AKW B;  4ZYS A;  1CHQ D;  1TS4 A;  2I5H A;  2KUM A;  3T51 B;  5HGT A;  3RZD B;  3T56 B;  3J7A 5;  4DR3 L;  1EYA A;  5IY0 A;  1O7Z A;  2CQO A;  3PUW A;  4KHP Q;  3VA5 A;  2BE5 D;  3MAQ A;  4A3J H;  4FF3 A;  4KV6 A;  3H0G G;  1SE2 A;  1RF2 D;  2E5L L;  2O2L D;  5JJL A;  2K28 A;  5M3M H;  3RNU A;  3CPW A;  3TRZ A;  4BWG B;  3S2H B;  4CDD C;  1KLG D;  3HOW B;  4JCV E;  4JI1 Q;  2R92 B;  4A93 B;  1Q81 C;  3HKS A;  2PYK A;  1VQ6 A;  2F3I A;  3PO2 B;  2VZA A;  4O2D A;  3G4S A;  1EWH A;  3CRK C;  2MJ8 A;  2F0M A;  2WAQ G;  4C3J G;  3CKI B;  1JOQ A;  4LF4 Q;  3K7U C;  1RIP A;  1ONL A;  3MXP A;  5EPK A;  3ZYY X;  3LWU A;  1D5M C;  1OXX K;  2JA6 B;  4IUN A;  4DV7 Q;  2OF1 A;  5E1F A;  1UE6 A;  3SVM A;  2NYZ D;  3KF6 B;  1YIT A;  3W5O A;  3AYH B;  2SOB A;  1G6P A;  4U68 A;  1HNZ L;  5C44 H;  5GRO A;  1YIJ A;  3X3N A;  2R7Z G;  1K0R A;  1HH2 P;  3GTO H;  1XMQ Q;  4RCN A;  1YNJ C;  3KYH C;  1CUK A;  1YNX A;  4BXX G;  4LF5 Q;  4LF8 L;  4KK7 A;  1PH6 A;  3LWE A;  3GDE A;  1GUN A;  2DN8 A;  1ET9 A;  4LFC Q;  5LL6 S;  2PW7 A;  3A8K E;  4TSS A;  1U4P A;  1EFW A;  3NBI A;  3J81 c;  2V1C C;  5IYD H;  3TBI B;  4CDF C;  2X6L A;  1JIC A;  4B3R L;  2JK8 A;  4A3I B;  2WAC A;  2DNC A;  2Z4I A;  1ICF B;  4DAY A;  1B53 A;  2HT1 A;  1BCP F;  4Y7N H;  1Q1E A;  1N9W A;  1QE6 A;  1F2Y A;  5KNC A;  2EY1 A;  4GN5 A;  4CKB A;  4IFD H;  3A7L A;  3GTK B;  3PO2 H;  1PTO C;  5C3E G;  1G91 A;  4TQU S;  2HDL A;  2HHH Q;  4OWW B;  4RKB A;  4AQY L;  2DY7 A;  4FF1 A;  1HZB A;  2CWA A;  4H13 C;  2ZJR A;  3LNN A;  2L12 A;  3R93 A;  4B3S Q;  3CCU A;  2LS0 1;  1PTO D;  4DR4 Q;  1K83 H;  1SLJ A;  3NUC A;  2KBN A;  1XPU A;  2K5W A;  1XNR L;  1STA A;  1ZEQ X;  4ILW A;  3CCM A;  4FYD A;  3MFY A;  2ZT9 C;  3PUX A;  4JI6 L;  3FPU B;  4K2L A;  3R3O A;  1CA6 A;  1NJI C;  4B3T L;  2JA7 G;  2B63 B;  4FXD A;  2WAQ E;  2GA4 B;  2F0F A;  4KHV A;  1CSP A;  3FKI G;  1GKH A;  4HSP A;  3SK6 A;  4XDX A;  3KDF B;  3HOX G;  2B39 A;  2VUM G;  1PFB A;  4LFB L;  2NUC A;  2A69 C;  5K36 H;  2BH2 A;  1SND A;  4L5S A;  5EGT A;  3OW2 A;  4GOP B;  2QDL A;  5M3M B;  4GN3 B;  1R4Q B;  4DR4 L;  5CR3 A;  2UUA L;  2E2I H;  2PNH A;  2VXW A;  4FDB A;  1VQD A;  1AN8 A;  1DGS A;  4DNI A;  1WTX A;  1Q90 A;  3RZO B;  4PMC A;  1NUC A;  2EIF A;  4JK1 C;  4JI4 Q;  3BDO A;  2DUD A;  3RLF A;  2IHE A;  3HOV H;  1O7I A;  2YTX A;  4OHJ A;  4DR1 L;  4DAV A;  4ZKC B;  1XWE A;  5IYD G;  1K83 B;  2CHB D;  2JA7 H;  4KLK A;  2HCI A;  1Y8N B;  1Q12 A;  1BDO A;  1F9S A;  2R61 A;  4TRD A;  5LL6 X;  2WAQ B;  4HJ9 A;  2MP1 A;  2A74 C;  4DR7 Q;  2D62 A;  4A3D B;  1L0W A;  3CF5 A;  2XNA C;  1QNU A;  1VQH A;  2DJG C;  2L11 A;  4X3U A;  3NP8 A;  4EVO A;  5M5X H;  1HA6 A;  2L5T A;  1HR0 L;  1XPO A;  1WTR A;  1FJG L;  5M5W B;  3H15 A;  3WOF A;  3ULJ A;  1SYG A;  4ZK9 B;  2AUJ D;  4HED A;  2PZT A;  2FMM A;  4DK3 C;  1OXV A;  3QO2 A;  4EGV A;  5M5Y B;  4XTC S;  4WJ3 M;  1I6H H;  4NKL A;  1TII D;  4YHH L;  5C0X J;  2DGY A;  1H95 A;  3N6R A;  1TWG B;  2YTV A;  1KD1 C;  2PQE A;  2OWO A;  4GN4 B;  2DJF C;  1IBK L;  1HNW Q;  2CCZ A;  1D2B A;  1EIY B;  4IPD A;  1KQS A;  4C3J H;  1KHI A;  4HIM A;  3QR8 A;  4RHR A;  4YWK A;  3I4N H;  2IY5 B;  2XN9 C;  3JAM i;  4JI0 L;  2KJX A;  3RLN A;  3UDF A;  5C44 B;  1UAP A;  1X32 A;  4M1U B;  4LAA A;  3HOZ B;  4LF4 L;  2K5N A;  4A3E B;  4GZY C;  2SDF A;  4A3G G;  4BXX H;  2CW0 D;  1B7Y B;  2B2V A;  2HHH L;  1RD9 D;  1I4H A;  1FNV A;  1II3 A;  1V9P A;  1G2S A;  5H1S E;  1X3P A;  1K3R A;  1NSN S;  4RHS A;  4DV2 L;  4A3J G;  5C44 G;  3A8I E;  4P74 A;  5DEH A;  1S5C D;  3R8B A;  1PYW D;  2EPB A;  2QW7 A;  4DV6 L;  4DAM A;  4JBK A;  2WP8 J;  3BYY B;  1PHJ A;  2GN5 A;  3CCE A;  4UP9 A;  3H91 A;  2CVR A;  4A3K G;  2E5L Q;  4B3R Q;  1CK1 A;  3CRL C;  4O0A A;  4KHP L;  1GUW A;  5EQ0 A;  3MHB A;  4PZ7 A;  4UPA A;  4DKA C;  3OMC A;  1P8L A;  2R92 G;  4DGZ A;  1EU4 A;  3STB D;  1Q82 C;  3HS0 C;  1HZ9 A;  3GTP H;  3DUZ A;  3GTJ H;  3S9W A;  4LF9 L;  2B2W A;  2K7V A;  4CJ2 C;  3CPF A;  4DXG A;  4DXF A;  5D3D A;  5FJ8 H;  4LF5 L;  4LF8 Q;  4HCS A;  1J9O A;  4GOP A;  2F0W A;  4ZAI A;  3Q0A A;  2RCN A;  2Z9H A;  3G7L A;  5E4X A;  1QVF A;  2IJ0 A;  5IT9 E;  5ELO A;  1HHV A;  1QZG A;  4IJH A;  2F0J A;  3I7F A;  1WD0 A;  1JOO A;  1WCM B;  4POF A;  1N8R C;  4IUP A;  4OO1 G;  1Y1V H;  3MEH A;  3E3X A;  3ERS X;  4R1J A;  2F4V Q;  1JJG A;  1OO9 B;  4BBR H;  1C9O A;  5IYB G;  2K75 A;  3HOX B;  3K0Y A;  5CV4 A;  4BY7 B;  1VQB A;  2H1E A;  2Z0S A;  1J6Q A;  1RJT A;  4RGO S;  3VR6 A;  2ZM6 L;  1M8A A;  2A6E C;  1K9M C;  2K5V A;  3EN2 A;  4FVM A;  3KJP A;  1S5F D;  2JA5 H;  1D1I A;  3S2D B;  3G6E A;  4RGN A;  4DV1 L;  1Y1V G;  4X66 L;  2PMZ E;  1LTT D;  2B2W C;  4ZLT F;  4B3M L;  4OO1 H;  4GOP C;  3HP3 A;  1NMF A;  1X56 A;  3DXJ C;  1EY4 A;  3PUY A;  2Z6B A;  3T1H Q;  4UP8 A;  3DWP A;  2EY5 A;  4FXG C;  2I0Q A;  4RGM A;  2RF4 A;  4BBS H;  2KHJ A;  5IGD A;  2RSO A;  2CQA A;  1JB3 A;  5GQO A;  4ZKB B;  5I4D A;  1FVI A;  3E0J A;  5BR8 Q;  2F0I A;  2NZH A;  4DV0 Q;  1NR4 A;  1BQQ T;  1QCB D;  5JVH 3;  2G9D A;  2V4D A;  4X65 L;  3CQZ B;  3P20 A;  1STY A;  1ILP A;  1SYF A;  3Q24 A;  2X6G A;  3D4D A;  3MXN B;  3VDY A;  3I90 A;  5J39 A;  1SMY C;  2B2T C;  2BCO A;  4ZCK A;  5IP9 G;  1YHQ A;  4BBR G;  2B29 A;  3I70 A;  1LT4 D;  4XT1 B;  5M5W H;  3NTK A;  4BA1 I;  1B3Q A;  2NVY B;  1ASZ A;  1U4L A;  1C4Q A;  1QUQ B;  3M85 A;  4A3F B;  1TY2 A;  4X62 L;  1VQ5 A;  4X65 Q;  3D4R A;  3KLR A;  3HOU G;  2VB2 X;  1H9S A;  3ERQ A;  1PRT C;  5C5M A;  1EY9 A;  4QY7 A;  3M9B A;  5GAG C;  1X65 A;  2NVY H;  3SEB A;  4DR7 L;  3U4Z A;  5BR8 L;  1B4O A;  1HZC A;  1CSQ A;  5I6W A;  3T1Y L;  2OTJ A;  1YJ9 A;  1YVC A;  2M9V A;  2MO1 A;  2OQ0 A;  4C3H G;  4HJ7 A;  3HOZ G;  5E3F A;  4AH6 A;  3K5O A;  1PH1 A;  1PTO F;  4DV6 Q;  2K52 A;  3P1H A;  4JI5 L;  1OXT A;  1JMC A;  4ID6 A;  3CQZ H;  1BCP C;  1Y8O B;  1PFM A;  2WB1 E;  2F1M A;  3QIA A;  2KCN A;  3EFX D;  3X3M A;  1Z6H A;  1V43 A;  3HOW G;  5C3W A;  4NXM Q;  1BCP D;  4K5V A;  5C6A A;  3J7Y W;  3H3V H;  2Q2I A;  2EJM A;  1ESF A;  4LFB Q;  4CKC A;  1U4R A;  1LO5 D;  1KNE A;  2QEX A;  1BVS A;  4KI0 A;  1BR9 A;  1EUJ A;  5JEA G;  2YYZ A;  1DZ1 A;  1Q86 C;  3I8Z A;  1XTC D;  4L6T B;  4LFA L;  1IBK Q;  4DUY Q;  1DD2 A;  5FLM G;  3D0F A;  3HG9 A;  2A6E D;  4DU9 A;  1XNR Q;  1C7Y A;  4UY8 C;  3RR5 A;  1J5E Q;  3HZX A;  1GM5 A;  1O80 A;  2E76 C;  1I94 L;  4QGU A;  3U58 A;  4HR7 B;  1KDA A;  4YY3 L;  3RZO H;  2ZTE A;  3NWS A;  3SDZ A;  2WB1 B;  5CV7 A;  1I4X A;  1VQI A;  1EEI D;  3KF8 B;  3SHL A;  1Q1B A;  1PYB A;  2K5Q A;  1O7Y A;  2EY6 A;  3A74 A;  3QOJ A;  1WCM H;  5C0X I;  5KYL A;  1LT5 D;  1AE2 A;  1AEX A;  1AZQ A;  1KXL A;  4K6D A;  2QF7 A;  1V1P A;  1XNQ Q;  4IAL A;  4YWL A;  3M4O B;  2O4X A;  1UWV A;  3HOX H;  1L2F A;  3GTQ B;  1SDF A;  1E22 A;  4JBW A;  5EKK A;  3SXH A;  5FO8 B;  3I3C A;  2N78 A;  1EOV A;  2ES2 A;  1P16 A;  3K59 A;  4A3B G;  5LMN W;  5JJZ A;  1I3Q H;  4EX5 A;  5ELB A;  1TWF H;  4XQQ A;  4F8M A;  3NEN A;  2JJQ A;  2E2J B;  4G7O C;  4J8Q A;  3F8T A;  4QB4 A;  4DV5 L;  3T1Y Q;  2NTS A;  1NAP A;  4C2M B;  3Q6S A;  1WTH A;  3NSW A;  1VQL A;  2RKS A;  2TMP A;  4NXN Q;  4YCU A;  1DM0 B;  1S40 A;  2HQE A;  4MN3 A;  3KJO A;  1JOR A;  5A2Q L;  5JOB A;  5EAY A;  2WKC A;  2A69 D;  2EJF C;  2EYF A;  5BN4 A;  3A5Z B;  1PH4 A;  2A5H A;  3ZJY C;  1XTD A;  2F03 A;  1IL8 A;  1B1Z A;  1JWM D;  4J6H A;  1R9T H;  3GTG B;  3S1M B;  1PTO B;  1BO0 A;  4EQN A;  4R4Q A;  2NTT A;  1DON A;  2KCC A;  2NN6 H;  4RH6 A;  3J80 c;  1JE4 A;  2HCC A;  4K8J A;  4K14 A;  4DV4 L;  4A3I H;  4K5W A;  1FGB D;  1YEZ A;  1ESR A;  4DR2 Q;  1S4Z A;  4GKJ L;  2XGT A;  3UDG A;  5CV6 A;  3DM3 A;  2ZXO A;  3BJU A;  4E6I A;  1CZW A;  2BDN A;  4PMW A;  3CAM A;  3GP7 A;  4ZRZ A;  4POG A;  3H6M A;  5IOD A;  3K57 A;  1TQO A;  1HCZ A;  3QWN A;  1PRT B;  2NVX B;  5JEA J;  4ZUI A;  3M7G A;  3K7A H;  1B9N A;  3CC2 A;  4X3K A;  5KGU A;  4JI4 L;  3S1N B;  2F3W A;  4UP7 A;  4C3I B;  5IGG A;  2IX3 A;  2WFW A;  1W2B A;  3L3O C;  1I4G A;  4KD3 A;  4DNT B;  2L9H A;  4LFC L;  3AU7 A;  4KJN A;  2F0H A;  3MC0 B;  1BUV T;  1Q3L A;  3A56 A;  1D1K A;  1ZYR C;  3K5N A;  4C3H H;  1XMQ L;  2G5D A;  2HIV A;  2RHS B;  3S17 B;  3TN2 A;  4EQ5 A;  4JW0 A;  4LUV A;  3MXN A;  3FMC A;  4HCE A;  1ICW A;  2JP1 A;  4OWX B;  2EXD A;  1VMC A;  2KOL A;  3PF4 A;  4IPC A;  1L0Y B;  3OWF A;  2XWJ B;  1BF4 A;  4P72 A;  1HQM C;  4HTH A;  3PUZ A;  2H5X A;  2I07 B;  4NDX A;  3S1M H;  2NZO A;  4O1N A;  5ELC A;  3MXG A;  1CKM A;  4LUZ A;  1F2Z A;  4MIU A;  3EA6 A;  2MHV A;  2JA8 B;  3PO3 B;  1EQQ A;  2AWN A;  2B2Y A;  2RCF A;  3J7Z C;  4G57 A;  1ROD A;  4V19 0;  4IUQ A;  1O78 A;  4CDE C;  2ZJQ A;  1QG7 A;  1SYC A;  2K50 A;  1EOT A;  4MHE A;  4C1N I;  1UNS A;  1QB5 D;  5A35 A;  1IKM A;  1UEB A;  3JAM c;  3TRE A;  1HPC A;  2F0E A;  3RN2 A;  4DFA A;  1JOK A;  2NB0 A;  3C1E A;  5CV8 A;  2VQE Q;  3OW7 A;  4XQN A;  4G7Z C;  3DM1 A;  1TWC H;  4WOR A;  1ZXT A;  4BBS G;  1TT2 A;  5LMN L;  4DR3 Q;  2EQS A;  2JE6 I;  3V96 A;  1WI5 A;  3J80 E;  5FOB B;  1IZ6 A;  1K8M A;  3J81 E;  4HSV A;  4X62 Q;  1EEF D;  3TZU A;  4AIM A;  3I4O A;  1OTC A;  1X55 A;  3S14 B;  1K8O A;  4I7Z C;  1A8V A;  1I4Q A;  1NMG A;  1PYS B;  2BA1 A;  3D6C A;  2OXP A;  3DMU A;  1UEA B;  2HUG A;  3FPP A;  3KLS X;  2JA8 G;  3U4V A;  1ZYR D;  3M4Q A;  1Y1W B;  4KTA A;  2LMC B;  5C4X G;  2CWP A;  1UE5 A;  3K0X A;  3I4M G;  5IYB H;  1LTS D;  2ICI A;  4FNF A;  1WTO A;  4NMZ A;  2NN6 I;  2ATW A;  1EYG A;  4K0K Q;  3F2D A;  4ZQ3 A;  4R8I A;  2F0N A;  2JA9 A;  5LMN Q;  1SNC A;  1T5E A;  1A3V A;  1B9M A;  3DWA A;  4DR5 L;  1HNX Q;  1TWH H;  2B3G A;  4KKU A;  4LF6 Q;  4N9P A;  4RA8 A;  1XPR A;  2F4I A;  5C0X G;  1JB7 A;  4IN3 A;  3RD4 A;  1IBL Q;  2LY7 A;  5I2Y A;  3MFG A;  2B2U C;  2A68 D;  5IT9 c;  2VY3 A;  2QDB A;  5T1I A;  3HOY B;  3M4O H;  1MD2 D;  1NBW A;  1WJJ A;  2D2C C;  1JJC B;  1X54 A;  4U67 3;  1U0L A;  3NEM A;  3L7Z C;  1TS3 A;  1WCM G;  2VQE L;  2R93 G;  1T5X D;  4P75 A;  4X66 Q;  3CP0 A;  1XNQ L;  2M00 A;  2ENB A;  2DY8 A;  2KCT A;  3HOY G;  1VQP A;  2P5Z X;  1ENA A;  4IPH A;  1PV4 A;  1B2T A;  2N49 A;  4JYA L;  1PH8 A;  4GKK Q;  3IL8 A;  2PNR C;  3OMG A;  4DR6 L;  4LJZ C;  1EY8 A;  1V1P B;  4FF2 A;  3RZD H;  1GHJ A;  4A75 A;  1C8C A;  2Q2U A;  4PZ6 A;  2EYO A;  1ASY A;  2RSN A;  3GV6 A;  3JAM E;  2I46 A;  2OEO A;  1U4M A;  1GHK A;  1CI3 M;  1MIU A;  4HID A;  1JJ2 A;  5IT9 L;  1STB A;  1T9H A;  4A3C H;  1G2T A;  1L1O B;  5KYI A;  2UXC L;  5EBC A;  1VQM A;  4LFA Q;  1VQ7 A;  1EYD A;  1TY0 A;  3GTJ B;  1HTP A;  4AQY Q;  1K0S A;  3A5U A;  1GJX A;  4HJA A;  4PG3 A;  3HOW H;  2J7Z A;  1IYU A;  1EWI A;  4JI6 Q;  2WIN B;  4GKK L;  5FLX c;  4LWC A;  5M3F B;  2MNA A;  3ICE A;  3A8J E;  3J81 L;  4DUZ L;  1G8Z D;  2SNS A;  1N32 L;  2KQ3 A;  4X3T A;  1SBB B;  4DK1 A;  3TDQ A;  4ULL A;  1HRJ A;  5TSS A;  1LLR D;  1YHB A;  4C3I G;  3CHB D;  5AFW A;  3C2P A;  2Y0S E;  3PCO B;  1GUO A;  1S3O A;  1VQ4 A;  3S1R H;  1SAP A;  4F7X A;  1FYC A;  4JOI A;  3RN5 A;  4RG1 A;  4ODG A;  4XYQ A;  3I4N B;  2LSS A;  3SGI A;  2PI2 A;  4JI7 L;  4MZ9 A;  1E1O A;  3NBH A;  5G3L D;  4OXP A;  1H9R A;  5JJK A;  1FNU A;  3S1Q B;  1QNK A;  4Z9C B;  4HMJ A;  1Q7Y C;  4DK0 A;  5CBE E;  4N8X 1;  1MGS A;  2NN6 G;  1WTV A;  2PZW A;  1SEB D;  3IAY A;  1F2L A;  1DOL A;  4JI2 Q;  1R4P B;  2L1B A;  2Z8L A;  4I7A A;  1MI2 A;  4TVA B;  3S1Q H;  3QJY A;  1UE1 A;  1CM9 A;  1X3E A;  2B8F A;  1LT6 D;  2N88 A;  1EIH A;  2RDH A;  5M3F G;  1FR3 A;  3TS2 A;  2EOT A;  3V05 A;  3S2D H;  4KN4 C;  1JCK B;  4XT3 B;  1DCZ A;  3GTO B;  1MSH A;  2K32 A;  3C46 A;  4KY7 A;  3S14 H;  3J81 j;  2O5J C;  1MBY A;  4GS3 A;  3WWV A;  1BCP B;  1PRT D;  2C35 B;  1YHA A;  1O7L A;  4XYO A;  4AYB B;  4OWT B;  5LMU Q;  4JI7 Q;  1HR0 Q;  2VUM H;  5CMD A;  1LTB D;  1A6X A;  5C0X H;  3U50 C;  4CJ1 B;  3U9O A;  1A0I A;  5C4J B;  4G7H C;  2F52 A;  1HFN A;  3TS0 A;  2PMZ B;  3FHW A;  5JPM C;  1V1O A;  3DWQ A;  3K58 A;  2ZM6 Q;  2FIN B;  1PH2 A;  4CKE A;  2Q8T A;  3G6J B;  2HD3 A;  2NVT B;  4JI1 L;  2LKV A;  3IFT A;  4FO2 A;  4B3M Q;  1I3Q B;  1XJV A;  3K6O A;  4OEM B;  4DV1 Q;  2A68 C;  5GAD C;  2CKZ B;  2EE1 A;  4BY7 H;  1CA5 A;  5D14 A;  3NWT A;  3MXU A;  1YNN C;  5C5L A;  5COR A;  2B8G A;  3OTO Q;  1D5X C;  3H3V I;  4QIW E;  2KVM A;  1CKN A;  1I4R A;  3BVZ A;  5COY A;  5EPJ A;  2F4V L;  2PI2 E;  2ZXP A;  3SK8 A;  1SRU A;  2PCF B;  1J8I A;  4DUY L;  1VQF A;  3QG1 A;  3CXC A;  3GO5 A;  4YY3 Q;  4OEL B;  1CQF A;  3VR5 A;  3F1Z A;  2D0P A; 
#chains in the Genus database with same CATH homology
 3I4M B;  1PZK D;  2D9U A;  3GTP B;  1AW7 A;  1SYD A;  4K2K A;  5JEA H;  2AWO A;  4KMU C;  1LTA D;  2NZ1 D;  2YU9 B;  3S16 B;  3SR1 A;  3H09 A;  5LHY 1;  1F9R A;  2MGS A;  1YNJ D;  4ZUJ A;  3ND8 A;  3A7A B;  1CZG A;  4YIJ A;  1TWH B;  1RDP D;  4QCL A;  1CT1 D;  2KA7 A;  4C56 C;  1JWU D;  3PUV A;  2OT2 A;  2CW0 C;  3VYT A;  4OIK A;  1IHZ A;  1Z47 A;  3FEW X;  3GTL B;  1Z7T A;  2R3Z A;  2E2H B;  2ICE C;  3NTH A;  3A55 A;  3VYS A;  4A3B B;  2QIL A;  3P75 A;  1LTG D;  2ZXR A;  1WTQ A;  3S15 B;  1HFG A;  3T4A C;  2F0T A;  1VCI A;  1SNM A;  2TSS A;  2KHS A;  1SE3 A;  4V0B A;  4BY1 B;  3TP5 A;  1JC7 A;  1SSO A;  2K1B A;  2FJ2 A;  2B2V C;  3K5M A;  2K33 A;  2AUK A;  1W6K A;  3W3A A;  5FO9 B;  2IPK D;  5ELD A;  1KNA A;  4C3J B;  4X3S A;  4KKS A;  2NWG A;  1H9J A;  4QUC A;  4LK1 C;  2EVB A;  5KNB A;  5M5X B;  4I65 A;  2F0L A;  3S1R B;  4R8N A;  1S5B D;  1A2U A;  1CTM A;  5K5P A;  3BS1 A;  2E2D C;  3KUP A;  1RTN A;  1EL0 A;  4FXK C;  1KDB A;  3D8G A;  3TME A;  3BVM A;  5BN5 A;  1SJE D;  2D5D A;  1SNP A;  2EYP A;  1GUT A;  4A3G B;  2PW5 A;  3W2D A;  1JWS D;  2VNU D;  1E2Z A;  4A3J B;  3OPO A;  3OHX C;  4PQX A;  3D4W A;  3OOC A;  2JEB I;  3HEJ A;  1TU2 B;  2B2Y C;  1AZP A;  1L0X B;  1QIL A;  5CBA E;  1W6J A;  1RTO A;  4FP5 D;  2XWB B;  1JQY D;  1WVL A;  2IX0 A;  1S5E D;  2O5I C;  1ILQ A;  1M4V A;  5KIX A;  1GUG A;  2A6H C;  4NP5 A;  4PMB A;  1VF5 C;  2MUY A;  2F0O A;  4RAU C;  3J80 L;  3DHQ A;  4C1N K;  3VYU A;  4DF7 A;  2L55 A;  4EQP A;  1B50 A;  1F9Q A;  3MA2 B;  1EFI D;  1SJH D;  3BVG A;  3TP6 A;  1F2M A;  3NQI A;  2M2L A;  4CHT B;  2F0P A;  1I50 B;  5I6Y A;  2DNE A;  1FD7 D;  1LTR D;  3HRZ C;  2J0T D;  4F88 A;  4Y7N B;  4XIG S;  1WD1 A;  5J22 A;  4XQJ A;  3KLS A;  1KTK A;  2VUM B;  3HOV B;  1PMR A;  3GD7 A;  5DM7 3;  1HUM A;  4N9T A;  1RHP A;  1MSG A;  2X69 A;  2QEJ C;  3BDL A;  2F0G A;  2G9H D;  1BOS A;  1I6H B;  5C4Z A;  2K5D A;  3NXW A;  2FMC A;  1EZ8 A;  1SFO B;  2EDG A;  2QKI C;  1XYI A;  4A3K B;  2H4O A;  2Q8I B;  1Q8I A;  5IGC A;  2RVL A;  1E2V A;  4DA2 A;  5I9P A;  4RWS C;  3IFD A;  2N55 A;  1PTO H;  1TKW B;  5C3X A;  3Q22 A;  2K6A A;  1DXM A;  1KAB A;  1EU3 A;  1TWC B;  3KBG A;  1WTW A;  2RDF A;  5JPN C;  1TR5 A;  1G29 1;  3D3R A;  2B2T A;  1TS5 A;  3N52 A;  1GOZ A;  4K5X A;  2R93 B;  5T1G A;  1TVX A;  2RQX A;  4XXE A;  1EZ6 A;  1DOK A;  3J7A F;  1HXY D;  4WRD A;  4IUV A;  3HGB A;  5C3E B;  3M7N A;  4CJ0 B;  3EJI A;  2A6H D;  4BS9 A;  2JEA I;  3H0G B;  5F2D A;  3OWE B;  2EJG C;  5IGF A;  1KAA A;  4G4K A;  2L0C A;  4Q0F A;  2Z4H A;  5CC4 A;  4DNR B;  1PZJ D;  3Q23 A;  4L63 B;  3WOE A;  1FNW A;  1IW7 D;  3ERO A;  1ENC A;  1PLF A;  1QWY A;  2K04 A;  3BDC A;  4A3M B;  4UDU C;  3SE0 A;  4R9W A;  2C5C A;  3ITP A;  5FK9 C;  2ID0 A;  1AFP A;  3OSO A;  1SXT A;  2XRQ D;  5K36 G;  1STG A;  1AP0 A;  2AQ2 B;  2WII B;  1IYV A;  1EY7 A;  2E2I B;  2BDO A;  4EQO A;  3T16 A;  5I2X A;  2K01 A;  3LX0 A;  1UUP A;  1VDZ A;  4TKO B;  3IKJ A;  1GXD C;  4B9W A;  2AQ3 B;  2PPB C;  4KD4 A;  2E75 C;  3EVQ A;  1Y8P B;  4QMG A;  2F0S A;  3PV0 A;  3J7A V;  4QF4 A;  2AQ1 B;  4IFD G;  2JSO A;  1Y69 U;  3TP8 A;  2MPM A;  5CYU A;  4KY6 A;  1LTI D;  3DEP A;  5NUC A;  1ML0 D;  1R9T B;  4S3S A;  1IW7 C;  2EZV A;  5EJW A;  1I6V C;  5EKI A;  2SEB D;  4IFD I;  1F9P A;  1QOH A;  2EYL A;  3UI2 A;  1V8Q A;  5J1Z A;  4RCO A;  2PZU A;  3GTM B;  1BXT A;  3D31 A;  1C48 A;  1OXU A;  4NW2 A;  1TWF B;  1IKL A;  4HN7 A;  2RA4 A;  1BBX C;  4F87 A;  2BE5 C;  1HA5 A;  3K5L A;  2K05 A;  3VYR A;  5M9O A;  2LFN A;  2XVS A;  3WDN A;  3PIP 3;  1EYC A;  3FVQ A;  2PO4 A;  1D5Z C;  1H9S B;  4PV1 C;  3PMF A;  1VMP A;  1STN A;  5C4X B;  1H9K A;  3P7J A;  1HTL D;  3MVV A;  5IIF A;  5A2Q E;  5DNF A;  3AB9 A;  2SNM A;  4BA2 I;  3H94 A;  1STH A;  1D6E C;  2K03 A;  4IQZ A;  1RCV D;  1A2T A;  1DJR D;  4K8I A;  1PFN A;  5JVG 3;  1EY0 A;  4IUR A;  4L8J A;  1A3T A;  1SYE A;  4QUF A;  2Y0S B;  3PIO 3;  3K7A B;  5DM6 3;  3I73 A;  3R2I A;  3VR4 A;  4QIW B;  4KN7 C;  3E5S A;  3T13 A;  1XX8 A;  3NTI A;  2IT1 A;  5EPL A;  4WFN 3;  3BYT B;  3JAM L;  3VA7 A;  3TSS A;  3O13 A;  3AMU A;  2R6G A;  5BN3 A;  3R2T A;  1EIG A;  3GV3 A;  4IUU A;  4IUT A;  5E4W C;  1EQV A;  4IZ8 A;  2F0K A;  3TP7 A;  3V2T A;  4RFB A;  3FKI B;  2KED A;  2JYO A;  1H9M A;  2WV6 D;  2BA0 A;  2F3V A;  4IFD J;  1I4P A;  5KRU A;  4C3H B;  2WKD A;  4HMI A;  1CHP D;  3SK5 A;  4KKT A;  1PZI D;  2HDM A;  3F2U A;  1DOM A;  5EKL A;  2KEC A;  5DAU A;  1KDC A;  2XSC A;  2BOS A;  1SNO A;  3NE5 B;  1A15 A;  2RBM A;  1E2W A;  1ENF A;  1KLU D;  2E74 C;  4FF4 A;  3QB3 A;  3QOL A;  2A73 B;  1S5D D;  1B44 D;  4DN4 M;  2F0V A;  1A3U A;  1GUS A;  5D65 A;  1QJO A;  4OL7 A;  3EQL C;  1PDQ A;  2FHT A;  4WJW A;  3NK9 A;  4DAP A;  5ISR A;  5C4H A;  1ZKO A;  1VF7 A;  1HQR D;  4BBS B;  3NQT A;  1TWA B;  2IX1 A;  2NVQ B;  2XIW A;  3KK7 A;  2JXM B;  4Q5V A;  5ELF A;  2F0D A;  3SK4 A;  3ND9 A;  1B3A A;  1BNZ A;  4KY5 A;  3C3L A;  4K6L A;  3HOU B;  4H0L C;  4B08 A;  1LV9 A;  4RGT A;  1U9R A;  2KEE A;  3I91 A;  4P2C B;  2F0U A;  2L4N A;  2EY2 A;  4CGY B;  4KJO A;  5I9O A;  1SE4 A;  3VR2 A;  3VR3 A;  4BBR B;  5KEE A;  1EWC A;  1LAB A;  2R7Z B;  4RKL A;  1PXU A;  2J4X A;  2B2U A;  2VB3 X;  1DYQ A;  3L9A X;  3MWY W;  1NCV A;  3URY A;  3RUZ A;  5CV9 A;  5JAV A;  5G3L F;  3M4Y A;  3MZ5 A;  2FFK B;  3FRP B;  1PRT F;  4CBV A;  5HUR A;  1Y1V B;  5FLX E;  3NPP A;  1YNN D;  5IGB A;  2C9O A;  3NHH A;  3I4L A;  1TS2 A;  1STE A;  3KF8 A;  3U9S A;  2EYH A;  4PNY A;  5IOC A;  2EYJ A;  4J1M A;  5EBD A;  3H3V C;  3C1F A;  1X3Q A;  3D6W A;  5IGE A;  1JR0 D;  3TZD A;  2F0Q A;  4M8A A;  4OO1 I;  4OGQ C;  4ABN A;  1EY5 A;  2IWH A;  1OXS C;  4B9X A;  3GQB A;  1WTP A;  3DEO A;  3M3Y B;  3OIQ A;  2IL8 A;  2IW3 A;  1LAC A;  5KND A;  2RDG A;  3KBX A;  4KHZ A;  3MTS A;  2NBF A;  3BZD B;  4HAE A;  2EYM A;  1NR2 A;  3A54 A;  5D3I B;  5ELE A;  3T53 B;  3ONA B;  5CGK A;  5CV5 A;  4OIJ A;  2Z1C A;  2Q8R E;  5FKA C;  4UAI A;  1SNQ A;  1XXG A;  1SYB A;  2QCP X;  3OIP A;  1LT3 D;  2EXZ A;  1RKN A;  3RMH A;  4H44 C;  1EQT A;  5FO7 B;  3HKZ B;  1G6Z A;  4ME5 A;  1ET6 A;  1F77 A;  1EY6 A;  1HUN A;  4O42 A;  4H7B A;  1SMY D;  1CFM A;  2JA7 B;  3BG3 A;  3I72 A;  2JA5 B;  3E6Z X;  4LMQ D;  3FDT A;  1E0B A;  3CU7 A;  5FLX L;  2XRS D;  1CQV A;  4ZYS A;  1CHQ D;  1TS4 A;  2KUM A;  3T51 B;  5HGT A;  3RZD B;  3T56 B;  1EYA A;  1O7Z A;  3PUW A;  3VA5 A;  2BE5 D;  3MAQ A;  4FF3 A;  4KV6 A;  1SE2 A;  1RF2 D;  2O2L D;  2K28 A;  4BWG B;  3S2H B;  1KLG D;  3HOW B;  2R92 B;  4A93 B;  2PYK A;  3PO2 B;  1EWH A;  3CRK C;  2MJ8 A;  2F0M A;  4C3J G;  3CKI B;  1JOQ A;  3MXP A;  1ONL A;  5EPK A;  3ZYY X;  3LWU A;  1D5M C;  1OXX K;  2JA6 B;  4IUN A;  2OF1 A;  5E1F A;  3SVM A;  2NYZ D;  2SOB A;  4U68 A;  3X3N A;  4RCN A;  1YNJ C;  4KK7 A;  3LWE A;  1GUN A;  2DN8 A;  1ET9 A;  5LL6 S;  2PW7 A;  3A8K E;  4TSS A;  1U4P A;  3NBI A;  3TBI B;  2X6L A;  1JIC A;  4A3I B;  2WAC A;  2DNC A;  2Z4I A;  4DAY A;  1B53 A;  1BCP F;  1Q1E A;  1QE6 A;  1F2Y A;  5KNC A;  2EY1 A;  4CKB A;  4IFD H;  3A7L A;  3GTK B;  1PTO C;  1G91 A;  4TQU S;  2HDL A;  4RKB A;  2DY7 A;  4FF1 A;  4H13 C;  3LNN A;  2L12 A;  3R93 A;  2LS0 1;  1PTO D;  3NUC A;  2K5W A;  4FYD A;  1STA A;  1ZEQ X;  4ILW A;  3MFY A;  2ZT9 C;  3PUX A;  3FPU B;  4K2L A;  3R3O A;  1CA6 A;  2B63 B;  4FXD A;  2GA4 B;  2F0F A;  4KHV A;  4HSP A;  3SK6 A;  4XDX A;  2B39 A;  1PFB A;  2NUC A;  2A69 C;  5K36 H;  1SND A;  5EGT A;  5M3M B;  1R4Q B;  5CR3 A;  2VXW A;  1AN8 A;  1WTX A;  1Q90 A;  3RZO B;  4PMC A;  1NUC A;  4JK1 C;  3BDO A;  3RLF A;  4OHJ A;  4DAV A;  4ZKC B;  1XWE A;  1K83 B;  2CHB D;  2HCI A;  1Y8N B;  1Q12 A;  1BDO A;  1F9S A;  2R61 A;  4TRD A;  5LL6 X;  2WAQ B;  2MP1 A;  2A74 C;  2D62 A;  4A3D B;  2XNA C;  1QNU A;  2L11 A;  4X3U A;  3NP8 A;  4EVO A;  1HA6 A;  2L5T A;  1WTR A;  5M5W B;  3WOF A;  1SYG A;  4ZK9 B;  2AUJ D;  4HED A;  2PZT A;  2FMM A;  1OXV A;  3QO2 A;  4EGV A;  5M5Y B;  4XTC S;  4NKL A;  1TII D;  5C0X J;  3N6R A;  1TWG B;  2PQE A;  1D2B A;  4RHR A;  2XN9 C;  2KJX A;  5C44 B;  1UAP A;  1X32 A;  4M1U B;  4LAA A;  3HOZ B;  4A3E B;  4GZY C;  2SDF A;  2CW0 D;  2B2V A;  1RD9 D;  1I4H A;  1FNV A;  1II3 A;  1G2S A;  1X3P A;  1NSN S;  4RHS A;  3A8I E;  5DEH A;  1S5C D;  3R8B A;  1PYW D;  2EPB A;  2WP8 J;  3BYY B;  3H91 A;  2CVR A;  1CK1 A;  3CRL C;  1GUW A;  5EQ0 A;  3MHB A;  3OMC A;  4DGZ A;  1EU4 A;  3HS0 C;  3DUZ A;  3S9W A;  2B2W A;  2K7V A;  4CJ2 C;  4DXF A;  4DXG A;  5D3D A;  4HCS A;  1J9O A;  2F0W A;  4ZAI A;  3Q0A A;  3G7L A;  5E4X A;  2IJ0 A;  5IT9 E;  1HHV A;  2F0J A;  1WD0 A;  1JOO A;  1WCM B;  4OO1 G;  4IUP A;  3MEH A;  1OO9 B;  3HOX B;  3K0Y A;  5CV4 A;  4BY7 B;  2H1E A;  1RJT A;  4RGO S;  3VR6 A;  1M8A A;  2A6E C;  4FVM A;  1S5F D;  1D1I A;  3S2D B;  4RGN A;  1LTT D;  2B2W C;  4ZLT F;  4OO1 H;  3HP3 A;  3DXJ C;  1EY4 A;  3PUY A;  3DWP A;  2EY5 A;  4FXG C;  4RGM A;  5IGD A;  2RSO A;  2CQA A;  1JB3 A;  4ZKB B;  5I4D A;  3E0J A;  2F0I A;  1NR4 A;  1BQQ T;  1QCB D;  5JVH 3;  2G9D A;  2V4D A;  3CQZ B;  3P20 A;  1STY A;  1ILP A;  1SYF A;  3Q24 A;  2X6G A;  3D4D A;  3I90 A;  5J39 A;  1SMY C;  2B2T C;  2BCO A;  3I70 A;  1LT4 D;  4XT1 B;  3NTK A;  4BA1 I;  2NVY B;  1U4L A;  1C4Q A;  3M85 A;  4A3F B;  1TY2 A;  3D4R A;  3KLR A;  2VB2 X;  1H9S A;  3ERQ A;  1PRT C;  5C5M A;  1EY9 A;  3SEB A;  1B4O A;  5I6W A;  2M9V A;  4C3H G;  5E3F A;  3K5O A;  1PTO F;  3P1H A;  1OXT A;  4ID6 A;  1BCP C;  1Y8O B;  1PFM A;  2F1M A;  3QIA A;  2KCN A;  3EFX D;  3X3M A;  1Z6H A;  1V43 A;  5C3W A;  1BCP D;  4K5V A;  5C6A A;  3J7Y W;  2EJM A;  1ESF A;  4CKC A;  1U4R A;  1LO5 D;  1KNE A;  4KI0 A;  1BR9 A;  5JEA G;  2YYZ A;  1DZ1 A;  3I8Z A;  1XTC D;  4L6T B;  1DD2 A;  3HG9 A;  2A6E D;  4DU9 A;  3HZX A;  1O80 A;  2E76 C;  4HR7 B;  1KDA A;  3NWS A;  3SDZ A;  2WB1 B;  5CV7 A;  1I4X A;  1EEI D;  3SHL A;  1Q1B A;  2K5Q A;  1O7Y A;  2EY6 A;  3QOJ A;  5C0X I;  5KYL A;  1LT5 D;  1AEX A;  1AZQ A;  4K6D A;  2QF7 A;  1V1P A;  4IAL A;  3M4O B;  2O4X A;  3GTQ B;  1SDF A;  4JBW A;  5EKK A;  3SXH A;  5FO8 B;  3I3C A;  3K59 A;  5JJZ A;  5ELB A;  4XQQ A;  4F8M A;  2E2J B;  4G7O C;  4J8Q A;  4QB4 A;  2NTS A;  1NAP A;  4C2M B;  3Q6S A;  3NSW A;  2RKS A;  2TMP A;  1DM0 B;  2HQE A;  4MN3 A;  1JOR A;  5A2Q L;  5JOB A;  2WKC A;  2A69 D;  2EJF C;  2EYF A;  5BN4 A;  2A5H A;  2F03 A;  1IL8 A;  1B1Z A;  1JWM D;  4J6H A;  3S1M B;  3GTG B;  1PTO B;  1BO0 A;  4EQN A;  2NTT A;  1DON A;  2KCC A;  2NN6 H;  4RH6 A;  1JE4 A;  2HCC A;  4K8J A;  4K14 A;  4K5W A;  1FGB D;  1ESR A;  1S4Z A;  5CV6 A;  2ZXO A;  4E6I A;  1CZW A;  2BDN A;  4PMW A;  3GP7 A;  4ZRZ A;  3H6M A;  5IOD A;  3K57 A;  1TQO A;  1HCZ A;  3QWN A;  1PRT B;  2NVX B;  5JEA J;  4ZUI A;  3M7G A;  1B9N A;  4X3K A;  5KGU A;  3S1N B;  2F3W A;  4C3I B;  5IGG A;  2IX3 A;  3L3O C;  1I4G A;  4KD3 A;  4DNT B;  2L9H A;  3AU7 A;  4KJN A;  2F0H A;  1BUV T;  3MC0 B;  1Q3L A;  3A56 A;  1D1K A;  1ZYR C;  3K5N A;  3S17 B;  3TN2 A;  3MXN A;  3FMC A;  4HCE A;  1ICW A;  2JP1 A;  1VMC A;  2KOL A;  1L0Y B;  3OWF A;  2XWJ B;  1BF4 A;  1HQM C;  4HTH A;  3PUZ A;  2I07 B;  4NDX A;  4O1N A;  5ELC A;  3MXG A;  1F2Z A;  4MIU A;  3EA6 A;  2MHV A;  2JA8 B;  3PO3 B;  2AWN A;  2B2Y A;  4G57 A;  1ROD A;  4V19 0;  4IUQ A;  1O78 A;  1QG7 A;  1SYC A;  1EOT A;  4MHE A;  4C1N I;  1UNS A;  1QB5 D;  5A35 A;  1IKM A;  1HPC A;  2F0E A;  4DFA A;  1JOK A;  2NB0 A;  3C1E A;  5CV8 A;  3OW7 A;  4XQN A;  4G7Z C;  3DM1 A;  4WOR A;  1ZXT A;  1TT2 A;  2JE6 I;  3V96 A;  3J80 E;  5FOB B;  1K8M A;  3J81 E;  4HSV A;  1EEF D;  3TZU A;  3S14 B;  1K8O A;  4I7Z C;  1I4Q A;  2BA1 A;  3D6C A;  2OXP A;  3DMU A;  1UEA B;  2HUG A;  3FPP A;  3KLS X;  1ZYR D;  1Y1W B;  4KTA A;  2LMC B;  1LTS D;  2ICI A;  4FNF A;  1WTO A;  4NMZ A;  2NN6 I;  4ZQ3 A;  4R8I A;  2F0N A;  1SNC A;  1T5E A;  1A3V A;  1B9M A;  3DWA A;  4KKU A;  4N9P A;  4RA8 A;  2F4I A;  5C0X G;  4IN3 A;  3RD4 A;  2LY7 A;  5I2Y A;  3MFG A;  2B2U C;  2A68 D;  5T1I A;  2QDB A;  3HOY B;  1MD2 D;  2D2C C;  4U67 3;  3L7Z C;  1TS3 A;  1T5X D;  2M00 A;  2ENB A;  2DY8 A;  1ENA A;  1B2T A;  3IL8 A;  2PNR C;  3OMG A;  1EY8 A;  4LJZ C;  1V1P B;  4FF2 A;  1GHJ A;  1C8C A;  2EYO A;  2RSN A;  3GV6 A;  3JAM E;  2I46 A;  2OEO A;  1U4M A;  1GHK A;  1CI3 M;  5IT9 L;  1STB A;  1G2T A;  5KYI A;  5EBC A;  1EYD A;  1TY0 A;  3GTJ B;  1HTP A;  1GJX A;  2J7Z A;  1IYU A;  2WIN B;  5M3F B;  3A8J E;  3J81 L;  1G8Z D;  2SNS A;  2KQ3 A;  4X3T A;  1SBB B;  4DK1 A;  3TDQ A;  4ULL A;  1HRJ A;  5TSS A;  1LLR D;  4C3I G;  3CHB D;  5AFW A;  3C2P A;  1GUO A;  1SAP A;  4F7X A;  1FYC A;  4ODG A;  4XYQ A;  3I4N B;  3NBH A;  5G3L D;  1H9R A;  1FNU A;  3S1Q B;  1QNK A;  4Z9C B;  4HMJ A;  4DK0 A;  5CBE E;  1MGS A;  2NN6 G;  1WTV A;  2PZW A;  1SEB D;  3IAY A;  1F2L A;  1DOL A;  1R4P B;  2L1B A;  2Z8L A;  1MI2 A;  3QJY A;  1CM9 A;  2B8F A;  1LT6 D;  2N88 A;  1EIH A;  2RDH A;  1FR3 A;  2EOT A;  3V05 A;  4KN4 C;  1JCK B;  4XT3 B;  1DCZ A;  3GTO B;  1MSH A;  2K32 A;  3C46 A;  4KY7 A;  2O5J C;  1MBY A;  1BCP B;  1PRT D;  1O7L A;  4AYB B;  4XYO A;  5CMD A;  1LTB D;  1A6X A;  5C0X H;  4CJ1 B;  3U9O A;  5C4J B;  4G7H C;  1HFN A;  2PMZ B;  5JPM C;  1V1O A;  3DWQ A;  3K58 A;  2FIN B;  4CKE A;  2Q8T A;  3G6J B;  2NVT B;  2LKV A;  3IFT A;  4FO2 A;  1I3Q B;  3K6O A;  2A68 C;  2EE1 A;  1CA5 A;  5D14 A;  3NWT A;  3MXU A;  1YNN C;  5C5L A;  5COR A;  2B8G A;  1D5X C;  2KVM A;  1I4R A;  3BVZ A;  5COY A;  5EPJ A;  2ZXP A;  3SK8 A;  2PCF B;  1J8I A;  3QG1 A;  3GO5 A;  1CQF A;  3VR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...