2EJFC

Crystal structure of the biotin protein ligase (mutations r48a and k111a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
NVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
total genus 12
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ejfC00
1HQMC 3L7ZC 5C0XH 3T53B 1G291 3IKJA 3NE5B 3W3AA 1YNJC 4I7ZC 5K36G 3OOCA 4KMUC 4H13C 2B8FA 5C0XG 1GUGA 3MFYA 4DNRB 5KNBA 1CTMA 3QIAA 3LWUA 3SDZA 3M4YA 2E76C 1GHKA 2JEAI 1ZYRC 2PNRC 5A35A 3U9SA 1ONLA 3DXJC 3VR6A 2LMCB 4KN7C 1FYCA 1Z7TA 2BA1A 2NN6H 2PCFB 1E2WA 4G7HC 3PUYA 3CRLC 2K33A 3I4LA 1Y8PB 3T51B 3QG1A 1H9SB 1ZKOA 4L8JA 1DCZA 1OXSC 1Q1BA 2A69C 3LNNA 4JBWA 4PV1C 3VR3A 1E2VA 2A6EC 2KCCA 3QJYA 3N6RA 1GHJA 1H9JA 1HTPA 2JE6I 1SMYC 1VF5C 4BA1I 1VCIA 1HCZA 2AUKA 2KA7A 3A8IE 4KI0A 2AWOA 2K32A 3SE0A 2A69D 5K36H 1DD2A 1IYVA 1CI3M 3BDOA 2BE5D 3WDNA 2EJMA 2D62A 5KNDA 1B9MA 1Z6HA 1VDZA 1TU2B 2DNEA 4XTCS 1GUNA 1Q90A 3T56B 4OO1H 3ND8A 5BN4A 1Q12A 1E2ZA 3IFTA 3PV0A 3A7AB 3GQBA 1IYUA 4KKUA 4KN4C 1H9SA 2V4DA 3I72A 4HR7B 4OO1G 2PPBC 3VR5A 1LACA 2D2CC 3I73A 1VF7A 1LABA 1QJOA 1T5EA 3MXUA 4TKOB 1YNNC 3RLFA 1Y8NB 2YYZA 1O78A 2EJGC 1Y69U 2EJFC 2K7VA 1OXXK 5BN5A 4G7OC 4KKSA 2A68D 2EVBA 4GZYC 2JEBI 2BE5C 4OGQC 1Y8OB 1EWHA 2EDGA 3A7LA 1Q1EA 3KLRA 1IW7C 2O5JC 1H9MA 2F1MA 2L5TA 3BG3A 3P20A 1K8OA 3A8KE 1OXVA 2R6GA 5JEAH 2NN6I 4IQZA 2B8GA 1H9RA 3TZUA 3D4RA 3CRKC 2QF7A 1H9KA 3VA7A 5JEAG 3M85A 2ZT9C 4DK0A 2A6ED 1TKWB 2NN6G 3VR4A 4LK1C 2BDOA 4LJZC 3OW7A 3VR2A 1O7LA 4KKTA 3FPPA 4IFDG 1BDOA 1K8MA 1GUSA 3HGBA 3OPOA 1B9NA 2D5DA 1I6VC 1DXMA 2BA0A 2E75C 5KNCA 4IFDH 4H0LC 1FR3A 3M7NA 4XIGS 1OXTA 2JXMB 3AB9A 3ND9A 3PUXA 4JK1C 4DNTB 3EQLC 3PUVA 4RCNA 4DK1A 1OXUA 2DN8A 3GD7A 2CW0C 2Q8IB 4TQUS 2IT1A 1A6XA 1HPCA 4G7ZC 4BA2I 2DNCA 3A8JE 4KHZA 1IW7D 2A6HC 1GUTA 1V8QA 5BN3A 2A68C 1CFMA 1GJXA 3PUZA 1V43A 4H44C 1PMRA 3H94A 2E74C 1GUOA 3FMCA 3PUWA 2AUJD 2O5IC 2A6HD 3D31A
chains in the Genus database with same CATH superfamily
3IKJA 2K05A 5GAHC 2CH4A 2YTYA 2E8GA 5IIFA 2VL6A 2YU9H 1BCPB 5IT9c 1QNKA 4A3FG 5I6WA 2A73B 4B3SL 3AEVA 4JI6L 5GADC 2CWPA 4K8IA 3H0GG 3H15A 4K0KQ 2AKWB 4IUNA 2MNAA 2FFKB 5JPNC 2DJFC 5ISRA 1PZID 3TSSA 5LL6S 2RVLA 1STYA 1DYQA 3BDOA 2BE5D 4BBSG 1YHBA 1N8RC 3O13A 1SNOA 4JBMA 4O1NA 3RMHA 2N3SA 1A8VA 1IZ6A 1NUCA 1Q3LA 4EQNA 1LT3D 4GLAC 2K7VA 2QDBA 2A68D 2F0OA 2QKIC 1EY0A 1BUVT 4KJOA 4MNOA 4HJAA 1R9TB 5IGGA 2JA5H 3PO3B 3GTQH 4A93H 2K5VA 3W1GA 2N88A 3HKZE 2KHJA 2R93G 3K0XA 4HIMA 1TWHH 3S15B 5IP9G 2NWGA 3VR4A 4LJZC 2F0DA 4DR3L 1SE8A 1SNCA 2ES2A 1HFNA 1STGA 4LWCA 2D0OA 4FO2A 4A3FH 2HQLA 2VW9A 4XIGS 3AB9A 2Y0SB 3KBXA 1X54A 2L55A 2NVTB 4JI1Q 1AZQA 1AE2A 1SAPA 1EU4A 5JAVA 1I4GA 2XTIA 4IUVA 3VA5A 3FKIB 4KHZA 2Z8LA 1D8LA 4GNXB 2F4VL 3S2HB 2EIFA 4ULLA 5C4ZA 5J3BA 3L7ZC 1FVIA 1G91A 1I94Q 4A3EG 3TS0A 1RHPA 2D9UA 2XWJB 2NYZD 1JMCA 1M90C 4NW2A 4C1NK 2NTSA 4WRDA 3OTOQ 3BS1A 4DR3Q 5IP7H 1TWGB 1DOLA 1SMYD 4XQQA 4IPCA 3HOVB 2CCZA 2B29A 3QG1A 3NBHB 1ZKOA 4EVOA 2HDLA 4EX5A 2K75A 2A6EC 1EY5A 1QUQB 2ZXPA 1KL9A 4XXEA 1G6ZA 1SMYC 1O7ZA 3MXGA 1I4QA 4K2KA 4YIJA 1L0WA 5K36H 1XJVA 2L11A 3JAME 1CI3M 1IYVA 3V2TA 1K83B 2DNEA 1QVGA 1I4XA 4NPSA 4A3KH 5IT9L 4NXNQ 1XMQQ 1K0SA 5M3FH 1F9RA 4TKOB 4KTAA 5CV9A 2LFNA 2OXPA 1OXXK 1P8LA 3IL8A 3HOYG 2I5MX 5C44H 1BOSA 5KGUA 3A7LA 1Q1EA 3GTLB 5CGKA 5K5PA 2C35B 3EBEA 1LUZA 3D3RA 1W6KA 2IWHA 1W3SA 5KIXA 1C4QA 3CRKC 2QF7A 2R3ZA 4UP9A 4DF7A 1IBKL 1N34Q 2VUMG 3HOVG 3VYSA 4DAPA 3KLWA 3ERQA 4PZ8A 1VQKA 5BR8L 2NTTA 4LUVA 3RZOB 3KDFB 3Q22A 4J6HA 1HZCA 4LF8Q 2F52A 2ATWA 4HIOA 3MEHA 1I6VC 2F0TA 1T5XD 2BA0A 2F0HA 5KNCA 1NJIC 1VQ9A 1SJHD 4IFDI 4RCNA 2UUCQ 1QUQA 4DUYL 2RHSB 1F2YA 1NY4A 4ME3A 3QR8A 3K57A 4AIMA 3U9OA 3M3YB 5FKAC 2TMPA 1VQFA 5C0XJ 2IX3A 1HTLD 3GTJH 1Y1VH 1EEFD 2UUCL 4CJ1B 1VQGA 2UXDQ 3BVGA 1XX8A 1KDAA 3L9AX 4H13C 2B8FA 3MFYA 2A1AA 5FLMG 1RTOA 4JI0Q 5ELFA 2CH4W 3R3OA 3UDGA 3CCVA 3NQIA 1SYGA 2OWOA 4LF8L 1TS5A 1Z7TA 3G6JB 3FHWA 4YCUA 4N8X1 1BF4A 1QG7A 3JC66 4POGA 1LM0A 2B2WA 4RFBA 3F1ZA 1HTPA 1D5XC 5IE8A 3HOZB 2SNMA 1PYSB 4B9XA 1ML0D 3S1QH 2I5LX 4GN3B 2JA5G 2VUMH 4HJ7A 1Q90A 3E0EA 4MIUA 3Q24A 1U9RA 1VQ6A 4DV3Q 2R93H 4RGOS 1A2UA 1Y1WB 1EQQA 1GUWA 3KUPA 2NVXH 3I4OA 2EZVA 1LACA 1HXYD 2Q8RE 4RGNA 4DR2L 2K5DA 4V190 1YZ6A 2SDFA 1I3QH 1EFWA 1VQJA 4DV1Q 3KLRA 1EOVA 1FGUA 1MBYA 1II3A 1YNXA 4C3IB 3KLSA 4IJLA 4S3SA 3J7YW 2UXCQ 2R6GA 4XT1B 5JEAH 3TP7A 4QGUA 3H6MA 1B3AA 3EVQA 1PA6A 2LXJA 1JJ2A 3PF4A 3I2ZA 1PTOC 5C4HA 5J39A 1PRTF 4LNQA 3F2UA 4LK1C 4KKTA 4NXMQ 2GA4B 2FINB 2F0SA 3AU7A 2O4XA 1YBYA 5FLMH 4KD3A 5EPLA 3M7NA 1U5KA 2B3GA 1B4OA 4BY7B 5IYDH 4FXDA 4RHSA 3G6EA 2IX0A 5IP7G 4XQJA 5EKIA 3M9BA 5IGFA 3GTOH 5CV7A 1F9QA 3K0YA 5G3LD 3KYHC 2IHEA 2R7ZH 3GTMB 4DV2Q 1CSPA 4KY5A 1SLJA 1YNJC 3F2CA 1TWAH 2ZM6Q 5K36G 3W1BA 3A0JA 3SXHA 2RDFA 3I8ZA 1I6HB 2PW7A 1Z9FA 3CAMA 2WAQB 1EY6A 2JEAI 1DM0B 2UUAL 4EQPA 3VR6A 1CUKA 1KLGD 2ZXRA 4DUZQ 1LTGD 4KY7A 1PH9A 5EBDA 4DR7L 1Q1BA 2ZM6L 1L1OC 3NSWA 2AMCB 2I5HA 2G9HD 5TSSA 1VQIA 3STBD 1N32Q 3I3CA 3GTPB 5J1ZA 1TU2B 3ND8A 2Q2TA 1RKNA 4C3JG 1M1KC 1A15A 2BDNA 5EJWA 4L5RC 3GQBA 3TP5A 1HA5A 1HJPA 3OWEB 4PNYA 1VQ5A 3DWPA 4LUZA 1WD1A 1NR2A 1ZXTA 1C9OA 1CA5A 2JEBI 1D5ZC 1NTGA 1U4RA 1SBBB 4H02A 5D3DA 3HP3A 2B2UC 4OEMB 3CQZH 4IJHA 2I0QA 2EOTA 5LMNQ 1E1TA 3K81C 1VQBA 2K50A 4QY7A 1VQ8A 1NR4A 2A6ED 1TS4A 2QEXA 2FMMA 2QCPX 4DXGA 5M5XB 1VQ7A 4IUQA 1NMGA 1UEBA 1BDOA 3LGJA 2RDGA 3QO2A 3D8GA 4OX9L 3M7GA 4V0BA 3M4PA 1F2ZA 2JXMB 4IPGA 2QW7A 4CGYB 3JAMc 2CFMA 4J8QA 4DR2Q 4DA2A 5C3WA 4FXGC 5ELCA 3GTKB 2CW0C 2KOLA 4BBRG 2OQKA 4ZK9B 2UXBQ 4X3KA 2DGYA 2JQOA 1BCPD 5EKLA 1ILPA 3P7JA 4JI8Q 3TDQA 1V8QA 3T13A 4DPGA 1SE2A 4H44C 2EXZA 1XWEA 2CQOA 4M8AA 4I65A 3PO2G 3GTGB 2JA6G 4YCVA 1GUGA 1YNND 4DV4L 4UHVA 2HT1A 1A62A 2IHFA 3ITPA 2EPBA 5EGTA 2Q2UA 2VB3X 2F4IA 3SDZA 3S9WA 4NKLA 3S2DH 4IPDA 1PH3A 4KN7C 3CRLC 4ZKCB 1TWCB 1Y8PB 3T51B 1CKOA 4DGZA 1STBA 4GS3A 5GAGC 3J7A5 3S14H 3TEHB 3STBC 3DWAA 3WOFA 1C7YA 2IY5B 2IPKD 1GHJA 1VMPA 2MGSA 4BA1I 1XNRQ 1VCIA 4DR6Q 4M1UB 2HIXA 2Z0SA 1PVOA 4A3KB 4DAVA 2F3VA 2EJMA 1VQMA 4JI7L 2MO1A 1EYGA 2UUBL 2AQ3B 4FF4A 1G2TA 3RZDH 2BCOA 3E9HA 1XMQL 4R8NA 3A7AB 3C3LA 4KKUA 1IYUA 3EIVA 5IYBG 1L1OB 2JYOA 3RLNA 3MXUA 2PO4A 5I9PA 1I5FA 3RLFA 5J22A 3MEFA 1BXTA 2EY2A 3CP0A 4GKJL 2L9HA 4CDDC 1C0AA 2UXCL 3L0OA 4G4KA 1VQ4A 1JJGA 4WJWA 1CQFA 1V1PA 2PMZB 1VS0A 2F0PA 4A3MH 3CD6A 4X3SA 4X6AH 1CZWA 1SNMA 3L2PA 1AEXA 2BDOA 1NAPA 1Z47A 5EPJA 1D1KA 5EKKA 3PO2H 4QIWB 4AQYQ 3I4NB 4QF4A 2L12A 1WTVA 1MSHA 1TY2A 1YHAA 1AE3A 1EYAA 3PUXA 1W6JA 3BVMA 2F0QA 3I90A 5JVG3 4KHPL 4LFBQ 3I70A 4A3BH 4TQUS 5KRUA 4F7XA 2MHVA 1HPCA 2F3IA 1CK1A 5I2XA 1MGSA 2PI2A 4F87A 3CCSA 2E2JH 4JI6Q 5IWAL 1KC8C 3EA6A 2VY3A 1KHIA 2OTLA 3PUWA 1XNQQ 2LS01 4KD4A 3MHBA 4DUYQ 3D4WA 2VQFQ 1UE5A 4C3IG 3TS2A 4JPBW 5FO7B 1CTMA 3DLLA 3NELA 3G71A 4CJ2C 4C3JH 3E0JA 1HUNA 1QILA 5A35A 2N78A 2NN6H 3P1HA 1TVXA 2K33A 5IGEA 3I4MB 4KY6A 3TRZA 1H9SB 2B2YC 4X64Q 3MVVA 1PTOB 4KV6A 5I4DA 3PMFA 2C5CA 1PFNA 3OIPA 4XYOA 3F2BA 3E5SA 1K3RA 1X3FA 2E2HH 1DD2A 1LTAD 5A2QL 3TQYA 5KNDA 3OMGA 4DK6C 1Y1WH 5CBAE 4YWLA 2Z1CA 2MFIA 1B3QA 4KN4C 3I72A 2SEBD 1UEAB 3DEPA 4WJ3M 2JA9A 5M3MB 1FJGL 4P2CB 2VQFL 1UE1A 2KCTA 1MJEA 2B2UA 1JR0D 3KF8A 2F0WA 5KEEA 3DM1A 4O2DA 5IGCA 2L5TA 3H3VI 3A8KE 3S17H 1TR5A 3CMAA 2IX1A 2SNSA 2NN6I 1RODA 1WTWA 2B8GA 2NVYB 1PH4A 1EU3A 1SNDA 4GLVB 1H9KA 4A76A 3IAYA 2EY1A 4EGVA 3J81i 1EIGA 3PIOA 4ZRZA 4DR6L 4LFCQ 4MN3A 1X65A 4IFDG 1AZPA 1FNWA 3MWYW 3OMCA 4R4IA 1EOTA 1GUSA 2PZTA 4FP5D 4B3ML 1JORA 2PYKA 4OIKA 1SYCA 1JE4A 4BY7H 2FJ2A 4DNTB 1I94L 2JA6H 2UXDL 2F0JA 4DK1A 3G7LA 1YHQA 1EQRA 3TP6A 4JG2A 2E5LQ 4JI1L 1KRSA 4DAYB 1LTRD 3CCQA 1HUMA 5C4XH 4A3JB 2HHHQ 1BQQT 5CMDA 1GUTA 3IFDA 5M3MG 1CFMA 5CV5A 1GJXA 3H94A 3VYTA 3T1HL 1MD2D 2HDMA 1G51A 4FVMA 5CV6A 1I4PA 1D1IA 4A3GG 2WAQE 2OEOA 5AFWA 1UE7A 2NVQH 2XNAC 3S16H 4JI3L 5F2DA 3OOCA 2A19A 1I50B 2KQ3A 5JPMC 5ELOA 2MO0A 1IL8A 4FXKC 5IOCA 1D6EC 3NXWA 3L3OC 2PNRC 3T4AC 1Q7YC 3DXJC 4JI2L 3MFGA 2WKDA 1BVSA 5IGDA 3PIO3 2A69C 4GKKL 1ENFA 4KHPQ 4LFBL 3SVMA 1XMOL 4DFAA 2IL8A 1N32L 2AWOA 2B2YA 3K7AH 4O42A 2PMZE 3KF8B 1EYDA 2I07B 1I4HA 1LO5D 1VDZA 3H3VH 3H3VC 5JEAJ 2R92B 3S2HH 1K28A 3TZDA 4GLXA 2D2CC 2LKVA 2Q8TA 2FHTA 1BNZA 1JCKB 4A3LH 2B39A 1PZKD 3HOXG 4JVZA 2XVSA 3TBIB 2OF1A 3A74A 2MJ8A 5JJZA 4P75A 1RDPD 4K0KL 1S5FD 1KXLA 3P20A 5ELDA 3J80c 4AH6A 4I7AA 4JI2Q 4A3DH 2FMCA 1L1OA 4IQZA 1PYWD 4XDXA 2B2VC 2KHIA 4DV6L 3WOEA 2ENBA 1Q81C 2MUYA 4ALPA 1SMXA 1SYDA 1VQDA 1O7LA 4A3GH 1AFPA 3HGBA 1K83H 3OPOA 4TRDA 2PI2E 4A3FB 1SN8A 5D3IB 1CKNA 3VYUA 4H0LC 1FGBD 3UI2A 4FF2A 4CKEA 4JK1C 4ABNA 1IBLL 1HA6A 4BXXH 2R61A 2VZAA 3OIQA 1BCPF 4X64L 3HOWG 2ZJPA 4R9WA 2ALYB 4APVA 2XRQD 1DOKA 3DWQA 2NB0A 5E4WC 1F9SA 1FNUA 2MP1A 5FLXL 5C44G 2F0LA 1IBLQ 1NSNS 1KIXA 2BOSA 5C0XH 1E3PA 2RCFA 4K5XA 1TS3A 1O80A 3R93A 4KMUC 3CW2C 5DM63 3AFQA 2WV6D 3CCUA 1X56A 1FJGQ 4JOIA 2JA8H 2RDHA 3M4YA 1F9PA 2JSOA 4JI4L 4BY1G 3SEBA 1FYCA 1U4LA 4BS9A 2KCNA 4L8JA 2JA7G 1VMCA 3VR3A 4LF5L 3SK6A 1TIID 2VQEQ 1BR9A 3ONAB 5IYCH 4LF6Q 1HNWL 2E2DC 1VF5C 2J4XA 2A69D 1FD7D 2MQHA 2HHHL 2EQSA 1JICA 1S4ZA 2K04A 2K14A 1S5BD 1WCMG 1Q12A 5C4JB 4KK7A 5HY6A 2K28A 1LLRD 1G6PA 4OO1G 2KUMA 2CQAA 1PRTB 1S72A 1WTOA 5EQ0A 5HGTA 1B7YB 1Y8NB 2RBMA 5C44B 3VYRA 3CCMA 1Y1VG 4DR4Q 1JOOA 4PMBA 4OGQC 3D6WA 4HIDA 2CVRA 2HIVA 3FKIG 3K5OA 4BY7G 3J80E 5LMUQ 4QUCA 4N8FA 4WFN3 2NZ1D 3J81c 4ZUIA 1E7ZA 4DR5L 2KEDA 5C4XG 1HZ9A 1ESRA 1ET6A 1STEA 4OHJA 1HFGA 3G4SA 1ZYRD 1PTOD 2X6GA 1B1ZA 2V1CC 3I56A 5G3LF 2AQ2B 2ICEC 3ZYYX 4JI5L 2HCCA 1ICWA 2CHBD 4CBVA 5DM73 3PQIA 1NMFA 3GD7A 1JOKA 1ICFB 4GOPC 3UE1A 4DR4L 2DNCA 5KYLA 1IW7D 1KNEA 2PQEA 2RCNA 3HKZG 1X3GA 1CZGA 4DN4M 3J7AV 3SR1A 1LTTD 2F0FA 4WJ4A 4ZLTF 4JBKA 3CHBD 4ZUJA 3S1RH 4I7ZC 4DR5Q 1RD9D 3H0GH 1EUJA 4J1MA 4JI8L 3T1YQ 3PO3H 1TXYA 5GAEC 1ONLA 4A93B 3NEMA 1V9PA 4FNFA 4ZAIA 2ASBA 4QJFA 1K3BC 4HJ8A 3HOXH 1A3TA 2KCCA 2E2HB 1HNXQ 5ELNA 2J7ZA 3K59A 4HTHA 2VUMB 1PH2A 5CBEE 4A3IG 1HR0Q 3GP7A 2R93B 5BN4A 2NVXB 4IOCA 4BBSH 2PZUA 5IGBA 3HOUG 2ZXOA 3HKZB 3NTHA 3TMEA 2PPBC 3CC7A 1WTPA 3IRBA 4Z9CB 1SYFA 4JYAQ 5C5LA 2RKSA 1O78A 2EJGC 3MZ5A 4YWMA 4G7OC 2E2IH 1HNZL 4EQOA 3A5UA 4K6DA 2RQXA 3ULJA 3R2IA 1IW7C 4IPHA 3K7UC 3V05A 2UUBQ 1XTDA 1MSGA 2F1MA 3BG3A 3K6OA 4A4IA 2CW0D 1EL0A 4RA8A 4O0AA 2CWAA 5JOBA 1N33Q 4Q5VA 1D2BA 1LTSD 2N55A 1R4PB 1A63A 3W5OA 2C9OA 4DK0A 4HIKA 1VQLA 3DUZA 1QVCA 1E22A 2K03A 1S5CD 4GKJQ 4JOIC 4B3MQ 4DV5L 3GTPH 1ILQA 2JA6B 1YNJD 5M5YH 4K5VA 3PSIA 4N9PA 3OSOA 1YI2A 2ZTDA 1AH9A 3PO3G 3CPFA 4U68A 3I4MG 3BZKA 2JK8A 2JA8G 1PH7A 1A6XA 1MIUA 3K5LA 2A8VA 1JWUD 3I7FA 4R8IA 1YJNA 1M8AA 2EYHA 3HOWB 4BBRB 3K5NA 1HRJA 3PUZA 4A3EH 2KVMA 1GUOA 4E6IA 3NENA 2JA5B 4Y7NH 1TWFH 1BO0A 2N8NA 3S24A 1I50H 3HG9A 3W3AA 3ULPA 4LF7L 1N9WA 1VQEA 4DR1Q 5LHY1 3HOUH 4X65L 2QILA 4B9WA 4OXPA 2KHSA 5AJ3L 3QIAA 4GNXC 1ENAA 2KJXA 5IWAQ 2VNUD 1HHVA 2B2VA 5LL6X 4BWGB 1OXSC 1L0XB 1S3OA 4YCWA 4DR1L 1H9JA 2F0NA 3RZOH 3GTKH 3UDFA 3QOLA 3ER0A 4KI0A 1JB3A 5E7NA 3SE0A 1DONA 1O7YA 2GN5A 3FKIH 4OIJA 3CMEA 2RF4A 4P73A 3AMUA 2HD3A 3A5ZB 3NP8A 5DNFA 4A3KG 4G57A 5C5MA 2NBFA 2ZJRA 2F0VA 5CC4A 2F0EA 3JAMi 1N34L 3H09A 3HFZB 3S1MB 3D4DA 4GZYC 1Y8OB 5AJ3Q 1PV4A 1CHQD 1SNPA 1EWIA 3GTJB 3QWNA 4PMWA 1K8OA 4K2LA 2F0GA 4DV2L 2G5DA 3HOVH 4IALA 1EZ6A 1QOHA 2EXDA 3BZDB 1PHJA 1EIHA 3VA7A 1BCPC 5FJ8H 2Q2IA 4L5TA 3UDXA 2K52A 1PZJD 3OW7A 1LV9A 2N49A 3P75A 2JA7B 1WOCA 1K8MA 4CKCA 1SFOB 4DV0L 1SEBD 2P5ZX 1MJCA 5EPKA 4DR7Q 3QOJA 4OWWB 3EQLC 3KFUA 2DN8A 1PXUA 3EFXD 3FPUB 3MXNB 1WCMB 2RA4A 3MXNA 4ODGA 4G7ZC 5E1FA 2Z9HA 3FP9A 4IUTA 2XGTA 5T1GA 1FNVA 2UU9L 4DV3L 1U4PA 1XXGA 1XYIA 1YIJA 2O5IC 2AHOB 2A6HD 2CKZB 3GTGH 1HQMC 4GN4B 4YHHL 3T53B 4C3HB 4B08A 3CCLA 2B2WC 2XWBB 1KABA 4A3IH 5EBCA 4B3RL 1GM5A 4KLKA 1WVLA 2TSSA 2ZJQA 1E24A 2A5HA 1VQOA 3BJUA 2QA4A 1KDBA 1JOQA 3U58A 4LFAL 3FVQA 2BH8A 2R7FA 2VQEL 2WFWA 4AYBG 3RR5A 1JJCB 1R4QB 4UDUC 2K32A 2WP8J 5M5WH 2PW5A 2D62A 5D14A 5FJ8G 1SNQA 1A0IA 1GUNA 4LFAQ 2L0CA 1IL2A 3U4ZA 2EYFA 4A3BG 1E2ZA 3IFTA 4XT3B 5C3EH 3CPWA 1U0LA 1ASYA 2D0PA 2V4DA 1SROA 4HCEA 3VR5A 3I73A 3PIP3 4JYAL 4DV6Q 1T5EA 1UE6A 4ZQ3A 3M4QA 4F88A 2YYZA 1X3PA 1NBWA 2KECA 1NE3A 1CA6A 2WB1B 4OL7A 5JJIA 3OW2A 1A3VA 3Q23A 3GTMH 3JAML 4RKBA 1KDCA 1R9TH 1BBUA 1SRUA 3TZUA 5CR3A 1X3EA 1RTNA 3I4MH 2YTXA 5GQOA 1IXRA 1TWAB 5JEAG 1EIYB 5ELBA 1PTOH 2M9VA 3NBHA 1V1PB 3BYYB 4N9TA 5KYIA 1SDFA 3KF6B 4DV4Q 3I4NH 2XN9C 1CKMA 4X65Q 3CKIB 4AQYL 2F0UA 3OHXC 4P71A 2B2TA 2E75C 1HZAA 2Q2HA 2K1BA 4HJ9A 5A2QE 3PUVA 5JVH3 4K6LA 2B63B 1OXUA 1DZ1A 4RGMA 1DOMA 1GOZA 1WTHA 1EY4A 2I46A 2LY7A 2IT1A 1I3QB 5IYDG 4BA2I 2R7ZG 1F2MA 1RF2D 3UE0A 1W2BA 2A6HC 5C3XA 3BVZA 2M2LA 1OO9B 4JI4Q 4UPAA 3EN2A 4CKBA 4OONA 1CQVA 1EIFA 3W2DA 4DAMA 2UUAQ 2E74C 3FMCA 1Q86C 3D31A 5JJLA 1Q46A 5FK9C 2EYOA 1ENCA 3AFPA 1ZEQX 4IO9A 4LF6L 1HNWQ 3H0GB 2Z6BA 1PRTD 4DXFA 4QMGA 1WD0A 4HAEA 3Q8DA 4IZ8A 1KD1C 2OQ0A 3CQZB 2ID0A 3U9SA 3GTQB 2LMCB 2BA1A 2PCFB 1GKHA 3AQQA 2X69A 4HEDA 3C1EA 4X66Q 3HOXB 1TWHB 2PQAA 1Y14B 3I55A 2ZTCA 3URYA 4GKKQ 5CYUA 2PQAB 1Q8IA 2VB2X 2KA7A 3OWFA 5FLXE 4C2MB 1BBWA 1G8ZD 1GVPA 1O7IA 4OO1I 2HCIA 3GTOB 1IYJB 3J80i 4XTCS 5C0XI 1NCVA 4JV5Q 4X66L 2Z4IA 3V96A 1MHWC 3I4NG 3DHQA 1PLFA 2WAQG 4ME5A 4KJNA 2MPMA 2NVTH 5M3MH 5EAYA 1QJOA 3ICEA 1YNNC 3RN5A 1WTRA 2KBNA 5M3FB 3S16B 4B3TQ 4IFDJ 1K8GA 2WB1E 2BE5C 1EEID 1EYCA 2EDGA 2O5JC 3LWEA 1KNAA 1PFSA 2PZWA 3MXPA 1KAWA 3PGZA 4L5QA 3D0FA 1QVFA 2XRSD 2R7DA 1IBKQ 1J5EL 3CC2A 1YEZA 4C56C 1SXTA 4B3TL 1PH8A 1SR3A 4HMJA 3SK4A 1C8CA 2OCEA 1IBMQ 1EQTA 3KOJA 1KAAA 2EYJA 4GN5A 2O2LD 3CU7A 1H95A 1TWGH 2VXWA 3K7AB 4JBJA 2RHQB 1WI5A 1RCVD 3HEJA 1DXMA 1SJED 2EY5A 1STAA 5LMNL 1K8AC 3KJPA 3S14B 1OXTA 3ND9A 1D5MC 5FO9B 3C2PA 2GVAA 3Q0AA 1UWVA 2Q8IB 3NBIA 2QEJC 2AWNA 4NDXA 4R4TA 3CCEA 1X6OA 4A3EB 5M3FG 3M3YH 2YV5A 4Y7NB 1PH1A 5CORA 1KQSA 1EWCA 4JW0A 2AUJD 2JJQA 5IY0A 3HOYH 4C1NI 4A3DB 3UDIA 1GO3E 4JI5Q 5M9OA 1G291 1JWMD 3NE5B 5FO8B 4X3TA 3HOUB 3U4VA 3A55A 1X55A 2Z6KA 4CJ0B 3NWSA 1RL2A 3OYYA 1J8IA 1C48A 4DNRB 2SOBA 3GTLH 4L6TB 1SYBA 1A3UA 3LWUA 2E76C 1HQRD 1EZ8A 4X62L 4G7HC 1WTXA 4P74A 1WFQA 4XQNA 1PTOF 4RH6A 4J15A 3LNNA 4RWSC 4BY1B 2F3WA 2K6AA 3SK8A 1AW7A 5GROA 2JE6I 3G48A 4DK3C 3NPPA 4MZ9A 1HNZQ 1HCZA 3PO2B 4Q0FA 1J9OA 1EY8A 3BZCA 1P16A 2A74C 3DMUA 4AYBB 1B9MA 3S1QB 1Z6HA 3T1YL 1IHZA 4DU9A 5IYBH 2R92H 3T1HQ 1T9HA 3PV0A 1JB7A 1U4MA 4GNXA 1H9SA 2AQ1B 1VF7A 1RJTA 1PRTC 2EE1A 4A3BB 1LYLA 4LF9L 1Y69U 4F8MA 4JI7Q 1BBXC 1HR0L 5L37A 4QIWE 4IUUA 4L63B 5JJKA 1Y1VB 4X62Q 4UP7A 1M4VA 3TREA 5CV8A 1TWCH 1PH5A 1FL0A 1XPRA 2K4KA 3F2DA 2NZHA 2ZT9C 3VDYA 3NUCA 1SSOA 1B44D 1JWSD 1XNRL 4ZYSA 4ILWA 4C3JB 3RLOA 1LT5D 1YJ9A 1B53A 1QB5D 4ZKBB 3RZDB 1A2TA 1WJJA 3NK9A 3H91A 2EYPA 2H4OA 4YY3L 3S1NH 2EYLA 4DUZL 3RNUA 3I91A 4H7BA 1GXDC 4IN3A 1PFBA 5COYA 4Y52H 3MA2B 3HOZH 4LF9Q 1S5ED 2IW3A 4L5SA 2WKCA 4X3UA 3M4OH 3FEWX 2G9DA 1CSQA 5DLQE 3NTKA 1DJRD 1G2SA 5BN3A 5I6YA 3DM3A 1YITA 3E3XA 3NQTA 4PMCA 4R4OA 4C3HH 2Z6KC 1UNSA 1J5EQ 3HKSA 2WB1G 4A3IB 2HUGA 4KHVA 2K5WA 3EROA 1ET9A 3Q6SA 1GD7A 4CDFC 1CHPD 3GO5A 2YU9B 3GV6A 3C46A 1JQYD 4OELB 4FF1A 4C3IH 3RUZA 3CF5A 2UU9Q 2Y0SG 3PUYA 3R8BA 3I4LA 1TQOA 4K14A 1XTCD 4PZ7A 5HURA 4HSPA 3N6RA 4LF5Q 1TY0A 3CC4A 4QCLA 2OTJA 3FRPB 4LFCL 1Y1WG 4WORA 2WINB 1YJWA 4RMFA 5T1IA 5C3EB 1QE6A 1B2TA 5CV4A 3DEOA 2DJGC 1XNQL 1KRTA 3T16A 2DY7A 4XYQA 1LABA 4LF4Q 3ERSX 2E5LL 1HH2P 4U673 4QL5A 4EQ5A 1N36Q 2QGQA 2L4NA 3PIPA 1H9MA 1WYDA 1ASZA 2H5XA 4RHRA 3QB3A 1OXVA 3HZXA 4TVAB 3ZJYC 3J81j 4LF4L 2NVQB 3M85A 4A3JG 4RG1A 2PNHA 4GOPA 1I6HH 2L15A 1IBML 4LAAA 4RKLA 3A54A 3S15H 3A56A 1AN8A 5M5XH 2D5DA 2KCMA 4IFDH 1HZBA 2H1EA 1FR3A 1LT4D 2JP1A 2B63H 4BBSB 3K80C 1Q8KA 1XPUA 1CM9A 4HN7A 5ELEA 1MI2A 2VS1A 3E6ZX 3A8JE 1JT8A 3F8TA 3MAQA 3TP8A 2A68C 2M00A 1MKHA 1PMRA 2XIWA 1LT6D 1WTQA 3S1RB 2K01A 3HS0C 2NVYH 3J7ZC 1Q82C 4CHTB 3NWTA 4LF7Q 5E3FA 1JE5A 1QCBD 1XMOQ 2HQEA 1XPOA 3GDEA 2R92G 3C1FA 3N52A 1SE4A 4MTNA 4IOAA 5D65A 1E2WA 2NZOA 4NXNL 4HSVA 1EY7A 3SHLA 5M5YB 4GOPB 1TS2A 3GV3A 4YHHQ 1V1QA 1OTCA 4JI3Q 4JBWA 4PV1C 1L0YB 4C2MH 4MHEA 2K5HA 4NMZA 3K5MA 4B3RQ 2AUKA 2B2TC 1STHA 3D6CA 4A3GB 4HCSA 4FYDA 4LMQD 4A3JH 1VQAA 5C4XB 1YVCA 4UAIA 2JN4A 3J81L 4DNIA 2K5QA 2X6LA 1E0BA 1EFID 4BBRH 3LX0A 2KEEA 1PFMA 4JCVE 4DKAC 4HR7B 4PQXA 4TSSA 3FDTA 3BDCA 3TN2A 4YY3Q 3K58A 2E2IB 2EYMA 4QQBX 3RD4A 1HR0W 1UUPA 5H1SE 4B3SQ 1K0RA 2QDLA 4A3LG 1KLUD 3J80L 4NXML 4OWXB 4YWKA 1PYBA 4A3DG 3R2TA 3CXCA 4DV0Q 4AYBE 2F0IA 3MTSA 2RSOA 4K8JA 4UP8A 1H9RA 3EJIA 5IT9E 2ICIA 1TT2A 1N33L 3HOZG 1UAPA 3MC0B 3PF5A 1QWYA 4A3MB 1SYEA 4A75A 1X9NA 3U50C 2L1BA 3VR2A 4DAYA 3FPPA 2LXKA 3S2DB 4C3HG 1S5DD 4RAUC 5C6AA 5FLXc 1VQHA 5E4XA 4BXXG 4ZCKA 3CCJA 2DY8A 1B8AA 1B50A 3KF6A 1IKMA 4R4CA 3CCRA 3E9IA 2UXBL 4FF3A 3K8AA 3SK5A 4PG3A 3B6YA 3S1MH 1JC7A 3HOWH 1F2LA 2GVBA 3BDLA 1STNA 4NB3A 4CDEC 3PCOB 2FXQA 3HOYB 4HJ5A 1I4RA 2Z4HA 1F77A 1TWFB 2RSNA 5IODA 1VQCA 1B70B 1LTBD 2K5NA 3J7AF 1VQPA 2YTVA 5DAUA 4HMIA 1PDQA 5C0XG 2WACA 1QZHA 3X3MA 4UY8C 3KBGA 1DGSA 5KNBA 4JI0L 3NTIA 1GHKA 4RCOA 4A3MG 1ZYRC 3KLSX 4A3CH 4POFA 5LMUL 2JA7H 4JV5L 4MTKA 3NHHA 4PZ6A 5IYCG 1PH6A 4BY1H 2F03A 1DCZA 1E2VA 3QJYA 3KJOA 5HGQA 3SGIA 1L2FA 3A8IE 1WCMH 3WDNA 1CKNB 4DV5Q 3T56B 1V1OA 1K73C 4OO1H 3BYTB 1LTLA 2Y0SE 3HRZC 2J0TD 1QNUA 2WIIB 3J81E 4NP5A 1E1OA 4IUPA 1J6QA 1BKBA 1ESFA 1SE3A 3OTOL 2EJFC 5BN5A 1S40A 1N36L 4KKSA 2E2JB 1X32A 2EVBA 1IKLA 5FOBB 2KENA 5NUCA 1EWHA 4JC0A 4DV1L 2JA8B 5DEHA 3KK7A 1KTKA 4IURA 4OX9Q 2B63G 2F4VQ 1EQVA 1NNXA 4DV7Q 1X3QA 2LSSA 4P72A 1K9MC 2BH2A 3S17B 4ID6A 3D4RA 2OT2A 4OWTB 2EY6A 1EY9A 3BU2A 1TKWB 2NUCA 2NN6G 4QB4A 3RN2A 5BR8Q 1VQNA 1CT1D 1SFOH 1LTID 5I2YA 5M5WB 2DUDA 4DV7L 1B9NA 3X3NA 3S1NB 1QZGA 4K5WA 2IJ0A 4R4QA 4RGTA 5C4JH 5LMNW 4LUOA 3AYHB 3ULLA 4LW1A 4R1JA 4A3CG 1HNXL 2XSCA 3M4OB 5C3EG 4FDBA 4A93G 3KDFA 2F0KA 2ZTEA 1RIPA 5I9OA 3WWVA 2F0MA 1AP0A 4QUFA 5IP9H 1V43A 4CDCC 1D7QA 2R7ZB
chains in the Genus database with same CATH topology
3IKJA 2K05A 5IIFA 1BCPB 1QNKA 5I6WA 2A73B 4K8IA 4IUNA 2FFKB 5JPNC 5ISRA 1PZID 3TSSA 5LL6S 2RVLA 1STYA 1DYQA 3BDOA 2BE5D 3O13A 1SNOA 4O1NA 3RMHA 1NUCA 1Q3LA 4EQNA 1LT3D 2K7VA 2QDBA 2A68D 2F0OA 2QKIC 1EY0A 1BUVT 4KJOA 1R9TB 5IGGA 3PO3B 2N88A 3S15B 2NWGA 3VR4A 4LJZC 2F0DA 1SNCA 1HFNA 1STGA 4FO2A 4XIGS 3AB9A 2Y0SB 3KBXA 2L55A 2NVTB 1AZQA 1SAPA 1EU4A 5JAVA 1I4GA 4IUVA 3VA5A 3FKIB 4KHZA 2Z8LA 3S2HB 4ULLA 5C4ZA 3L7ZC 1G91A 1RHPA 2D9UA 2XWJB 2NYZD 4NW2A 4C1NK 2NTSA 4WRDA 3BS1A 1TWGB 1DOLA 1SMYD 4XQQA 3HOVB 3QG1A 1ZKOA 4EVOA 2HDLA 2A6EC 1EY5A 4XXEA 2ZXPA 1G6ZA 1SMYC 1O7ZA 3MXGA 1I4QA 4K2KA 4YIJA 5K36H 2L11A 3JAME 1CI3M 1IYVA 3V2TA 1K83B 2DNEA 1I4XA 5IT9L 1F9RA 4TKOB 4KTAA 5CV9A 2LFNA 2OXPA 1OXXK 3IL8A 1BOSA 5KGUA 3A7LA 1Q1EA 3GTLB 5CGKA 5K5PA 3D3RA 1W6KA 2IWHA 5KIXA 1C4QA 3CRKC 2QF7A 2R3ZA 4DF7A 3VYSA 4DAPA 3ERQA 2NTTA 3RZOB 3Q22A 4J6HA 3MEHA 1I6VC 2F0TA 1T5XD 2BA0A 2F0HA 5KNCA 1SJHD 4IFDI 4RCNA 1F2YA 3K57A 3U9OA 3M3YB 5FKAC 2TMPA 5C0XJ 2IX3A 1HTLD 1EEFD 4CJ1B 3BVGA 1XX8A 1KDAA 3L9AX 4H13C 2B8FA 3MFYA 1RTOA 5ELFA 3R3OA 3NQIA 1SYGA 1TS5A 1Z7TA 3G6JB 1BF4A 1QG7A 2B2WA 4RFBA 1HTPA 1D5XC 3HOZB 2SNMA 4B9XA 1ML0D 1Q90A 4MIUA 3Q24A 1U9RA 4RGOS 1A2UA 1Y1WB 1GUWA 3KUPA 2EZVA 1LACA 1HXYD 2Q8RE 4RGNA 2K5DA 4V190 2SDFA 3KLRA 1MBYA 1II3A 4C3IB 3KLSA 4S3SA 3J7YW 2R6GA 4XT1B 5JEAH 3TP7A 3H6MA 1B3AA 3EVQA 1PTOC 5C4HA 5J39A 1PRTF 3F2UA 4LK1C 4KKTA 2GA4B 2FINB 2F0SA 3AU7A 2O4XA 4KD3A 5EPLA 3M7NA 1B4OA 4BY7B 4FXDA 4RHSA 2IX0A 4XQJA 5EKIA 5IGFA 5CV7A 1F9QA 3K0YA 5G3LD 3GTMB 4KY5A 1YNJC 5K36G 1I6HB 3SXHA 2RDFA 3I8ZA 2PW7A 2WAQB 1EY6A 2JEAI 1DM0B 4EQPA 3VR6A 1KLGD 2ZXRA 1LTGD 4KY7A 5EBDA 1Q1BA 3NSWA 2G9HD 5TSSA 3I3CA 3GTPB 5J1ZA 1TU2B 3ND8A 1RKNA 4C3JG 1A15A 2BDNA 5EJWA 3GQBA 3TP5A 1HA5A 3OWEB 4PNYA 3DWPA 1WD1A 1NR2A 1ZXTA 1CA5A 1D5ZC 2JEBI 1U4RA 1SBBB 5D3DA 3HP3A 2B2UC 2EOTA 1NR4A 2A6ED 1TS4A 2FMMA 2QCPX 4DXGA 5M5XB 4IUQA 1BDOA 2RDGA 3QO2A 3D8GA 3M7GA 4V0BA 1F2ZA 2JXMB 4CGYB 4J8QA 4DA2A 5C3WA 4FXGC 5ELCA 3GTKB 2CW0C 2KOLA 4ZK9B 4X3KA 1BCPD 5EKLA 1ILPA 3P7JA 3TDQA 1V8QA 3T13A 1SE2A 4H44C 2EXZA 1XWEA 4M8AA 4I65A 3GTGB 1GUGA 1YNND 3ITPA 2EPBA 5EGTA 2VB3X 2F4IA 3SDZA 3S9WA 4NKLA 4KN7C 3CRLC 4ZKCB 1TWCB 1Y8PB 3T51B 4DGZA 1STBA 3DWAA 3WOFA 2IPKD 1GHJA 1VMPA 2MGSA 4BA1I 1VCIA 4M1UB 4A3KB 4DAVA 2F3VA 2EJMA 2AQ3B 4FF4A 1G2TA 2BCOA 4R8NA 3A7AB 3C3LA 4KKUA 1IYUA 2JYOA 3MXUA 2PO4A 5I9PA 3RLFA 5J22A 1BXTA 2EY2A 2L9HA 4G4KA 4WJWA 1CQFA 1V1PA 2PMZB 2F0PA 4X3SA 1CZWA 1SNMA 1AEXA 2BDOA 1NAPA 1Z47A 5EPJA 1D1KA 5EKKA 4QIWB 3I4NB 4QF4A 2L12A 1WTVA 1MSHA 1TY2A 1EYAA 3PUXA 1W6JA 3BVMA 2F0QA 3I90A 5JVG3 3I70A 5KRUA 4TQUS 4F7XA 2MHVA 1HPCA 1CK1A 5I2XA 1MGSA 4F87A 3EA6A 3PUWA 2LS01 4KD4A 3MHBA 3D4WA 4C3IG 5FO7B 1CTMA 4CJ2C 3E0JA 1HUNA 1QILA 5A35A 2NN6H 3P1HA 1TVXA 2K33A 5IGEA 3I4MB 4KY6A 1H9SB 2B2YC 3MVVA 1PTOB 4KV6A 5I4DA 3PMFA 2C5CA 1PFNA 3OIPA 4XYOA 3E5SA 1DD2A 1LTAD 5A2QL 5KNDA 3OMGA 5CBAE 2Z1CA 4KN4C 3I72A 2SEBD 1UEAB 3DEPA 5M3MB 4P2CB 2B2UA 1JR0D 3KF8A 2F0WA 5KEEA 3DM1A 5IGCA 2L5TA 3A8KE 1TR5A 2IX1A 2SNSA 2NN6I 1RODA 1WTWA 2B8GA 2NVYB 1EU3A 1SNDA 1H9KA 3IAYA 2EY1A 4EGVA 1EIGA 4ZRZA 4MN3A 4IFDG 1AZPA 1FNWA 3MWYW 3OMCA 1EOTA 1GUSA 2PZTA 4FP5D 1JORA 2PYKA 4OIKA 1SYCA 1JE4A 2FJ2A 4DNTB 2F0JA 4DK1A 3G7LA 3TP6A 1LTRD 1HUMA 4A3JB 1BQQT 5CMDA 1GUTA 3IFDA 1CFMA 5CV5A 1GJXA 3H94A 3VYTA 1MD2D 2HDMA 5CV6A 4FVMA 1I4PA 1D1IA 2OEOA 5AFWA 2XNAC 5F2DA 3OOCA 1I50B 2KQ3A 5JPMC 1IL8A 4FXKC 5IOCA 1D6EC 3NXWA 3L3OC 2PNRC 3T4AC 3DXJC 3MFGA 2WKDA 5IGDA 3PIO3 2A69C 1ENFA 3SVMA 4DFAA 2IL8A 2AWOA 2B2YA 4O42A 1EYDA 2I07B 1I4HA 3H3VC 1LO5D 1VDZA 5JEAJ 2R92B 3TZDA 2D2CC 2LKVA 2Q8TA 2FHTA 1BNZA 1JCKB 2B39A 1PZKD 2XVSA 3TBIB 2OF1A 2MJ8A 5JJZA 1RDPD 1S5FD 3P20A 5ELDA 2FMCA 4IQZA 1PYWD 4XDXA 2B2VC 3WOEA 2ENBA 2MUYA 1SYDA 1O7LA 1AFPA 3HGBA 3OPOA 4TRDA 4A3FB 5D3IB 3VYUA 4H0LC 1FGBD 3UI2A 4FF2A 4CKEA 4JK1C 4ABNA 1HA6A 2R61A 3OIQA 1BCPF 4R9WA 2XRQD 1DOKA 3DWQA 2NB0A 5E4WC 1F9SA 1FNUA 2MP1A 5FLXL 2F0LA 1NSNS 2BOSA 5C0XH 4K5XA 1TS3A 1O80A 3R93A 4KMUC 5DM63 2WV6D 2RDHA 3M4YA 1F9PA 2JSOA 3SEBA 1FYCA 1U4LA 4BS9A 2KCNA 4L8JA 1VMCA 3VR3A 3SK6A 1TIID 1BR9A 3ONAB 2E2DC 1VF5C 2J4XA 2A69D 1FD7D 1JICA 1S4ZA 2K04A 1S5BD 1Q12A 5C4JB 4KK7A 2K28A 1LLRD 4OO1G 2KUMA 2CQAA 1PRTB 1WTOA 5EQ0A 5HGTA 1Y8NB 2RBMA 5C44B 3VYRA 1JOOA 4PMBA 4OGQC 3D6WA 2CVRA 3K5OA 3J80E 4QUCA 4WFN3 2NZ1D 4ZUIA 2KEDA 1ESRA 1ET6A 1STEA 4OHJA 1HFGA 1ZYRD 1PTOD 2X6GA 1B1ZA 5G3LF 2AQ2B 2ICEC 3ZYYX 2HCCA 1ICWA 2CHBD 4CBVA 5DM73 3GD7A 1JOKA 2DNCA 5KYLA 1IW7D 1KNEA 2PQEA 1CZGA 4DN4M 3J7AV 3SR1A 1LTTD 2F0FA 4ZLTF 3CHBD 4ZUJA 4I7ZC 1RD9D 4J1MA 1ONLA 4A93B 4FNFA 4ZAIA 1A3TA 2KCCA 2E2HB 2J7ZA 3K59A 4HTHA 2VUMB 5CBEE 3GP7A 2R93B 5BN4A 2NVXB 2PZUA 5IGBA 2ZXOA 3HKZB 3NTHA 3TMEA 2PPBC 1WTPA 4Z9CB 1SYFA 5C5LA 2RKSA 1O78A 2EJGC 3MZ5A 4G7OC 4EQOA 4K6DA 2RQXA 3R2IA 1IW7C 3V05A 1MSGA 2F1MA 3BG3A 3K6OA 2CW0D 1EL0A 4RA8A 5JOBA 4Q5VA 1D2BA 1LTSD 2N55A 1R4PB 2C9OA 4DK0A 3DUZA 2K03A 1S5CD 1ILQA 2JA6B 1YNJD 4K5VA 4N9PA 3OSOA 4U68A 1A6XA 3K5LA 1JWUD 4R8IA 1M8AA 2EYHA 3HOWB 4BBRB 3K5NA 1HRJA 3PUZA 2KVMA 1GUOA 4E6IA 2JA5B 1BO0A 3HG9A 3W3AA 5LHY1 2QILA 4B9WA 2KHSA 3QIAA 1ENAA 2KJXA 2VNUD 1HHVA 2B2VA 5LL6X 4BWGB 1OXSC 1L0XB 1H9JA 2F0NA 3QOLA 4KI0A 3SE0A 1JB3A 1DONA 1O7YA 4OIJA 3AMUA 3NP8A 5DNFA 4G57A 5C5MA 2NBFA 2F0VA 5CC4A 2F0EA 3H09A 3S1MB 3D4DA 4GZYC 1Y8OB 1CHQD 1SNPA 3GTJB 3QWNA 4PMWA 1K8OA 4K2LA 2F0GA 4IALA 1EZ6A 1QOHA 3BZDB 1EIHA 3VA7A 1BCPC 1PZJD 3OW7A 1LV9A 3P75A 2JA7B 1K8MA 4CKCA 1SFOB 1SEBD 5EPKA 3QOJA 3EQLC 2DN8A 1PXUA 3EFXD 3FPUB 1WCMB 2RA4A 3MXNA 4ODGA 4G7ZC 5E1FA 4IUTA 5T1GA 1FNVA 1U4PA 1XXGA 1XYIA 2O5IC 2A6HD 1HQMC 3T53B 4C3HB 4B08A 2B2WC 2XWBB 1KABA 5EBCA 1WVLA 2TSSA 2A5HA 1KDBA 1JOQA 3FVQA 1R4QB 4UDUC 2K32A 2WP8J 2PW5A 2D62A 5D14A 1SNQA 1GUNA 2L0CA 2EYFA 1E2ZA 3IFTA 4XT3B 2V4DA 4HCEA 3VR5A 3PIP3 3I73A 1T5EA 4ZQ3A 4F88A 2YYZA 1X3PA 2KECA 1CA6A 2WB1B 4OL7A 1A3VA 3Q23A 3JAML 4RKBA 1KDCA 3TZUA 5CR3A 1RTNA 1TWAB 5JEAG 5ELBA 1PTOH 2M9VA 3NBHA 1V1PB 3BYYB 4N9TA 5KYIA 1SDFA 2XN9C 3CKIB 2F0UA 3OHXC 2B2TA 2E75C 2K1BA 5A2QE 3PUVA 5JVH3 4K6LA 2B63B 1OXUA 1DZ1A 4RGMA 1DOMA 1GOZA 1EY4A 2I46A 2LY7A 2IT1A 1I3QB 4BA2I 1F2MA 1RF2D 2A6HC 5C3XA 3BVZA 2M2LA 1OO9B 4CKBA 3W2DA 1CQVA 2E74C 3FMCA 3D31A 5FK9C 2EYOA 1ENCA 1ZEQX 3H0GB 1PRTD 4DXFA 4QMGA 1WD0A 4HAEA 4IZ8A 3CQZB 2ID0A 3GTQB 3U9SA 2LMCB 2BA1A 2PCFB 2X69A 4HEDA 3C1EA 3HOXB 1TWHB 3URYA 5CYUA 1Q8IA 2VB2X 2KA7A 3OWFA 5FLXE 4C2MB 1G8ZD 4OO1I 2HCIA 3GTOB 4XTCS 5C0XI 1NCVA 2Z4IA 3V96A 3DHQA 1PLFA 4ME5A 4KJNA 2MPMA 1QJOA 1YNNC 1WTRA 5M3FB 3S16B 4IFDJ 2BE5C 1EEID 1EYCA 2EDGA 2O5JC 3LWEA 1KNAA 2PZWA 3MXPA 2XRSD 4C56C 1SXTA 4HMJA 3SK4A 1C8CA 1EQTA 1KAAA 2EYJA 2O2LD 3CU7A 2VXWA 3K7AB 1RCVD 3HEJA 1DXMA 1SJED 2EY5A 1STAA 3S14B 1OXTA 3ND9A 1D5MC 5FO9B 3C2PA 3Q0AA 2Q8IB 3NBIA 2QEJC 2AWNA 4NDXA 4A3EB 4Y7NB 5CORA 1EWCA 2AUJD 4C1NI 4A3DB 5M9OA 1G291 1JWMD 3NE5B 5FO8B 4X3TA 3HOUB 3A55A 4CJ0B 3NWSA 1J8IA 1C48A 4DNRB 2SOBA 4L6TB 1SYBA 1A3UA 3LWUA 2E76C 1HQRD 1EZ8A 4G7HC 1WTXA 4XQNA 1PTOF 4RH6A 3LNNA 4RWSC 4BY1B 2F3WA 2K6AA 3SK8A 1AW7A 2JE6I 3NPPA 1HCZA 3PO2B 4Q0FA 1J9OA 1EY8A 2A74C 3DMUA 4AYBB 1B9MA 3S1QB 1Z6HA 1IHZA 4DU9A 3PV0A 1U4MA 1H9SA 2AQ1B 1VF7A 1RJTA 1PRTC 2EE1A 4A3BB 1Y69U 4F8MA 1BBXC 4IUUA 4L63B 1Y1VB 1M4VA 5CV8A 2ZT9C 3NUCA 1SSOA 1B44D 1JWSD 4ZYSA 4ILWA 4C3JB 1LT5D 1B53A 1QB5D 4ZKBB 3RZDB 1A2TA 3NK9A 3H91A 2EYPA 2H4OA 2EYLA 3I91A 4H7BA 1GXDC 4IN3A 1PFBA 5COYA 3MA2B 1S5ED 2IW3A 2WKCA 4X3UA 3FEWX 2G9DA 3NTKA 1DJRD 1G2SA 5BN3A 5I6YA 3NQTA 4PMCA 1UNSA 4A3IB 2HUGA 4KHVA 2K5WA 3EROA 1ET9A 3Q6SA 1CHPD 3GO5A 2YU9B 3GV6A 3C46A 1JQYD 4FF1A 3RUZA 3PUYA 3R8BA 3I4LA 1TQOA 4K14A 1XTCD 5HURA 4HSPA 3N6RA 1TY0A 4QCLA 3FRPB 4WORA 2WINB 5T1IA 5C3EB 1QE6A 1B2TA 5CV4A 3DEOA 3T16A 2DY7A 4XYQA 1LABA 4U673 2L4NA 1H9MA 4RHRA 3QB3A 1OXVA 3HZXA 2NVQB 3M85A 4LAAA 4RKLA 3A54A 3A56A 1AN8A 2D5DA 4IFDH 2H1EA 1FR3A 1LT4D 2JP1A 4BBSB 1CM9A 4HN7A 5ELEA 1MI2A 3E6ZX 3A8JE 3MAQA 3TP8A 2A68C 2M00A 1PMRA 2XIWA 1LT6D 1WTQA 3S1RB 2K01A 3HS0C 4CHTB 3NWTA 5E3FA 1QCBD 2HQEA 3C1FA 3N52A 1SE4A 5D65A 1E2WA 4HSVA 1EY7A 3SHLA 5M5YB 1TS2A 3GV3A 4JBWA 4PV1C 1L0YB 4MHEA 4NMZA 3K5MA 2AUKA 2B2TC 1STHA 3D6CA 4A3GB 4HCSA 4FYDA 4LMQD 5C4XB 4UAIA 3J81L 2K5QA 2X6LA 1E0BA 1EFID 3LX0A 2KEEA 1PFMA 4HR7B 4PQXA 4TSSA 3FDTA 3BDCA 3TN2A 3K58A 2E2IB 2EYMA 3RD4A 1UUPA 1KLUD 3J80L 3R2TA 2F0IA 3MTSA 2RSOA 4K8JA 1H9RA 3EJIA 5IT9E 2ICIA 1TT2A 1UAPA 3MC0B 1QWYA 4A3MB 1SYEA 2L1BA 3VR2A 4DAYA 3FPPA 3S2DB 4C3HG 1S5DD 4RAUC 5C6AA 5E4XA 2DY8A 1B50A 1IKMA 4FF3A 3SK5A 1JC7A 1F2LA 3BDLA 1STNA 3HOYB 1I4RA 2Z4HA 1F77A 1TWFB 2RSNA 5IODA 1LTBD 3J7AF 5DAUA 4HMIA 1PDQA 5C0XG 2WACA 3X3MA 3KBGA 5KNBA 3NTIA 1GHKA 4RCOA 1ZYRC 3KLSX 3NHHA 2F03A 1DCZA 1E2VA 3QJYA 3A8IE 3WDNA 3T56B 1V1OA 4OO1H 3BYTB 3HRZC 2J0TD 1QNUA 2WIIB 3J81E 4NP5A 4IUPA 1ESFA 1SE3A 2EJFC 5BN5A 4KKSA 2E2JB 1X32A 2EVBA 1IKLA 5FOBB 5NUCA 1EWHA 2JA8B 5DEHA 3KK7A 1KTKA 4IURA 1EQVA 1X3QA 3S17B 4ID6A 3D4RA 2OT2A 2EY6A 1EY9A 1TKWB 2NUCA 2NN6G 4QB4A 1CT1D 1LTID 5I2YA 5M5WB 1B9NA 3X3NA 3S1NB 4K5WA 2IJ0A 4RGTA 2XSCA 3M4OB 2F0KA 5I9OA 2F0MA 1AP0A 4QUFA 1V43A 2R7ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQM C;  3L7Z C;  5C0X H;  3T53 B;  1G29 1;  3IKJ A;  3NE5 B;  3W3A A;  1YNJ C;  4I7Z C;  5K36 G;  3OOC A;  4KMU C;  4H13 C;  2B8F A;  5C0X G;  1GUG A;  3MFY A;  4DNR B;  5KNB A;  1CTM A;  3QIA A;  3LWU A;  3SDZ A;  3M4Y A;  2E76 C;  1GHK A;  2JEA I;  1ZYR C;  2PNR C;  5A35 A;  3U9S A;  1ONL A;  3DXJ C;  3VR6 A;  2LMC B;  4KN7 C;  1FYC A;  1Z7T A;  2BA1 A;  2NN6 H;  2PCF B;  1E2W A;  4G7H C;  3PUY A;  3CRL C;  2K33 A;  3I4L A;  1Y8P B;  3T51 B;  3QG1 A;  1H9S B;  1ZKO A;  4L8J A;  1DCZ A;  1OXS C;  1Q1B A;  2A69 C;  3LNN A;  4JBW A;  4PV1 C;  3VR3 A;  1E2V A;  2A6E C;  2KCC A;  3QJY A;  3N6R A;  1GHJ A;  1H9J A;  1HTP A;  2JE6 I;  1SMY C;  1VF5 C;  4BA1 I;  1VCI A;  1HCZ A;  2AUK A;  2KA7 A;  3A8I E;  4KI0 A;  2AWO A;  2K32 A;  3SE0 A;  2A69 D;  5K36 H;  1DD2 A;  1IYV A;  1CI3 M;  3BDO A;  2BE5 D;  3WDN A;  2EJM A;  2D62 A;  5KND A;  1B9M A;  1Z6H A;  1VDZ A;  1TU2 B;  2DNE A;  4XTC S;  1GUN A;  1Q90 A;  3T56 B;  4OO1 H;  3ND8 A;  5BN4 A;  1Q12 A;  1E2Z A;  3IFT A;  3PV0 A;  3A7A B;  3GQB A;  1IYU A;  4KKU A;  4KN4 C;  1H9S A;  2V4D A;  3I72 A;  4HR7 B;  4OO1 G;  2PPB C;  3VR5 A;  1LAC A;  2D2C C;  3I73 A;  1VF7 A;  1LAB A;  1QJO A;  1T5E A;  3MXU A;  4TKO B;  1YNN C;  3RLF A;  1Y8N B;  2YYZ A;  1O78 A;  2EJG C;  1Y69 U;  2EJF C;  2K7V A;  1OXX K;  5BN5 A;  4G7O C;  4KKS A;  2A68 D;  2EVB A;  4GZY C;  2JEB I;  2BE5 C;  4OGQ C;  1Y8O B;  1EWH A;  2EDG A;  3A7L A;  1Q1E A;  3KLR A;  1IW7 C;  2O5J C;  1H9M A;  2F1M A;  2L5T A;  3BG3 A;  3P20 A;  1K8O A;  3A8K E;  1OXV A;  2R6G A;  5JEA H;  2NN6 I;  4IQZ A;  2B8G A;  1H9R A;  3TZU A;  3D4R A;  3CRK C;  2QF7 A;  1H9K A;  3VA7 A;  5JEA G;  3M85 A;  2ZT9 C;  4DK0 A;  2A6E D;  1TKW B;  2NN6 G;  3VR4 A;  4LK1 C;  2BDO A;  4LJZ C;  3OW7 A;  3VR2 A;  1O7L A;  4KKT A;  3FPP A;  4IFD G;  1BDO A;  1K8M A;  1GUS A;  3HGB A;  3OPO A;  1B9N A;  2D5D A;  1I6V C;  1DXM A;  2BA0 A;  2E75 C;  5KNC A;  4IFD H;  4H0L C;  1FR3 A;  3M7N A;  4XIG S;  1OXT A;  2JXM B;  3AB9 A;  3ND9 A;  3PUX A;  4JK1 C;  4DNT B;  3EQL C;  3PUV A;  4RCN A;  4DK1 A;  1OXU A;  2DN8 A;  3GD7 A;  2CW0 C;  2Q8I B;  4TQU S;  2IT1 A;  1A6X A;  1HPC A;  4G7Z C;  4BA2 I;  2DNC A;  3A8J E;  4KHZ A;  1IW7 D;  2A6H C;  1GUT A;  1V8Q A;  5BN3 A;  2A68 C;  1CFM A;  1GJX A;  3PUZ A;  1V43 A;  4H44 C;  1PMR A;  3H94 A;  2E74 C;  1GUO A;  3FMC A;  3PUW A;  2AUJ D;  2O5I C;  2A6H D;  3D31 A; 
#chains in the Genus database with same CATH topology
 3IKJ A;  2K05 A;  5GAH C;  2CH4 A;  2YTY A;  2E8G A;  5IIF A;  2VL6 A;  2YU9 H;  1BCP B;  5IT9 c;  1QNK A;  4A3F G;  5I6W A;  2A73 B;  4B3S L;  3AEV A;  4JI6 L;  5GAD C;  2CWP A;  4K8I A;  3H0G G;  3H15 A;  4K0K Q;  2AKW B;  4IUN A;  2MNA A;  2FFK B;  5JPN C;  2DJF C;  5ISR A;  1PZI D;  3TSS A;  5LL6 S;  2RVL A;  1STY A;  1DYQ A;  3BDO A;  2BE5 D;  4BBS G;  1YHB A;  1N8R C;  3O13 A;  1SNO A;  4JBM A;  4O1N A;  3RMH A;  2N3S A;  1A8V A;  1IZ6 A;  1NUC A;  1Q3L A;  4EQN A;  1LT3 D;  4GLA C;  2K7V A;  2QDB A;  2A68 D;  2F0O A;  2QKI C;  1EY0 A;  1BUV T;  4KJO A;  4MNO A;  4HJA A;  1R9T B;  5IGG A;  2JA5 H;  3PO3 B;  3GTQ H;  4A93 H;  2K5V A;  3W1G A;  2N88 A;  3HKZ E;  2KHJ A;  2R93 G;  3K0X A;  4HIM A;  1TWH H;  3S15 B;  5IP9 G;  2NWG A;  3VR4 A;  4LJZ C;  2F0D A;  4DR3 L;  1SE8 A;  1SNC A;  2ES2 A;  1HFN A;  1STG A;  4LWC A;  2D0O A;  4FO2 A;  4A3F H;  2HQL A;  2VW9 A;  4XIG S;  3AB9 A;  2Y0S B;  3KBX A;  1X54 A;  2L55 A;  2NVT B;  4JI1 Q;  1AZQ A;  1AE2 A;  1SAP A;  1EU4 A;  5JAV A;  1I4G A;  2XTI A;  4IUV A;  3VA5 A;  3FKI B;  4KHZ A;  2Z8L A;  1D8L A;  4GNX B;  2F4V L;  3S2H B;  2EIF A;  4ULL A;  5C4Z A;  5J3B A;  3L7Z C;  1FVI A;  1G91 A;  1I94 Q;  4A3E G;  3TS0 A;  1RHP A;  2D9U A;  2XWJ B;  2NYZ D;  1JMC A;  1M90 C;  4NW2 A;  4C1N K;  2NTS A;  4WRD A;  3OTO Q;  3BS1 A;  4DR3 Q;  5IP7 H;  1TWG B;  1DOL A;  1SMY D;  4XQQ A;  4IPC A;  3HOV B;  2CCZ A;  2B29 A;  3QG1 A;  3NBH B;  1ZKO A;  4EVO A;  2HDL A;  4EX5 A;  2K75 A;  2A6E C;  1EY5 A;  1QUQ B;  2ZXP A;  1KL9 A;  4XXE A;  1G6Z A;  1SMY C;  1O7Z A;  3MXG A;  1I4Q A;  4K2K A;  4YIJ A;  1L0W A;  5K36 H;  1XJV A;  2L11 A;  3JAM E;  1CI3 M;  1IYV A;  3V2T A;  1K83 B;  2DNE A;  1QVG A;  1I4X A;  4NPS A;  4A3K H;  5IT9 L;  4NXN Q;  1XMQ Q;  1K0S A;  5M3F H;  1F9R A;  4TKO B;  4KTA A;  5CV9 A;  2LFN A;  2OXP A;  1OXX K;  1P8L A;  3IL8 A;  3HOY G;  2I5M X;  5C44 H;  1BOS A;  5KGU A;  3A7L A;  1Q1E A;  3GTL B;  5CGK A;  5K5P A;  2C35 B;  3EBE A;  1LUZ A;  3D3R A;  1W6K A;  2IWH A;  1W3S A;  5KIX A;  1C4Q A;  3CRK C;  2QF7 A;  2R3Z A;  4UP9 A;  4DF7 A;  1IBK L;  1N34 Q;  2VUM G;  3HOV G;  3VYS A;  4DAP A;  3KLW A;  3ERQ A;  4PZ8 A;  1VQK A;  5BR8 L;  2NTT A;  4LUV A;  3RZO B;  3KDF B;  3Q22 A;  4J6H A;  1HZC A;  4LF8 Q;  2F52 A;  2ATW A;  4HIO A;  3MEH A;  1I6V C;  2F0T A;  1T5X D;  2BA0 A;  2F0H A;  5KNC A;  1NJI C;  1VQ9 A;  1SJH D;  4IFD I;  4RCN A;  2UUC Q;  1QUQ A;  4DUY L;  2RHS B;  1F2Y A;  1NY4 A;  4ME3 A;  3QR8 A;  3K57 A;  4AIM A;  3U9O A;  3M3Y B;  5FKA C;  2TMP A;  1VQF A;  5C0X J;  2IX3 A;  1HTL D;  3GTJ H;  1Y1V H;  1EEF D;  2UUC L;  4CJ1 B;  1VQG A;  2UXD Q;  3BVG A;  1XX8 A;  1KDA A;  3L9A X;  4H13 C;  2B8F A;  3MFY A;  2A1A A;  5FLM G;  1RTO A;  4JI0 Q;  5ELF A;  2CH4 W;  3R3O A;  3UDG A;  3CCV A;  3NQI A;  1SYG A;  2OWO A;  4LF8 L;  1TS5 A;  1Z7T A;  3G6J B;  3FHW A;  4YCU A;  4N8X 1;  1BF4 A;  1QG7 A;  3JC6 6;  4POG A;  1LM0 A;  2B2W A;  4RFB A;  3F1Z A;  1HTP A;  1D5X C;  5IE8 A;  3HOZ B;  2SNM A;  1PYS B;  4B9X A;  1ML0 D;  3S1Q H;  2I5L X;  4GN3 B;  2JA5 G;  2VUM H;  4HJ7 A;  1Q90 A;  3E0E A;  4MIU A;  3Q24 A;  1U9R A;  1VQ6 A;  4DV3 Q;  2R93 H;  4RGO S;  1A2U A;  1Y1W B;  1EQQ A;  1GUW A;  3KUP A;  2NVX H;  3I4O A;  2EZV A;  1LAC A;  1HXY D;  2Q8R E;  4RGN A;  4DR2 L;  2K5D A;  4V19 0;  1YZ6 A;  2SDF A;  1I3Q H;  1EFW A;  1VQJ A;  4DV1 Q;  3KLR A;  1EOV A;  1FGU A;  1MBY A;  1II3 A;  1YNX A;  4C3I B;  3KLS A;  4IJL A;  4S3S A;  3J7Y W;  2UXC Q;  2R6G A;  4XT1 B;  5JEA H;  3TP7 A;  4QGU A;  3H6M A;  1B3A A;  3EVQ A;  1PA6 A;  2LXJ A;  1JJ2 A;  3PF4 A;  3I2Z A;  1PTO C;  5C4H A;  5J39 A;  1PRT F;  4LNQ A;  3F2U A;  4LK1 C;  4KKT A;  4NXM Q;  2GA4 B;  2FIN B;  2F0S A;  3AU7 A;  2O4X A;  1YBY A;  5FLM H;  4KD3 A;  5EPL A;  3M7N A;  1U5K A;  2B3G A;  1B4O A;  4BY7 B;  5IYD H;  4FXD A;  4RHS A;  3G6E A;  2IX0 A;  5IP7 G;  4XQJ A;  5EKI A;  3M9B A;  5IGF A;  3GTO H;  5CV7 A;  1F9Q A;  3K0Y A;  5G3L D;  3KYH C;  2IHE A;  2R7Z H;  3GTM B;  4DV2 Q;  1CSP A;  4KY5 A;  1SLJ A;  1YNJ C;  3F2C A;  1TWA H;  2ZM6 Q;  5K36 G;  3W1B A;  3A0J A;  3SXH A;  2RDF A;  3I8Z A;  1I6H B;  2PW7 A;  1Z9F A;  3CAM A;  2WAQ B;  1EY6 A;  2JEA I;  1DM0 B;  2UUA L;  4EQP A;  3VR6 A;  1CUK A;  1KLG D;  2ZXR A;  4DUZ Q;  1LTG D;  4KY7 A;  1PH9 A;  5EBD A;  4DR7 L;  1Q1B A;  2ZM6 L;  1L1O C;  3NSW A;  2AMC B;  2I5H A;  2G9H D;  5TSS A;  1VQI A;  3STB D;  1N32 Q;  3I3C A;  3GTP B;  5J1Z A;  1TU2 B;  3ND8 A;  2Q2T A;  1RKN A;  4C3J G;  1M1K C;  1A15 A;  2BDN A;  5EJW A;  4L5R C;  3GQB A;  3TP5 A;  1HA5 A;  1HJP A;  3OWE B;  4PNY A;  1VQ5 A;  3DWP A;  4LUZ A;  1WD1 A;  1NR2 A;  1ZXT A;  1C9O A;  1CA5 A;  2JEB I;  1D5Z C;  1NTG A;  1U4R A;  1SBB B;  4H02 A;  5D3D A;  3HP3 A;  2B2U C;  4OEM B;  3CQZ H;  4IJH A;  2I0Q A;  2EOT A;  5LMN Q;  1E1T A;  3K81 C;  1VQB A;  2K50 A;  4QY7 A;  1VQ8 A;  1NR4 A;  2A6E D;  1TS4 A;  2QEX A;  2FMM A;  2QCP X;  4DXG A;  5M5X B;  1VQ7 A;  4IUQ A;  1NMG A;  1UEB A;  1BDO A;  3LGJ A;  2RDG A;  3QO2 A;  3D8G A;  4OX9 L;  3M7G A;  4V0B A;  3M4P A;  1F2Z A;  2JXM B;  4IPG A;  2QW7 A;  4CGY B;  3JAM c;  2CFM A;  4J8Q A;  4DR2 Q;  4DA2 A;  5C3W A;  4FXG C;  5ELC A;  3GTK B;  2CW0 C;  2KOL A;  4BBR G;  2OQK A;  4ZK9 B;  2UXB Q;  4X3K A;  2DGY A;  2JQO A;  1BCP D;  5EKL A;  1ILP A;  3P7J A;  4JI8 Q;  3TDQ A;  1V8Q A;  3T13 A;  4DPG A;  1SE2 A;  4H44 C;  2EXZ A;  1XWE A;  2CQO A;  4M8A A;  4I65 A;  3PO2 G;  3GTG B;  2JA6 G;  4YCV A;  1GUG A;  1YNN D;  4DV4 L;  4UHV A;  2HT1 A;  1A62 A;  2IHF A;  3ITP A;  2EPB A;  5EGT A;  2Q2U A;  2VB3 X;  2F4I A;  3SDZ A;  3S9W A;  4NKL A;  3S2D H;  4IPD A;  1PH3 A;  4KN7 C;  3CRL C;  4ZKC B;  1TWC B;  1Y8P B;  3T51 B;  1CKO A;  4DGZ A;  1STB A;  4GS3 A;  5GAG C;  3J7A 5;  3S14 H;  3TEH B;  3STB C;  3DWA A;  3WOF A;  1C7Y A;  2IY5 B;  2IPK D;  1GHJ A;  1VMP A;  2MGS A;  4BA1 I;  1XNR Q;  1VCI A;  4DR6 Q;  4M1U B;  2HIX A;  2Z0S A;  1PVO A;  4A3K B;  4DAV A;  2F3V A;  2EJM A;  1VQM A;  4JI7 L;  2MO1 A;  1EYG A;  2UUB L;  2AQ3 B;  4FF4 A;  1G2T A;  3RZD H;  2BCO A;  3E9H A;  1XMQ L;  4R8N A;  3A7A B;  3C3L A;  4KKU A;  1IYU A;  3EIV A;  5IYB G;  1L1O B;  2JYO A;  3RLN A;  3MXU A;  2PO4 A;  5I9P A;  1I5F A;  3RLF A;  5J22 A;  3MEF A;  1BXT A;  2EY2 A;  3CP0 A;  4GKJ L;  2L9H A;  4CDD C;  1C0A A;  2UXC L;  3L0O A;  4G4K A;  1VQ4 A;  1JJG A;  4WJW A;  1CQF A;  1V1P A;  2PMZ B;  1VS0 A;  2F0P A;  4A3M H;  3CD6 A;  4X3S A;  4X6A H;  1CZW A;  1SNM A;  3L2P A;  1AEX A;  2BDO A;  1NAP A;  1Z47 A;  5EPJ A;  1D1K A;  5EKK A;  3PO2 H;  4QIW B;  4AQY Q;  3I4N B;  4QF4 A;  2L12 A;  1WTV A;  1MSH A;  1TY2 A;  1YHA A;  1AE3 A;  1EYA A;  3PUX A;  1W6J A;  3BVM A;  2F0Q A;  3I90 A;  5JVG 3;  4KHP L;  4LFB Q;  3I70 A;  4A3B H;  4TQU S;  5KRU A;  4F7X A;  2MHV A;  1HPC A;  2F3I A;  1CK1 A;  5I2X A;  1MGS A;  2PI2 A;  4F87 A;  3CCS A;  2E2J H;  4JI6 Q;  5IWA L;  1KC8 C;  3EA6 A;  2VY3 A;  1KHI A;  2OTL A;  3PUW A;  1XNQ Q;  2LS0 1;  4KD4 A;  3MHB A;  4DUY Q;  3D4W A;  2VQF Q;  1UE5 A;  4C3I G;  3TS2 A;  4JPB W;  5FO7 B;  1CTM A;  3DLL A;  3NEL A;  3G71 A;  4CJ2 C;  4C3J H;  3E0J A;  1HUN A;  1QIL A;  5A35 A;  2N78 A;  2NN6 H;  3P1H A;  1TVX A;  2K33 A;  5IGE A;  3I4M B;  4KY6 A;  3TRZ A;  1H9S B;  2B2Y C;  4X64 Q;  3MVV A;  1PTO B;  4KV6 A;  5I4D A;  3PMF A;  2C5C A;  1PFN A;  3OIP A;  4XYO A;  3F2B A;  3E5S A;  1K3R A;  1X3F A;  2E2H H;  1DD2 A;  1LTA D;  5A2Q L;  3TQY A;  5KND A;  3OMG A;  4DK6 C;  1Y1W H;  5CBA E;  4YWL A;  2Z1C A;  2MFI A;  1B3Q A;  4KN4 C;  3I72 A;  2SEB D;  1UEA B;  3DEP A;  4WJ3 M;  2JA9 A;  5M3M B;  1FJG L;  4P2C B;  2VQF L;  1UE1 A;  2KCT A;  1MJE A;  2B2U A;  1JR0 D;  3KF8 A;  2F0W A;  5KEE A;  3DM1 A;  4O2D A;  5IGC A;  2L5T A;  3H3V I;  3A8K E;  3S17 H;  1TR5 A;  3CMA A;  2IX1 A;  2SNS A;  2NN6 I;  1ROD A;  1WTW A;  2B8G A;  2NVY B;  1PH4 A;  1EU3 A;  1SND A;  4GLV B;  1H9K A;  4A76 A;  3IAY A;  2EY1 A;  4EGV A;  3J81 i;  1EIG A;  3PIO A;  4ZRZ A;  4DR6 L;  4LFC Q;  4MN3 A;  1X65 A;  4IFD G;  1AZP A;  1FNW A;  3MWY W;  3OMC A;  4R4I A;  1EOT A;  1GUS A;  2PZT A;  4FP5 D;  4B3M L;  1JOR A;  2PYK A;  4OIK A;  1SYC A;  1JE4 A;  4BY7 H;  2FJ2 A;  4DNT B;  1I94 L;  2JA6 H;  2UXD L;  2F0J A;  4DK1 A;  3G7L A;  1YHQ A;  1EQR A;  3TP6 A;  4JG2 A;  2E5L Q;  4JI1 L;  1KRS A;  4DAY B;  1LTR D;  3CCQ A;  1HUM A;  5C4X H;  4A3J B;  2HHH Q;  1BQQ T;  5CMD A;  1GUT A;  3IFD A;  5M3M G;  1CFM A;  5CV5 A;  1GJX A;  3H94 A;  3VYT A;  3T1H L;  1MD2 D;  2HDM A;  1G51 A;  4FVM A;  5CV6 A;  1I4P A;  1D1I A;  4A3G G;  2WAQ E;  2OEO A;  5AFW A;  1UE7 A;  2NVQ H;  2XNA C;  3S16 H;  4JI3 L;  5F2D A;  3OOC A;  2A19 A;  1I50 B;  2KQ3 A;  5JPM C;  5ELO A;  2MO0 A;  1IL8 A;  4FXK C;  5IOC A;  1D6E C;  3NXW A;  3L3O C;  2PNR C;  3T4A C;  1Q7Y C;  3DXJ C;  4JI2 L;  3MFG A;  2WKD A;  1BVS A;  5IGD A;  3PIO 3;  2A69 C;  4GKK L;  1ENF A;  4KHP Q;  4LFB L;  3SVM A;  1XMO L;  4DFA A;  2IL8 A;  1N32 L;  2AWO A;  2B2Y A;  3K7A H;  4O42 A;  2PMZ E;  3KF8 B;  1EYD A;  2I07 B;  1I4H A;  1LO5 D;  1VDZ A;  3H3V H;  3H3V C;  5JEA J;  2R92 B;  3S2H H;  1K28 A;  3TZD A;  4GLX A;  2D2C C;  2LKV A;  2Q8T A;  2FHT A;  1BNZ A;  1JCK B;  4A3L H;  2B39 A;  1PZK D;  3HOX G;  4JVZ A;  2XVS A;  3TBI B;  2OF1 A;  3A74 A;  2MJ8 A;  5JJZ A;  4P75 A;  1RDP D;  4K0K L;  1S5F D;  1KXL A;  3P20 A;  5ELD A;  3J80 c;  4AH6 A;  4I7A A;  4JI2 Q;  4A3D H;  2FMC A;  1L1O A;  4IQZ A;  1PYW D;  4XDX A;  2B2V C;  2KHI A;  4DV6 L;  3WOE A;  2ENB A;  1Q81 C;  2MUY A;  4ALP A;  1SMX A;  1SYD A;  1VQD A;  1O7L A;  4A3G H;  1AFP A;  3HGB A;  1K83 H;  3OPO A;  4TRD A;  2PI2 E;  4A3F B;  1SN8 A;  5D3I B;  1CKN A;  3VYU A;  4H0L C;  1FGB D;  3UI2 A;  4FF2 A;  4CKE A;  4JK1 C;  4ABN A;  1IBL L;  1HA6 A;  4BXX H;  2R61 A;  2VZA A;  3OIQ A;  1BCP F;  4X64 L;  3HOW G;  2ZJP A;  4R9W A;  2ALY B;  4APV A;  2XRQ D;  1DOK A;  3DWQ A;  2NB0 A;  5E4W C;  1F9S A;  1FNU A;  2MP1 A;  5FLX L;  5C44 G;  2F0L A;  1IBL Q;  1NSN S;  1KIX A;  2BOS A;  5C0X H;  1E3P A;  2RCF A;  4K5X A;  1TS3 A;  1O80 A;  3R93 A;  4KMU C;  3CW2 C;  5DM6 3;  3AFQ A;  2WV6 D;  3CCU A;  1X56 A;  1FJG Q;  4JOI A;  2JA8 H;  2RDH A;  3M4Y A;  1F9P A;  2JSO A;  4JI4 L;  4BY1 G;  3SEB A;  1FYC A;  1U4L A;  4BS9 A;  2KCN A;  4L8J A;  2JA7 G;  1VMC A;  3VR3 A;  4LF5 L;  3SK6 A;  1TII D;  2VQE Q;  1BR9 A;  3ONA B;  5IYC H;  4LF6 Q;  1HNW L;  2E2D C;  1VF5 C;  2J4X A;  2A69 D;  1FD7 D;  2MQH A;  2HHH L;  2EQS A;  1JIC A;  1S4Z A;  2K04 A;  2K14 A;  1S5B D;  1WCM G;  1Q12 A;  5C4J B;  4KK7 A;  5HY6 A;  2K28 A;  1LLR D;  1G6P A;  4OO1 G;  2KUM A;  2CQA A;  1PRT B;  1S72 A;  1WTO A;  5EQ0 A;  5HGT A;  1B7Y B;  1Y8N B;  2RBM A;  5C44 B;  3VYR A;  3CCM A;  1Y1V G;  4DR4 Q;  1JOO A;  4PMB A;  4OGQ C;  3D6W A;  4HID A;  2CVR A;  2HIV A;  3FKI G;  3K5O A;  4BY7 G;  3J80 E;  5LMU Q;  4QUC A;  4N8F A;  4WFN 3;  2NZ1 D;  3J81 c;  4ZUI A;  1E7Z A;  4DR5 L;  2KED A;  5C4X G;  1HZ9 A;  1ESR A;  1ET6 A;  1STE A;  4OHJ A;  1HFG A;  3G4S A;  1ZYR D;  1PTO D;  2X6G A;  1B1Z A;  2V1C C;  3I56 A;  5G3L F;  2AQ2 B;  2ICE C;  3ZYY X;  4JI5 L;  2HCC A;  1ICW A;  2CHB D;  4CBV A;  5DM7 3;  3PQI A;  1NMF A;  3GD7 A;  1JOK A;  1ICF B;  4GOP C;  3UE1 A;  4DR4 L;  2DNC A;  5KYL A;  1IW7 D;  1KNE A;  2PQE A;  2RCN A;  3HKZ G;  1X3G A;  1CZG A;  4DN4 M;  3J7A V;  3SR1 A;  1LTT D;  2F0F A;  4WJ4 A;  4ZLT F;  4JBK A;  3CHB D;  4ZUJ A;  3S1R H;  4I7Z C;  4DR5 Q;  1RD9 D;  3H0G H;  1EUJ A;  4J1M A;  4JI8 L;  3T1Y Q;  3PO3 H;  1TXY A;  5GAE C;  1ONL A;  4A93 B;  3NEM A;  1V9P A;  4FNF A;  4ZAI A;  2ASB A;  4QJF A;  1K3B C;  4HJ8 A;  3HOX H;  1A3T A;  2KCC A;  2E2H B;  1HNX Q;  5ELN A;  2J7Z A;  3K59 A;  4HTH A;  2VUM B;  1PH2 A;  5CBE E;  4A3I G;  1HR0 Q;  3GP7 A;  2R93 B;  5BN4 A;  2NVX B;  4IOC A;  4BBS H;  2PZU A;  5IGB A;  3HOU G;  2ZXO A;  3HKZ B;  3NTH A;  3TME A;  2PPB C;  3CC7 A;  1WTP A;  3IRB A;  4Z9C B;  1SYF A;  4JYA Q;  5C5L A;  2RKS A;  1O78 A;  2EJG C;  3MZ5 A;  4YWM A;  4G7O C;  2E2I H;  1HNZ L;  4EQO A;  3A5U A;  4K6D A;  2RQX A;  3ULJ A;  3R2I A;  1IW7 C;  4IPH A;  3K7U C;  3V05 A;  2UUB Q;  1XTD A;  1MSG A;  2F1M A;  3BG3 A;  3K6O A;  4A4I A;  2CW0 D;  1EL0 A;  4RA8 A;  4O0A A;  2CWA A;  5JOB A;  1N33 Q;  4Q5V A;  1D2B A;  1LTS D;  2N55 A;  1R4P B;  1A63 A;  3W5O A;  2C9O A;  4DK0 A;  4HIK A;  1VQL A;  3DUZ A;  1QVC A;  1E22 A;  2K03 A;  1S5C D;  4GKJ Q;  4JOI C;  4B3M Q;  4DV5 L;  3GTP H;  1ILQ A;  2JA6 B;  1YNJ D;  5M5Y H;  4K5V A;  3PSI A;  4N9P A;  3OSO A;  1YI2 A;  2ZTD A;  1AH9 A;  3PO3 G;  3CPF A;  4U68 A;  3I4M G;  3BZK A;  2JK8 A;  2JA8 G;  1PH7 A;  1A6X A;  1MIU A;  3K5L A;  2A8V A;  1JWU D;  3I7F A;  4R8I A;  1YJN A;  1M8A A;  2EYH A;  3HOW B;  4BBR B;  3K5N A;  1HRJ A;  3PUZ A;  4A3E H;  2KVM A;  1GUO A;  4E6I A;  3NEN A;  2JA5 B;  4Y7N H;  1TWF H;  1BO0 A;  2N8N A;  3S24 A;  1I50 H;  3HG9 A;  3W3A A;  3ULP A;  4LF7 L;  1N9W A;  1VQE A;  4DR1 Q;  5LHY 1;  3HOU H;  4X65 L;  2QIL A;  4B9W A;  4OXP A;  2KHS A;  5AJ3 L;  3QIA A;  4GNX C;  1ENA A;  2KJX A;  5IWA Q;  2VNU D;  1HHV A;  2B2V A;  5LL6 X;  4BWG B;  1OXS C;  1L0X B;  1S3O A;  4YCW A;  4DR1 L;  1H9J A;  2F0N A;  3RZO H;  3GTK H;  3UDF A;  3QOL A;  3ER0 A;  4KI0 A;  1JB3 A;  5E7N A;  3SE0 A;  1DON A;  1O7Y A;  2GN5 A;  3FKI H;  4OIJ A;  3CME A;  2RF4 A;  4P73 A;  3AMU A;  2HD3 A;  3A5Z B;  3NP8 A;  5DNF A;  4A3K G;  4G57 A;  5C5M A;  2NBF A;  2ZJR A;  2F0V A;  5CC4 A;  2F0E A;  3JAM i;  1N34 L;  3H09 A;  3HFZ B;  3S1M B;  3D4D A;  4GZY C;  1Y8O B;  5AJ3 Q;  1PV4 A;  1CHQ D;  1SNP A;  1EWI A;  3GTJ B;  3QWN A;  4PMW A;  1K8O A;  4K2L A;  2F0G A;  4DV2 L;  2G5D A;  3HOV H;  4IAL A;  1EZ6 A;  1QOH A;  2EXD A;  3BZD B;  1PHJ A;  1EIH A;  3VA7 A;  1BCP C;  5FJ8 H;  2Q2I A;  4L5T A;  3UDX A;  2K52 A;  1PZJ D;  3OW7 A;  1LV9 A;  2N49 A;  3P75 A;  2JA7 B;  1WOC A;  1K8M A;  4CKC A;  1SFO B;  4DV0 L;  1SEB D;  2P5Z X;  1MJC A;  5EPK A;  4DR7 Q;  3QOJ A;  4OWW B;  3EQL C;  3KFU A;  2DN8 A;  1PXU A;  3EFX D;  3FPU B;  3MXN B;  1WCM B;  2RA4 A;  3MXN A;  4ODG A;  4G7Z C;  5E1F A;  2Z9H A;  3FP9 A;  4IUT A;  2XGT A;  5T1G A;  1FNV A;  2UU9 L;  4DV3 L;  1U4P A;  1XXG A;  1XYI A;  1YIJ A;  2O5I C;  2AHO B;  2A6H D;  2CKZ B;  3GTG H;  1HQM C;  4GN4 B;  4YHH L;  3T53 B;  4C3H B;  4B08 A;  3CCL A;  2B2W C;  2XWB B;  1KAB A;  4A3I H;  5EBC A;  4B3R L;  1GM5 A;  4KLK A;  1WVL A;  2TSS A;  2ZJQ A;  1E24 A;  2A5H A;  1VQO A;  3BJU A;  2QA4 A;  1KDB A;  1JOQ A;  3U58 A;  4LFA L;  3FVQ A;  2BH8 A;  2R7F A;  2VQE L;  2WFW A;  4AYB G;  3RR5 A;  1JJC B;  1R4Q B;  4UDU C;  2K32 A;  2WP8 J;  5M5W H;  2PW5 A;  2D62 A;  5D14 A;  5FJ8 G;  1SNQ A;  1A0I A;  1GUN A;  4LFA Q;  2L0C A;  1IL2 A;  3U4Z A;  2EYF A;  4A3B G;  1E2Z A;  3IFT A;  4XT3 B;  5C3E H;  3CPW A;  1U0L A;  1ASY A;  2D0P A;  2V4D A;  1SRO A;  4HCE A;  3VR5 A;  3I73 A;  3PIP 3;  4JYA L;  4DV6 Q;  1T5E A;  1UE6 A;  4ZQ3 A;  3M4Q A;  4F88 A;  2YYZ A;  1X3P A;  1NBW A;  2KEC A;  1NE3 A;  1CA6 A;  2WB1 B;  4OL7 A;  5JJI A;  3OW2 A;  1A3V A;  3Q23 A;  3GTM H;  3JAM L;  4RKB A;  1KDC A;  1R9T H;  1BBU A;  1SRU A;  3TZU A;  5CR3 A;  1X3E A;  1RTN A;  3I4M H;  2YTX A;  5GQO A;  1IXR A;  1TWA B;  5JEA G;  1EIY B;  5ELB A;  1PTO H;  2M9V A;  3NBH A;  1V1P B;  3BYY B;  4N9T A;  5KYI A;  1SDF A;  3KF6 B;  4DV4 Q;  3I4N H;  2XN9 C;  1CKM A;  4X65 Q;  3CKI B;  4AQY L;  2F0U A;  3OHX C;  4P71 A;  2B2T A;  2E75 C;  1HZA A;  2Q2H A;  2K1B A;  4HJ9 A;  5A2Q E;  3PUV A;  5JVH 3;  4K6L A;  2B63 B;  1OXU A;  1DZ1 A;  4RGM A;  1DOM A;  1GOZ A;  1WTH A;  1EY4 A;  2I46 A;  2LY7 A;  2IT1 A;  1I3Q B;  5IYD G;  4BA2 I;  2R7Z G;  1F2M A;  1RF2 D;  3UE0 A;  1W2B A;  2A6H C;  5C3X A;  3BVZ A;  2M2L A;  1OO9 B;  4JI4 Q;  4UPA A;  3EN2 A;  4CKB A;  4OON A;  1CQV A;  1EIF A;  3W2D A;  4DAM A;  2UUA Q;  2E74 C;  3FMC A;  1Q86 C;  3D31 A;  5JJL A;  1Q46 A;  5FK9 C;  2EYO A;  1ENC A;  3AFP A;  1ZEQ X;  4IO9 A;  4LF6 L;  1HNW Q;  3H0G B;  2Z6B A;  1PRT D;  4DXF A;  4QMG A;  1WD0 A;  4HAE A;  3Q8D A;  4IZ8 A;  1KD1 C;  2OQ0 A;  3CQZ B;  2ID0 A;  3U9S A;  3GTQ B;  2LMC B;  2BA1 A;  2PCF B;  1GKH A;  3AQQ A;  2X69 A;  4HED A;  3C1E A;  4X66 Q;  3HOX B;  1TWH B;  2PQA A;  1Y14 B;  3I55 A;  2ZTC A;  3URY A;  4GKK Q;  5CYU A;  2PQA B;  1Q8I A;  2VB2 X;  2KA7 A;  3OWF A;  5FLX E;  4C2M B;  1BBW A;  1G8Z D;  1GVP A;  1O7I A;  4OO1 I;  2HCI A;  3GTO B;  1IYJ B;  3J80 i;  4XTC S;  5C0X I;  1NCV A;  4JV5 Q;  4X66 L;  2Z4I A;  3V96 A;  1MHW C;  3I4N G;  3DHQ A;  1PLF A;  2WAQ G;  4ME5 A;  4KJN A;  2MPM A;  2NVT H;  5M3M H;  5EAY A;  1QJO A;  3ICE A;  1YNN C;  3RN5 A;  1WTR A;  2KBN A;  5M3F B;  3S16 B;  4B3T Q;  4IFD J;  1K8G A;  2WB1 E;  2BE5 C;  1EEI D;  1EYC A;  2EDG A;  2O5J C;  3LWE A;  1KNA A;  1PFS A;  2PZW A;  3MXP A;  1KAW A;  3PGZ A;  4L5Q A;  3D0F A;  1QVF A;  2XRS D;  2R7D A;  1IBK Q;  1J5E L;  3CC2 A;  1YEZ A;  4C56 C;  1SXT A;  4B3T L;  1PH8 A;  1SR3 A;  4HMJ A;  3SK4 A;  1C8C A;  2OCE A;  1IBM Q;  1EQT A;  3KOJ A;  1KAA A;  2EYJ A;  4GN5 A;  2O2L D;  3CU7 A;  1H95 A;  1TWG H;  2VXW A;  3K7A B;  4JBJ A;  2RHQ B;  1WI5 A;  1RCV D;  3HEJ A;  1DXM A;  1SJE D;  2EY5 A;  1STA A;  5LMN L;  1K8A C;  3KJP A;  3S14 B;  1OXT A;  3ND9 A;  1D5M C;  5FO9 B;  3C2P A;  2GVA A;  3Q0A A;  1UWV A;  2Q8I B;  3NBI A;  2QEJ C;  2AWN A;  4NDX A;  4R4T A;  3CCE A;  1X6O A;  4A3E B;  5M3F G;  3M3Y H;  2YV5 A;  4Y7N B;  1PH1 A;  5COR A;  1KQS A;  1EWC A;  4JW0 A;  2AUJ D;  2JJQ A;  5IY0 A;  3HOY H;  4C1N I;  4A3D B;  3UDI A;  1GO3 E;  4JI5 Q;  5M9O A;  1G29 1;  1JWM D;  3NE5 B;  5FO8 B;  4X3T A;  3HOU B;  3U4V A;  3A55 A;  1X55 A;  2Z6K A;  4CJ0 B;  3NWS A;  1RL2 A;  3OYY A;  1J8I A;  1C48 A;  4DNR B;  2SOB A;  3GTL H;  4L6T B;  1SYB A;  1A3U A;  3LWU A;  2E76 C;  1HQR D;  1EZ8 A;  4X62 L;  4G7H C;  1WTX A;  4P74 A;  1WFQ A;  4XQN A;  1PTO F;  4RH6 A;  4J15 A;  3LNN A;  4RWS C;  4BY1 B;  2F3W A;  2K6A A;  3SK8 A;  1AW7 A;  5GRO A;  2JE6 I;  3G48 A;  4DK3 C;  3NPP A;  4MZ9 A;  1HNZ Q;  1HCZ A;  3PO2 B;  4Q0F A;  1J9O A;  1EY8 A;  3BZC A;  1P16 A;  2A74 C;  3DMU A;  4AYB B;  1B9M A;  3S1Q B;  1Z6H A;  3T1Y L;  1IHZ A;  4DU9 A;  5IYB H;  2R92 H;  3T1H Q;  1T9H A;  3PV0 A;  1JB7 A;  1U4M A;  4GNX A;  1H9S A;  2AQ1 B;  1VF7 A;  1RJT A;  1PRT C;  2EE1 A;  4A3B B;  1LYL A;  4LF9 L;  1Y69 U;  4F8M A;  4JI7 Q;  1BBX C;  1HR0 L;  5L37 A;  4QIW E;  4IUU A;  4L63 B;  5JJK A;  1Y1V B;  4X62 Q;  4UP7 A;  1M4V A;  3TRE A;  5CV8 A;  1TWC H;  1PH5 A;  1FL0 A;  1XPR A;  2K4K A;  3F2D A;  2NZH A;  2ZT9 C;  3VDY A;  3NUC A;  1SSO A;  1B44 D;  1JWS D;  1XNR L;  4ZYS A;  4ILW A;  4C3J B;  3RLO A;  1LT5 D;  1YJ9 A;  1B53 A;  1QB5 D;  4ZKB B;  3RZD B;  1A2T A;  1WJJ A;  3NK9 A;  3H91 A;  2EYP A;  2H4O A;  4YY3 L;  3S1N H;  2EYL A;  4DUZ L;  3RNU A;  3I91 A;  4H7B A;  1GXD C;  4IN3 A;  1PFB A;  5COY A;  4Y52 H;  3MA2 B;  3HOZ H;  4LF9 Q;  1S5E D;  2IW3 A;  4L5S A;  2WKC A;  4X3U A;  3M4O H;  3FEW X;  2G9D A;  1CSQ A;  5DLQ E;  3NTK A;  1DJR D;  1G2S A;  5BN3 A;  5I6Y A;  3DM3 A;  1YIT A;  3E3X A;  3NQT A;  4PMC A;  4R4O A;  4C3H H;  2Z6K C;  1UNS A;  1J5E Q;  3HKS A;  2WB1 G;  4A3I B;  2HUG A;  4KHV A;  2K5W A;  3ERO A;  1ET9 A;  3Q6S A;  1GD7 A;  4CDF C;  1CHP D;  3GO5 A;  2YU9 B;  3GV6 A;  3C46 A;  1JQY D;  4OEL B;  4FF1 A;  4C3I H;  3RUZ A;  3CF5 A;  2UU9 Q;  2Y0S G;  3PUY A;  3R8B A;  3I4L A;  1TQO A;  4K14 A;  1XTC D;  4PZ7 A;  5HUR A;  4HSP A;  3N6R A;  4LF5 Q;  1TY0 A;  3CC4 A;  4QCL A;  2OTJ A;  3FRP B;  4LFC L;  1Y1W G;  4WOR A;  2WIN B;  1YJW A;  4RMF A;  5T1I A;  5C3E B;  1QE6 A;  1B2T A;  5CV4 A;  3DEO A;  2DJG C;  1XNQ L;  1KRT A;  3T16 A;  2DY7 A;  4XYQ A;  1LAB A;  4LF4 Q;  3ERS X;  2E5L L;  1HH2 P;  4U67 3;  4QL5 A;  4EQ5 A;  1N36 Q;  2QGQ A;  2L4N A;  3PIP A;  1H9M A;  1WYD A;  1ASZ A;  2H5X A;  4RHR A;  3QB3 A;  1OXV A;  3HZX A;  4TVA B;  3ZJY C;  3J81 j;  4LF4 L;  2NVQ B;  3M85 A;  4A3J G;  4RG1 A;  2PNH A;  4GOP A;  1I6H H;  2L15 A;  1IBM L;  4LAA A;  4RKL A;  3A54 A;  3S15 H;  3A56 A;  1AN8 A;  5M5X H;  2D5D A;  2KCM A;  4IFD H;  1HZB A;  2H1E A;  1FR3 A;  1LT4 D;  2JP1 A;  2B63 H;  4BBS B;  3K80 C;  1Q8K A;  1XPU A;  1CM9 A;  4HN7 A;  5ELE A;  1MI2 A;  2VS1 A;  3E6Z X;  3A8J E;  1JT8 A;  3F8T A;  3MAQ A;  3TP8 A;  2A68 C;  2M00 A;  1MKH A;  1PMR A;  2XIW A;  1LT6 D;  1WTQ A;  3S1R B;  2K01 A;  3HS0 C;  2NVY H;  3J7Z C;  1Q82 C;  4CHT B;  3NWT A;  4LF7 Q;  5E3F A;  1JE5 A;  1QCB D;  1XMO Q;  2HQE A;  1XPO A;  3GDE A;  2R92 G;  3C1F A;  3N52 A;  1SE4 A;  4MTN A;  4IOA A;  5D65 A;  1E2W A;  2NZO A;  4NXN L;  4HSV A;  1EY7 A;  3SHL A;  5M5Y B;  4GOP B;  1TS2 A;  3GV3 A;  4YHH Q;  1V1Q A;  1OTC A;  4JI3 Q;  4JBW A;  4PV1 C;  1L0Y B;  4C2M H;  4MHE A;  2K5H A;  4NMZ A;  3K5M A;  4B3R Q;  2AUK A;  2B2T C;  1STH A;  3D6C A;  4A3G B;  4HCS A;  4FYD A;  4LMQ D;  4A3J H;  1VQA A;  5C4X B;  1YVC A;  4UAI A;  2JN4 A;  3J81 L;  4DNI A;  2K5Q A;  2X6L A;  1E0B A;  1EFI D;  4BBR H;  3LX0 A;  2KEE A;  1PFM A;  4JCV E;  4DKA C;  4HR7 B;  4PQX A;  4TSS A;  3FDT A;  3BDC A;  3TN2 A;  4YY3 Q;  3K58 A;  2E2I B;  2EYM A;  4QQB X;  3RD4 A;  1HR0 W;  1UUP A;  5H1S E;  4B3S Q;  1K0R A;  2QDL A;  4A3L G;  1KLU D;  3J80 L;  4NXM L;  4OWX B;  4YWK A;  1PYB A;  4A3D G;  3R2T A;  3CXC A;  4DV0 Q;  4AYB E;  2F0I A;  3MTS A;  2RSO A;  4K8J A;  4UP8 A;  1H9R A;  3EJI A;  5IT9 E;  2ICI A;  1TT2 A;  1N33 L;  3HOZ G;  1UAP A;  3MC0 B;  3PF5 A;  1QWY A;  4A3M B;  1SYE A;  4A75 A;  1X9N A;  3U50 C;  2L1B A;  3VR2 A;  4DAY A;  3FPP A;  2LXK A;  3S2D B;  4C3H G;  1S5D D;  4RAU C;  5C6A A;  5FLX c;  1VQH A;  5E4X A;  4BXX G;  4ZCK A;  3CCJ A;  2DY8 A;  1B8A A;  1B50 A;  3KF6 A;  1IKM A;  4R4C A;  3CCR A;  3E9I A;  2UXB L;  4FF3 A;  3K8A A;  3SK5 A;  4PG3 A;  3B6Y A;  3S1M H;  1JC7 A;  3HOW H;  1F2L A;  2GVB A;  3BDL A;  1STN A;  4NB3 A;  4CDE C;  3PCO B;  2FXQ A;  3HOY B;  4HJ5 A;  1I4R A;  2Z4H A;  1F77 A;  1TWF B;  2RSN A;  5IOD A;  1VQC A;  1B70 B;  1LTB D;  2K5N A;  3J7A F;  1VQP A;  2YTV A;  5DAU A;  4HMI A;  1PDQ A;  5C0X G;  2WAC A;  1QZH A;  3X3M A;  4UY8 C;  3KBG A;  1DGS A;  5KNB A;  4JI0 L;  3NTI A;  1GHK A;  4RCO A;  4A3M G;  1ZYR C;  3KLS X;  4A3C H;  4POF A;  5LMU L;  2JA7 H;  4JV5 L;  4MTK A;  3NHH A;  4PZ6 A;  5IYC G;  1PH6 A;  4BY1 H;  2F03 A;  1DCZ A;  1E2V A;  3QJY A;  3KJO A;  5HGQ A;  3SGI A;  1L2F A;  3A8I E;  1WCM H;  3WDN A;  1CKN B;  4DV5 Q;  3T56 B;  1V1O A;  1K73 C;  4OO1 H;  3BYT B;  1LTL A;  2Y0S E;  3HRZ C;  2J0T D;  1QNU A;  2WII B;  3J81 E;  4NP5 A;  1E1O A;  4IUP A;  1J6Q A;  1BKB A;  1ESF A;  1SE3 A;  3OTO L;  2EJF C;  5BN5 A;  1S40 A;  1N36 L;  4KKS A;  2E2J B;  1X32 A;  2EVB A;  1IKL A;  5FOB B;  2KEN A;  5NUC A;  1EWH A;  4JC0 A;  4DV1 L;  2JA8 B;  5DEH A;  3KK7 A;  1KTK A;  4IUR A;  4OX9 Q;  2B63 G;  2F4V Q;  1EQV A;  1NNX A;  4DV7 Q;  1X3Q A;  2LSS A;  4P72 A;  1K9M C;  2BH2 A;  3S17 B;  4ID6 A;  3D4R A;  2OT2 A;  4OWT B;  2EY6 A;  1EY9 A;  3BU2 A;  1TKW B;  2NUC A;  2NN6 G;  4QB4 A;  3RN2 A;  5BR8 Q;  1VQN A;  1CT1 D;  1SFO H;  1LTI D;  5I2Y A;  5M5W B;  2DUD A;  4DV7 L;  1B9N A;  3X3N A;  3S1N B;  1QZG A;  4K5W A;  2IJ0 A;  4R4Q A;  4RGT A;  5C4J H;  5LMN W;  4LUO A;  3AYH B;  3ULL A;  4LW1 A;  4R1J A;  4A3C G;  1HNX L;  2XSC A;  3M4O B;  5C3E G;  4FDB A;  4A93 G;  3KDF A;  2F0K A;  2ZTE A;  1RIP A;  5I9O A;  3WWV A;  2F0M A;  1AP0 A;  4QUF A;  5IP9 H;  1V43 A;  4CDC C;  1D7Q A;  2R7Z B; 
#chains in the Genus database with same CATH homology
 3IKJ A;  2K05 A;  5IIF A;  1BCP B;  1QNK A;  5I6W A;  2A73 B;  4K8I A;  4IUN A;  2FFK B;  5JPN C;  5ISR A;  1PZI D;  3TSS A;  5LL6 S;  2RVL A;  1STY A;  1DYQ A;  3BDO A;  2BE5 D;  3O13 A;  1SNO A;  4O1N A;  3RMH A;  1NUC A;  1Q3L A;  4EQN A;  1LT3 D;  2K7V A;  2QDB A;  2A68 D;  2F0O A;  2QKI C;  1EY0 A;  1BUV T;  4KJO A;  1R9T B;  5IGG A;  3PO3 B;  2N88 A;  3S15 B;  2NWG A;  3VR4 A;  4LJZ C;  2F0D A;  1SNC A;  1HFN A;  1STG A;  4FO2 A;  4XIG S;  3AB9 A;  2Y0S B;  3KBX A;  2L55 A;  2NVT B;  1AZQ A;  1SAP A;  1EU4 A;  5JAV A;  1I4G A;  4IUV A;  3VA5 A;  3FKI B;  4KHZ A;  2Z8L A;  3S2H B;  4ULL A;  5C4Z A;  3L7Z C;  1G91 A;  1RHP A;  2D9U A;  2XWJ B;  2NYZ D;  4NW2 A;  4C1N K;  2NTS A;  4WRD A;  3BS1 A;  1TWG B;  1DOL A;  1SMY D;  4XQQ A;  3HOV B;  3QG1 A;  1ZKO A;  4EVO A;  2HDL A;  2A6E C;  1EY5 A;  4XXE A;  2ZXP A;  1G6Z A;  1SMY C;  1O7Z A;  3MXG A;  1I4Q A;  4K2K A;  4YIJ A;  5K36 H;  2L11 A;  3JAM E;  1CI3 M;  1IYV A;  3V2T A;  1K83 B;  2DNE A;  1I4X A;  5IT9 L;  1F9R A;  4TKO B;  4KTA A;  5CV9 A;  2LFN A;  2OXP A;  1OXX K;  3IL8 A;  1BOS A;  5KGU A;  3A7L A;  1Q1E A;  3GTL B;  5CGK A;  5K5P A;  3D3R A;  1W6K A;  2IWH A;  5KIX A;  1C4Q A;  3CRK C;  2QF7 A;  2R3Z A;  4DF7 A;  3VYS A;  4DAP A;  3ERQ A;  2NTT A;  3RZO B;  3Q22 A;  4J6H A;  3MEH A;  1I6V C;  2F0T A;  1T5X D;  2BA0 A;  2F0H A;  5KNC A;  1SJH D;  4IFD I;  4RCN A;  1F2Y A;  3K57 A;  3U9O A;  3M3Y B;  5FKA C;  2TMP A;  5C0X J;  2IX3 A;  1HTL D;  1EEF D;  4CJ1 B;  3BVG A;  1XX8 A;  1KDA A;  3L9A X;  4H13 C;  2B8F A;  3MFY A;  1RTO A;  5ELF A;  3R3O A;  3NQI A;  1SYG A;  1TS5 A;  1Z7T A;  3G6J B;  1BF4 A;  1QG7 A;  2B2W A;  4RFB A;  1HTP A;  1D5X C;  3HOZ B;  2SNM A;  4B9X A;  1ML0 D;  1Q90 A;  4MIU A;  3Q24 A;  1U9R A;  4RGO S;  1A2U A;  1Y1W B;  1GUW A;  3KUP A;  2EZV A;  1LAC A;  1HXY D;  2Q8R E;  4RGN A;  2K5D A;  4V19 0;  2SDF A;  3KLR A;  1MBY A;  1II3 A;  4C3I B;  3KLS A;  4S3S A;  3J7Y W;  2R6G A;  4XT1 B;  5JEA H;  3TP7 A;  3H6M A;  1B3A A;  3EVQ A;  1PTO C;  5C4H A;  5J39 A;  1PRT F;  3F2U A;  4LK1 C;  4KKT A;  2GA4 B;  2FIN B;  2F0S A;  3AU7 A;  2O4X A;  4KD3 A;  5EPL A;  3M7N A;  1B4O A;  4BY7 B;  4FXD A;  4RHS A;  2IX0 A;  4XQJ A;  5EKI A;  5IGF A;  5CV7 A;  1F9Q A;  3K0Y A;  5G3L D;  3GTM B;  4KY5 A;  1YNJ C;  5K36 G;  1I6H B;  3SXH A;  2RDF A;  3I8Z A;  2PW7 A;  2WAQ B;  1EY6 A;  2JEA I;  1DM0 B;  4EQP A;  3VR6 A;  1KLG D;  2ZXR A;  1LTG D;  4KY7 A;  5EBD A;  1Q1B A;  3NSW A;  2G9H D;  5TSS A;  3I3C A;  3GTP B;  5J1Z A;  1TU2 B;  3ND8 A;  1RKN A;  4C3J G;  1A15 A;  2BDN A;  5EJW A;  3GQB A;  3TP5 A;  1HA5 A;  3OWE B;  4PNY A;  3DWP A;  1WD1 A;  1NR2 A;  1ZXT A;  1CA5 A;  1D5Z C;  2JEB I;  1U4R A;  1SBB B;  5D3D A;  3HP3 A;  2B2U C;  2EOT A;  1NR4 A;  2A6E D;  1TS4 A;  2FMM A;  2QCP X;  4DXG A;  5M5X B;  4IUQ A;  1BDO A;  2RDG A;  3QO2 A;  3D8G A;  3M7G A;  4V0B A;  1F2Z A;  2JXM B;  4CGY B;  4J8Q A;  4DA2 A;  5C3W A;  4FXG C;  5ELC A;  3GTK B;  2CW0 C;  2KOL A;  4ZK9 B;  4X3K A;  1BCP D;  5EKL A;  1ILP A;  3P7J A;  3TDQ A;  1V8Q A;  3T13 A;  1SE2 A;  4H44 C;  2EXZ A;  1XWE A;  4M8A A;  4I65 A;  3GTG B;  1GUG A;  1YNN D;  3ITP A;  2EPB A;  5EGT A;  2VB3 X;  2F4I A;  3SDZ A;  3S9W A;  4NKL A;  4KN7 C;  3CRL C;  4ZKC B;  1TWC B;  1Y8P B;  3T51 B;  4DGZ A;  1STB A;  3DWA A;  3WOF A;  2IPK D;  1GHJ A;  1VMP A;  2MGS A;  4BA1 I;  1VCI A;  4M1U B;  4A3K B;  4DAV A;  2F3V A;  2EJM A;  2AQ3 B;  4FF4 A;  1G2T A;  2BCO A;  4R8N A;  3A7A B;  3C3L A;  4KKU A;  1IYU A;  2JYO A;  3MXU A;  2PO4 A;  5I9P A;  3RLF A;  5J22 A;  1BXT A;  2EY2 A;  2L9H A;  4G4K A;  4WJW A;  1CQF A;  1V1P A;  2PMZ B;  2F0P A;  4X3S A;  1CZW A;  1SNM A;  1AEX A;  2BDO A;  1NAP A;  1Z47 A;  5EPJ A;  1D1K A;  5EKK A;  4QIW B;  3I4N B;  4QF4 A;  2L12 A;  1WTV A;  1MSH A;  1TY2 A;  1EYA A;  3PUX A;  1W6J A;  3BVM A;  2F0Q A;  3I90 A;  5JVG 3;  3I70 A;  5KRU A;  4TQU S;  4F7X A;  2MHV A;  1HPC A;  1CK1 A;  5I2X A;  1MGS A;  4F87 A;  3EA6 A;  3PUW A;  2LS0 1;  4KD4 A;  3MHB A;  3D4W A;  4C3I G;  5FO7 B;  1CTM A;  4CJ2 C;  3E0J A;  1HUN A;  1QIL A;  5A35 A;  2NN6 H;  3P1H A;  1TVX A;  2K33 A;  5IGE A;  3I4M B;  4KY6 A;  1H9S B;  2B2Y C;  3MVV A;  1PTO B;  4KV6 A;  5I4D A;  3PMF A;  2C5C A;  1PFN A;  3OIP A;  4XYO A;  3E5S A;  1DD2 A;  1LTA D;  5A2Q L;  5KND A;  3OMG A;  5CBA E;  2Z1C A;  4KN4 C;  3I72 A;  2SEB D;  1UEA B;  3DEP A;  5M3M B;  4P2C B;  2B2U A;  1JR0 D;  3KF8 A;  2F0W A;  5KEE A;  3DM1 A;  5IGC A;  2L5T A;  3A8K E;  1TR5 A;  2IX1 A;  2SNS A;  2NN6 I;  1ROD A;  1WTW A;  2B8G A;  2NVY B;  1EU3 A;  1SND A;  1H9K A;  3IAY A;  2EY1 A;  4EGV A;  1EIG A;  4ZRZ A;  4MN3 A;  4IFD G;  1AZP A;  1FNW A;  3MWY W;  3OMC A;  1EOT A;  1GUS A;  2PZT A;  4FP5 D;  1JOR A;  2PYK A;  4OIK A;  1SYC A;  1JE4 A;  2FJ2 A;  4DNT B;  2F0J A;  4DK1 A;  3G7L A;  3TP6 A;  1LTR D;  1HUM A;  4A3J B;  1BQQ T;  5CMD A;  1GUT A;  3IFD A;  1CFM A;  5CV5 A;  1GJX A;  3H94 A;  3VYT A;  1MD2 D;  2HDM A;  5CV6 A;  4FVM A;  1I4P A;  1D1I A;  2OEO A;  5AFW A;  2XNA C;  5F2D A;  3OOC A;  1I50 B;  2KQ3 A;  5JPM C;  1IL8 A;  4FXK C;  5IOC A;  1D6E C;  3NXW A;  3L3O C;  2PNR C;  3T4A C;  3DXJ C;  3MFG A;  2WKD A;  5IGD A;  3PIO 3;  2A69 C;  1ENF A;  3SVM A;  4DFA A;  2IL8 A;  2AWO A;  2B2Y A;  4O42 A;  1EYD A;  2I07 B;  1I4H A;  3H3V C;  1LO5 D;  1VDZ A;  5JEA J;  2R92 B;  3TZD A;  2D2C C;  2LKV A;  2Q8T A;  2FHT A;  1BNZ A;  1JCK B;  2B39 A;  1PZK D;  2XVS A;  3TBI B;  2OF1 A;  2MJ8 A;  5JJZ A;  1RDP D;  1S5F D;  3P20 A;  5ELD A;  2FMC A;  4IQZ A;  1PYW D;  4XDX A;  2B2V C;  3WOE A;  2ENB A;  2MUY A;  1SYD A;  1O7L A;  1AFP A;  3HGB A;  3OPO A;  4TRD A;  4A3F B;  5D3I B;  3VYU A;  4H0L C;  1FGB D;  3UI2 A;  4FF2 A;  4CKE A;  4JK1 C;  4ABN A;  1HA6 A;  2R61 A;  3OIQ A;  1BCP F;  4R9W A;  2XRQ D;  1DOK A;  3DWQ A;  2NB0 A;  5E4W C;  1F9S A;  1FNU A;  2MP1 A;  5FLX L;  2F0L A;  1NSN S;  2BOS A;  5C0X H;  4K5X A;  1TS3 A;  1O80 A;  3R93 A;  4KMU C;  5DM6 3;  2WV6 D;  2RDH A;  3M4Y A;  1F9P A;  2JSO A;  3SEB A;  1FYC A;  1U4L A;  4BS9 A;  2KCN A;  4L8J A;  1VMC A;  3VR3 A;  3SK6 A;  1TII D;  1BR9 A;  3ONA B;  2E2D C;  1VF5 C;  2J4X A;  2A69 D;  1FD7 D;  1JIC A;  1S4Z A;  2K04 A;  1S5B D;  1Q12 A;  5C4J B;  4KK7 A;  2K28 A;  1LLR D;  4OO1 G;  2KUM A;  2CQA A;  1PRT B;  1WTO A;  5EQ0 A;  5HGT A;  1Y8N B;  2RBM A;  5C44 B;  3VYR A;  1JOO A;  4PMB A;  4OGQ C;  3D6W A;  2CVR A;  3K5O A;  3J80 E;  4QUC A;  4WFN 3;  2NZ1 D;  4ZUI A;  2KED A;  1ESR A;  1ET6 A;  1STE A;  4OHJ A;  1HFG A;  1ZYR D;  1PTO D;  2X6G A;  1B1Z A;  5G3L F;  2AQ2 B;  2ICE C;  3ZYY X;  2HCC A;  1ICW A;  2CHB D;  4CBV A;  5DM7 3;  3GD7 A;  1JOK A;  2DNC A;  5KYL A;  1IW7 D;  1KNE A;  2PQE A;  1CZG A;  4DN4 M;  3J7A V;  3SR1 A;  1LTT D;  2F0F A;  4ZLT F;  3CHB D;  4ZUJ A;  4I7Z C;  1RD9 D;  4J1M A;  1ONL A;  4A93 B;  4FNF A;  4ZAI A;  1A3T A;  2KCC A;  2E2H B;  2J7Z A;  3K59 A;  4HTH A;  2VUM B;  5CBE E;  3GP7 A;  2R93 B;  5BN4 A;  2NVX B;  2PZU A;  5IGB A;  2ZXO A;  3HKZ B;  3NTH A;  3TME A;  2PPB C;  1WTP A;  4Z9C B;  1SYF A;  5C5L A;  2RKS A;  1O78 A;  2EJG C;  3MZ5 A;  4G7O C;  4EQO A;  4K6D A;  2RQX A;  3R2I A;  1IW7 C;  3V05 A;  1MSG A;  2F1M A;  3BG3 A;  3K6O A;  2CW0 D;  1EL0 A;  4RA8 A;  5JOB A;  4Q5V A;  1D2B A;  1LTS D;  2N55 A;  1R4P B;  2C9O A;  4DK0 A;  3DUZ A;  2K03 A;  1S5C D;  1ILQ A;  2JA6 B;  1YNJ D;  4K5V A;  4N9P A;  3OSO A;  4U68 A;  1A6X A;  3K5L A;  1JWU D;  4R8I A;  1M8A A;  2EYH A;  3HOW B;  4BBR B;  3K5N A;  1HRJ A;  3PUZ A;  2KVM A;  1GUO A;  4E6I A;  2JA5 B;  1BO0 A;  3HG9 A;  3W3A A;  5LHY 1;  2QIL A;  4B9W A;  2KHS A;  3QIA A;  1ENA A;  2KJX A;  2VNU D;  1HHV A;  2B2V A;  5LL6 X;  4BWG B;  1OXS C;  1L0X B;  1H9J A;  2F0N A;  3QOL A;  4KI0 A;  3SE0 A;  1JB3 A;  1DON A;  1O7Y A;  4OIJ A;  3AMU A;  3NP8 A;  5DNF A;  4G57 A;  5C5M A;  2NBF A;  2F0V A;  5CC4 A;  2F0E A;  3H09 A;  3S1M B;  3D4D A;  4GZY C;  1Y8O B;  1CHQ D;  1SNP A;  3GTJ B;  3QWN A;  4PMW A;  1K8O A;  4K2L A;  2F0G A;  4IAL A;  1EZ6 A;  1QOH A;  3BZD B;  1EIH A;  3VA7 A;  1BCP C;  1PZJ D;  3OW7 A;  1LV9 A;  3P75 A;  2JA7 B;  1K8M A;  4CKC A;  1SFO B;  1SEB D;  5EPK A;  3QOJ A;  3EQL C;  2DN8 A;  1PXU A;  3EFX D;  3FPU B;  1WCM B;  2RA4 A;  3MXN A;  4ODG A;  4G7Z C;  5E1F A;  4IUT A;  5T1G A;  1FNV A;  1U4P A;  1XXG A;  1XYI A;  2O5I C;  2A6H D;  1HQM C;  3T53 B;  4C3H B;  4B08 A;  2B2W C;  2XWB B;  1KAB A;  5EBC A;  1WVL A;  2TSS A;  2A5H A;  1KDB A;  1JOQ A;  3FVQ A;  1R4Q B;  4UDU C;  2K32 A;  2WP8 J;  2PW5 A;  2D62 A;  5D14 A;  1SNQ A;  1GUN A;  2L0C A;  2EYF A;  1E2Z A;  3IFT A;  4XT3 B;  2V4D A;  4HCE A;  3VR5 A;  3PIP 3;  3I73 A;  1T5E A;  4ZQ3 A;  4F88 A;  2YYZ A;  1X3P A;  2KEC A;  1CA6 A;  2WB1 B;  4OL7 A;  1A3V A;  3Q23 A;  3JAM L;  4RKB A;  1KDC A;  3TZU A;  5CR3 A;  1RTN A;  1TWA B;  5JEA G;  5ELB A;  1PTO H;  2M9V A;  3NBH A;  1V1P B;  3BYY B;  4N9T A;  5KYI A;  1SDF A;  2XN9 C;  3CKI B;  2F0U A;  3OHX C;  2B2T A;  2E75 C;  2K1B A;  5A2Q E;  3PUV A;  5JVH 3;  4K6L A;  2B63 B;  1OXU A;  1DZ1 A;  4RGM A;  1DOM A;  1GOZ A;  1EY4 A;  2I46 A;  2LY7 A;  2IT1 A;  1I3Q B;  4BA2 I;  1F2M A;  1RF2 D;  2A6H C;  5C3X A;  3BVZ A;  2M2L A;  1OO9 B;  4CKB A;  3W2D A;  1CQV A;  2E74 C;  3FMC A;  3D31 A;  5FK9 C;  2EYO A;  1ENC A;  1ZEQ X;  3H0G B;  1PRT D;  4DXF A;  4QMG A;  1WD0 A;  4HAE A;  4IZ8 A;  3CQZ B;  2ID0 A;  3GTQ B;  3U9S A;  2LMC B;  2BA1 A;  2PCF B;  2X69 A;  4HED A;  3C1E A;  3HOX B;  1TWH B;  3URY A;  5CYU A;  1Q8I A;  2VB2 X;  2KA7 A;  3OWF A;  5FLX E;  4C2M B;  1G8Z D;  4OO1 I;  2HCI A;  3GTO B;  4XTC S;  5C0X I;  1NCV A;  2Z4I A;  3V96 A;  3DHQ A;  1PLF A;  4ME5 A;  4KJN A;  2MPM A;  1QJO A;  1YNN C;  1WTR A;  5M3F B;  3S16 B;  4IFD J;  2BE5 C;  1EEI D;  1EYC A;  2EDG A;  2O5J C;  3LWE A;  1KNA A;  2PZW A;  3MXP A;  2XRS D;  4C56 C;  1SXT A;  4HMJ A;  3SK4 A;  1C8C A;  1EQT A;  1KAA A;  2EYJ A;  2O2L D;  3CU7 A;  2VXW A;  3K7A B;  1RCV D;  3HEJ A;  1DXM A;  1SJE D;  2EY5 A;  1STA A;  3S14 B;  1OXT A;  3ND9 A;  1D5M C;  5FO9 B;  3C2P A;  3Q0A A;  2Q8I B;  3NBI A;  2QEJ C;  2AWN A;  4NDX A;  4A3E B;  4Y7N B;  5COR A;  1EWC A;  2AUJ D;  4C1N I;  4A3D B;  5M9O A;  1G29 1;  1JWM D;  3NE5 B;  5FO8 B;  4X3T A;  3HOU B;  3A55 A;  4CJ0 B;  3NWS A;  1J8I A;  1C48 A;  4DNR B;  2SOB A;  4L6T B;  1SYB A;  1A3U A;  3LWU A;  2E76 C;  1HQR D;  1EZ8 A;  4G7H C;  1WTX A;  4XQN A;  1PTO F;  4RH6 A;  3LNN A;  4RWS C;  4BY1 B;  2F3W A;  2K6A A;  3SK8 A;  1AW7 A;  2JE6 I;  3NPP A;  1HCZ A;  3PO2 B;  4Q0F A;  1J9O A;  1EY8 A;  2A74 C;  3DMU A;  4AYB B;  1B9M A;  3S1Q B;  1Z6H A;  1IHZ A;  4DU9 A;  3PV0 A;  1U4M A;  1H9S A;  2AQ1 B;  1VF7 A;  1RJT A;  1PRT C;  2EE1 A;  4A3B B;  1Y69 U;  4F8M A;  1BBX C;  4IUU A;  4L63 B;  1Y1V B;  1M4V A;  5CV8 A;  2ZT9 C;  3NUC A;  1SSO A;  1B44 D;  1JWS D;  4ZYS A;  4ILW A;  4C3J B;  1LT5 D;  1B53 A;  1QB5 D;  4ZKB B;  3RZD B;  1A2T A;  3NK9 A;  3H91 A;  2EYP A;  2H4O A;  2EYL A;  3I91 A;  4H7B A;  1GXD C;  4IN3 A;  1PFB A;  5COY A;  3MA2 B;  1S5E D;  2IW3 A;  2WKC A;  4X3U A;  3FEW X;  2G9D A;  3NTK A;  1DJR D;  1G2S A;  5BN3 A;  5I6Y A;  3NQT A;  4PMC A;  1UNS A;  4A3I B;  2HUG A;  4KHV A;  2K5W A;  3ERO A;  1ET9 A;  3Q6S A;  1CHP D;  3GO5 A;  2YU9 B;  3GV6 A;  3C46 A;  1JQY D;  4FF1 A;  3RUZ A;  3PUY A;  3R8B A;  3I4L A;  1TQO A;  4K14 A;  1XTC D;  5HUR A;  4HSP A;  3N6R A;  1TY0 A;  4QCL A;  3FRP B;  4WOR A;  2WIN B;  5T1I A;  5C3E B;  1QE6 A;  1B2T A;  5CV4 A;  3DEO A;  3T16 A;  2DY7 A;  4XYQ A;  1LAB A;  4U67 3;  2L4N A;  1H9M A;  4RHR A;  3QB3 A;  1OXV A;  3HZX A;  2NVQ B;  3M85 A;  4LAA A;  4RKL A;  3A54 A;  3A56 A;  1AN8 A;  2D5D A;  4IFD H;  2H1E A;  1FR3 A;  1LT4 D;  2JP1 A;  4BBS B;  1CM9 A;  4HN7 A;  5ELE A;  1MI2 A;  3E6Z X;  3A8J E;  3MAQ A;  3TP8 A;  2A68 C;  2M00 A;  1PMR A;  2XIW A;  1LT6 D;  1WTQ A;  3S1R B;  2K01 A;  3HS0 C;  4CHT B;  3NWT A;  5E3F A;  1QCB D;  2HQE A;  3C1F A;  3N52 A;  1SE4 A;  5D65 A;  1E2W A;  4HSV A;  1EY7 A;  3SHL A;  5M5Y B;  1TS2 A;  3GV3 A;  4JBW A;  4PV1 C;  1L0Y B;  4MHE A;  4NMZ A;  3K5M A;  2AUK A;  2B2T C;  1STH A;  3D6C A;  4A3G B;  4HCS A;  4FYD A;  4LMQ D;  5C4X B;  4UAI A;  3J81 L;  2K5Q A;  2X6L A;  1E0B A;  1EFI D;  3LX0 A;  2KEE A;  1PFM A;  4HR7 B;  4PQX A;  4TSS A;  3FDT A;  3BDC A;  3TN2 A;  3K58 A;  2E2I B;  2EYM A;  3RD4 A;  1UUP A;  1KLU D;  3J80 L;  3R2T A;  2F0I A;  3MTS A;  2RSO A;  4K8J A;  1H9R A;  3EJI A;  5IT9 E;  2ICI A;  1TT2 A;  1UAP A;  3MC0 B;  1QWY A;  4A3M B;  1SYE A;  2L1B A;  3VR2 A;  4DAY A;  3FPP A;  3S2D B;  4C3H G;  1S5D D;  4RAU C;  5C6A A;  5E4X A;  2DY8 A;  1B50 A;  1IKM A;  4FF3 A;  3SK5 A;  1JC7 A;  1F2L A;  3BDL A;  1STN A;  3HOY B;  1I4R A;  2Z4H A;  1F77 A;  1TWF B;  2RSN A;  5IOD A;  1LTB D;  3J7A F;  5DAU A;  4HMI A;  1PDQ A;  5C0X G;  2WAC A;  3X3M A;  3KBG A;  5KNB A;  3NTI A;  1GHK A;  4RCO A;  1ZYR C;  3KLS X;  3NHH A;  2F03 A;  1DCZ A;  1E2V A;  3QJY A;  3A8I E;  3WDN A;  3T56 B;  1V1O A;  4OO1 H;  3BYT B;  3HRZ C;  2J0T D;  1QNU A;  2WII B;  3J81 E;  4NP5 A;  4IUP A;  1ESF A;  1SE3 A;  2EJF C;  5BN5 A;  4KKS A;  2E2J B;  1X32 A;  2EVB A;  1IKL A;  5FOB B;  5NUC A;  1EWH A;  2JA8 B;  5DEH A;  3KK7 A;  1KTK A;  4IUR A;  1EQV A;  1X3Q A;  3S17 B;  4ID6 A;  3D4R A;  2OT2 A;  2EY6 A;  1EY9 A;  1TKW B;  2NUC A;  2NN6 G;  4QB4 A;  1CT1 D;  1LTI D;  5I2Y A;  5M5W B;  1B9N A;  3X3N A;  3S1N B;  4K5W A;  2IJ0 A;  4RGT A;  2XSC A;  3M4O B;  2F0K A;  5I9O A;  2F0M A;  1AP0 A;  4QUF A;  1V43 A;  2R7Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...