2EJFC

Crystal structure of the biotin protein ligase (mutations r48a and k111a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
NVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
total genus 12
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ejfC00
1GJXA 1DXMA 2NN6H 3LWUA 4JK1C 4PV1C 2KCCA 3A8KE 5C0XH 2QF7A 5KNDA 3A7LA 3MFYA 1H9KA 1YNJC 1IW7D 2E74C 2A6EC 2A68D 4DK1A 1O7LA 4XIGS 3T56B 1OXXK 1Q1BA 5JEAG 2BDOA 2JE6I 3BG3A 1Q1EA 4LK1C 4RCNA 2K33A 2A6HC 2CW0C 4OO1H 1I6VC 1SMYC 5BN3A 3T53B 2A69C 3PV0A 4OGQC 1VF7A 3LNNA 3VR2A 1A6XA 4IQZA 2B8GA 2BE5D 5KNCA 4HR7B 1K8OA 2DNCA 2D62A 1YNNC 3MXUA 1E2ZA 1LACA 1Y8PB 4TKOB 2PPBC 1OXUA 1Q12A 2JEBI 2EDGA 3QIAA 3QJYA 4GZYC 1FYCA 2A69D 1H9JA 2D5DA 3DXJC 1Y69U 3PUVA 2IT1A 4JBWA 2EJGC 1OXVA 1VF5C 3RLFA 4DNTB 2O5JC 1QJOA 1VCIA 4KI0A 5K36G 1H9RA 3NE5B 4OO1G 4G7HC 1T5EA 4I7ZC 1GUTA 3U9SA 3HGBA 1IW7C 2LMCB 2BA0A 1GUGA 1OXTA 3PUYA 2B8FA 1E2WA 2PNRC 4LJZC 4KN7C 2DNEA 1DCZA 1PMRA 2A68C 2A6ED 5C0XG 3VR6A 2E76C 2E75C 4XTCS 2NN6G 3OPOA 4KKSA 4DNRB 5JEAH 5K36H 2EJFC 4TQUS 1BDOA 2AUJD 3VA7A 1HPCA 3N6RA 3D31A 3M4YA 4H13C 2L5TA 3I73A 3PUZA 2Q8IB 3AB9A 3A8JE 1VDZA 4G7ZC 1OXSC 1CI3M 1H9SA 2JXMB 5BN5A 2YYZA 3IKJA 1EWHA 2JEAI 3D4RA 1E2VA 3ND9A 2DN8A 2ZT9C 1GUNA 1V8QA 4IFDG 4L8JA 2BE5C 3OW7A 1ZYRC 1ZKOA 3W3AA 4G7OC 2D2CC 2K32A 3H94A 2EVBA 4BA1I 4H44C 2AUKA 1K8MA 3BDOA 1Y8OB 3PUXA 4KKTA 1GHKA 3P20A 2R6GA 3WDNA 5A35A 1ONLA 1TU2B 2EJMA 2V4DA 1B9NA 1H9MA 4KHZA 1Z6HA 3OOCA 1Z7TA 1HTPA 2F1MA 3L7ZC 2BA1A 1G291 1IYVA 1GUOA 1FR3A 1GUSA 2A6HD 1B9MA 4BA2I 3M7NA 4KMUC 3TZUA 3GD7A 1TKWB 3I72A 3M85A 1CTMA 1DD2A 1V43A 1GHJA 3SE0A 3VR5A 1H9SB 1LABA 3QG1A 3IFTA 4DK0A 3EQLC 1HCZA 4IFDH 1CFMA 2NN6I 2O5IC 2KA7A 3PUWA 3CRLC 5KNBA 3KLRA 1Y8NB 3T51B 1HQMC 3FPPA 1IYUA 3A8IE 3A7AB 3CRKC 3FMCA 3GQBA 3ND8A 4KKUA 1Q90A 3SDZA 2AWOA 3VR3A 3I4LA 2K7VA 5BN4A 1O78A 2PCFB 3VR4A 4KN4C 4H0LC
chains in the Genus database with same CATH superfamily
3U9OA 2M2LA 5KNDA 1N34Q 3BVGA 1JE4A 1FNWA 1SYFA 2DJGC 4R4TA 5J22A 3P75A 3G71A 4JCVE 5I2XA 4XT1B 3KK7A 1L0XB 3ZJYC 3GTMB 3D0FA 4RKLA 1BQQT 3S1QB 1K73C 1SE8A 4RCOA 3SVMA 4LF4L 2JA8H 3WWVA 1VQKA 4C3HH 3TP5A 1KC8C 1W6KA 1TS4A 3I4MH 4DV2L 2PO4A 1LTTD 4A3GB 3R93A 2MP1A 3NTKA 4DUYQ 1UEAB 3SHLA 3JAML 1MHWC 3CCMA 1Y1WH 1X54A 4A3CG 1I4RA 1WYDA 2YTVA 2K1BA 2UXDQ 2NVYH 3S1NH 3DWAA 3TN2A 1BUVT 1LT6D 4HJ7A 1DOLA 2UUCL 2IW3A 3GV3A 1YNJD 2E2JH 4YCWA 3STBD 1WTXA 4X62L 4EVOA 2MUYA 2TMPA 1ESFA 3J7AV 1JICA 1GKHA 4G7ZC 4A3EG 1VQ8A 1H9SA 2A73B 1YNND 2JEAI 2DN8A 5EJWA 1TWHB 4R4CA 3T1HL 2B2WC 1NSNS 1VQ5A 1N34L 1PTOF 2K28A 2ZM6Q 3RZDH 2XVSA 1A3TA 1GXDC 4JI1Q 5IP9G 5KYLA 4XXEA 1RKNA 5FJ8G 4DA2A 2K03A 2PZUA 3MVVA 1WOCA 3UDIA 4JI7Q 1C7YA 1QNKA 1I4HA 3SGIA 4KMUC 5LMNL 2XWJB 1WTOA 3VR5A 5D3IB 1PFBA 1HTLD 4CKCA 5M5YB 1YIJA 2K5WA 1X55A 4RHSA 4UP7A 1ESRA 5IYCH 3A55A 4ZCKA 5IP7H 1N33Q 1EIYB 2MO1A 1HQMC 1MIUA 1TS3A 1I94Q 4MIUA 3TBIB 3NUCA 3VR3A 3NTIA 2L0CA 1DXMA 4C3IG 4V0BA 4HJ9A 1H95A 4B3TQ 3EJIA 3MHBA 5JOBA 1H9KA 2LSSA 1JJCB 2K5HA 3Q6SA 4A75A 3CQZH 3I55A 5C44G 4LK1C 1FNUA 1BBXC 2UXCL 4AIMA 4MHEA 3U58A 5JJIA 3JAMc 3J81i 4DXFA 2JA5G 3HOVG 4DR2Q 3E3XA 1PZID 3DLLA 1SRUA 2QDLA 4ABNA 4BY1H 2R93H 3D6CA 2EDGA 4K8IA 5FLMG 4KHPL 2WB1B 2ZM6L 3MEHA 1XTCD 3PUVA 1WI5A 2DJFC 4JBJA 4BY7B 4C56C 2C35B 2K50A 2XTIA 1S40A 4CKBA 2NVXH 1J6QA 3DWPA 1NR2A 1OXTA 4G57A 2M00A 1LTID 3HOZG 3J81E 4EGVA 3NBIA 2E76C 1XJVA 1AZPA 4HCEA 1ASYA 2F0LA 2HQEA 1FVIA 1FD7D 1I50H 1RL2A 4IPGA 1VQHA 2ZT9C 3OW7A 2ZXRA 2D2CC 2OEOA 1O7IA 4A3KH 3NHHA 4YCVA 5C0XI 2R6GA 4RGNA 5A35A 3VYTA 1I3QB 3S1MH 1XPOA 3GDEA 1ENAA 4DGZA 3OW2A 1AE2A 1YHQA 1CKNB 4ME5A 3BZDB 5HY6A 5I2YA 1P8LA 2CWAA 1CUKA 3Q0AA 3SK4A 1PRTB 3FDTA 4HJAA 4L5TA 5J1ZA 3IAYA 3RLNA 4A3MG 1V43A 3TS2A 1XXGA 4WFN3 1G8ZD 1PZKD 3CCLA 3GO5A 2Z6BA 2F3WA 2WB1G 3L0OA 1SNCA 2Z9HA 4R1JA 3PIPA 3EROA 4NKLA 1BKBA 3FPPA 3A8IE 4R4QA 1Q90A 1P16A 2K7VA 2HT1A 1PA6A 5BR8Q 1M8AA 3QB3A 4PV1C 5LL6X 1YZ6A 4EQOA 3STBC 1YNJC 2VUMG 1UE6A 1C48A 2K04A 1XNRL 2CWPA 3D6WA 4A4IA 4A3BG 2N88A 4DR5L 2F0GA 3FKIH 1EYAA 1STAA 1I6VC 4A3FH 3AYHB 4YWMA 3TP8A 5M3MG 3MWYW 2VQEL 3G7LA 1HR0W 1HNZL 2D62A 1YNNC 1LM0A 2NVQB 3CU7A 2NVQH 2NB0A 1PTOB 2A8VA 3S16B 1UWVA 1GOZA 5M3FB 3MFGA 4DV4Q 2KHIA 1KL9A 3RLFA 2K6AA 3GTOB 3QWNA 3RLOA 4DV6L 4R9WA 4PMCA 4G7HC 5D3DA 4JI5Q 3KLWA 4Y7NH 3HGBA 1IL2A 2YTXA 3M3YH 2BA0A 3H3VC 1BNZA 1E2WA 4X65Q 4GOPA 2H1EA 4XYOA 4A3BB 1WCMH 2ZTEA 4DR6L 1RODA 2OQ0A 2L11A 4ID6A 4RGTA 3I7FA 3HKZG 4LWCA 1X3QA 4H13C 2R61A 2IHFA 3CF5A 3FP9A 2R92H 3ZYYX 5EPKA 1VDZA 1XWEA 1HH2P 4BXXH 2R92B 3J81j 1EY8A 3ND9A 5IGFA 2F03A 1QILA 3DEPA 1JCKB 2CFMA 4BA1I 4A3DH 4A3BH 4A3GG 4CKEA 4AQYQ 3J81c 1BVSA 2LKVA 1PXUA 1TWCH 1LTLA 2J7ZA 5LMUL 2AWNA 1KDAA 1Q46A 3K5OA 4X66Q 2F1MA 2BA1A 2KHSA 1CQVA 2F4IA 4BA2I 4ZKCB 3M7NA 2OCEA 4XQNA 5ELEA 1DD2A 2L12A 4JOIC 3SE0A 4A3JB 4DR4L 4AYBG 4OEMB 4NXMQ 1C8CA 4DF7A 4UAIA 2UXDL 1I5FA 4OXPA 5DM63 4GN5A 1K9MC 1TWCB 4BXXG 4RGMA 2UUCQ 1ET9A 5T1GA 3D8GA 4KN4C 1SROA 2HUGA 4B3RL 1NJIC 3A8KE 3N52A 2E74C 4QCLA 1SE4A 1MBYA 1LUZA 1QZGA 5ELBA 3KJOA 3BYTB 4ILWA 3D4DA 2MQHA 1Q1EA 3FVQA 4X66L 1AEXA 1LYLA 3UDGA 2A69C 3NQIA 5T1IA 5KGUA 2RDHA 4HR7B 3PIP3 2KCTA 1IKLA 1SSOA 4IUVA 4KTAA 2NUCA 3PO3H 1OXUA 3PO3B 4NDXA 5I9OA 2R7DA 1D2BA 4WORA 3HOZH 4RMFA 4TRDA 2XIWA 1RCVD 2CH4W 4IJHA 1UE5A 3T4AC 1IW7C 1SNMA 2WKCA 2N8NA 3IFDA 1WTRA 1GVPA 2PNRC 1STEA 3CPFA 4X65L 2VB3X 2HHHL 4CJ1B 3T13A 3NXWA 1U5KA 2BH8A 3CMEA 3X3NA 2ES2A 4KKSA 4C1NI 4DNRB 5I9PA 2DY8A 4OHJA 1Z9FA 3D31A 5IE8A 5M5WB 2WV6D 1RDPD 2KUMA 1QWYA 1STNA 1E2VA 1WVLA 4O2DA 4E6IA 3F2DA 1ZYRC 2B2YC 3FPUB 1RTNA 1Q8IA 3BDOA 1CKNA 3HOXB 4HN7A 4A3MB 1TIID 3R3OA 2E2IH 1JOOA 2JQOA 2C5CA 2PZTA 1Z7TA 4DAPA 2SOBA 2SNSA 3UE0A 3I3CA 1O80A 1F9PA 1L1OC 4P71A 3K59A 1KLGD 1WTPA 1HNXQ 1TR5A 2JSOA 4IPDA 4UP9A 1CSPA 3ERSX 5C4XG 3EQLC 1V9PA 3C1EA 3WOEA 2IX0A 3BVMA 5KNBA 1PFNA 4WJ3M 3R2IA 4TVAB 1UAPA 2B2WA 3OMCA 2VUMB 1B53A 1QVFA 1EY0A 1EZ6A 1V1QA 1NUCA 3V05A 4A3IH 2RSOA 2IWHA 1I6HB 4HEDA 3BZCA 2IL8A 1BCPC 1SYCA 2K05A 4JYAQ 1IW7D 1BBUA 3IRBA 4QUCA 4K2KA 3V2TA 2X69A 3VYRA 1EQTA 2A5HA 4XIGS 3RNUA 4RCNA 2CW0C 2PMZE 3J7ZC 1A6XA 1SDFA 1IZ6A 2QKIC 2BE5D 1XPUA 3MXGA 3CW2C 1HR0Q 1EUJA 3GV6A 4QMGA 4DV2Q 2R93G 2UU9Q 1TWAH 3E0EA 3E9IA 3NP8A 1QB5D 3MC0B 2A69D 2K52A 1R4QB 1HRJA 1B8AA 2B2TA 1ENCA 2E8GA 3GTLH 1OXVA 1NTGA 4DNTB 2WAQE 3TS0A 4GNXB 2CCZA 3EA6A 2Y0SB 1GUTA 1Y1WG 3F8TA 1HZ9A 1STYA 5IYDH 3ITPA 4LJZC 5FO7B 2F0QA 5M9OA 4A3JG 2KHJA 2PZWA 1BBWA 1DCZA 1CSQA 2RBMA 4GLAC 3QO2A 4NXNL 1A62A 5CGKA 5IT9L 4X6AH 4IUNA 1LTSD 1RF2D 4FVMA 3A8JE 2F0UA 1KRTA 5IWAQ 1IBKQ 4C1NK 1N8RC 1GUNA 1V8QA 4IFDG 1G2TA 2Q2TA 4A93B 3HG9A 2EXZA 5D65A 4C3JG 3E9HA 2JA7H 2JK8A 4LNQA 4DV0L 5AJ3Q 1H9MA 2PNHA 3MEFA 2JA7B 4LF6Q 1NR4A 1Y1WB 1G291 1PRTD 2IX3A 1IYVA 3DM3A 2JP1A 5KRUA 1TKWB 3M85A 1FJGQ 1WTQA 1PDQA 1PH1A 4JBMA 1EZ8A 4GKJQ 3K5LA 2K5NA 5JAVA 5C3EG 1Q81C 2EXDA 2PMZB 4IPCA 1XNQL 4K6LA 2AWOA 4JI8L 4NPSA 1XMQL 1X3FA 4HAEA 2PI2E 4PG3A 3VA5A 2AQ3B 4ZUIA 1KABA 3KDFA 4IALA 3LWUA 4YHHQ 2KCCA 4ZYSA 4K5WA 3VDYA 4GS3A 4QIWE 5EKLA 3W1BA 2D9UA 1EYDA 3J7A5 2KCMA 3J80E 1D1IA 2XN9C 1NNXA 4IURA 1LTGD 4OX9L 3T53B 5IOCA 1VF7A 3LNNA 2Z6KC 1N9WA 1KQSA 1W3SA 2K5DA 1LACA 4KHVA 1RD9D 5DLQE 3P7JA 4A3DB 4K2LA 4N8X1 3C46A 4I7AA 5IODA 3MA2B 2IT1A 4C3HG 4GLXA 2JA6B 1DZ1A 4JC0A 5KYIA 2LFNA 3CCQA 4LFCL 1ZXTA 4OX9Q 5EKIA 2EYLA 2Q8TA 2F0HA 2B8FA 3SK8A 3R8BA 3TP7A 2DGYA 4DXGA 2XRSD 4U673 4DAVA 1VQ9A 1TXYA 3F1ZA 3HOXH 2NTSA 5C5MA 3ULJA 1UEBA 1A0IA 3BDCA 3RN5A 1XNQQ 4O1NA 4POFA 5H1SE 4DPGA 3HOVB 2QA4A 4DR7L 2B2VC 5NUCA 1EWHA 3RZOH 1I6HH 1XPRA 1ILPA 2LXKA 3I8ZA 4TSSA 3KJPA 3PO2H 2E2HB 4ODGA 2C9OA 2HDLA 3BVZA 3UDXA 3CCUA 3FKIG 1SYBA 3CHBD 4O42A 4KJOA 3OOCA 2EYFA 4UDUC 1MJCA 3K7UC 4QGUA 1C9OA 4A3LH 5A2QE 1F9RA 1KRSA 3CD6A 1RHPA 4DR5Q 1IBMQ 3M4OH 4PQXA 1E3PA 3GTJB 1NMFA 2I5MX 4KHPQ 3CCSA 1LTAD 3HOYB 5EBDA 5JJLA 4OELB 3A7AB 2E5LQ 2XSCA 1B1ZA 2EYOA 5BN4A 3ULLA 5C44B 4HJ8A 1BCPB 4IUUA 2NN6H 3T16A 1DJRD 3NPPA 1VQGA 3NBHB 4CDDC 4OONA 2EE1A 3GTJH 2FINB 2VXWA 3NWTA 2ATWA 4BBSH 4IUQA 2Z1CA 3MXPA 1IBKL 1IKMA 4HCSA 2UXBL 1SNPA 3NELA 1X3EA 1LO5D 2PW7A 4IQZA 2CQOA 1HZAA 5IGBA 1XMOL 1JB7A 3FRPB 3MXUA 2HCCA 4KY6A 2KBNA 1SJED 1WTVA 3NTHA 1N32L 3KBGA 3K80C 4P74A 3QIAA 4QQBX 1JE5A 1SYEA 5CBAE 2I07B 2A74C 5C0XJ 1XYIA 2RCFA 2IJ0A 5C3WA 3GTMH 1QJOA 1F77A 3T1YQ 4JI7L 1MI2A 1STGA 3H0GH 5FO9B 3K58A 5M3MH 1R9TH 2ICIA 1BF4A 1L2FA 3B6YA 3KF8A 1E22A 2A68C 2F0IA 5G3LF 5COYA 3PIO3 3OMGA 3PF5A 3I73A 4RHRA 3S1QH 5IIFA 4JV5Q 2HIVA 3K81C 2B29A 1WD1A 1G51A 1JMCA 1AW7A 2OXPA 2VQFQ 1D1KA 4K14A 4P73A 2AUKA 4DR3L 3P1HA 2JJQA 2ZXOA 3P20A 3WDNA 4DR2L 5HURA 4LFAQ 1WJJA 1VQFA 1PTOD 3J7YW 2A6HD 1KDBA 1ENFA 4GN4B 3TQYA 3GD7A 4C2MB 4P2CB 2VZAA 3BU2A 4C3IH 4RH6A 4A76A 4FF1A 1LABA 2N49A 4C3IB 4FF3A 1EIFA 4FF4A 4ZK9B 4ZLTF 2QCPX 2XGTA 3CC2A 1S5ED 3KDFB 3KLSX 5FKAC 2EY6A 3ND8A 3G6JB 3NQTA 4DV4L 3KF8B 1G91A 1E24A 2OT2A 2PQAB 1JC7A 2EYPA 5C0XH 1FNVA 1TQOA 5EAYA 3EBEA 2YTYA 2JA9A 1HZCA 5KEEA 4MTKA 3S14H 1EY9A 1HFNA 1XMOQ 3K57A 3I4NB 1EU4A 2VY3A 4Q5VA 2A6HC 3I4NH 3OSOA 5JPMC 5FJ8H 2RVLA 1HQRD 2R7ZB 1SE3A 2HHHQ 2Z4HA 3E5SA 2XWBB 4CBVA 3HRZC 1Q12A 3K0YA 1VQJA 1TS2A 1PYWD 2J4XA 1FYCA 4BY7H 1Y69U 2EY1A 4L5RC 5HGQA 1N33L 2BOSA 3AFQA 4G4KA 5FLMH 1ICFB 3DMUA 4KI0A 4GLVB 3U9SA 4NP5A 4MTNA 1EOVA 1PH3A 3M4QA 3PUYA 4K6DA 2VQEQ 4S3SA 4ZUJA 5JEAJ 4KD4A 5CV6A 1EWCA 2NN6G 2EJFC 1HA5A 3KOJA 1L0WA 4F8MA 1UE7A 4GKKL 1SLJA 1X65A 2Q8IB 5J39A 4DR1L 4IZ8A 1I50B 2ZJPA 2Y0SE 4NXNQ 4GNXA 1STHA 4A3IB 1K3RA 1IL8A 1QOHA 1BCPF 1SN8A 4G7OC 3RZOB 1ZKOA 1YJ9A 1KD1C 1JJ2A 1JORA 1KNEA 1UUPA 4CJ0B 2R93B 1F9SA 1K0RA 2G9HD 3HKZE 2AMCB 2E2DC 4KKTA 5CORA 4BBRG 3PO2B 3H09A 2UUAL 4A3LG 2PI2A 1WD0A 4GKKQ 5D14A 1B9MA 4NXML 3ONAB 3S17H 1Y1VG 3HP3A 3TZUA 5CV4A 1VQLA 1IBLQ 3K6OA 1HR0L 4OWXB 1J5EL 3IFTA 1WTHA 1WCMB 5IY0A 4QUFA 1EIHA 2KEEA 1B3AA 4UHVA 3W5OA 4DR1Q 5IP9H 1IYUA 3GQBA 2N3SA 4EQNA 1IYJB 1V1PB 1KXLA 1E7ZA 2OTLA 3VYUA 2RKSA 4QL5A 4HMJA 4C3JH 3HOXG 1D5ZC 4LF4Q 4EQPA 4LFCQ 1FGUA 4BS9A 3CC7A 2R7FA 3HKZB 1DGSA 3S2DB 3BG3A 4OO1H 3CPWA 2F3VA 5BN3A 2EY2A 4BBRH 2V1CC 3RN2A 4LUOA 1CZWA 4K0KQ 1VQDA 1MKHA 4ZRZA 1JWUD 3F2UA 4X3UA 5DM73 3CC4A 3I4MB 1EL0A 4DUZQ 2LY7A 1I4QA 1A3UA 4JBWA 2EJGC 1VF5C 5ELCA 4GOPC 1VQOA 1BR9A 2DUDA 2WACA 2F0MA 4MNOA 2Q2UA 2O4XA 4F87A 3CAMA 2VL6A 2YU9H 1SYGA 1I4GA 1NCVA 3TREA 4K0KL 5BR8L 4JI5L 2Z6KA 3PF4A 3OWFA 2ALYB 4RWSC 3N6RA 4GKJL 1II3A 1JOQA 2L5TA 5ELOA 1K8GA 4LF5L 3OTOL 4Z9CB 5IWAL 3KBXA 1YVCA 1LTBD 3QOLA 3D4RA 3S2HB 2ZTDA 1PVOA 1VQ6A 3BZKA 4OL7A 4H44C 1CM9A 4IO9A 5IGGA 4DV5Q 3I4NG 2UUBQ 2EJMA 4F7XA 4B3ML 3RMHA 4UY8C 1GO3E 1I4XA 2KVMA 4Q0FA 1ICWA 1QVGA 1CKOA 4UP8A 4DV7Q 4X3KA 4DR3Q 4XYQA 2OTJA 1FL0A 1RTOA 4B9XA 1GHJA 1A2TA 4L6TB 1QE6A 3MXNA 4N8FA 2KENA 4IFDH 3CQZB 3A5ZB 2BCOA 2PQAA 2B2UA 2EYHA 1K28A 3NSWA 1KHIA 3CRKC 1SFOB 2N78A 4B3SL 2VS1A 3SDZA 4JI4Q 1LT5D 2XRQD 2ID0A 1O78A 3T1HQ 2GN5A 1QVCA 4XQQA 5EKKA 3CCJA 1YHBA 3MFYA 2A6EC 4A3JH 3MAQA 4JI4L 3HEJA 2E2HH 1S5FD 1MGSA 4R8NA 1AH9A 2BDOA 3H3VH 1X6OA 5CBEE 1EY5A 4X62Q 3T1YL 1MJEA 4OWTB 2WAQB 1PRTC 1YNXA 1RIPA 4R4IA 2F0JA 2RQXA 1U4RA 4EX5A 3ICEA 4PZ8A 2B2UC 3EFXD 1KAAA 2PPBC 2F0EA 5IGEA 5CV5A 2JEBI 2WINB 3JAMi 2B63B 4JYAL 2RSNA 2D5DA 2PQEA 4HSVA 1PH4A 5DEHA 3HOYH 4IFDI 4DV5L 1K83H 4IPHA 3CCEA 3V96A 1L0YB 2VW9A 2LMCB 1GUGA 1D5MC 3H6MA 2DY7A 1Q86C 5E3FA 1NY4A 1TWFB 3TMEA 1STBA 1NE3A 1HNXL 1E1TA 3S15H 2A6ED 1B4OA 3OPOA 3SK6A 4AH6A 1JWSD 3D4WA 4A3IG 4QB4A 1HPCA 2RA4A 3M9BA 1B2TA 2L55A 1X3GA 2JXMB 4OO1I 3DUZA 1S5BD 4LAAA 1RJTA 4DAYB 3JC66 1BOSA 3K7AB 3K8AA 1SEBD 4JPBW 1Q8KA 4OWWB 3H94A 2MPMA 2EYMA 2EVBA 5JVH3 4DV3Q 4B3TL 2I5HA 5JVG3 3S14B 3HOWG 4YWLA 3M7GA 1GHKA 1B44D 1U9RA 5M3FG 3I56A 4KHZA 5E4WC 2NTTA 2F0SA 1O7YA 3L7ZC 3J80L 1YJWA 2MJ8A 4BBSG 1LTRD 4XQJA 1A2UA 3OHXC 5M3MB 1Q82C 3SR1A 3U50C 1QUQA 2BH2A 2NN6I 2NBFA 3GTQH 3GTGH 3CRLC 1U4MA 1C4QA 4HSPA 1VQEA 3I70A 1VQNA 4MN3A 1TWGH 1PFMA 2ZXPA 3VR4A 3H0GB 2D0PA 4H0LC 1GJXA 4LF7L 2HCIA 2CKZB 2KEDA 2F0TA 4IUTA 3A7LA 2WAQG 1IBML 4JI2Q 2CQAA 4A3GH 2HQLA 2G9DA 3FKIB 5CV8A 5LHY1 4HIOA 3H91A 4A3DG 3GTQB 4LMQD 4OGQC 1TWGB 3NENA 2B63G 4DUYL 2GVAA 5I6YA 2JA8B 2K75A 2MFIA 4JI6L 2G5DA 2R92G 2DNCA 2UUAQ 1VQPA 4TKOB 3TP6A 2NZOA 4K8JA 2K5QA 4X3TA 2YU9B 3TSSA 1K3BC 1D7QA 1WCMG 2OF1A 5GAEC 4IN3A 1AE3A 1JQYD 3OIPA 1L1OA 2MHVA 3NWSA 1LV9A 5EPLA 5CC4A 3GTKB 1VCIA 3X3MA 1VQCA 4I7ZC 2IPKD 4KJNA 1T5XD 1YEZA 5C4JB 4C2MH 1CZGA 3URYA 3S9WA 4FP5D 3L2PA 4YWKA 1D6EC 4B3SQ 1PMRA 4JI0L 5A2QL 4L5SA 3E0JA 2JYOA 5K36H 3BS1A 1EYGA 3M4YA 3H3VI 4FO2A 5JPNC 3S1RH 3GTOH 1BXTA 5BN5A 4DR4Q 4DFAA 3WOFA 4A3FG 1HXYD 4RG1A 3J80c 4CDEC 1S72A 1AN8A 2AHOB 4C3JB 1PH2A 1VS0A 1TWHH 5CV9A 2K32A 3RR5A 4BBSB 1SXTA 3QR8A 4RA8A 3KF6A 4KY5A 1CQFA 4WRDA 2SNMA 2Q2IA 1AFPA 3ERQA 4WJ4A 4HIDA 1CHQD 1KAWA 3Q8DA 5IGCA 2RCNA 2EIFA 2VB2X 1F2LA 3AQQA 1PH9A 1V1OA 1F2MA 2TSSA 5I6WA 2KCNA 3QOJA 5EGTA 4LW1A 5C3EH 2F0PA 3KLRA 4TQUS 5LMNQ 1HUNA 1EY4A 1X9NA 2SEBD 4GOPB 2F0FA 4POGA 1JT8A 2QF7A 1EU3A 2F0DA 1PYBA 1GD7A 3MXNB 4LF5Q 3M4PA 1KLUD 2WKDA 1XNRQ 4A93H 3K0XA 4J15A 1I94L 4OIKA 1E0BA 3GTPB 4KK7A 3BYYB 4YY3Q 1Y1VB 4KD3A 3RUZA 1K8OA 4B3RQ 3GP7A 1U4PA 3RZDB 1PYSB 4XDXA 2K4KA 5EPJA 4K5XA 2L15A 1MSHA 3QJYA 2N55A 1CA5A 4J1MA 2D0OA 2GVBA 5C6AA 1VMCA 2L1BA 5ELFA 3BDLA 5IYBG 4H02A 1T5EA 4FXGC 5J3BA 4L63B 4RFBA 1WTWA 1PHJA 1LT4D 1PH5A 1K0SA 5M5XB 1DONA 1PLFA 3J80i 3A74A 3FHWA 3G48A 1MD2D 4BY1G 1HNWQ 5ISRA 1SFOH 3HOVH 1QUQB 3IKJA 5ELDA 4JI0Q 2EOTA 1HNWL 4DU9A 4IJLA 4N9TA 1S5CD 1JWMD 4AYBE 2FJ2A 1HA6A 1HHVA 3L3OC 4A3MH 4LUZA 1QG7A 4N9PA 3GTGB 1ONLA 1TU2B 1B9NA 3K5NA 1EQRA 3AMUA 4J8QA 1W6JA 4DR6Q 3HFZB 1PTOC 2CH4A 2I0QA 5GAHC 1FR3A 2QGQA 2R7ZH 2FFKB 1CK1A 2YV5A 3MZ5A 5IP7G 2F0NA 2X6GA 2WFWA 4DV6Q 3PGZA 2JA7G 2QEXA 2KA7A 3ER0A 4MZ9A 2ZJQA 5CMDA 3OTOQ 2FMMA 4GN3B 5C4XH 4CDFC 4X64Q 4R8IA 1IHZA 1EYCA 1SYDA 2A68D 2R7ZG 3S16H 3ULPA 3KLSA 2ASBA 1VQAA 3T56B 4IOCA 3E6ZX 1Q7YC 1AZQA 5JEAG 1G6PA 3GTKH 4DV0Q 3H15A 5LL6S 4FXDA 3VR2A 4DNIA 4JBKA 4R4OA 1PRTF 4LF9L 4A3FB 3DM1A 1DM0B 2PYKA 2R3ZA 2RDGA 4P72A 5KNCA 5IYDG 3EIVA 4O0AA 5C4JH 1K8AC 1E2ZA 3DWQA 4M1UB 4I65A 4GZYC 1S5DD 1T9HA 5CV7A 2F0VA 3W2DA 2JA5B 3DXJC 1YHAA 2JA5H 4H7BA 5KIXA 2F0KA 1D8LA 1H9RA 3S17B 3TZDA 4A3CH 3JAME 5C44H 4ZQ3A 1M4VA 4PNYA 2M9VA 1OTCA 3Q24A 1UE1A 1MSGA 2QILA 3MTSA 1OO9B 1B3QA 1YI2A 4LF8Q 3KUPA 4XTCS 2Z8LA 5JEAH 4PMBA 4DK6C 3C1FA 3CMAA 3SXHA 4BBRB 2FMCA 1CI3M 1A3VA 1SE2A 2YYZA 2JA8G 2ENBA 5IYCG 4U68A 3W3AA 3VYSA 1Y14B 2AQ2B 2H5XA 4JI1L 1SNOA 4WJWA 3PQIA 4B08A 1CHPD 5C3XA 1FGBD 4QY7A 4DK3C 2Q2HA 3PCOB 4F88A 3FEWX 1Z6HA 1EEFD 4KY7A 1M90C 1NMGA 3J81L 1LLRD 1SR3A 2I46A 2CHBD 2L4NA 1GUOA 4Y52H 1EQQA 3I72A 1JR0D 3C3LA 2SDFA 1PH8A 1IBLL 1AP0A 1H9SB 2ICEC 4LFAL 5E4XA 1CFMA 3GTPH 4YHHL 5G3LD 4A3EB 1FJGL 2LS01 4PZ7A 4CGYB 4JOIA 4A3EH 3I91A 1Y1VH 4DKAC 1TS5A 3CP0A 1XMQQ 1E1OA 4JK1C 1EQVA 5AJ3L 2PW5A 3S2HH 1DYQA 4HMIA 4PMWA 3Q23A 1TWFH 1YITA 2A1AA 3OWEB 1A15A 2EYJA 4NMZA 1KNAA 4DV7L 4DAMA 3HOZB 1ZEQX 4KLKA 4KV6A 2B39A 2K33A 1SJHD 5M5WH 2MGSA 3PV0A 5FLXL 1NBWA 1Q3LA 1G6ZA 3I90A 5IGDA 5IYBH 3HZXA 3KF6B 2BDNA 2QW7A 2KECA 2F4VL 2B3GA 4L5QA 2CVRA 5C4ZA 3PMFA 4NB3A 5K36G 3Q22A 3NE5B 2E5LL 3PO3G 4OO1G 1EFID 2NYZD 3OIQA 2MO0A 4HIKA 4ME3A 3W1GA 2OWOA 1PH7A 5FOBB 2F52A 5K5PA 3TDQA 4QIWB 4JI3Q 4GNXC 2UXBQ 5F2DA 1VQIA 2JA6H 2EY5A 4IOAA 5I4DA 2O2LD 1SMXA 4FF2A 4A93G 1X3PA 1U4LA 2NZHA 5CYUA 4ZKBB 1EY6A 1HFGA 3BJUA 4X64L 1X32A 5DAUA 1KIXA 1L1OB 4JVZA 2AQ1B 1UNSA 4BY1B 3R2TA 1M1KC 3LWEA 2B63H 1Y8OB 1EEID 3HKSA 1J8IA 1TT2A 1XTDA 2WB1E 3UDFA 3U4ZA 1VQBA 2V4DA 2B2YA 1K83B 3G4SA 3IL8A 2ZTCA 4PZ6A 5ELNA 2HDMA 2K01A 2FXQA 4DUZL 2EQSA 1NAPA 3HOUH 3M4OB 1W2BA 1N36Q 1X56A 2Q8RE 4JI6Q 2NVYB 5HGTA 1A8VA 1VMPA 3NBHA 2GA4B 4EQ5A 4LFBL 1BO0A 3AFPA 1N36L 4LF7Q 4OIJA 3PSIA 4B9WA 2IY5B 2RHQB 1HUMA 3FMCA 4KKUA 5JJZA 3F2CA 4JV5L 4CHTB 2VNUD 5IT9c 4X3SA 3I4LA 2PCFB 4HJ5A 5C4XB 1SAPA 2P5ZX 4JG2A 2HIXA 1DOMA 2K14A 1S3OA 4A3KB 1B7YB 4FXKC 1EOTA 3LGJA 1Q1BA 3S24A 5IT9E 2LXJA 5LMUQ 1I3QH 5E1FA 2FHTA 2NZ1D 2X6LA 3HOWH 4C3HB 4LFBQ 3AU7A 1CT1D 4HTHA 1R9TB 4BY7G 1J9OA 3CCRA 1Y8PB 1B50A 1N32Q 3OYYA 4RKBA 4DV3L 3CXCA 1H9JA 1KTKA 4LF9Q 4FDBA 1R4PB 5GROA 1PH6A 2F0WA 4XT3B 3GTLB 2UXCQ 1SNDA 3H0GG 3A54A 1VQ7A 3NK9A 1I4PA 2EZVA 2B2TC 1HZBA 3CCVA 5GADC 5LMNW 2DNEA 4JI8Q 5C0XG 2E75C 3S2DH 1BDOA 5C3EB 3VA7A 3HOYG 3SK5A 3PUZA 2VUMH 2WP8J 1TY0A 1OXSC 1VQ4A 1PV4A 5GAGC 2JN4A 1A63A 4JI3L 1EY7A 2KJXA 5FK9C 3PIOA 2NVTB 2BE5C 2Z0SA 2MNAA 4DV1Q 3PUXA 2IX1A 1TY2A 2CW0D 3CKIB 2K5VA 3G6EA 3EVQA 1S4ZA 3A0JA 4APVA 2RDFA 2RHSB 4QF4A 5L37A 1QZHA 1HTPA 4DV1L 5FLXE 1SMYD 1ML0D 2F4VQ 2Y0SG 1GUSA 1BCPD 2WIIB 4HIMA 4V190 5FLXc 3KYHC 1TVXA 3S1NB 5M5YH 3I4OA 2NVTH 1EWIA 1PTOH 3QG1A 1IXRA 5FO8B 4DK0A 3LX0A 2E2JB 5M3FH 1KDCA 2O5IC 3O13A 3T51B 4A3KG 4FNFA 1F2ZA 1F9QA 4CDCC 3J7AF 4IFDJ 1JOKA 1XX8A 3S1RB 3HOUG 5DNFA 4Y7NB 3EN2A 3PUWA 3TEHB 4YIJA 3I2ZA 5M5XH 2F0OA 4RGOS 1PZJD 4DK1A 1O7LA 4DR7Q 3AEVA 1OXXK 3PO2G 1O7ZA 2JE6I 1JB3A 2QDBA 2E2IB 1SMYC 5EBCA 3SEBA 1JJGA 1YBYA 2Z4IA 2B8GA 1ZYRD 2UUBL 1VQMA 4AYBB 2JA6G 2VQFL 1LT3D 2I5LX 1PFSA 2RF4A 4LF8L 4FYDA 1J5EQ 2KOLA 2EPBA 1GUWA 4K5VA 4M8AA 1C0AA 5CR3A 4AQYL 2O5JC 2J0TD 4J6HA 2UU9L 2NVXB 2ZJRA 1DOKA 3NEMA 1EFWA 1QNUA 5AFWA 2KQ3A 5JJKA 1D5XC 4ZAIA 2NWGA 4KN7C 4YCUA 3D3RA 3VR6A 4DN4M 2H4OA 5GQOA 4B3MQ 2AUJD 4YY3L 1GM5A 2OQKA 4LUVA 3AB9A 4JI2L 1U0LA 2AKWB 3F2BA 1F2YA 3HOUB 4ULLA 1G2SA 4IUPA 3I4MG 1YJNA 4L8JA 1HJPA 4P75A 5C4HA 4ALPA 2QEJC 3UI2A 5E7NA 1K8MA 3A56A 3S15B 3UE1A 4UPAA 1ASZA 2B2VA 5EQ0A 1Z47A 1SNQA 3K5MA 1HNZQ 3L9AX 3TRZA 2IHEA 4LF6L 4RAUC 2A19A 3HOWB 3DHQA 2F3IA 2XNAC 4BWGB 3M3YB 1ET6A 1WFQA 4NW2A 4DAYA 5C5LA 1CTMA 3DEOA 3K7AH 3KFUA 1ILQA 1TWAB 3HS0C 3RD4A 1CA6A 3C2PA 1QCBD 4JW0A 1HCZA 4QJFA 2L9HA 1CKMA 1SBBB 1Y8NB 1EIGA 1B70B 3S1MB 5TSSA 1V1PA 3A5UA 2HD3A 4CJ2C 3U4VA
chains in the Genus database with same CATH topology
3U9OA 2M2LA 5KNDA 3BVGA 1JE4A 1FNWA 1SYFA 5J22A 3P75A 5I2XA 4XT1B 3KK7A 1L0XB 3GTMB 4RKLA 1BQQT 3S1QB 4RCOA 3SVMA 3TP5A 1W6KA 1TS4A 2PO4A 1LTTD 4A3GB 3R93A 2MP1A 3NTKA 1UEAB 3SHLA 3JAML 1I4RA 2K1BA 3DWAA 3TN2A 1BUVT 1LT6D 1DOLA 2IW3A 3GV3A 1YNJD 1WTXA 4EVOA 2MUYA 2TMPA 1ESFA 3J7AV 1JICA 4G7ZC 1H9SA 2A73B 1YNND 2JEAI 2DN8A 5EJWA 1TWHB 2B2WC 1NSNS 1PTOF 2K28A 2XVSA 1A3TA 1GXDC 5KYLA 4XXEA 1RKNA 4DA2A 2K03A 2PZUA 3MVVA 1QNKA 1I4HA 4KMUC 2XWJB 1WTOA 3VR5A 5D3IB 1HTLD 1PFBA 4CKCA 5M5YB 2K5WA 4RHSA 1ESRA 3A55A 1HQMC 1TS3A 4MIUA 3TBIB 3NUCA 3VR3A 3NTIA 2L0CA 1DXMA 4C3IG 4V0BA 3EJIA 3MHBA 5JOBA 1H9KA 3Q6SA 4LK1C 1FNUA 1BBXC 4MHEA 4DXFA 1PZID 4ABNA 3D6CA 2EDGA 4K8IA 2WB1B 3MEHA 1XTCD 3PUVA 4BY7B 4C56C 4CKBA 3DWPA 1NR2A 1OXTA 4G57A 2M00A 1LTID 3J81E 4EGVA 3NBIA 2E76C 1AZPA 4HCEA 2F0LA 2HQEA 1FD7D 2ZT9C 3OW7A 2ZXRA 2D2CC 2OEOA 3NHHA 5C0XI 2R6GA 4RGNA 5A35A 3VYTA 1I3QB 1ENAA 4DGZA 4ME5A 3BZDB 5I2YA 3Q0AA 3SK4A 1PRTB 3FDTA 5J1ZA 3IAYA 1V43A 1XXGA 4WFN3 1G8ZD 1PZKD 3GO5A 2F3WA 1SNCA 3EROA 4NKLA 3FPPA 3A8IE 1Q90A 2K7VA 1M8AA 3QB3A 4PV1C 5LL6X 4EQOA 1YNJC 1C48A 2K04A 3D6WA 2N88A 2F0GA 1EYAA 1STAA 1I6VC 3TP8A 3MWYW 3G7LA 2D62A 1YNNC 2NVQB 3CU7A 2NB0A 1PTOB 3S16B 1GOZA 5M3FB 3MFGA 3RLFA 2K6AA 3GTOB 3QWNA 4R9WA 4PMCA 4G7HC 5D3DA 3HGBA 2BA0A 3H3VC 1BNZA 1E2WA 2H1EA 4XYOA 4A3BB 1RODA 2L11A 4ID6A 4RGTA 1X3QA 4H13C 2R61A 3ZYYX 5EPKA 1VDZA 1XWEA 2R92B 1EY8A 3ND9A 5IGFA 2F03A 1QILA 3DEPA 1JCKB 4BA1I 4CKEA 2LKVA 1PXUA 2J7ZA 2AWNA 1KDAA 3K5OA 2F1MA 2BA1A 2KHSA 1CQVA 2F4IA 4BA2I 4ZKCB 3M7NA 4XQNA 5ELEA 1DD2A 2L12A 3SE0A 4A3JB 1C8CA 4DF7A 4UAIA 5DM63 1TWCB 4RGMA 1ET9A 5T1GA 3D8GA 4KN4C 2HUGA 3A8KE 3N52A 2E74C 4QCLA 1SE4A 1MBYA 5ELBA 3BYTB 4ILWA 3D4DA 1Q1EA 3FVQA 1AEXA 2A69C 3NQIA 5T1IA 5KGUA 2RDHA 4HR7B 3PIP3 1IKLA 1SSOA 4IUVA 4KTAA 2NUCA 1OXUA 3PO3B 4NDXA 5I9OA 1D2BA 4WORA 4TRDA 2XIWA 1RCVD 3T4AC 1IW7C 1SNMA 2WKCA 3IFDA 1WTRA 2PNRC 1STEA 2VB3X 4CJ1B 3T13A 3NXWA 3X3NA 4KKSA 4C1NI 4DNRB 5I9PA 2DY8A 4OHJA 3D31A 5M5WB 2WV6D 1RDPD 2KUMA 1QWYA 1STNA 1E2VA 1WVLA 4E6IA 1ZYRC 2B2YC 3FPUB 1RTNA 1Q8IA 3BDOA 3HOXB 4HN7A 4A3MB 1TIID 3R3OA 1JOOA 2C5CA 2PZTA 1Z7TA 4DAPA 2SOBA 2SNSA 3I3CA 1O80A 1F9PA 3K59A 1KLGD 1WTPA 1TR5A 2JSOA 3EQLC 3C1EA 3WOEA 2IX0A 3BVMA 5KNBA 1PFNA 3R2IA 1UAPA 2B2WA 3OMCA 2VUMB 1B53A 1EY0A 1EZ6A 1NUCA 3V05A 2RSOA 2IWHA 1I6HB 4HEDA 2IL8A 1BCPC 1SYCA 2K05A 1IW7D 4QUCA 4K2KA 3V2TA 2X69A 3VYRA 1EQTA 2A5HA 4XIGS 4RCNA 2CW0C 1A6XA 1SDFA 2QKIC 2BE5D 3MXGA 3GV6A 4QMGA 3NP8A 1QB5D 3MC0B 2A69D 1R4QB 1HRJA 2B2TA 1ENCA 1OXVA 4DNTB 3EA6A 2Y0SB 1GUTA 1STYA 3ITPA 4LJZC 5FO7B 2F0QA 5M9OA 2PZWA 1DCZA 2RBMA 3QO2A 5CGKA 5IT9L 4IUNA 1LTSD 1RF2D 4FVMA 3A8JE 2F0UA 4C1NK 1GUNA 1V8QA 4IFDG 1G2TA 4A93B 3HG9A 2EXZA 5D65A 4C3JG 1H9MA 2JA7B 1NR4A 1Y1WB 1G291 1PRTD 2IX3A 1IYVA 2JP1A 5KRUA 1TKWB 3M85A 1WTQA 1PDQA 1EZ8A 3K5LA 5JAVA 2PMZB 4K6LA 2AWOA 4HAEA 3VA5A 2AQ3B 4ZUIA 1KABA 4IALA 3LWUA 2KCCA 4ZYSA 4K5WA 5EKLA 2D9UA 1EYDA 3J80E 1D1IA 2XN9C 4IURA 1LTGD 3T53B 5IOCA 1VF7A 3LNNA 2K5DA 1LACA 4KHVA 1RD9D 3P7JA 4A3DB 4K2LA 3C46A 5IODA 3MA2B 2IT1A 4C3HG 2JA6B 1DZ1A 5KYIA 2LFNA 1ZXTA 5EKIA 2EYLA 2Q8TA 2F0HA 2B8FA 3SK8A 3R8BA 3TP7A 4DXGA 2XRSD 4U673 4DAVA 2NTSA 5C5MA 3BDCA 4O1NA 3HOVB 2B2VC 5NUCA 1EWHA 1ILPA 3I8ZA 4TSSA 2E2HB 4ODGA 2C9OA 2HDLA 3BVZA 1SYBA 3CHBD 4KJOA 4O42A 3OOCA 2EYFA 4UDUC 5A2QE 1F9RA 1RHPA 4PQXA 3GTJB 1LTAD 3HOYB 5EBDA 3A7AB 2XSCA 1B1ZA 2EYOA 5BN4A 5C44B 1BCPB 4IUUA 2NN6H 3T16A 1DJRD 3NPPA 2EE1A 2FINB 2VXWA 3NWTA 4IUQA 2Z1CA 3MXPA 1IKMA 4HCSA 1SNPA 1LO5D 2PW7A 4IQZA 5IGBA 3FRPB 3MXUA 2HCCA 4KY6A 1WTVA 1SJED 3NTHA 3KBGA 3QIAA 5CBAE 1SYEA 2I07B 2A74C 5C0XJ 1XYIA 2IJ0A 5C3WA 1QJOA 1F77A 1MI2A 1STGA 5FO9B 3K58A 2ICIA 1BF4A 3KF8A 2A68C 2F0IA 5G3LF 5COYA 3PIO3 3OMGA 3I73A 4RHRA 5IIFA 1WD1A 1AW7A 2OXPA 1D1KA 4K14A 2AUKA 3P1HA 2ZXOA 3P20A 3WDNA 5HURA 1PTOD 3J7YW 2A6HD 1KDBA 1ENFA 3GD7A 4C2MB 4P2CB 4RH6A 4FF1A 1LABA 4C3IB 4FF3A 4FF4A 4ZK9B 4ZLTF 2QCPX 1S5ED 3KLSX 5FKAC 2EY6A 3ND8A 3G6JB 3NQTA 1G91A 2OT2A 1JC7A 2EYPA 5C0XH 1FNVA 1TQOA 5KEEA 1EY9A 1HFNA 3K57A 3I4NB 1EU4A 4Q5VA 2A6HC 3OSOA 5JPMC 2RVLA 1HQRD 2R7ZB 1SE3A 2Z4HA 3E5SA 2XWBB 4CBVA 3HRZC 1Q12A 3K0YA 2J4XA 1TS2A 1PYWD 1FYCA 1Y69U 2EY1A 2BOSA 4G4KA 3DMUA 4KI0A 3U9SA 4NP5A 3PUYA 4K6DA 4S3SA 4ZUJA 5JEAJ 4KD4A 5CV6A 1EWCA 2NN6G 2EJFC 1HA5A 4F8MA 2Q8IB 5J39A 4IZ8A 1I50B 1STHA 4A3IB 1IL8A 1QOHA 1BCPF 4G7OC 3RZOB 1ZKOA 1JORA 1UUPA 1KNEA 4CJ0B 2R93B 1F9SA 2G9HD 5CORA 2E2DC 4KKTA 3PO2B 3H09A 1WD0A 5D14A 1B9MA 3ONAB 3HP3A 3TZUA 5CV4A 3K6OA 3IFTA 1WCMB 4QUFA 1EIHA 2KEEA 1B3AA 1IYUA 3GQBA 4EQNA 1V1PB 3VYUA 2RKSA 4HMJA 1D5ZC 4EQPA 4BS9A 3HKZB 3S2DB 3BG3A 4OO1H 2F3VA 5BN3A 2EY2A 1CZWA 4ZRZA 1JWUD 3F2UA 4X3UA 5DM73 3I4MB 1EL0A 2LY7A 1I4QA 1A3UA 4JBWA 2EJGC 1VF5C 5ELCA 1BR9A 2WACA 2F0MA 2O4XA 4F87A 1SYGA 1I4GA 1NCVA 3OWFA 4RWSC 3N6RA 1II3A 1JOQA 2L5TA 4Z9CB 3KBXA 1LTBD 3QOLA 3D4RA 3S2HB 4OL7A 4H44C 1CM9A 5IGGA 2EJMA 4F7XA 3RMHA 1I4XA 2KVMA 4Q0FA 1ICWA 4X3KA 4XYQA 1RTOA 4B9XA 1GHJA 1A2TA 4L6TB 1QE6A 3MXNA 4IFDH 3CQZB 2BCOA 2B2UA 2EYHA 3NSWA 3CRKC 1SFOB 3SDZA 1LT5D 2XRQD 2ID0A 1O78A 4XQQA 5EKKA 3MFYA 2A6EC 3MAQA 3HEJA 1S5FD 1MGSA 4R8NA 2BDOA 5CBEE 1EY5A 2WAQB 1PRTC 2F0JA 2RQXA 1U4RA 2B2UC 3EFXD 1KAAA 2PPBC 2F0EA 5IGEA 5CV5A 2JEBI 2WINB 2B63B 2RSNA 2D5DA 2PQEA 4HSVA 5DEHA 4IFDI 3V96A 1L0YB 2LMCB 1GUGA 1D5MC 3H6MA 2DY7A 5E3FA 1TWFB 3TMEA 1STBA 2A6ED 1B4OA 3OPOA 3SK6A 1JWSD 3D4WA 4QB4A 1HPCA 2RA4A 1B2TA 2L55A 2JXMB 4OO1I 3DUZA 1S5BD 4LAAA 1RJTA 1BOSA 3K7AB 1SEBD 3H94A 2MPMA 2EYMA 2EVBA 5JVH3 3S14B 5JVG3 3M7GA 1GHKA 1B44D 1U9RA 4KHZA 5E4WC 2NTTA 2F0SA 1O7YA 3L7ZC 3J80L 2MJ8A 1LTRD 4XQJA 1A2UA 3OHXC 5M3MB 3SR1A 2NN6I 2NBFA 3CRLC 1U4MA 1C4QA 4HSPA 3I70A 4MN3A 1PFMA 2ZXPA 3VR4A 3H0GB 4H0LC 1GJXA 2HCIA 2KEDA 2F0TA 3A7LA 4IUTA 2CQAA 2G9DA 3FKIB 5CV8A 5LHY1 3H91A 3GTQB 4LMQD 4OGQC 1TWGB 5I6YA 2JA8B 2DNCA 4TKOB 3TP6A 4K8JA 2K5QA 4X3TA 2YU9B 3TSSA 2OF1A 4IN3A 1JQYD 3OIPA 2MHVA 3NWSA 1LV9A 5EPLA 5CC4A 3GTKB 1VCIA 3X3MA 4I7ZC 2IPKD 4KJNA 1T5XD 5C4JB 1CZGA 3URYA 3S9WA 4FP5D 1D6EC 1PMRA 5A2QL 3E0JA 2JYOA 5K36H 3BS1A 3M4YA 4FO2A 5JPNC 1BXTA 5BN5A 4DFAA 3WOFA 1HXYD 1AN8A 4C3JB 5CV9A 2K32A 4BBSB 1SXTA 4RA8A 4KY5A 1CQFA 4WRDA 2SNMA 1AFPA 3ERQA 1CHQD 5IGCA 2VB2X 1F2LA 1V1OA 1F2MA 2TSSA 5I6WA 2KCNA 3QOJA 5EGTA 2F0PA 3KLRA 4TQUS 1HUNA 1EY4A 2SEBD 2F0FA 2QF7A 1EU3A 2F0DA 1KLUD 2WKDA 4OIKA 1E0BA 3GTPB 4KK7A 3BYYB 1Y1VB 4KD3A 3RUZA 1K8OA 3GP7A 1U4PA 3RZDB 4XDXA 5EPJA 4K5XA 1MSHA 3QJYA 2N55A 1CA5A 4J1MA 5C6AA 1VMCA 2L1BA 5ELFA 3BDLA 1T5EA 4FXGC 1WTWA 4L63B 4RFBA 1LT4D 5M5XB 1DONA 1PLFA 1MD2D 5ISRA 3IKJA 5ELDA 2EOTA 4DU9A 4N9TA 1S5CD 1JWMD 2FJ2A 1HA6A 1HHVA 3L3OC 1QG7A 4N9PA 3GTGB 1ONLA 1TU2B 1B9NA 3K5NA 3AMUA 4J8QA 1W6JA 1PTOC 1FR3A 2FFKB 1CK1A 3MZ5A 2F0NA 2X6GA 2KA7A 5CMDA 2FMMA 4R8IA 1IHZA 1EYCA 1SYDA 2A68D 3KLSA 3T56B 3E6ZX 1AZQA 5JEAG 5LL6S 4FXDA 3VR2A 1PRTF 4A3FB 3DM1A 1DM0B 2PYKA 2R3ZA 2RDGA 5KNCA 1E2ZA 3DWQA 4M1UB 4I65A 4GZYC 1S5DD 5CV7A 2JA5B 2F0VA 3W2DA 3DXJC 4H7BA 5KIXA 2F0KA 1H9RA 3S17B 3TZDA 3JAME 4ZQ3A 1M4VA 4PNYA 2M9VA 3Q24A 1MSGA 2QILA 3MTSA 1OO9B 3KUPA 4XTCS 2Z8LA 5JEAH 4PMBA 3C1FA 3SXHA 4BBRB 2FMCA 1CI3M 1A3VA 1SE2A 2YYZA 2ENBA 4U68A 3W3AA 3VYSA 2AQ2B 1SNOA 4WJWA 4B08A 1CHPD 5C3XA 1FGBD 4F88A 3FEWX 1Z6HA 1EEFD 4KY7A 3J81L 1LLRD 2I46A 2CHBD 2L4NA 1GUOA 3I72A 1JR0D 3C3LA 2SDFA 1AP0A 1H9SB 2ICEC 5E4XA 1CFMA 5G3LD 4A3EB 2LS01 4CGYB 3I91A 1TS5A 4JK1C 1EQVA 2PW5A 1DYQA 4HMIA 4PMWA 3Q23A 3OWEB 1A15A 2EYJA 4NMZA 1KNAA 3HOZB 1ZEQX 4KV6A 2B39A 2K33A 1SJHD 2MGSA 3PV0A 5FLXL 1Q3LA 1G6ZA 3I90A 5IGDA 3HZXA 2BDNA 2KECA 2CVRA 5C4ZA 3PMFA 5K36G 3Q22A 3NE5B 4OO1G 1EFID 2NYZD 3OIQA 5FOBB 5K5PA 3TDQA 4QIWB 5F2DA 2EY5A 5I4DA 2O2LD 4FF2A 1X3PA 1U4LA 5CYUA 4ZKBB 1EY6A 1HFGA 1X32A 5DAUA 2AQ1B 1UNSA 4BY1B 3R2TA 3LWEA 1Y8OB 1EEID 1J8IA 1TT2A 2V4DA 2B2YA 1K83B 3IL8A 2HDMA 2K01A 1NAPA 3M4OB 2Q8RE 2NVYB 5HGTA 1VMPA 3NBHA 2GA4B 1BO0A 4OIJA 4B9WA 1HUMA 3FMCA 4KKUA 5JJZA 4CHTB 2VNUD 4X3SA 3I4LA 2PCFB 5C4XB 1SAPA 1DOMA 4A3KB 4FXKC 1EOTA 5IT9E 1Q1BA 5E1FA 2FHTA 2NZ1D 2X6LA 4C3HB 3AU7A 1CT1D 4HTHA 1R9TB 1J9OA 1Y8PB 1B50A 4RKBA 1H9JA 1KTKA 1R4PB 2F0WA 4XT3B 3GTLB 1SNDA 3A54A 3NK9A 1I4PA 2EZVA 2B2TC 2DNEA 5C0XG 2E75C 1BDOA 5C3EB 3VA7A 3SK5A 3PUZA 2WP8J 1TY0A 1OXSC 1EY7A 2KJXA 5FK9C 2NVTB 2BE5C 3PUXA 2IX1A 1TY2A 2CW0D 3CKIB 3EVQA 1S4ZA 2RDFA 4QF4A 1HTPA 5FLXE 1SMYD 1ML0D 1GUSA 1BCPD 2WIIB 4V190 1TVXA 3S1NB 1PTOH 3QG1A 5FO8B 4DK0A 3LX0A 2E2JB 1KDCA 2O5IC 3O13A 3T51B 4FNFA 1F2ZA 1F9QA 3J7AF 4IFDJ 1JOKA 1XX8A 3S1RB 5DNFA 4Y7NB 3PUWA 4YIJA 2F0OA 4RGOS 1PZJD 4DK1A 1O7LA 1OXXK 1O7ZA 2JE6I 1JB3A 2QDBA 2E2IB 1SMYC 5EBCA 3SEBA 2Z4IA 2B8GA 1ZYRD 4AYBB 1LT3D 4FYDA 2KOLA 2EPBA 1GUWA 4K5VA 4M8AA 5CR3A 2O5JC 2J0TD 4J6HA 2NVXB 1DOKA 1QNUA 5AFWA 2KQ3A 1D5XC 4ZAIA 2NWGA 4KN7C 3D3RA 3VR6A 4DN4M 2H4OA 2AUJD 3AB9A 1F2YA 3HOUB 4ULLA 1G2SA 4IUPA 4L8JA 5C4HA 3UI2A 2QEJC 1K8MA 3A56A 3S15B 2B2VA 5EQ0A 1Z47A 1SNQA 3K5MA 3L9AX 4RAUC 3HOWB 3DHQA 2XNAC 4BWGB 3M3YB 1ET6A 4NW2A 4DAYA 5C5LA 1CTMA 3DEOA 1TWAB 1ILQA 3HS0C 3RD4A 1CA6A 3C2PA 1QCBD 1HCZA 2L9HA 1SBBB 1Y8NB 1EIGA 3S1MB 5TSSA 1V1PA 4CJ2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJX A;  1DXM A;  2NN6 H;  3LWU A;  4JK1 C;  4PV1 C;  2KCC A;  3A8K E;  5C0X H;  2QF7 A;  5KND A;  3A7L A;  3MFY A;  1H9K A;  1YNJ C;  1IW7 D;  2E74 C;  2A6E C;  2A68 D;  4DK1 A;  1O7L A;  4XIG S;  3T56 B;  1OXX K;  1Q1B A;  5JEA G;  2BDO A;  2JE6 I;  3BG3 A;  1Q1E A;  4LK1 C;  4RCN A;  2K33 A;  2A6H C;  2CW0 C;  4OO1 H;  1I6V C;  1SMY C;  5BN3 A;  3T53 B;  2A69 C;  3PV0 A;  4OGQ C;  1VF7 A;  3LNN A;  3VR2 A;  1A6X A;  4IQZ A;  2B8G A;  2BE5 D;  5KNC A;  4HR7 B;  1K8O A;  2DNC A;  2D62 A;  1YNN C;  3MXU A;  1E2Z A;  1LAC A;  1Y8P B;  4TKO B;  2PPB C;  1OXU A;  1Q12 A;  2JEB I;  2EDG A;  3QIA A;  3QJY A;  4GZY C;  1FYC A;  2A69 D;  1H9J A;  2D5D A;  3DXJ C;  1Y69 U;  3PUV A;  2IT1 A;  4JBW A;  2EJG C;  1OXV A;  1VF5 C;  3RLF A;  4DNT B;  2O5J C;  1QJO A;  1VCI A;  4KI0 A;  5K36 G;  1H9R A;  3NE5 B;  4OO1 G;  4G7H C;  1T5E A;  4I7Z C;  1GUT A;  3U9S A;  3HGB A;  1IW7 C;  2LMC B;  2BA0 A;  1GUG A;  1OXT A;  3PUY A;  2B8F A;  1E2W A;  2PNR C;  4LJZ C;  4KN7 C;  2DNE A;  1DCZ A;  1PMR A;  2A68 C;  2A6E D;  5C0X G;  3VR6 A;  2E76 C;  2E75 C;  4XTC S;  2NN6 G;  3OPO A;  4KKS A;  4DNR B;  5JEA H;  5K36 H;  2EJF C;  4TQU S;  1BDO A;  2AUJ D;  3VA7 A;  1HPC A;  3N6R A;  3D31 A;  3M4Y A;  4H13 C;  2L5T A;  3I73 A;  3PUZ A;  2Q8I B;  3AB9 A;  3A8J E;  1VDZ A;  4G7Z C;  1OXS C;  1CI3 M;  1H9S A;  2JXM B;  5BN5 A;  2YYZ A;  3IKJ A;  1EWH A;  2JEA I;  3D4R A;  1E2V A;  3ND9 A;  2DN8 A;  2ZT9 C;  1GUN A;  1V8Q A;  4IFD G;  4L8J A;  2BE5 C;  3OW7 A;  1ZYR C;  1ZKO A;  3W3A A;  4G7O C;  2D2C C;  2K32 A;  3H94 A;  2EVB A;  4BA1 I;  4H44 C;  2AUK A;  1K8M A;  3BDO A;  1Y8O B;  3PUX A;  4KKT A;  1GHK A;  3P20 A;  2R6G A;  3WDN A;  5A35 A;  1ONL A;  1TU2 B;  2EJM A;  2V4D A;  1B9N A;  1H9M A;  4KHZ A;  1Z6H A;  3OOC A;  1Z7T A;  1HTP A;  2F1M A;  3L7Z C;  2BA1 A;  1G29 1;  1IYV A;  1GUO A;  1FR3 A;  1GUS A;  2A6H D;  1B9M A;  4BA2 I;  3M7N A;  4KMU C;  3TZU A;  3GD7 A;  1TKW B;  3I72 A;  3M85 A;  1CTM A;  1DD2 A;  1V43 A;  1GHJ A;  3SE0 A;  3VR5 A;  1H9S B;  1LAB A;  3QG1 A;  3IFT A;  4DK0 A;  3EQL C;  1HCZ A;  4IFD H;  1CFM A;  2NN6 I;  2O5I C;  2KA7 A;  3PUW A;  3CRL C;  5KNB A;  3KLR A;  1Y8N B;  3T51 B;  1HQM C;  3FPP A;  1IYU A;  3A8I E;  3A7A B;  3CRK C;  3FMC A;  3GQB A;  3ND8 A;  4KKU A;  1Q90 A;  3SDZ A;  2AWO A;  3VR3 A;  3I4L A;  2K7V A;  5BN4 A;  1O78 A;  2PCF B;  3VR4 A;  4KN4 C;  4H0L C; 
#chains in the Genus database with same CATH topology
 3U9O A;  2M2L A;  5KND A;  1N34 Q;  3BVG A;  1JE4 A;  1FNW A;  1SYF A;  2DJG C;  4R4T A;  5J22 A;  3P75 A;  3G71 A;  4JCV E;  5I2X A;  4XT1 B;  3KK7 A;  1L0X B;  3ZJY C;  3GTM B;  3D0F A;  4RKL A;  1BQQ T;  3S1Q B;  1K73 C;  1SE8 A;  4RCO A;  3SVM A;  4LF4 L;  2JA8 H;  3WWV A;  1VQK A;  4C3H H;  3TP5 A;  1KC8 C;  1W6K A;  1TS4 A;  3I4M H;  4DV2 L;  2PO4 A;  1LTT D;  4A3G B;  3R93 A;  2MP1 A;  3NTK A;  4DUY Q;  1UEA B;  3SHL A;  3JAM L;  1MHW C;  3CCM A;  1Y1W H;  1X54 A;  4A3C G;  1I4R A;  1WYD A;  2YTV A;  2K1B A;  2UXD Q;  2NVY H;  3S1N H;  3DWA A;  3TN2 A;  1BUV T;  1LT6 D;  4HJ7 A;  1DOL A;  2UUC L;  2IW3 A;  3GV3 A;  1YNJ D;  2E2J H;  4YCW A;  3STB D;  1WTX A;  4X62 L;  4EVO A;  2MUY A;  2TMP A;  1ESF A;  3J7A V;  1JIC A;  1GKH A;  4G7Z C;  4A3E G;  1VQ8 A;  1H9S A;  2A73 B;  1YNN D;  2JEA I;  2DN8 A;  5EJW A;  1TWH B;  4R4C A;  3T1H L;  2B2W C;  1NSN S;  1VQ5 A;  1N34 L;  1PTO F;  2K28 A;  2ZM6 Q;  3RZD H;  2XVS A;  1A3T A;  1GXD C;  4JI1 Q;  5IP9 G;  5KYL A;  4XXE A;  1RKN A;  5FJ8 G;  4DA2 A;  2K03 A;  2PZU A;  3MVV A;  1WOC A;  3UDI A;  4JI7 Q;  1C7Y A;  1QNK A;  1I4H A;  3SGI A;  4KMU C;  5LMN L;  2XWJ B;  1WTO A;  3VR5 A;  5D3I B;  1PFB A;  1HTL D;  4CKC A;  5M5Y B;  1YIJ A;  2K5W A;  1X55 A;  4RHS A;  4UP7 A;  1ESR A;  5IYC H;  3A55 A;  4ZCK A;  5IP7 H;  1N33 Q;  1EIY B;  2MO1 A;  1HQM C;  1MIU A;  1TS3 A;  1I94 Q;  4MIU A;  3TBI B;  3NUC A;  3VR3 A;  3NTI A;  2L0C A;  1DXM A;  4C3I G;  4V0B A;  4HJ9 A;  1H95 A;  4B3T Q;  3EJI A;  3MHB A;  5JOB A;  1H9K A;  2LSS A;  1JJC B;  2K5H A;  3Q6S A;  4A75 A;  3CQZ H;  3I55 A;  5C44 G;  4LK1 C;  1FNU A;  1BBX C;  2UXC L;  4AIM A;  4MHE A;  3U58 A;  5JJI A;  3JAM c;  3J81 i;  4DXF A;  2JA5 G;  3HOV G;  4DR2 Q;  3E3X A;  1PZI D;  3DLL A;  1SRU A;  2QDL A;  4ABN A;  4BY1 H;  2R93 H;  3D6C A;  2EDG A;  4K8I A;  5FLM G;  4KHP L;  2WB1 B;  2ZM6 L;  3MEH A;  1XTC D;  3PUV A;  1WI5 A;  2DJF C;  4JBJ A;  4BY7 B;  4C56 C;  2C35 B;  2K50 A;  2XTI A;  1S40 A;  4CKB A;  2NVX H;  1J6Q A;  3DWP A;  1NR2 A;  1OXT A;  4G57 A;  2M00 A;  1LTI D;  3HOZ G;  3J81 E;  4EGV A;  3NBI A;  2E76 C;  1XJV A;  1AZP A;  4HCE A;  1ASY A;  2F0L A;  2HQE A;  1FVI A;  1FD7 D;  1I50 H;  1RL2 A;  4IPG A;  1VQH A;  2ZT9 C;  3OW7 A;  2ZXR A;  2D2C C;  2OEO A;  1O7I A;  4A3K H;  3NHH A;  4YCV A;  5C0X I;  2R6G A;  4RGN A;  5A35 A;  3VYT A;  1I3Q B;  3S1M H;  1XPO A;  3GDE A;  1ENA A;  4DGZ A;  3OW2 A;  1AE2 A;  1YHQ A;  1CKN B;  4ME5 A;  3BZD B;  5HY6 A;  5I2Y A;  1P8L A;  2CWA A;  1CUK A;  3Q0A A;  3SK4 A;  1PRT B;  3FDT A;  4HJA A;  4L5T A;  5J1Z A;  3IAY A;  3RLN A;  4A3M G;  1V43 A;  3TS2 A;  1XXG A;  4WFN 3;  1G8Z D;  1PZK D;  3CCL A;  3GO5 A;  2Z6B A;  2F3W A;  2WB1 G;  3L0O A;  1SNC A;  2Z9H A;  4R1J A;  3PIP A;  3ERO A;  4NKL A;  1BKB A;  3FPP A;  3A8I E;  4R4Q A;  1Q90 A;  1P16 A;  2K7V A;  2HT1 A;  1PA6 A;  5BR8 Q;  1M8A A;  3QB3 A;  4PV1 C;  5LL6 X;  1YZ6 A;  4EQO A;  3STB C;  1YNJ C;  2VUM G;  1UE6 A;  1C48 A;  2K04 A;  1XNR L;  2CWP A;  3D6W A;  4A4I A;  4A3B G;  2N88 A;  4DR5 L;  2F0G A;  3FKI H;  1EYA A;  1STA A;  1I6V C;  4A3F H;  3AYH B;  4YWM A;  3TP8 A;  5M3M G;  3MWY W;  2VQE L;  3G7L A;  1HR0 W;  1HNZ L;  2D62 A;  1YNN C;  1LM0 A;  2NVQ B;  3CU7 A;  2NVQ H;  2NB0 A;  1PTO B;  2A8V A;  3S16 B;  1UWV A;  1GOZ A;  5M3F B;  3MFG A;  4DV4 Q;  2KHI A;  1KL9 A;  3RLF A;  2K6A A;  3GTO B;  3QWN A;  3RLO A;  4DV6 L;  4R9W A;  4PMC A;  4G7H C;  5D3D A;  4JI5 Q;  3KLW A;  4Y7N H;  3HGB A;  1IL2 A;  2YTX A;  3M3Y H;  2BA0 A;  3H3V C;  1BNZ A;  1E2W A;  4X65 Q;  4GOP A;  2H1E A;  4XYO A;  4A3B B;  1WCM H;  2ZTE A;  4DR6 L;  1ROD A;  2OQ0 A;  2L11 A;  4ID6 A;  4RGT A;  3I7F A;  3HKZ G;  4LWC A;  1X3Q A;  4H13 C;  2R61 A;  2IHF A;  3CF5 A;  3FP9 A;  2R92 H;  3ZYY X;  5EPK A;  1VDZ A;  1XWE A;  1HH2 P;  4BXX H;  2R92 B;  3J81 j;  1EY8 A;  3ND9 A;  5IGF A;  2F03 A;  1QIL A;  3DEP A;  1JCK B;  2CFM A;  4BA1 I;  4A3D H;  4A3B H;  4A3G G;  4CKE A;  4AQY Q;  3J81 c;  1BVS A;  2LKV A;  1PXU A;  1TWC H;  1LTL A;  2J7Z A;  5LMU L;  2AWN A;  1KDA A;  1Q46 A;  3K5O A;  4X66 Q;  2F1M A;  2BA1 A;  2KHS A;  1CQV A;  2F4I A;  4BA2 I;  4ZKC B;  3M7N A;  2OCE A;  4XQN A;  5ELE A;  1DD2 A;  2L12 A;  4JOI C;  3SE0 A;  4A3J B;  4DR4 L;  4AYB G;  4OEM B;  4NXM Q;  1C8C A;  4DF7 A;  4UAI A;  2UXD L;  1I5F A;  4OXP A;  5DM6 3;  4GN5 A;  1K9M C;  1TWC B;  4BXX G;  4RGM A;  2UUC Q;  1ET9 A;  5T1G A;  3D8G A;  4KN4 C;  1SRO A;  2HUG A;  4B3R L;  1NJI C;  3A8K E;  3N52 A;  2E74 C;  4QCL A;  1SE4 A;  1MBY A;  1LUZ A;  1QZG A;  5ELB A;  3KJO A;  3BYT B;  4ILW A;  3D4D A;  2MQH A;  1Q1E A;  3FVQ A;  4X66 L;  1AEX A;  1LYL A;  3UDG A;  2A69 C;  3NQI A;  5T1I A;  5KGU A;  2RDH A;  4HR7 B;  3PIP 3;  2KCT A;  1IKL A;  1SSO A;  4IUV A;  4KTA A;  2NUC A;  3PO3 H;  1OXU A;  3PO3 B;  4NDX A;  5I9O A;  2R7D A;  1D2B A;  4WOR A;  3HOZ H;  4RMF A;  4TRD A;  2XIW A;  1RCV D;  2CH4 W;  4IJH A;  1UE5 A;  3T4A C;  1IW7 C;  1SNM A;  2WKC A;  2N8N A;  3IFD A;  1WTR A;  1GVP A;  2PNR C;  1STE A;  3CPF A;  4X65 L;  2VB3 X;  2HHH L;  4CJ1 B;  3T13 A;  3NXW A;  1U5K A;  2BH8 A;  3CME A;  3X3N A;  2ES2 A;  4KKS A;  4C1N I;  4DNR B;  5I9P A;  2DY8 A;  4OHJ A;  1Z9F A;  3D31 A;  5IE8 A;  5M5W B;  2WV6 D;  1RDP D;  2KUM A;  1QWY A;  1STN A;  1E2V A;  1WVL A;  4O2D A;  4E6I A;  3F2D A;  1ZYR C;  2B2Y C;  3FPU B;  1RTN A;  1Q8I A;  3BDO A;  1CKN A;  3HOX B;  4HN7 A;  4A3M B;  1TII D;  3R3O A;  2E2I H;  1JOO A;  2JQO A;  2C5C A;  2PZT A;  1Z7T A;  4DAP A;  2SOB A;  2SNS A;  3UE0 A;  3I3C A;  1O80 A;  1F9P A;  1L1O C;  4P71 A;  3K59 A;  1KLG D;  1WTP A;  1HNX Q;  1TR5 A;  2JSO A;  4IPD A;  4UP9 A;  1CSP A;  3ERS X;  5C4X G;  3EQL C;  1V9P A;  3C1E A;  3WOE A;  2IX0 A;  3BVM A;  5KNB A;  1PFN A;  4WJ3 M;  3R2I A;  4TVA B;  1UAP A;  2B2W A;  3OMC A;  2VUM B;  1B53 A;  1QVF A;  1EY0 A;  1EZ6 A;  1V1Q A;  1NUC A;  3V05 A;  4A3I H;  2RSO A;  2IWH A;  1I6H B;  4HED A;  3BZC A;  2IL8 A;  1BCP C;  1SYC A;  2K05 A;  4JYA Q;  1IW7 D;  1BBU A;  3IRB A;  4QUC A;  4K2K A;  3V2T A;  2X69 A;  3VYR A;  1EQT A;  2A5H A;  4XIG S;  3RNU A;  4RCN A;  2CW0 C;  2PMZ E;  3J7Z C;  1A6X A;  1SDF A;  1IZ6 A;  2QKI C;  2BE5 D;  1XPU A;  3MXG A;  3CW2 C;  1HR0 Q;  1EUJ A;  3GV6 A;  4QMG A;  4DV2 Q;  2R93 G;  2UU9 Q;  1TWA H;  3E0E A;  3E9I A;  3NP8 A;  1QB5 D;  3MC0 B;  2A69 D;  2K52 A;  1R4Q B;  1HRJ A;  1B8A A;  2B2T A;  1ENC A;  2E8G A;  3GTL H;  1OXV A;  1NTG A;  4DNT B;  2WAQ E;  3TS0 A;  4GNX B;  2CCZ A;  3EA6 A;  2Y0S B;  1GUT A;  1Y1W G;  3F8T A;  1HZ9 A;  1STY A;  5IYD H;  3ITP A;  4LJZ C;  5FO7 B;  2F0Q A;  5M9O A;  4A3J G;  2KHJ A;  2PZW A;  1BBW A;  1DCZ A;  1CSQ A;  2RBM A;  4GLA C;  3QO2 A;  4NXN L;  1A62 A;  5CGK A;  5IT9 L;  4X6A H;  4IUN A;  1LTS D;  1RF2 D;  4FVM A;  3A8J E;  2F0U A;  1KRT A;  5IWA Q;  1IBK Q;  4C1N K;  1N8R C;  1GUN A;  1V8Q A;  4IFD G;  1G2T A;  2Q2T A;  4A93 B;  3HG9 A;  2EXZ A;  5D65 A;  4C3J G;  3E9H A;  2JA7 H;  2JK8 A;  4LNQ A;  4DV0 L;  5AJ3 Q;  1H9M A;  2PNH A;  3MEF A;  2JA7 B;  4LF6 Q;  1NR4 A;  1Y1W B;  1G29 1;  1PRT D;  2IX3 A;  1IYV A;  3DM3 A;  2JP1 A;  5KRU A;  1TKW B;  3M85 A;  1FJG Q;  1WTQ A;  1PDQ A;  1PH1 A;  4JBM A;  1EZ8 A;  4GKJ Q;  3K5L A;  2K5N A;  5JAV A;  5C3E G;  1Q81 C;  2EXD A;  2PMZ B;  4IPC A;  1XNQ L;  4K6L A;  2AWO A;  4JI8 L;  4NPS A;  1XMQ L;  1X3F A;  4HAE A;  2PI2 E;  4PG3 A;  3VA5 A;  2AQ3 B;  4ZUI A;  1KAB A;  3KDF A;  4IAL A;  3LWU A;  4YHH Q;  2KCC A;  4ZYS A;  4K5W A;  3VDY A;  4GS3 A;  4QIW E;  5EKL A;  3W1B A;  2D9U A;  1EYD A;  3J7A 5;  2KCM A;  3J80 E;  1D1I A;  2XN9 C;  1NNX A;  4IUR A;  1LTG D;  4OX9 L;  3T53 B;  5IOC A;  1VF7 A;  3LNN A;  2Z6K C;  1N9W A;  1KQS A;  1W3S A;  2K5D A;  1LAC A;  4KHV A;  1RD9 D;  5DLQ E;  3P7J A;  4A3D B;  4K2L A;  4N8X 1;  3C46 A;  4I7A A;  5IOD A;  3MA2 B;  2IT1 A;  4C3H G;  4GLX A;  2JA6 B;  1DZ1 A;  4JC0 A;  5KYI A;  2LFN A;  3CCQ A;  4LFC L;  1ZXT A;  4OX9 Q;  5EKI A;  2EYL A;  2Q8T A;  2F0H A;  2B8F A;  3SK8 A;  3R8B A;  3TP7 A;  2DGY A;  4DXG A;  2XRS D;  4U67 3;  4DAV A;  1VQ9 A;  1TXY A;  3F1Z A;  3HOX H;  2NTS A;  5C5M A;  3ULJ A;  1UEB A;  1A0I A;  3BDC A;  3RN5 A;  1XNQ Q;  4O1N A;  4POF A;  5H1S E;  4DPG A;  3HOV B;  2QA4 A;  4DR7 L;  2B2V C;  5NUC A;  1EWH A;  3RZO H;  1I6H H;  1XPR A;  1ILP A;  2LXK A;  3I8Z A;  4TSS A;  3KJP A;  3PO2 H;  2E2H B;  4ODG A;  2C9O A;  2HDL A;  3BVZ A;  3UDX A;  3CCU A;  3FKI G;  1SYB A;  3CHB D;  4O42 A;  4KJO A;  3OOC A;  2EYF A;  4UDU C;  1MJC A;  3K7U C;  4QGU A;  1C9O A;  4A3L H;  5A2Q E;  1F9R A;  1KRS A;  3CD6 A;  1RHP A;  4DR5 Q;  1IBM Q;  3M4O H;  4PQX A;  1E3P A;  3GTJ B;  1NMF A;  2I5M X;  4KHP Q;  3CCS A;  1LTA D;  3HOY B;  5EBD A;  5JJL A;  4OEL B;  3A7A B;  2E5L Q;  2XSC A;  1B1Z A;  2EYO A;  5BN4 A;  3ULL A;  5C44 B;  4HJ8 A;  1BCP B;  4IUU A;  2NN6 H;  3T16 A;  1DJR D;  3NPP A;  1VQG A;  3NBH B;  4CDD C;  4OON A;  2EE1 A;  3GTJ H;  2FIN B;  2VXW A;  3NWT A;  2ATW A;  4BBS H;  4IUQ A;  2Z1C A;  3MXP A;  1IBK L;  1IKM A;  4HCS A;  2UXB L;  1SNP A;  3NEL A;  1X3E A;  1LO5 D;  2PW7 A;  4IQZ A;  2CQO A;  1HZA A;  5IGB A;  1XMO L;  1JB7 A;  3FRP B;  3MXU A;  2HCC A;  4KY6 A;  2KBN A;  1SJE D;  1WTV A;  3NTH A;  1N32 L;  3KBG A;  3K80 C;  4P74 A;  3QIA A;  4QQB X;  1JE5 A;  1SYE A;  5CBA E;  2I07 B;  2A74 C;  5C0X J;  1XYI A;  2RCF A;  2IJ0 A;  5C3W A;  3GTM H;  1QJO A;  1F77 A;  3T1Y Q;  4JI7 L;  1MI2 A;  1STG A;  3H0G H;  5FO9 B;  3K58 A;  5M3M H;  1R9T H;  2ICI A;  1BF4 A;  1L2F A;  3B6Y A;  3KF8 A;  1E22 A;  2A68 C;  2F0I A;  5G3L F;  5COY A;  3PIO 3;  3OMG A;  3PF5 A;  3I73 A;  4RHR A;  3S1Q H;  5IIF A;  4JV5 Q;  2HIV A;  3K81 C;  2B29 A;  1WD1 A;  1G51 A;  1JMC A;  1AW7 A;  2OXP A;  2VQF Q;  1D1K A;  4K14 A;  4P73 A;  2AUK A;  4DR3 L;  3P1H A;  2JJQ A;  2ZXO A;  3P20 A;  3WDN A;  4DR2 L;  5HUR A;  4LFA Q;  1WJJ A;  1VQF A;  1PTO D;  3J7Y W;  2A6H D;  1KDB A;  1ENF A;  4GN4 B;  3TQY A;  3GD7 A;  4C2M B;  4P2C B;  2VZA A;  3BU2 A;  4C3I H;  4RH6 A;  4A76 A;  4FF1 A;  1LAB A;  2N49 A;  4C3I B;  4FF3 A;  1EIF A;  4FF4 A;  4ZK9 B;  4ZLT F;  2QCP X;  2XGT A;  3CC2 A;  1S5E D;  3KDF B;  3KLS X;  5FKA C;  2EY6 A;  3ND8 A;  3G6J B;  3NQT A;  4DV4 L;  3KF8 B;  1G91 A;  1E24 A;  2OT2 A;  2PQA B;  1JC7 A;  2EYP A;  5C0X H;  1FNV A;  1TQO A;  5EAY A;  3EBE A;  2YTY A;  2JA9 A;  1HZC A;  5KEE A;  4MTK A;  3S14 H;  1EY9 A;  1HFN A;  1XMO Q;  3K57 A;  3I4N B;  1EU4 A;  2VY3 A;  4Q5V A;  2A6H C;  3I4N H;  3OSO A;  5JPM C;  5FJ8 H;  2RVL A;  1HQR D;  2R7Z B;  1SE3 A;  2HHH Q;  2Z4H A;  3E5S A;  2XWB B;  4CBV A;  3HRZ C;  1Q12 A;  3K0Y A;  1VQJ A;  1TS2 A;  1PYW D;  2J4X A;  1FYC A;  4BY7 H;  1Y69 U;  2EY1 A;  4L5R C;  5HGQ A;  1N33 L;  2BOS A;  3AFQ A;  4G4K A;  5FLM H;  1ICF B;  3DMU A;  4KI0 A;  4GLV B;  3U9S A;  4NP5 A;  4MTN A;  1EOV A;  1PH3 A;  3M4Q A;  3PUY A;  4K6D A;  2VQE Q;  4S3S A;  4ZUJ A;  5JEA J;  4KD4 A;  5CV6 A;  1EWC A;  2NN6 G;  2EJF C;  1HA5 A;  3KOJ A;  1L0W A;  4F8M A;  1UE7 A;  4GKK L;  1SLJ A;  1X65 A;  2Q8I B;  5J39 A;  4DR1 L;  4IZ8 A;  1I50 B;  2ZJP A;  2Y0S E;  4NXN Q;  4GNX A;  1STH A;  4A3I B;  1K3R A;  1IL8 A;  1QOH A;  1BCP F;  1SN8 A;  4G7O C;  3RZO B;  1ZKO A;  1YJ9 A;  1KD1 C;  1JJ2 A;  1JOR A;  1KNE A;  1UUP A;  4CJ0 B;  2R93 B;  1F9S A;  1K0R A;  2G9H D;  3HKZ E;  2AMC B;  2E2D C;  4KKT A;  5COR A;  4BBR G;  3PO2 B;  3H09 A;  2UUA L;  4A3L G;  2PI2 A;  1WD0 A;  4GKK Q;  5D14 A;  1B9M A;  4NXM L;  3ONA B;  3S17 H;  1Y1V G;  3HP3 A;  3TZU A;  5CV4 A;  1VQL A;  1IBL Q;  3K6O A;  1HR0 L;  4OWX B;  1J5E L;  3IFT A;  1WTH A;  1WCM B;  5IY0 A;  4QUF A;  1EIH A;  2KEE A;  1B3A A;  4UHV A;  3W5O A;  4DR1 Q;  5IP9 H;  1IYU A;  3GQB A;  2N3S A;  4EQN A;  1IYJ B;  1V1P B;  1KXL A;  1E7Z A;  2OTL A;  3VYU A;  2RKS A;  4QL5 A;  4HMJ A;  4C3J H;  3HOX G;  1D5Z C;  4LF4 Q;  4EQP A;  4LFC Q;  1FGU A;  4BS9 A;  3CC7 A;  2R7F A;  3HKZ B;  1DGS A;  3S2D B;  3BG3 A;  4OO1 H;  3CPW A;  2F3V A;  5BN3 A;  2EY2 A;  4BBR H;  2V1C C;  3RN2 A;  4LUO A;  1CZW A;  4K0K Q;  1VQD A;  1MKH A;  4ZRZ A;  1JWU D;  3F2U A;  4X3U A;  5DM7 3;  3CC4 A;  3I4M B;  1EL0 A;  4DUZ Q;  2LY7 A;  1I4Q A;  1A3U A;  4JBW A;  2EJG C;  1VF5 C;  5ELC A;  4GOP C;  1VQO A;  1BR9 A;  2DUD A;  2WAC A;  2F0M A;  4MNO A;  2Q2U A;  2O4X A;  4F87 A;  3CAM A;  2VL6 A;  2YU9 H;  1SYG A;  1I4G A;  1NCV A;  3TRE A;  4K0K L;  5BR8 L;  4JI5 L;  2Z6K A;  3PF4 A;  3OWF A;  2ALY B;  4RWS C;  3N6R A;  4GKJ L;  1II3 A;  1JOQ A;  2L5T A;  5ELO A;  1K8G A;  4LF5 L;  3OTO L;  4Z9C B;  5IWA L;  3KBX A;  1YVC A;  1LTB D;  3QOL A;  3D4R A;  3S2H B;  2ZTD A;  1PVO A;  1VQ6 A;  3BZK A;  4OL7 A;  4H44 C;  1CM9 A;  4IO9 A;  5IGG A;  4DV5 Q;  3I4N G;  2UUB Q;  2EJM A;  4F7X A;  4B3M L;  3RMH A;  4UY8 C;  1GO3 E;  1I4X A;  2KVM A;  4Q0F A;  1ICW A;  1QVG A;  1CKO A;  4UP8 A;  4DV7 Q;  4X3K A;  4DR3 Q;  4XYQ A;  2OTJ A;  1FL0 A;  1RTO A;  4B9X A;  1GHJ A;  1A2T A;  4L6T B;  1QE6 A;  3MXN A;  4N8F A;  2KEN A;  4IFD H;  3CQZ B;  3A5Z B;  2BCO A;  2PQA A;  2B2U A;  2EYH A;  1K28 A;  3NSW A;  1KHI A;  3CRK C;  1SFO B;  2N78 A;  4B3S L;  2VS1 A;  3SDZ A;  4JI4 Q;  1LT5 D;  2XRQ D;  2ID0 A;  1O78 A;  3T1H Q;  2GN5 A;  1QVC A;  4XQQ A;  5EKK A;  3CCJ A;  1YHB A;  3MFY A;  2A6E C;  4A3J H;  3MAQ A;  4JI4 L;  3HEJ A;  2E2H H;  1S5F D;  1MGS A;  4R8N A;  1AH9 A;  2BDO A;  3H3V H;  1X6O A;  5CBE E;  1EY5 A;  4X62 Q;  3T1Y L;  1MJE A;  4OWT B;  2WAQ B;  1PRT C;  1YNX A;  1RIP A;  4R4I A;  2F0J A;  2RQX A;  1U4R A;  4EX5 A;  3ICE A;  4PZ8 A;  2B2U C;  3EFX D;  1KAA A;  2PPB C;  2F0E A;  5IGE A;  5CV5 A;  2JEB I;  2WIN B;  3JAM i;  2B63 B;  4JYA L;  2RSN A;  2D5D A;  2PQE A;  4HSV A;  1PH4 A;  5DEH A;  3HOY H;  4IFD I;  4DV5 L;  1K83 H;  4IPH A;  3CCE A;  3V96 A;  1L0Y B;  2VW9 A;  2LMC B;  1GUG A;  1D5M C;  3H6M A;  2DY7 A;  1Q86 C;  5E3F A;  1NY4 A;  1TWF B;  3TME A;  1STB A;  1NE3 A;  1HNX L;  1E1T A;  3S15 H;  2A6E D;  1B4O A;  3OPO A;  3SK6 A;  4AH6 A;  1JWS D;  3D4W A;  4A3I G;  4QB4 A;  1HPC A;  2RA4 A;  3M9B A;  1B2T A;  2L55 A;  1X3G A;  2JXM B;  4OO1 I;  3DUZ A;  1S5B D;  4LAA A;  1RJT A;  4DAY B;  3JC6 6;  1BOS A;  3K7A B;  3K8A A;  1SEB D;  4JPB W;  1Q8K A;  4OWW B;  3H94 A;  2MPM A;  2EYM A;  2EVB A;  5JVH 3;  4DV3 Q;  4B3T L;  2I5H A;  5JVG 3;  3S14 B;  3HOW G;  4YWL A;  3M7G A;  1GHK A;  1B44 D;  1U9R A;  5M3F G;  3I56 A;  4KHZ A;  5E4W C;  2NTT A;  2F0S A;  1O7Y A;  3L7Z C;  3J80 L;  1YJW A;  2MJ8 A;  4BBS G;  1LTR D;  4XQJ A;  1A2U A;  3OHX C;  5M3M B;  1Q82 C;  3SR1 A;  3U50 C;  1QUQ A;  2BH2 A;  2NN6 I;  2NBF A;  3GTQ H;  3GTG H;  3CRL C;  1U4M A;  1C4Q A;  4HSP A;  1VQE A;  3I70 A;  1VQN A;  4MN3 A;  1TWG H;  1PFM A;  2ZXP A;  3VR4 A;  3H0G B;  2D0P A;  4H0L C;  1GJX A;  4LF7 L;  2HCI A;  2CKZ B;  2KED A;  2F0T A;  4IUT A;  3A7L A;  2WAQ G;  1IBM L;  4JI2 Q;  2CQA A;  4A3G H;  2HQL A;  2G9D A;  3FKI B;  5CV8 A;  5LHY 1;  4HIO A;  3H91 A;  4A3D G;  3GTQ B;  4LMQ D;  4OGQ C;  1TWG B;  3NEN A;  2B63 G;  4DUY L;  2GVA A;  5I6Y A;  2JA8 B;  2K75 A;  2MFI A;  4JI6 L;  2G5D A;  2R92 G;  2DNC A;  2UUA Q;  1VQP A;  4TKO B;  3TP6 A;  2NZO A;  4K8J A;  2K5Q A;  4X3T A;  2YU9 B;  3TSS A;  1K3B C;  1D7Q A;  1WCM G;  2OF1 A;  5GAE C;  4IN3 A;  1AE3 A;  1JQY D;  3OIP A;  1L1O A;  2MHV A;  3NWS A;  1LV9 A;  5EPL A;  5CC4 A;  3GTK B;  1VCI A;  3X3M A;  1VQC A;  4I7Z C;  2IPK D;  4KJN A;  1T5X D;  1YEZ A;  5C4J B;  4C2M H;  1CZG A;  3URY A;  3S9W A;  4FP5 D;  3L2P A;  4YWK A;  1D6E C;  4B3S Q;  1PMR A;  4JI0 L;  5A2Q L;  4L5S A;  3E0J A;  2JYO A;  5K36 H;  3BS1 A;  1EYG A;  3M4Y A;  3H3V I;  4FO2 A;  5JPN C;  3S1R H;  3GTO H;  1BXT A;  5BN5 A;  4DR4 Q;  4DFA A;  3WOF A;  4A3F G;  1HXY D;  4RG1 A;  3J80 c;  4CDE C;  1S72 A;  1AN8 A;  2AHO B;  4C3J B;  1PH2 A;  1VS0 A;  1TWH H;  5CV9 A;  2K32 A;  3RR5 A;  4BBS B;  1SXT A;  3QR8 A;  4RA8 A;  3KF6 A;  4KY5 A;  1CQF A;  4WRD A;  2SNM A;  2Q2I A;  1AFP A;  3ERQ A;  4WJ4 A;  4HID A;  1CHQ D;  1KAW A;  3Q8D A;  5IGC A;  2RCN A;  2EIF A;  2VB2 X;  1F2L A;  3AQQ A;  1PH9 A;  1V1O A;  1F2M A;  2TSS A;  5I6W A;  2KCN A;  3QOJ A;  5EGT A;  4LW1 A;  5C3E H;  2F0P A;  3KLR A;  4TQU S;  5LMN Q;  1HUN A;  1EY4 A;  1X9N A;  2SEB D;  4GOP B;  2F0F A;  4POG A;  1JT8 A;  2QF7 A;  1EU3 A;  2F0D A;  1PYB A;  1GD7 A;  3MXN B;  4LF5 Q;  3M4P A;  1KLU D;  2WKD A;  1XNR Q;  4A93 H;  3K0X A;  4J15 A;  1I94 L;  4OIK A;  1E0B A;  3GTP B;  4KK7 A;  3BYY B;  4YY3 Q;  1Y1V B;  4KD3 A;  3RUZ A;  1K8O A;  4B3R Q;  3GP7 A;  1U4P A;  3RZD B;  1PYS B;  4XDX A;  2K4K A;  5EPJ A;  4K5X A;  2L15 A;  1MSH A;  3QJY A;  2N55 A;  1CA5 A;  4J1M A;  2D0O A;  2GVB A;  5C6A A;  1VMC A;  2L1B A;  5ELF A;  3BDL A;  5IYB G;  4H02 A;  1T5E A;  4FXG C;  5J3B A;  4L63 B;  4RFB A;  1WTW A;  1PHJ A;  1LT4 D;  1PH5 A;  1K0S A;  5M5X B;  1DON A;  1PLF A;  3J80 i;  3A74 A;  3FHW A;  3G48 A;  1MD2 D;  4BY1 G;  1HNW Q;  5ISR A;  1SFO H;  3HOV H;  1QUQ B;  3IKJ A;  5ELD A;  4JI0 Q;  2EOT A;  1HNW L;  4DU9 A;  4IJL A;  4N9T A;  1S5C D;  1JWM D;  4AYB E;  2FJ2 A;  1HA6 A;  1HHV A;  3L3O C;  4A3M H;  4LUZ A;  1QG7 A;  4N9P A;  3GTG B;  1ONL A;  1TU2 B;  1B9N A;  3K5N A;  1EQR A;  3AMU A;  4J8Q A;  1W6J A;  4DR6 Q;  3HFZ B;  1PTO C;  2CH4 A;  2I0Q A;  5GAH C;  1FR3 A;  2QGQ A;  2R7Z H;  2FFK B;  1CK1 A;  2YV5 A;  3MZ5 A;  5IP7 G;  2F0N A;  2X6G A;  2WFW A;  4DV6 Q;  3PGZ A;  2JA7 G;  2QEX A;  2KA7 A;  3ER0 A;  4MZ9 A;  2ZJQ A;  5CMD A;  3OTO Q;  2FMM A;  4GN3 B;  5C4X H;  4CDF C;  4X64 Q;  4R8I A;  1IHZ A;  1EYC A;  1SYD A;  2A68 D;  2R7Z G;  3S16 H;  3ULP A;  3KLS A;  2ASB A;  1VQA A;  3T56 B;  4IOC A;  3E6Z X;  1Q7Y C;  1AZQ A;  5JEA G;  1G6P A;  3GTK H;  4DV0 Q;  3H15 A;  5LL6 S;  4FXD A;  3VR2 A;  4DNI A;  4JBK A;  4R4O A;  1PRT F;  4LF9 L;  4A3F B;  3DM1 A;  1DM0 B;  2PYK A;  2R3Z A;  2RDG A;  4P72 A;  5KNC A;  5IYD G;  3EIV A;  4O0A A;  5C4J H;  1K8A C;  1E2Z A;  3DWQ A;  4M1U B;  4I65 A;  4GZY C;  1S5D D;  1T9H A;  5CV7 A;  2F0V A;  3W2D A;  2JA5 B;  3DXJ C;  1YHA A;  2JA5 H;  4H7B A;  5KIX A;  2F0K A;  1D8L A;  1H9R A;  3S17 B;  3TZD A;  4A3C H;  3JAM E;  5C44 H;  4ZQ3 A;  1M4V A;  4PNY A;  2M9V A;  1OTC A;  3Q24 A;  1UE1 A;  1MSG A;  2QIL A;  3MTS A;  1OO9 B;  1B3Q A;  1YI2 A;  4LF8 Q;  3KUP A;  4XTC S;  2Z8L A;  5JEA H;  4PMB A;  4DK6 C;  3C1F A;  3CMA A;  3SXH A;  4BBR B;  2FMC A;  1CI3 M;  1A3V A;  1SE2 A;  2YYZ A;  2JA8 G;  2ENB A;  5IYC G;  4U68 A;  3W3A A;  3VYS A;  1Y14 B;  2AQ2 B;  2H5X A;  4JI1 L;  1SNO A;  4WJW A;  3PQI A;  4B08 A;  1CHP D;  5C3X A;  1FGB D;  4QY7 A;  4DK3 C;  2Q2H A;  3PCO B;  4F88 A;  3FEW X;  1Z6H A;  1EEF D;  4KY7 A;  1M90 C;  1NMG A;  3J81 L;  1LLR D;  1SR3 A;  2I46 A;  2CHB D;  2L4N A;  1GUO A;  4Y52 H;  1EQQ A;  3I72 A;  1JR0 D;  3C3L A;  2SDF A;  1PH8 A;  1IBL L;  1AP0 A;  1H9S B;  2ICE C;  4LFA L;  5E4X A;  1CFM A;  3GTP H;  4YHH L;  5G3L D;  4A3E B;  1FJG L;  2LS0 1;  4PZ7 A;  4CGY B;  4JOI A;  4A3E H;  3I91 A;  1Y1V H;  4DKA C;  1TS5 A;  3CP0 A;  1XMQ Q;  1E1O A;  4JK1 C;  1EQV A;  5AJ3 L;  2PW5 A;  3S2H H;  1DYQ A;  4HMI A;  4PMW A;  3Q23 A;  1TWF H;  1YIT A;  2A1A A;  3OWE B;  1A15 A;  2EYJ A;  4NMZ A;  1KNA A;  4DV7 L;  4DAM A;  3HOZ B;  1ZEQ X;  4KLK A;  4KV6 A;  2B39 A;  2K33 A;  1SJH D;  5M5W H;  2MGS A;  3PV0 A;  5FLX L;  1NBW A;  1Q3L A;  1G6Z A;  3I90 A;  5IGD A;  5IYB H;  3HZX A;  3KF6 B;  2BDN A;  2QW7 A;  2KEC A;  2F4V L;  2B3G A;  4L5Q A;  2CVR A;  5C4Z A;  3PMF A;  4NB3 A;  5K36 G;  3Q22 A;  3NE5 B;  2E5L L;  3PO3 G;  4OO1 G;  1EFI D;  2NYZ D;  3OIQ A;  2MO0 A;  4HIK A;  4ME3 A;  3W1G A;  2OWO A;  1PH7 A;  5FOB B;  2F52 A;  5K5P A;  3TDQ A;  4QIW B;  4JI3 Q;  4GNX C;  2UXB Q;  5F2D A;  1VQI A;  2JA6 H;  2EY5 A;  4IOA A;  5I4D A;  2O2L D;  1SMX A;  4FF2 A;  4A93 G;  1X3P A;  1U4L A;  2NZH A;  5CYU A;  4ZKB B;  1EY6 A;  1HFG A;  3BJU A;  4X64 L;  1X32 A;  5DAU A;  1KIX A;  1L1O B;  4JVZ A;  2AQ1 B;  1UNS A;  4BY1 B;  3R2T A;  1M1K C;  3LWE A;  2B63 H;  1Y8O B;  1EEI D;  3HKS A;  1J8I A;  1TT2 A;  1XTD A;  2WB1 E;  3UDF A;  3U4Z A;  1VQB A;  2V4D A;  2B2Y A;  1K83 B;  3G4S A;  3IL8 A;  2ZTC A;  4PZ6 A;  5ELN A;  2HDM A;  2K01 A;  2FXQ A;  4DUZ L;  2EQS A;  1NAP A;  3HOU H;  3M4O B;  1W2B A;  1N36 Q;  1X56 A;  2Q8R E;  4JI6 Q;  2NVY B;  5HGT A;  1A8V A;  1VMP A;  3NBH A;  2GA4 B;  4EQ5 A;  4LFB L;  1BO0 A;  3AFP A;  1N36 L;  4LF7 Q;  4OIJ A;  3PSI A;  4B9W A;  2IY5 B;  2RHQ B;  1HUM A;  3FMC A;  4KKU A;  5JJZ A;  3F2C A;  4JV5 L;  4CHT B;  2VNU D;  5IT9 c;  4X3S A;  3I4L A;  2PCF B;  4HJ5 A;  5C4X B;  1SAP A;  2P5Z X;  4JG2 A;  2HIX A;  1DOM A;  2K14 A;  1S3O A;  4A3K B;  1B7Y B;  4FXK C;  1EOT A;  3LGJ A;  1Q1B A;  3S24 A;  5IT9 E;  2LXJ A;  5LMU Q;  1I3Q H;  5E1F A;  2FHT A;  2NZ1 D;  2X6L A;  3HOW H;  4C3H B;  4LFB Q;  3AU7 A;  1CT1 D;  4HTH A;  1R9T B;  4BY7 G;  1J9O A;  3CCR A;  1Y8P B;  1B50 A;  1N32 Q;  3OYY A;  4RKB A;  4DV3 L;  3CXC A;  1H9J A;  1KTK A;  4LF9 Q;  4FDB A;  1R4P B;  5GRO A;  1PH6 A;  2F0W A;  4XT3 B;  3GTL B;  2UXC Q;  1SND A;  3H0G G;  3A54 A;  1VQ7 A;  3NK9 A;  1I4P A;  2EZV A;  2B2T C;  1HZB A;  3CCV A;  5GAD C;  5LMN W;  2DNE A;  4JI8 Q;  5C0X G;  2E75 C;  3S2D H;  1BDO A;  5C3E B;  3VA7 A;  3HOY G;  3SK5 A;  3PUZ A;  2VUM H;  2WP8 J;  1TY0 A;  1OXS C;  1VQ4 A;  1PV4 A;  5GAG C;  2JN4 A;  1A63 A;  4JI3 L;  1EY7 A;  2KJX A;  5FK9 C;  3PIO A;  2NVT B;  2BE5 C;  2Z0S A;  2MNA A;  4DV1 Q;  3PUX A;  2IX1 A;  1TY2 A;  2CW0 D;  3CKI B;  2K5V A;  3G6E A;  3EVQ A;  1S4Z A;  3A0J A;  4APV A;  2RDF A;  2RHS B;  4QF4 A;  5L37 A;  1QZH A;  1HTP A;  4DV1 L;  5FLX E;  1SMY D;  1ML0 D;  2F4V Q;  2Y0S G;  1GUS A;  1BCP D;  2WII B;  4HIM A;  4V19 0;  5FLX c;  3KYH C;  1TVX A;  3S1N B;  5M5Y H;  3I4O A;  2NVT H;  1EWI A;  1PTO H;  3QG1 A;  1IXR A;  5FO8 B;  4DK0 A;  3LX0 A;  2E2J B;  5M3F H;  1KDC A;  2O5I C;  3O13 A;  3T51 B;  4A3K G;  4FNF A;  1F2Z A;  1F9Q A;  4CDC C;  3J7A F;  4IFD J;  1JOK A;  1XX8 A;  3S1R B;  3HOU G;  5DNF A;  4Y7N B;  3EN2 A;  3PUW A;  3TEH B;  4YIJ A;  3I2Z A;  5M5X H;  2F0O A;  4RGO S;  1PZJ D;  4DK1 A;  1O7L A;  4DR7 Q;  3AEV A;  1OXX K;  3PO2 G;  1O7Z A;  2JE6 I;  1JB3 A;  2QDB A;  2E2I B;  1SMY C;  5EBC A;  3SEB A;  1JJG A;  1YBY A;  2Z4I A;  2B8G A;  1ZYR D;  2UUB L;  1VQM A;  4AYB B;  2JA6 G;  2VQF L;  1LT3 D;  2I5L X;  1PFS A;  2RF4 A;  4LF8 L;  4FYD A;  1J5E Q;  2KOL A;  2EPB A;  1GUW A;  4K5V A;  4M8A A;  1C0A A;  5CR3 A;  4AQY L;  2O5J C;  2J0T D;  4J6H A;  2UU9 L;  2NVX B;  2ZJR A;  1DOK A;  3NEM A;  1EFW A;  1QNU A;  5AFW A;  2KQ3 A;  5JJK A;  1D5X C;  4ZAI A;  2NWG A;  4KN7 C;  4YCU A;  3D3R A;  3VR6 A;  4DN4 M;  2H4O A;  5GQO A;  4B3M Q;  2AUJ D;  4YY3 L;  1GM5 A;  2OQK A;  4LUV A;  3AB9 A;  4JI2 L;  1U0L A;  2AKW B;  3F2B A;  1F2Y A;  3HOU B;  4ULL A;  1G2S A;  4IUP A;  3I4M G;  1YJN A;  4L8J A;  1HJP A;  4P75 A;  5C4H A;  4ALP A;  2QEJ C;  3UI2 A;  5E7N A;  1K8M A;  3A56 A;  3S15 B;  3UE1 A;  4UPA A;  1ASZ A;  2B2V A;  5EQ0 A;  1Z47 A;  1SNQ A;  3K5M A;  1HNZ Q;  3L9A X;  3TRZ A;  2IHE A;  4LF6 L;  4RAU C;  2A19 A;  3HOW B;  3DHQ A;  2F3I A;  2XNA C;  4BWG B;  3M3Y B;  1ET6 A;  1WFQ A;  4NW2 A;  4DAY A;  5C5L A;  1CTM A;  3DEO A;  3K7A H;  3KFU A;  1ILQ A;  1TWA B;  3HS0 C;  3RD4 A;  1CA6 A;  3C2P A;  1QCB D;  4JW0 A;  1HCZ A;  4QJF A;  2L9H A;  1CKM A;  1SBB B;  1Y8N B;  1EIG A;  1B70 B;  3S1M B;  5TSS A;  1V1P A;  3A5U A;  2HD3 A;  4CJ2 C;  3U4V A; 
#chains in the Genus database with same CATH homology
 3U9O A;  2M2L A;  5KND A;  3BVG A;  1JE4 A;  1FNW A;  1SYF A;  5J22 A;  3P75 A;  5I2X A;  4XT1 B;  3KK7 A;  1L0X B;  3GTM B;  4RKL A;  1BQQ T;  3S1Q B;  4RCO A;  3SVM A;  3TP5 A;  1W6K A;  1TS4 A;  2PO4 A;  1LTT D;  4A3G B;  3R93 A;  2MP1 A;  3NTK A;  1UEA B;  3SHL A;  3JAM L;  1I4R A;  2K1B A;  3DWA A;  3TN2 A;  1BUV T;  1LT6 D;  1DOL A;  2IW3 A;  3GV3 A;  1YNJ D;  1WTX A;  4EVO A;  2MUY A;  2TMP A;  1ESF A;  3J7A V;  1JIC A;  4G7Z C;  1H9S A;  2A73 B;  1YNN D;  2JEA I;  2DN8 A;  5EJW A;  1TWH B;  2B2W C;  1NSN S;  1PTO F;  2K28 A;  2XVS A;  1A3T A;  1GXD C;  5KYL A;  4XXE A;  1RKN A;  4DA2 A;  2K03 A;  2PZU A;  3MVV A;  1QNK A;  1I4H A;  4KMU C;  2XWJ B;  1WTO A;  3VR5 A;  5D3I B;  1HTL D;  1PFB A;  4CKC A;  5M5Y B;  2K5W A;  4RHS A;  1ESR A;  3A55 A;  1HQM C;  1TS3 A;  4MIU A;  3TBI B;  3NUC A;  3VR3 A;  3NTI A;  2L0C A;  1DXM A;  4C3I G;  4V0B A;  3EJI A;  3MHB A;  5JOB A;  1H9K A;  3Q6S A;  4LK1 C;  1FNU A;  1BBX C;  4MHE A;  4DXF A;  1PZI D;  4ABN A;  3D6C A;  2EDG A;  4K8I A;  2WB1 B;  3MEH A;  1XTC D;  3PUV A;  4BY7 B;  4C56 C;  4CKB A;  3DWP A;  1NR2 A;  1OXT A;  4G57 A;  2M00 A;  1LTI D;  3J81 E;  4EGV A;  3NBI A;  2E76 C;  1AZP A;  4HCE A;  2F0L A;  2HQE A;  1FD7 D;  2ZT9 C;  3OW7 A;  2ZXR A;  2D2C C;  2OEO A;  3NHH A;  5C0X I;  2R6G A;  4RGN A;  5A35 A;  3VYT A;  1I3Q B;  1ENA A;  4DGZ A;  4ME5 A;  3BZD B;  5I2Y A;  3Q0A A;  3SK4 A;  1PRT B;  3FDT A;  5J1Z A;  3IAY A;  1V43 A;  1XXG A;  4WFN 3;  1G8Z D;  1PZK D;  3GO5 A;  2F3W A;  1SNC A;  3ERO A;  4NKL A;  3FPP A;  3A8I E;  1Q90 A;  2K7V A;  1M8A A;  3QB3 A;  4PV1 C;  5LL6 X;  4EQO A;  1YNJ C;  1C48 A;  2K04 A;  3D6W A;  2N88 A;  2F0G A;  1EYA A;  1STA A;  1I6V C;  3TP8 A;  3MWY W;  3G7L A;  2D62 A;  1YNN C;  2NVQ B;  3CU7 A;  2NB0 A;  1PTO B;  3S16 B;  1GOZ A;  5M3F B;  3MFG A;  3RLF A;  2K6A A;  3GTO B;  3QWN A;  4R9W A;  4PMC A;  4G7H C;  5D3D A;  3HGB A;  2BA0 A;  3H3V C;  1BNZ A;  1E2W A;  2H1E A;  4XYO A;  4A3B B;  1ROD A;  2L11 A;  4ID6 A;  4RGT A;  1X3Q A;  4H13 C;  2R61 A;  3ZYY X;  5EPK A;  1VDZ A;  1XWE A;  2R92 B;  1EY8 A;  3ND9 A;  5IGF A;  2F03 A;  1QIL A;  3DEP A;  1JCK B;  4BA1 I;  4CKE A;  2LKV A;  1PXU A;  2J7Z A;  2AWN A;  1KDA A;  3K5O A;  2F1M A;  2BA1 A;  2KHS A;  1CQV A;  2F4I A;  4BA2 I;  4ZKC B;  3M7N A;  4XQN A;  5ELE A;  1DD2 A;  2L12 A;  3SE0 A;  4A3J B;  1C8C A;  4DF7 A;  4UAI A;  5DM6 3;  1TWC B;  4RGM A;  1ET9 A;  5T1G A;  3D8G A;  4KN4 C;  2HUG A;  3A8K E;  3N52 A;  2E74 C;  4QCL A;  1SE4 A;  1MBY A;  5ELB A;  3BYT B;  4ILW A;  3D4D A;  1Q1E A;  3FVQ A;  1AEX A;  2A69 C;  3NQI A;  5T1I A;  5KGU A;  2RDH A;  4HR7 B;  3PIP 3;  1IKL A;  1SSO A;  4IUV A;  4KTA A;  2NUC A;  1OXU A;  3PO3 B;  4NDX A;  5I9O A;  1D2B A;  4WOR A;  4TRD A;  2XIW A;  1RCV D;  3T4A C;  1IW7 C;  1SNM A;  2WKC A;  3IFD A;  1WTR A;  2PNR C;  1STE A;  2VB3 X;  4CJ1 B;  3T13 A;  3NXW A;  3X3N A;  4KKS A;  4C1N I;  4DNR B;  5I9P A;  2DY8 A;  4OHJ A;  3D31 A;  5M5W B;  2WV6 D;  1RDP D;  2KUM A;  1QWY A;  1STN A;  1E2V A;  1WVL A;  4E6I A;  1ZYR C;  2B2Y C;  3FPU B;  1RTN A;  1Q8I A;  3BDO A;  3HOX B;  4HN7 A;  4A3M B;  1TII D;  3R3O A;  1JOO A;  2C5C A;  2PZT A;  1Z7T A;  4DAP A;  2SOB A;  2SNS A;  3I3C A;  1O80 A;  1F9P A;  3K59 A;  1KLG D;  1WTP A;  1TR5 A;  2JSO A;  3EQL C;  3C1E A;  3WOE A;  2IX0 A;  3BVM A;  5KNB A;  1PFN A;  3R2I A;  1UAP A;  2B2W A;  3OMC A;  2VUM B;  1B53 A;  1EY0 A;  1EZ6 A;  1NUC A;  3V05 A;  2RSO A;  2IWH A;  1I6H B;  4HED A;  2IL8 A;  1BCP C;  1SYC A;  2K05 A;  1IW7 D;  4QUC A;  4K2K A;  3V2T A;  2X69 A;  3VYR A;  1EQT A;  2A5H A;  4XIG S;  4RCN A;  2CW0 C;  1A6X A;  1SDF A;  2QKI C;  2BE5 D;  3MXG A;  3GV6 A;  4QMG A;  3NP8 A;  1QB5 D;  3MC0 B;  2A69 D;  1R4Q B;  1HRJ A;  2B2T A;  1ENC A;  1OXV A;  4DNT B;  3EA6 A;  2Y0S B;  1GUT A;  1STY A;  3ITP A;  4LJZ C;  5FO7 B;  2F0Q A;  5M9O A;  2PZW A;  1DCZ A;  2RBM A;  3QO2 A;  5CGK A;  5IT9 L;  4IUN A;  1LTS D;  1RF2 D;  4FVM A;  3A8J E;  2F0U A;  4C1N K;  1GUN A;  1V8Q A;  4IFD G;  1G2T A;  4A93 B;  3HG9 A;  2EXZ A;  5D65 A;  4C3J G;  1H9M A;  2JA7 B;  1NR4 A;  1Y1W B;  1G29 1;  1PRT D;  2IX3 A;  1IYV A;  2JP1 A;  5KRU A;  1TKW B;  3M85 A;  1WTQ A;  1PDQ A;  1EZ8 A;  3K5L A;  5JAV A;  2PMZ B;  4K6L A;  2AWO A;  4HAE A;  3VA5 A;  2AQ3 B;  4ZUI A;  1KAB A;  4IAL A;  3LWU A;  2KCC A;  4ZYS A;  4K5W A;  5EKL A;  2D9U A;  1EYD A;  3J80 E;  1D1I A;  2XN9 C;  4IUR A;  1LTG D;  3T53 B;  5IOC A;  1VF7 A;  3LNN A;  2K5D A;  1LAC A;  4KHV A;  1RD9 D;  3P7J A;  4A3D B;  4K2L A;  3C46 A;  5IOD A;  3MA2 B;  2IT1 A;  4C3H G;  2JA6 B;  1DZ1 A;  5KYI A;  2LFN A;  1ZXT A;  5EKI A;  2EYL A;  2Q8T A;  2F0H A;  2B8F A;  3SK8 A;  3R8B A;  3TP7 A;  4DXG A;  2XRS D;  4U67 3;  4DAV A;  2NTS A;  5C5M A;  3BDC A;  4O1N A;  3HOV B;  2B2V C;  5NUC A;  1EWH A;  1ILP A;  3I8Z A;  4TSS A;  2E2H B;  4ODG A;  2C9O A;  2HDL A;  3BVZ A;  1SYB A;  3CHB D;  4KJO A;  4O42 A;  3OOC A;  2EYF A;  4UDU C;  5A2Q E;  1F9R A;  1RHP A;  4PQX A;  3GTJ B;  1LTA D;  3HOY B;  5EBD A;  3A7A B;  2XSC A;  1B1Z A;  2EYO A;  5BN4 A;  5C44 B;  1BCP B;  4IUU A;  2NN6 H;  3T16 A;  1DJR D;  3NPP A;  2EE1 A;  2FIN B;  2VXW A;  3NWT A;  4IUQ A;  2Z1C A;  3MXP A;  1IKM A;  4HCS A;  1SNP A;  1LO5 D;  2PW7 A;  4IQZ A;  5IGB A;  3FRP B;  3MXU A;  2HCC A;  4KY6 A;  1WTV A;  1SJE D;  3NTH A;  3KBG A;  3QIA A;  5CBA E;  1SYE A;  2I07 B;  2A74 C;  5C0X J;  1XYI A;  2IJ0 A;  5C3W A;  1QJO A;  1F77 A;  1MI2 A;  1STG A;  5FO9 B;  3K58 A;  2ICI A;  1BF4 A;  3KF8 A;  2A68 C;  2F0I A;  5G3L F;  5COY A;  3PIO 3;  3OMG A;  3I73 A;  4RHR A;  5IIF A;  1WD1 A;  1AW7 A;  2OXP A;  1D1K A;  4K14 A;  2AUK A;  3P1H A;  2ZXO A;  3P20 A;  3WDN A;  5HUR A;  1PTO D;  3J7Y W;  2A6H D;  1KDB A;  1ENF A;  3GD7 A;  4C2M B;  4P2C B;  4RH6 A;  4FF1 A;  1LAB A;  4C3I B;  4FF3 A;  4FF4 A;  4ZK9 B;  4ZLT F;  2QCP X;  1S5E D;  3KLS X;  5FKA C;  2EY6 A;  3ND8 A;  3G6J B;  3NQT A;  1G91 A;  2OT2 A;  1JC7 A;  2EYP A;  5C0X H;  1FNV A;  1TQO A;  5KEE A;  1EY9 A;  1HFN A;  3K57 A;  3I4N B;  1EU4 A;  4Q5V A;  2A6H C;  3OSO A;  5JPM C;  2RVL A;  1HQR D;  2R7Z B;  1SE3 A;  2Z4H A;  3E5S A;  2XWB B;  4CBV A;  3HRZ C;  1Q12 A;  3K0Y A;  2J4X A;  1TS2 A;  1PYW D;  1FYC A;  1Y69 U;  2EY1 A;  2BOS A;  4G4K A;  3DMU A;  4KI0 A;  3U9S A;  4NP5 A;  3PUY A;  4K6D A;  4S3S A;  4ZUJ A;  5JEA J;  4KD4 A;  5CV6 A;  1EWC A;  2NN6 G;  2EJF C;  1HA5 A;  4F8M A;  2Q8I B;  5J39 A;  4IZ8 A;  1I50 B;  1STH A;  4A3I B;  1IL8 A;  1QOH A;  1BCP F;  4G7O C;  3RZO B;  1ZKO A;  1JOR A;  1UUP A;  1KNE A;  4CJ0 B;  2R93 B;  1F9S A;  2G9H D;  5COR A;  2E2D C;  4KKT A;  3PO2 B;  3H09 A;  1WD0 A;  5D14 A;  1B9M A;  3ONA B;  3HP3 A;  3TZU A;  5CV4 A;  3K6O A;  3IFT A;  1WCM B;  4QUF A;  1EIH A;  2KEE A;  1B3A A;  1IYU A;  3GQB A;  4EQN A;  1V1P B;  3VYU A;  2RKS A;  4HMJ A;  1D5Z C;  4EQP A;  4BS9 A;  3HKZ B;  3S2D B;  3BG3 A;  4OO1 H;  2F3V A;  5BN3 A;  2EY2 A;  1CZW A;  4ZRZ A;  1JWU D;  3F2U A;  4X3U A;  5DM7 3;  3I4M B;  1EL0 A;  2LY7 A;  1I4Q A;  1A3U A;  4JBW A;  2EJG C;  1VF5 C;  5ELC A;  1BR9 A;  2WAC A;  2F0M A;  2O4X A;  4F87 A;  1SYG A;  1I4G A;  1NCV A;  3OWF A;  4RWS C;  3N6R A;  1II3 A;  1JOQ A;  2L5T A;  4Z9C B;  3KBX A;  1LTB D;  3QOL A;  3D4R A;  3S2H B;  4OL7 A;  4H44 C;  1CM9 A;  5IGG A;  2EJM A;  4F7X A;  3RMH A;  1I4X A;  2KVM A;  4Q0F A;  1ICW A;  4X3K A;  4XYQ A;  1RTO A;  4B9X A;  1GHJ A;  1A2T A;  4L6T B;  1QE6 A;  3MXN A;  4IFD H;  3CQZ B;  2BCO A;  2B2U A;  2EYH A;  3NSW A;  3CRK C;  1SFO B;  3SDZ A;  1LT5 D;  2XRQ D;  2ID0 A;  1O78 A;  4XQQ A;  5EKK A;  3MFY A;  2A6E C;  3MAQ A;  3HEJ A;  1S5F D;  1MGS A;  4R8N A;  2BDO A;  5CBE E;  1EY5 A;  2WAQ B;  1PRT C;  2F0J A;  2RQX A;  1U4R A;  2B2U C;  3EFX D;  1KAA A;  2PPB C;  2F0E A;  5IGE A;  5CV5 A;  2JEB I;  2WIN B;  2B63 B;  2RSN A;  2D5D A;  2PQE A;  4HSV A;  5DEH A;  4IFD I;  3V96 A;  1L0Y B;  2LMC B;  1GUG A;  1D5M C;  3H6M A;  2DY7 A;  5E3F A;  1TWF B;  3TME A;  1STB A;  2A6E D;  1B4O A;  3OPO A;  3SK6 A;  1JWS D;  3D4W A;  4QB4 A;  1HPC A;  2RA4 A;  1B2T A;  2L55 A;  2JXM B;  4OO1 I;  3DUZ A;  1S5B D;  4LAA A;  1RJT A;  1BOS A;  3K7A B;  1SEB D;  3H94 A;  2MPM A;  2EYM A;  2EVB A;  5JVH 3;  3S14 B;  5JVG 3;  3M7G A;  1GHK A;  1B44 D;  1U9R A;  4KHZ A;  5E4W C;  2NTT A;  2F0S A;  1O7Y A;  3L7Z C;  3J80 L;  2MJ8 A;  1LTR D;  4XQJ A;  1A2U A;  3OHX C;  5M3M B;  3SR1 A;  2NN6 I;  2NBF A;  3CRL C;  1U4M A;  1C4Q A;  4HSP A;  3I70 A;  4MN3 A;  1PFM A;  2ZXP A;  3VR4 A;  3H0G B;  4H0L C;  1GJX A;  2HCI A;  2KED A;  2F0T A;  3A7L A;  4IUT A;  2CQA A;  2G9D A;  3FKI B;  5CV8 A;  5LHY 1;  3H91 A;  3GTQ B;  4LMQ D;  4OGQ C;  1TWG B;  5I6Y A;  2JA8 B;  2DNC A;  4TKO B;  3TP6 A;  4K8J A;  2K5Q A;  4X3T A;  2YU9 B;  3TSS A;  2OF1 A;  4IN3 A;  1JQY D;  3OIP A;  2MHV A;  3NWS A;  1LV9 A;  5EPL A;  5CC4 A;  3GTK B;  1VCI A;  3X3M A;  4I7Z C;  2IPK D;  4KJN A;  1T5X D;  5C4J B;  1CZG A;  3URY A;  3S9W A;  4FP5 D;  1D6E C;  1PMR A;  5A2Q L;  3E0J A;  2JYO A;  5K36 H;  3BS1 A;  3M4Y A;  4FO2 A;  5JPN C;  1BXT A;  5BN5 A;  4DFA A;  3WOF A;  1HXY D;  1AN8 A;  4C3J B;  5CV9 A;  2K32 A;  4BBS B;  1SXT A;  4RA8 A;  4KY5 A;  1CQF A;  4WRD A;  2SNM A;  1AFP A;  3ERQ A;  1CHQ D;  5IGC A;  2VB2 X;  1F2L A;  1V1O A;  1F2M A;  2TSS A;  5I6W A;  2KCN A;  3QOJ A;  5EGT A;  2F0P A;  3KLR A;  4TQU S;  1HUN A;  1EY4 A;  2SEB D;  2F0F A;  2QF7 A;  1EU3 A;  2F0D A;  1KLU D;  2WKD A;  4OIK A;  1E0B A;  3GTP B;  4KK7 A;  3BYY B;  1Y1V B;  4KD3 A;  3RUZ A;  1K8O A;  3GP7 A;  1U4P A;  3RZD B;  4XDX A;  5EPJ A;  4K5X A;  1MSH A;  3QJY A;  2N55 A;  1CA5 A;  4J1M A;  5C6A A;  1VMC A;  2L1B A;  5ELF A;  3BDL A;  1T5E A;  4FXG C;  1WTW A;  4L63 B;  4RFB A;  1LT4 D;  5M5X B;  1DON A;  1PLF A;  1MD2 D;  5ISR A;  3IKJ A;  5ELD A;  2EOT A;  4DU9 A;  4N9T A;  1S5C D;  1JWM D;  2FJ2 A;  1HA6 A;  1HHV A;  3L3O C;  1QG7 A;  4N9P A;  3GTG B;  1ONL A;  1TU2 B;  1B9N A;  3K5N A;  3AMU A;  4J8Q A;  1W6J A;  1PTO C;  1FR3 A;  2FFK B;  1CK1 A;  3MZ5 A;  2F0N A;  2X6G A;  2KA7 A;  5CMD A;  2FMM A;  4R8I A;  1IHZ A;  1EYC A;  1SYD A;  2A68 D;  3KLS A;  3T56 B;  3E6Z X;  1AZQ A;  5JEA G;  5LL6 S;  4FXD A;  3VR2 A;  1PRT F;  4A3F B;  3DM1 A;  1DM0 B;  2PYK A;  2R3Z A;  2RDG A;  5KNC A;  1E2Z A;  3DWQ A;  4M1U B;  4I65 A;  4GZY C;  1S5D D;  5CV7 A;  2JA5 B;  2F0V A;  3W2D A;  3DXJ C;  4H7B A;  5KIX A;  2F0K A;  1H9R A;  3S17 B;  3TZD A;  3JAM E;  4ZQ3 A;  1M4V A;  4PNY A;  2M9V A;  3Q24 A;  1MSG A;  2QIL A;  3MTS A;  1OO9 B;  3KUP A;  4XTC S;  2Z8L A;  5JEA H;  4PMB A;  3C1F A;  3SXH A;  4BBR B;  2FMC A;  1CI3 M;  1A3V A;  1SE2 A;  2YYZ A;  2ENB A;  4U68 A;  3W3A A;  3VYS A;  2AQ2 B;  1SNO A;  4WJW A;  4B08 A;  1CHP D;  5C3X A;  1FGB D;  4F88 A;  3FEW X;  1Z6H A;  1EEF D;  4KY7 A;  3J81 L;  1LLR D;  2I46 A;  2CHB D;  2L4N A;  1GUO A;  3I72 A;  1JR0 D;  3C3L A;  2SDF A;  1AP0 A;  1H9S B;  2ICE C;  5E4X A;  1CFM A;  5G3L D;  4A3E B;  2LS0 1;  4CGY B;  3I91 A;  1TS5 A;  4JK1 C;  1EQV A;  2PW5 A;  1DYQ A;  4HMI A;  4PMW A;  3Q23 A;  3OWE B;  1A15 A;  2EYJ A;  4NMZ A;  1KNA A;  3HOZ B;  1ZEQ X;  4KV6 A;  2B39 A;  2K33 A;  1SJH D;  2MGS A;  3PV0 A;  5FLX L;  1Q3L A;  1G6Z A;  3I90 A;  5IGD A;  3HZX A;  2BDN A;  2KEC A;  2CVR A;  5C4Z A;  3PMF A;  5K36 G;  3Q22 A;  3NE5 B;  4OO1 G;  1EFI D;  2NYZ D;  3OIQ A;  5FOB B;  5K5P A;  3TDQ A;  4QIW B;  5F2D A;  2EY5 A;  5I4D A;  2O2L D;  4FF2 A;  1X3P A;  1U4L A;  5CYU A;  4ZKB B;  1EY6 A;  1HFG A;  1X32 A;  5DAU A;  2AQ1 B;  1UNS A;  4BY1 B;  3R2T A;  3LWE A;  1Y8O B;  1EEI D;  1J8I A;  1TT2 A;  2V4D A;  2B2Y A;  1K83 B;  3IL8 A;  2HDM A;  2K01 A;  1NAP A;  3M4O B;  2Q8R E;  2NVY B;  5HGT A;  1VMP A;  3NBH A;  2GA4 B;  1BO0 A;  4OIJ A;  4B9W A;  1HUM A;  3FMC A;  4KKU A;  5JJZ A;  4CHT B;  2VNU D;  4X3S A;  3I4L A;  2PCF B;  5C4X B;  1SAP A;  1DOM A;  4A3K B;  4FXK C;  1EOT A;  5IT9 E;  1Q1B A;  5E1F A;  2FHT A;  2NZ1 D;  2X6L A;  4C3H B;  3AU7 A;  1CT1 D;  4HTH A;  1R9T B;  1J9O A;  1Y8P B;  1B50 A;  4RKB A;  1H9J A;  1KTK A;  1R4P B;  2F0W A;  4XT3 B;  3GTL B;  1SND A;  3A54 A;  3NK9 A;  1I4P A;  2EZV A;  2B2T C;  2DNE A;  5C0X G;  2E75 C;  1BDO A;  5C3E B;  3VA7 A;  3SK5 A;  3PUZ A;  2WP8 J;  1TY0 A;  1OXS C;  1EY7 A;  2KJX A;  5FK9 C;  2NVT B;  2BE5 C;  3PUX A;  2IX1 A;  1TY2 A;  2CW0 D;  3CKI B;  3EVQ A;  1S4Z A;  2RDF A;  4QF4 A;  1HTP A;  5FLX E;  1SMY D;  1ML0 D;  1GUS A;  1BCP D;  2WII B;  4V19 0;  1TVX A;  3S1N B;  1PTO H;  3QG1 A;  5FO8 B;  4DK0 A;  3LX0 A;  2E2J B;  1KDC A;  2O5I C;  3O13 A;  3T51 B;  4FNF A;  1F2Z A;  1F9Q A;  3J7A F;  4IFD J;  1JOK A;  1XX8 A;  3S1R B;  5DNF A;  4Y7N B;  3PUW A;  4YIJ A;  2F0O A;  4RGO S;  1PZJ D;  4DK1 A;  1O7L A;  1OXX K;  1O7Z A;  2JE6 I;  1JB3 A;  2QDB A;  2E2I B;  1SMY C;  5EBC A;  3SEB A;  2Z4I A;  2B8G A;  1ZYR D;  4AYB B;  1LT3 D;  4FYD A;  2KOL A;  2EPB A;  1GUW A;  4K5V A;  4M8A A;  5CR3 A;  2O5J C;  2J0T D;  4J6H A;  2NVX B;  1DOK A;  1QNU A;  5AFW A;  2KQ3 A;  1D5X C;  4ZAI A;  2NWG A;  4KN7 C;  3D3R A;  3VR6 A;  4DN4 M;  2H4O A;  2AUJ D;  3AB9 A;  1F2Y A;  3HOU B;  4ULL A;  1G2S A;  4IUP A;  4L8J A;  5C4H A;  3UI2 A;  2QEJ C;  1K8M A;  3A56 A;  3S15 B;  2B2V A;  5EQ0 A;  1Z47 A;  1SNQ A;  3K5M A;  3L9A X;  4RAU C;  3HOW B;  3DHQ A;  2XNA C;  4BWG B;  3M3Y B;  1ET6 A;  4NW2 A;  4DAY A;  5C5L A;  1CTM A;  3DEO A;  1TWA B;  1ILQ A;  3HS0 C;  3RD4 A;  1CA6 A;  3C2P A;  1QCB D;  1HCZ A;  2L9H A;  1SBB B;  1Y8N B;  1EIG A;  3S1M B;  5TSS A;  1V1P A;  4CJ2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...