2EJFC

Crystal structure of the biotin protein ligase (mutations r48a and k111a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
NVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 12
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ejfC00
2PCFB 3GD7A 3LNNA 4OO1G 1BDOA 2JEBI 3BDOA 3KLRA 3M4YA 3FPPA 1HTPA 1DXMA 2D62A 3PUVA 4DK0A 5JEAH 5C0XH 1GHKA 1O78A 1QJOA 1YNNC 2EVBA 3NE5B 1DD2A 1GUNA 2EDGA 1E2VA 1Q90A 4XTCS 1O7LA 4OGQC 3TZUA 2BE5D 5K36H 2CW0C 2QF7A 3I73A 3D31A 1GHJA 1FR3A 1VF5C 2YYZA 4H13C 5JEAG 3CRKC 1Y8PB 3AB9A 4G7ZC 1IYVA 1Y8OB 3QJYA 2B8FA 4DNTB 4KN7C 3SE0A 4KN4C 2PPBC 3PUWA 1G291 2V4DA 2A6ED 3OOCA 1VCIA 5K36G 1HCZA 2E75C 3VR2A 1H9SB 4PV1C 1Z7TA 1HQMC 2E76C 3I72A 2EJFC 2NN6I 1FYCA 1OXSC 3H94A 1OXXK 4H0LC 3FMCA 2IT1A 4HR7B 2JEAI 2A69D 2A6HC 2A6EC 1V8QA 1IW7C 2DN8A 2LMCB 3OW7A 1Y69U 1V43A 2D5DA 3MFYA 4DK1A 4GZYC 2K32A 3M7NA 3WDNA 3OPOA 3ND9A 4BA1I 2F1MA 5C0XG 1LABA 1ZKOA 4I7ZC 5A35A 3ND8A 4LJZC 4H44C 3P20A 1B9NA 3I4LA 3LWUA 1EWHA 4TKOB 3VR3A 1B9MA 5KNCA 2BA1A 2BE5C 1GUTA 4KI0A 5KNDA 1H9JA 1TU2B 1SMYC 3GQBA 3PUZA 2O5IC 3MXUA 3T51B 2Q8IB 2L5TA 4LK1C 4XIGS 2AUJD 3A7AB 1A6XA 1VF7A 3N6RA 1Q12A 1GUSA 2E74C 1K8OA 4RCNA 3A8KE 2KCCA 4G7HC 3T56B 2DNCA 3CRLC 4KKTA 2NN6H 3VA7A 1GJXA 4IFDH 1GUOA 4KHZA 1DCZA 3PUYA 3VR4A 1Q1EA 3DXJC 3EQLC 5KNBA 3PV0A 3HGBA 1H9RA 3PUXA 3SDZA 4KKUA 3BG3A 2A69C 1I6VC 1CI3M 2D2CC 2B8GA 4TQUS 1Y8NB 4JBWA 1K8MA 4KMUC 2NN6G 2JE6I 2JXMB 3U9SA 4IFDG 3M85A 1Z6HA 5BN3A 2EJMA 1ZYRC 1E2ZA 3VR6A 3QG1A 1OXUA 2AWOA 4IQZA 4DNRB 1E2WA 1PMRA 1T5EA 1OXVA 1TKWB 1YNJC 5BN4A 2DNEA 2A68D 2EJGC 3A7LA 3L7ZC 2K33A 1HPCA 2R6GA 2BDOA 3QIAA 3VR5A 4G7OC 1Q1BA 2K7VA 1IYUA 3IKJA 2ZT9C 4KKSA 4BA2I 1H9MA 3D4RA 4L8JA 1H9SA 1OXTA 3W3AA 4OO1H 2A6HD 2BA0A 1H9KA 3IFTA 2O5JC 5BN5A 1VDZA 1CFMA 1IW7D 3A8IE 3T53B 2A68C 3A8JE 1GUGA 4JK1C 1CTMA 1ONLA 2AUKA 2PNRC 3RLFA 2KA7A 1LACA
chains in the Genus database with same CATH superfamily
1I4XA 3T16A 3VYRA 1DXMA 5T1GA 4JI8Q 3F2DA 1QJOA 2VQFQ 3ERSX 4DGZA 1SMYD 3I73A 1DONA 1O7IA 5JVH3 2ZJPA 2HDLA 4LF6L 3NQIA 1C4QA 1D5MC 4PZ6A 4BBSG 2F0IA 4IUTA 3CCRA 1SXTA 4MIUA 2A6ED 4XQJA 5CV5A 2EIFA 5IWAQ 4IUUA 1HA5A 5C3EH 2GVBA 2E76C 4HSPA 3BVZA 1R9TH 2B63G 2CHBD 1EQTA 1STEA 2IT1A 2R7FA 1EFWA 1L0XB 4A93B 1F9PA 1UNSA 4GN5A 1BBWA 2AKWB 1BCPF 4DK1A 1IKMA 4JI3L 1PVOA 1SYBA 4IJLA 4J6HA 1GOZA 4JBMA 2A1AA 1KDBA 4LJZC 2ZTCA 2IX3A 1B9NA 1II3A 1EYCA 4RA8A 3NWTA 2QEJC 2TSSA 4WORA 5AJ3L 1EY6A 1A2TA 3CCMA 1TU2B 4XDXA 2DUDA 4QY7A 1F9RA 2F0FA 4ZQ3A 4IOCA 4LF9Q 4JC0A 3ZJYC 1T5XD 4RFBA 3CKIB 2VQEL 1ENFA 3P1HA 4AH6A 1PRTC 3D6CA 2RHQB 5DLQE 3WOFA 2UXDL 2MQHA 1WTVA 3PV0A 4JI8L 5E3FA 1HUMA 2XWJB 3QR8A 5IGBA 3HKZG 1L0YB 2VQFL 1D8LA 1ILQA 1PLFA 4JBWA 2JXMB 4A3IB 1EY8A 1ICFB 1EY9A 5FJ8H 4DV3L 1ML0D 2JQOA 2L11A 4NPSA 2R7ZH 1A3TA 1TKWB 5JVG3 3HOZG 4UP8A 3U4VA 2Q2IA 3BZCA 5IWAL 1FNWA 2EJGC 1HPCA 1NMFA 2IX1A 2K4KA 1SFOB 4QJFA 4X3TA 1TXYA 4BA2I 1XJVA 2ZT9C 1H9MA 1JICA 4X3SA 4RHRA 1TS5A 1N36L 2O5JC 4ZCKA 1TWFH 4RKBA 4UP7A 4XIGS 2ALYB 5M3MB 3J7AF 4QMGA 4OO1G 4A3EH 1JT8A 2D62A 3GTKB 4IUNA 4K5VA 5G3LD 4DK3C 3M4OH 2EVBA 1Z47A 1EYDA 4A3KG 2KQ3A 2WB1E 4OEMB 1O7YA 2CH4W 1JE5A 2QF7A 1U5KA 5EJWA 4MZ9A 2E2JB 2NVTB 2JSOA 1TS3A 4LF9L 1IXRA 2RSOA 1NTGA 3VR2A 1GM5A 4CJ1B 2MPMA 4IN3A 2H5XA 3T1HQ 1PRTD 4NXNQ 5CBEE 3OIPA 1D6EC 1YJWA 1M1KC 4NMZA 1CKOA 3UE1A 1ESRA 1M4VA 4FO2A 2JEAI 1JB3A 2E2DC 3A55A 3R93A 4YCUA 2VNUD 3OW7A 2MHVA 4LF5Q 3I56A 2E2HH 2F0EA 4BA1I 4XT3B 1ZKOA 4R4CA 2PQAB 3DLLA 1Y1VG 2UUBQ 3M3YB 3MXPA 2YU9H 1I4PA 3HRZC 5KNDA 1AZQA 1K8GA 2CCZA 5C4XB 3AFPA 4YY3Q 2L4NA 3NEMA 1A6XA 1A15A 3OMCA 1YZ6A 3S2DH 2F3IA 4OWXB 4C3JG 2OTJA 1JJCB 1P16A 1EIFA 1Q8IA 2X69A 5TSSA 3K8AA 4TSSA 4ILWA 1PFSA 3PUXA 1CI3M 4JI2L 3MXGA 2ZXRA 1LT3D 4F88A 3Q0AA 1A8VA 4ZUJA 1R9TB 2RHSB 3VR6A 1OXUA 2MO1A 3MA2B 1F2ZA 4U673 1G8ZD 4Q5VA 1SBBB 2Q8TA 3K59A 2WFWA 2I0QA 4RGOS 1NBWA 1DOKA 2MO0A 4PNYA 3MAQA 5GQOA 1MIUA 3T1YL 3E5SA 5D14A 4A3MG 3R3OA 1A63A 1SAPA 3HP3A 5JJKA 1FGUA 1BDOA 4EQ5A 3BDOA 2PNHA 3E3XA 4QUFA 3RLOA 4PQXA 2UUBL 2EY1A 3BYYB 1XTDA 2JA9A 1ZEQX 2R93H 1NSNS 3PIPA 2VB3X 2PQAA 3A74A 1ET9A 3NWSA 3TN2A 5IGGA 4CGYB 2NVYB 3W5OA 1GUWA 1F2LA 1MJEA 4FDBA 1BVSA 4G4KA 2XTIA 3KBXA 4O42A 1HR0Q 1HQMC 3EA6A 3I72A 3CC2A 2EJFC 3NELA 1SE2A 5J22A 1SEBD 3MVVA 2R7ZB 1MKHA 4CJ2C 5IYBG 3KJPA 2F0JA 3UDFA 1CA5A 3H3VH 1B7YB 4UAIA 3AEVA 4QL5A 4ALPA 4A3JG 1U4MA 4JCVE 2B29A 3KF6B 2R92H 1AFPA 1HA6A 5IT9E 5I2YA 4JI0Q 1HXYD 3U4ZA 1W2BA 5IGEA 2JA7H 4DUZQ 2NZ1D 3MXUA 4DR4Q 1XXGA 2Y0SB 4A3EB 4IALA 3M4OB 1Q8KA 1PZJD 1EZ8A 4IO9A 1E0BA 2PZUA 3A8KE 1TWCH 2ZTDA 3H09A 4YWLA 3LGJA 3H0GB 2UU9L 1GJXA 2KHJA 1QUQB 1STBA 1SYGA 1S5ED 1SNCA 2WINB 4GKJQ 3CQZH 2EYFA 3M85A 3DHQA 1F2YA 4X62Q 2QDLA 5ISRA 4LUZA 1LTAD 4A3CH 1SMXA 1B1ZA 5GAEC 1X3EA 4GS3A 2F0GA 1HR0L 3SHLA 2E2HB 4FF2A 3F8TA 3G7LA 4B3TQ 3J81i 4O1NA 1HJPA 4EX5A 1QVFA 3SR1A 3NTIA 3GTJB 2YU9B 1M90C 1HNZQ 1JWUD 3OTOQ 1KTKA 1WCMG 5IGCA 5JOBA 3PO2H 5CGKA 5KYLA 4X65Q 4JI4Q 4K0KL 1PA6A 3S2DB 1QWYA 4PZ7A 2Y0SE 4YCWA 3KF6A 1X55A 4GOPB 2VUMH 4DR4L 2KENA 2O4XA 4KY5A 4DV7Q 1Y8OB 1I4RA 1O80A 1NJIC 1HCZA 2E75C 2KBNA 4L5TA 1HFGA 4R4QA 4GN3B 1D5ZC 2L9HA 2ZJQA 2LXJA 5C44G 2F0PA 2N78A 1BQQT 1YVCA 3H3VI 1KHIA 3J81E 4GKJL 3FKIG 3HOYH 1QUQA 2XN9C 2VXWA 4ODGA 1GKHA 3NTKA 5C0XG 2F0NA 2QCPX 3K0YA 1VQIA 5ELFA 3I4LA 4FP5D 4TKOB 3PO3G 2LKVA 1IBLL 5KGUA 2BE5C 5E4XA 5GAHC 3NP8A 4X3KA 3W1BA 3T51B 4B3TL 4QCLA 2JP1A 2M2LA 3BYTB 2FMMA 4HCSA 2BOSA 1GUSA 1WTXA 4X6AH 2UXCQ 2Q8RE 5FO7B 1NR4A 5C4JH 1JOKA 3CMEA 3OTOL 2R93B 3I55A 1XNRQ 1Q1EA 3ULLA 4OL7A 4X65L 1BF4A 4JI4L 3D4WA 4OONA 1NE3A 1C8CA 5BN3A 5KEEA 4A3BH 4P71A 2VS1A 3CF5A 3KK7A 1SYDA 1AEXA 1PMRA 2G5DA 4ZKCB 4GOPA 1VQJA 1B53A 3I91A 2JA5B 2L55A 3CW2C 4JPBW 3A0JA 5EPKA 3G71A 3IL8A 1CUKA 3CC7A 1QZGA 5EAYA 3EVQA 4RKLA 4Y52H 4DR5L 5FO9B 4EQPA 1N32L 3RZDB 1U0LA 4K6LA 2JA7B 3AFQA 4EVOA 4POGA 1BCPD 3DEOA 2UUCL 1PH8A 4OIKA 5JEAJ 1I6HH 2N88A 4A93H 1TWCB 4Z9CB 3BZKA 1HNXQ 1BXTA 2O2LD 4OGQC 5ELOA 2BE5D 4WJ4A 4BY1G 4DF7A 4HIDA 1P8LA 1VQMA 2DJFC 1PH9A 4G7ZC 5K5PA 1EU3A 2EPBA 2A19A 2PMZE 4HMIA 2HQLA 1G2SA 1G291 2UXCL 3CQZB 2RCFA 2Z4HA 1SNPA 1XNRL 1YJ9A 4YWKA 2XNAC 5I2XA 1FYCA 2K75A 4YIJA 2XGTA 5ELCA 3WOEA 4EQOA 2P5ZX 1EFID 1O7ZA 5FLMG 4C3HH 1BO0A 1XMOQ 1LT4D 5M3FH 1PYSB 1J5EQ 5EBDA 4H44C 5I9PA 5IP7G 1VMCA 1HNWQ 5ELBA 1GO3E 1B9MA 4JV5Q 2C9OA 4A3IH 4ABNA 3PO2B 3NUCA 2AUJD 5IGDA 2JA8H 5L37A 1YHBA 3J7A5 3CPFA 3S15B 3RUZA 2VUMB 1SFOH 2R3ZA 2A8VA 2D2CC 1HNXL 1K8MA 2KECA 1X3PA 1Z6HA 4CDCC 3DWQA 5EBCA 5C5LA 5IP9G 2ES2A 2UUAQ 1E2ZA 1JE4A 4A3GB 3UE0A 3QG1A 2EQSA 3R2TA 2R61A 4IQZA 3SK5A 4NB3A 2Z8LA 2QGQA 2WKDA 3GTKH 4DV6Q 4R1JA 5GADC 3U50C 4P74A 1Y1WB 2MJ8A 2K7VA 2B63H 1WD0A 1KDCA 2NVTH 2HQEA 5CMDA 2EY2A 2E5LQ 3V2TA 5LL6S 1SRUA 5I9OA 4P72A 1XMOL 2NTSA 2CW0D 2Q2UA 3RLFA 2JA6B 3GTOB 1LACA 3FP9A 3SK6A 4XQQA 5JEAH 1HTPA 1J5EL 1OTCA 4ME3A 3TP6A 1HNWL 2L1BA 1Q90A 1K3RA 2EY5A 2WB1G 4M1UB 4JV5L 4L6TB 2BH8A 2D9UA 4QIWE 5IIFA 3S14H 4LUOA 2B2UC 1C48A 4RWSC 2EXZA 2YV5A 1VQOA 2EYLA 2HCCA 5LMUQ 1Z7TA 1AP0A 3O13A 4NP5A 2NN6I 5AFWA 3GTMB 3UI2A 4J1MA 1E7ZA 2FHTA 5C4XH 1A3UA 1JR0D 1V8QA 4F87A 1KRSA 3WWVA 2K5QA 4IPHA 2D5DA 3MFYA 3CCJA 2UUAL 1K83H 3WDNA 4NKLA 1I50B 3ND9A 2IPKD 4MTKA 1GVPA 2DGYA 4QF4A 4HTHA 1WTPA 1CZGA 1MD2D 3HOZH 1HZCA 2SDFA 5KNCA 1UUPA 1NMGA 3OWEB 1N8RC 2O5IC 2NB0A 4UP9A 1JMCA 4QUCA 1NY4A 1MHWC 4JW0A 1VQLA 4K6DA 3HOUH 1I6HB 2E5LL 3HZXA 2KHSA 4LAAA 4BWGB 4FYDA 1NAPA 1XNQQ 1HRJA 4BY7H 5I6YA 3QOLA 1DCZA 2XSCA 4IFDJ 5D3DA 5CV6A 3I2ZA 2IHFA 1LLRD 2A74C 1AW7A 3RZOH 3JAMc 1ZXTA 2Z6BA 4DR2L 1MSGA 2EZVA 1N9WA 1JOOA 1Q46A 2VB2X 3GP7A 5IYCG 4LNQA 2KCMA 1PTOB 1E2WA 1T5EA 3E0JA 1TWAH 2DNEA 2A68D 2ZTEA 5LMUL 4C3HB 1RODA 3DM1A 1IYUA 1C7YA 5M3FB 2HIXA 4L8JA 1VS0A 3CCSA 1XPUA 1UE5A 2NVYH 1LV9A 4A3LG 4JK1C 2MUYA 2B2WA 4PMCA 2J7ZA 2EYHA 1FNUA 3M4YA 1WOCA 4OXPA 2JA8B 4AYBB 1ENCA 3OHXC 1UE1A 3HOVH 3DUZA 1SYEA 1FGBD 1QCBD 4A76A 2F0WA 1Q3LA 4ZKBB 4OX9Q 4KN7C 3SE0A 3OYYA 1VCIA 1X54A 4C2MB 3HS0C 4QQBX 1PTOF 2NZOA 4R9WA 2F0OA 2OXPA 1PFMA 2IHEA 4POFA 4BBSB 5C3EG 4JYAQ 1YITA 1Y69U 1PZID 3K5NA 1X3GA 3D0FA 3KLWA 5IT9c 3OPOA 3H0GH 2B63B 2HT1A 5A35A 4DAVA 4KV6A 2RF4A 3I4NG 3C3LA 3GV3A 4NXMQ 4IZ8A 1PFBA 2F0DA 2WACA 4KI0A 3CCQA 1X3QA 1E1OA 4QB4A 3QO2A 1SNOA 2KUMA 1U9RA 3F2UA 4DV2Q 3QWNA 2KEEA 3KJOA 1VQPA 2RDGA 1N33Q 4OO1I 1K8OA 1TR5A 1RIPA 4RCNA 2KCCA 4GOPC 4B3MQ 2IJ0A 2Q2TA 1A0IA 1PZKD 3P7JA 1HHVA 4LW1A 3CRLC 4IFDH 4K5XA 3S14B 3A54A 3VR4A 1MGSA 1H9RA 4KKUA 3DM3A 1NCVA 2X6LA 4JBKA 2CVRA 4KMUC 2XRQD 5GROA 4RGMA 4BBRH 5IYDG 1L1OB 3GTJH 1ZYRC 3AQQA 5D65A 3GDEA 4OX9L 4V190 2CKZB 2IX0A 1VQEA 5J3BA 3HKZB 3I4OA 4ZRZA 4LFAQ 5FJ8G 5CC4A 1K83B 3IKJA 4H02A 1Q7YC 2R7ZG 1EOVA 4YCVA 1K0SA 1XMQQ 3KOJA 3TEHB 4JYAL 3HOZB 3A8JE 1CTMA 4K2KA 5IYBH 4KHVA 2NZHA 2JN4A 2PCFB 3Q8DA 4A3JH 3HOUB 5I6WA 5C0XJ 3SEBA 1N34Q 3MEFA 3A5UA 2MNAA 4NXML 3UDIA 5GAGC 2MFIA 1KNAA 4CDFC 2B2TA 5K36H 4BY7B 3T1HL 1VF5C 2PW7A 2Y0SG 4NXNL 4A3EG 4LF8Q 4DV2L 3SXHA 3NENA 1N33L 3RZOB 1WJJA 4M8AA 3NBHB 4B3ML 4HJ7A 1LTLA 4LF5L 3BU2A 1ET6A 5E7NA 3K0XA 1YEZA 3TS0A 1OXXK 5CV4A 4HR7B 4CHTB 3G48A 1TWAB 2DN8A 2LMCB 4A3DG 3H3VC 4ZAIA 2K52A 5C4HA 1DZ1A 4DXFA 2N49A 1NR2A 4YY3L 1B44D 2DY7A 1L1OA 4KTAA 3LWUA 2KJXA 4LFAL 5DAUA 2RQXA 3JAML 3GQBA 3CCEA 2Q8IB 2L5TA 4A3FG 2ICIA 3TDQA 1RF2D 1K9MC 4IFDI 3N6RA 4IOAA 1PV4A 1Y1VB 3PF4A 1VQFA 2JA5H 3T56B 3HOVB 2VW9A 1DOMA 3STBC 3I4MG 1WCMH 4OWWB 4R4IA 2B2UA 4BXXG 1SNQA 1IHZA 3AYHB 2AWNA 3BG3A 4EGVA 1N34L 4R8IA 2J4XA 4Q0FA 4C3JB 3RZDH 2CQAA 4LMQD 4LF8L 1S5FD 3V05A 3VA5A 1EY0A 4DFAA 2H1EA 2I07B 3ER0A 1VQ7A 1VQGA 2EXDA 5M9OA 4Y7NH 3S1NH 5IE8A 1EIYB 5C44H 5HY6A 1RJTA 1SYFA 3NBHA 4L63B 1E1TA 1TY0A 2BA0A 5C4ZA 1PH3A 4O2DA 1K73C 3CC4A 5EPLA 2QDBA 3BVGA 2PNRC 4PMWA 2JEBI 3KLRA 3BZDB 4C3IH 5C0XH 4DK0A 3D6WA 4A3MB 3HG9A 1E2VA 2BH2A 1EEFD 1KABA 2AMCB 3ITPA 5IY0A 1JC7A 3CRKC 5CV8A 1AZPA 2NVQH 5IT9L 2I46A 1SLJA 4DNTB 3GO5A 2V4DA 1EQVA 2AQ1B 4K2LA 1H9SB 4BBRB 1GD7A 1PFNA 3STBD 2VZAA 5C5MA 3H94A 4H0LC 4K8JA 2HD3A 2AQ3B 1BBUA 2A6HC 1HZAA 1V1PB 1YHAA 3E6ZX 5FLXc 4JI0L 2CFMA 3S9WA 3S15H 1VQ9A 4DUZL 1I4GA 3Q23A 4HJ5A 1EYGA 1PH6A 1WTWA 1BBXC 2B2VA 1ASZA 2LXKA 1XPRA 4R4TA 2HHHQ 2QA4A 1RCVD 1GUTA 3TBIB 3PIOA 2R92G 1EWIA 2EE1A 1F9SA 4GKKQ 2B2YA 3E0EA 4A3GH 4A3JB 2PO4A 1VF7A 1LTSD 1WTOA 3L0OA 2ASBA 1KD1C 2E74C 1OO9B 1STHA 2JA7G 2HIVA 3CCVA 1FVIA 2F52A 3C2PA 2CH4A 5DM63 4N8X1 1SNDA 1GUOA 4X62L 1TS4A 4I65A 1Y1WH 3C1FA 4RGTA 4TRDA 4DV4Q 4UDUC 4TQUS 2JE6I 1U4PA 4UY8C 4R4OA 1VQ5A 3GTOH 2B2WC 2JA6H 3A56A 3DEPA 2AWOA 3RNUA 4HMJA 1XYIA 3U58A 2L15A 5E4WC 1UEBA 1Y14B 1B2TA 3G6JB 2EYMA 4N9TA 1XPOA 2WKCA 1HNZL 2BDOA 5CYUA 3J7AV 4JI5Q 1CT1D 3CPWA 4DV1Q 1EY4A 1VQAA 3CU7A 4A3CG 5LHY1 2RA4A 1X3FA 1WD1A 2F0QA 3BJUA 1L2FA 1OXTA 1H9SA 2XRSD 1WTHA 2A6HD 1H9KA 4DAYB 1YHQA 1JJGA 4MNOA 3TSSA 5C0XI 1KNEA 1HTLD 2IL8A 1H95A 3HOXH 3J80c 5FLMH 4HJ9A 3A5ZB 2KA7A 1V1PA 1RL2A 5C3WA 5KIXA 3GTMH 4DV7L 4KD4A 3MTSA 5FKAC 3W1GA 2K5HA 2QW7A 1YJNA 1YNNC 4CKBA 5IP7H 4L5SA 4B9WA 2HHHL 4RMFA 1TY2A 1B8AA 4KD3A 2YYZA 1WCMB 3K5OA 3IRBA 2CWAA 1I50H 3FHWA 5A2QL 1TS2A 1STYA 1CKNB 4UHVA 5C6AA 4IPGA 3R8BA 1X6OA 2VUMG 2YTVA 3FDTA 3J7ZC 4DR7Q 2RSNA 4KJOA 1PTOC 2YTYA 4B3RQ 3FMCA 1IKLA 3PIP3 4DV4L 3E9HA 3F2CA 1W3SA 1VQ4A 2Z0SA 4KK7A 4Y7NB 3S1NB 1V43A 2I5MX 1IL2A 5C44B 1DYQA 4C1NI 1GXDC 1IZ6A 5BR8Q 3CD6A 2HCIA 3HOYG 4X66Q 3S1QB 1CSQA 1EEID 2I5HA 3FKIB 1S4ZA 1MI2A 2FJ2A 1C0AA 4DV1L 1IL8A 4LK1C 3S1RH 2PZWA 1X9NA 4C3IB 4DR1Q 3PMFA 2K01A 4HIKA 1PTOH 5CBAE 1E3PA 1YI2A 1V9PA 2QKIC 3PO3B 3HOWH 1D1KA 3IFDA 1X32A 4KKTA 2NN6H 4KHZA 4DAYA 3EQLC 2TMPA 1TWGB 2NVQB 4DNIA 1SN8A 2Q2HA 1EIHA 2A69C 1I6VC 1EYAA 3OWFA 1QG7A 1Y8NB 1IBMQ 3UDXA 1EQRA 2AQ2B 2HDMA 2K1BA 1I5FA 3KYHC 1PH4A 1QNKA 2OTLA 3L3OC 5NUCA 5BN4A 1G91A 4A3BG 3CCLA 1G6ZA 1CKNA 3S1MH 2B2TC 1WTRA 4B3RL 1BR9A 1LTRD 4WJ3M 5J39A 3NPPA 4IPCA 5EKLA 3EN2A 4JG2A 3K7AH 3K5MA 3H91A 3A8IE 4CBVA 4C2MH 1JWMD 1IYJB 4KHPQ 1UE7A 4DXGA 1G51A 3F1ZA 1HH2P 3ERQA 3FPPA 2NUCA 3HKSA 2I5LX 3K80C 3MHBA 3NE5B 1GUNA 4BBSH 3LWEA 2M00A 3KLSX 1KDAA 1DOLA 2WAQB 5FK9C 1JQYD 5FLXL 4DR1L 2K03A 3AB9A 3D4DA 2PPBC 1VQHA 2GVAA 3JC66 4A93G 2WIIB 1FD7D 4PMBA 3TP5A 1ENAA 1L1OC 5ELDA 1RD9D 3I8ZA 4JOIA 4BY1B 3PSIA 1FNVA 4ZK9B 1LT6D 2A69D 2A6EC 4F7XA 5JJZA 1CKMA 2K5VA 1IBML 4OHJA 4ME5A 2K32A 3M4QA 1A3VA 4N8FA 4XT1B 4PG3A 4LWCA 2ZXPA 4ZYSA 4J15A 3NHHA 3KBGA 4C3HG 3TMEA 3HOXB 4U68A 2XIWA 5M3FG 2OWOA 1NNXA 3RD4A 3LX0A 4AQYQ 3P75A 4LF4Q 2F0LA 2F0SA 2WV6D 4RGNA 3UDGA 4MN3A 1TVXA 4CKCA 4A3IG 4FF4A 4KHPL 4A4IA 3I7FA 5HGTA 4B3SQ 2JA8G 1U4LA 3HGBA 3AU7A 2WAQE 4IPDA 4DV6L 2B8GA 3K6OA 4RHSA 2WP8J 1EL0A 3BDLA 3DMUA 1FL0A 3J80L 2JYOA 1PH2A 4LFBQ 2UXDQ 3GTPH 3G4SA 1CA6A 4B08A 4DPGA 1B70B 4DR6Q 3EJIA 2L0CA 3A7LA 1UAPA 5COYA 3ULPA 5M3MG 4DV3Q 1Q1BA 3H15A 3Q24A 5HGQA 3L2PA 1WTQA 1ASYA 1LUZA 1AE2A 3MXNB 4OO1H 4RCOA 4J8QA 3IFTA 3EFXD 4XXEA 3K5LA 3S17B 1RTNA 1VQCA 1SSOA 4A3KH 1K8AC 4HIOA 1LTGD 3U9OA 2K50A 1TWHH 3GD7A 3S1RB 1QVGA 3SVMA 1GHKA 1N36Q 4LF7Q 2YTXA 3ONAB 2OF1A 4WJWA 3H6MA 2JJQA 3PQIA 4K14A 2BCOA 1O7LA 1A2UA 3I4NH 3HOWB 3TZUA 2HUGA 3V96A 1W6JA 3QOJA 3ZYYX 4C56C 5JEAG 4IURA 4AQYL 4LF4L 1WYDA 4DK6C 4KN4C 3Q6SA 4TVAB 3PUWA 1K28A 1M8AA 1LM0A 1KLGD 1HR0W 2RDFA 4FF1A 1HQRD 2B2VC 2WB1B 2QILA 3GV6A 4B3SL 2RCNA 1RHPA 5J1ZA 1JJ2A 2E2IH 5EKKA 1SJHD 4O0AA 2B2YC 1HZ9A 3BVMA 1AE3A 5CV9A 2H4OA 1Y1VH 2OQ0A 1YBYA 1U4RA 4KY7A 5IYDH 2LS01 3T13A 3S1MB 2C5CA 4V0BA 1V1OA 4LFBL 5C4XG 2F0KA 1LABA 1SROA 3J81j 5LMNW 3ND8A 1X65A 2F4VQ 3EIVA 1EWHA 3K7AB 4DR6L 1XNQL 1I94Q 2BA1A 2RDHA 4C3JH 1H9JA 2M9VA 5EQ0A 2J0TD 1DM0B 5EGTA 4KY6A 2KOLA 2EYPA 5ELEA 2K14A 5IOCA 1C9OA 1SYCA 2NTTA 1KLUD 4HJ8A 3MXNA 1EQQA 3HOUG 2X6GA 5KNBA 2NYZD 3GTQB 1KXLA 4LF7L 2Z4IA 2ZM6Q 2A73B 2AHOB 3K7UC 1ICWA 3OSOA 2D0OA 2JK8A 4BY7G 2SNSA 2EYJA 2EY6A 1JOQA 2MGSA 4FXKC 1JCKB 4E6IA 4P75A 5CORA 4DV5Q 3OW2A 4JI2Q 5M5YB 2RKSA 1B3AA 4A3MH 4L5RC 3RN2A 2B39A 2PYKA 3VYTA 4G7OC 1ILPA 4KKSA 2OT2A 4AYBE 3KDFB 4JBJA 3HFZB 1X56A 4QGUA 1BOSA 5BN5A 2DJGC 5JJIA 1R4PB 2D0PA 4DU9A 4A3DH 2AUKA 2LSSA 3RR5A 4DR3Q 4BS9A 4ID6A 3J7YW 2F4VL 3T1YQ 2G9DA 5CR3A 3MZ5A 4XTCS 4YHHQ 3MWYW 1I94L 3JAMi 3T4AC 3TREA 4JVZA 3E9IA 4GN4B 4DAPA 1CZWA 5DEHA 4A3FH 1I3QB 1IYVA 3D8GA 2CQOA 3EROA 4GLVB 1SDFA 3HOVG 4YWMA 5E1FA 4PV1C 4G57A 1DGSA 3VDYA 1B50A 3I4MH 4B9XA 3CXCA 3GTPB 5FOBB 4BXXH 2ZM6L 1RDPD 2SOBA 3M4PA 5JPNC 3NXWA 2F0TA 2FINB 1QOHA 3I3CA 4R8NA 1CM9A 3FVQA 2B3GA 4GNXB 2KEDA 4DV5L 3FEWX 3ICEA 2UXBQ 1RKNA 1S5BD 4XYOA 1LTBD 5C3EB 3H0GG 1AN8A 3NQTA 5M5XH 4A3KB 1AH9A 3TP7A 3PUZA 3JAME 2FFKB 1KRTA 1TWHB 1XX8A 5M5WH 3J81c 1G6PA 1J6QA 2EOTA 1UE6A 1LO5D 3I4NB 3DWPA 4G7HC 1EUJA 3KDFA 3RN5A 1D7QA 5C3XA 4DR3L 1ZYRD 3MC0B 3DXJC 2GN5A 2PI2E 3HKZE 3SDZA 3C46A 4I7AA 2N55A 4YHHL 1PH7A 2F03A 4IFDG 2UU9Q 3S2HH 3TS2A 1EU4A 2K28A 3CP0A 4HEDA 4K5WA 1Q81C 2PI2A 2E2IB 1KAAA 1XMQL 1OXVA 2SEBD 4BBRG 1EIGA 3S24A 3KLSA 4WRDA 3L7ZC 2R6GA 4HIMA 3VR5A 1VQKA 2F0UA 3GTGH 2XWBB 3D4RA 1KC8C 4GLAC 3G6EA 1EZ6A 1Z9FA 3TQYA 1CFMA 3T53B 4GLXA 5LL6X 2Z6KA 4CJ0B 1F9QA 1ONLA 1G2TA 2NBFA 2NVXH 2IY5B 3X3MA 4JOIC 2UXBL 1D2BA 1YNXA 4C1NK 4FF3A 1O78A 1I4HA 1STGA 3OMGA 1TIID 4GNXA 4NDXA 4CKEA 4KLKA 3BS1A 1FR3A 3X3NA 4OWTB 2PZTA 3Q22A 1PRTB 3VYSA 2NWGA 4CDDC 1S72A 4K0KQ 5LMNQ 2B8FA 5T1IA 1KQSA 1QILA 1XTCD 2V1CC 3S1QH 1T9HA 1TWFB 3K58A 5K36G 3SGIA 3FKIH 1R4QB 4LFCQ 1BUVT 2DY8A 1FJGQ 2F4IA 2Z1CA 3URYA 2G9HD 1HZBA 4RH6A 3RMHA 2KHIA 1MSHA 1EY5A 3PO3H 4GZYC 1PYBA 4FNFA 5G3LF 1A62A 2F1MA 3KF8B 1TWGH 4IUQA 1Q82C 2R93G 1HFNA 4DAMA 1IBKQ 1VQBA 4A3DB 4MTNA 1QNUA 3OIQA 2LFNA 1WI5A 2K5WA 1PRTF 1IBLQ 2DNCA 3AMUA 3PUYA 4ZLTF 5JAVA 2KCTA 2OCEA 4A3FB 3S16H 2JA5G 1CK1A 2R7DA 4XQNA 3D3RA 1D5XC 1QB5D 3F2BA 2EJMA 4L5QA 2XVSA 3I4MB 4HN7A 5LMNL 1K3BC 2N8NA 1YNJC 5EPJA 4LFCL 1DJRD 4OELB 4JI7Q 5KRUA 4FXGC 1FJGL 2MP1A 1VQDA 4WFN3 3GTLH 1SR3A 1UWVA 3NTHA 3PGZA 1F77A 3W3AA 2F0HA 2RBMA 1VDZA 3M9BA 4FXDA 1KIXA 2PW5A 1GUGA 5M5XB 4IJHA 4BY1H 5M5WB 3FPUB 5FO8B 4XYQA 1LTID 3CHBD 4DR5Q 2ENBA 2ATWA 1N32Q 3NSWA 1EOTA 4HSVA 5HURA 1IBKL 1HUNA 2VY3A 3KF8A 1S3OA 1PXUA 1BCPC 2E8GA 3D31A 4C3IG 4K8IA 3I90A 1Y8PB 1QZHA 4X3UA 2UUCQ 3QJYA 5EKIA 1WVLA 3NK9A 5A2QE 4IUPA 1BNZA 4KJNA 1J8IA 2ZJRA 1L0WA 3S2HB 2Z9HA 3EBEA 1OXSC 1ESFA 3IAYA 3J81L 3CCUA 2PMZB 1IW7C 4FVMA 2GA4B 2BDNA 5DM73 1PHJA 1QE6A 3RLNA 2K5NA 2F0VA 3M7NA 3PO2G 1SE4A 4GKKL 1Q86C 3GTGB 5JPMC 3P20A 2F0MA 2A5HA 1YNJD 3VR3A 1JB7A 3B6YA 4JI7L 3HEJA 1S5DD 4PZ8A 4ULLA 3FRPB 3R2IA 1S40A 2NVXB 4AIMA 3A7AB 4EQNA 4S3SA 2VL6A 1MBYA 2ICEC 3PF5A 2OEOA 3BDCA 3I70A 2ZXOA 1V1QA 1VQNA 4A3GG 5KYIA 1YIJA 2R92B 5IP9H 3NBIA 5CV7A 4LUVA 3W2DA 2OQKA 4HJAA 2WAQG 3S17H 1BKBA 1I4QA 1Y1WG 4JI5L 1VQ8A 4OIJA 5I4DA 1TT2A 3ULJA 4DNRB 1W6KA 2ID0A 2FXQA 4JI1Q 3KUPA 1RTOA 2L12A 5DNFA 4DV0Q 1SE3A 2JA6G 1STAA 3QIAA 5H1SE 4MHEA 1JWSD 4APVA 1SJED 1PDQA 3QB3A 1CHPD 1YNND 2PQEA 1IW7D 1XWEA 3DWAA 3MFGA 1VQ6A 4A75A 3LNNA 2CWPA 4JI6Q 4X64Q 1B4OA 3PUVA 4P73A 4N9PA 1EWCA 1DD2A 1NUCA 3HOXG 3K57A 3K81C 2EDGA 2RVLA 1TQOA 2CW0C 4H13C 1GHJA 2LY7A 4DR7L 5FLXE 1PTOD 3KFUA 1WFQA 3S16B 1QVCA 3TZDA 3TP8A 3OOCA 2F3VA 5IGFA 1JORA 3SK4A 5JJLA 4CDEC 2FMCA 4DUYQ 3VYUA 4QIWB 5BR8L 2QEXA 1E22A 4X66L 4RG1A 1EY7A 3CMAA 3J80i 4DA2A 1J9OA 3GTLB 4I7ZC 2F3WA 4H7BA 4DN4M 3GTQH 1F2MA 4JI1L 5D3IB 4DV0L 1UEAB 1SMYC 5M3MH 4LF6Q 4UPAA 1CQVA 3MEHA 1Q12A 3SK8A 2IW3A 3HOYB 1PH5A 1LT5D 5M5YH 3M7GA 5F2DA 1VMPA 3VA7A 2KCNA 5IODA 4JI6L 1KL9A 4P2CB 4X64L 3N52A 2E2JH 2N3SA 1LYLA 2K05A 5IYCH 3PIO3 3HOWG 2KVMA 2EYOA 1SE8A 2NN6G 3U9SA 3L9AX 5ELNA 1LTTD 4HCEA 4JI3Q 2Z6KC 2K6AA 1D1IA 3J80E 1CSPA 1PH1A 3PCOB 3TRZA 4F8MA 2C35B 4NW2A 5C4JB 4DR2Q 1MJCA 5AJ3Q 2K33A 4IUVA 4DUYL 4GNXC 4A3LH 2K5DA 1E24A 1KAWA 1SNMA 4HAEA 2K04A 1BCPB 1CQFA 3C1EA 4DKAC 1K0RA 1I3QH 1S5CD 4AYBG 4RAUC 1PYWD 2IWHA 3M3YH 2A68C 1B3QA 4ZUIA 2VQEQ 4A3BB 1STNA 2SNMA 3CAMA 1CHQD
chains in the Genus database with same CATH topology
1I4XA 3T16A 3VYRA 1DXMA 5T1GA 1QJOA 4DGZA 1SMYD 3I73A 1DONA 5JVH3 2HDLA 3NQIA 1C4QA 1D5MC 2F0IA 4IUTA 1SXTA 4MIUA 2A6ED 4XQJA 5CV5A 4IUUA 1HA5A 2E76C 4HSPA 3BVZA 2CHBD 1EQTA 1STEA 2IT1A 1L0XB 4A93B 1F9PA 1UNSA 1BCPF 4DK1A 1IKMA 1SYBA 4J6HA 1GOZA 1KDBA 4LJZC 2IX3A 1B9NA 1II3A 1EYCA 4RA8A 3NWTA 2QEJC 2TSSA 4WORA 1EY6A 1A2TA 1TU2B 4XDXA 1F9RA 2F0FA 4ZQ3A 1T5XD 4RFBA 3CKIB 1ENFA 3P1HA 1PRTC 3D6CA 3WOFA 1WTVA 3PV0A 5E3FA 1HUMA 2XWJB 5IGBA 1L0YB 1ILQA 1PLFA 4JBWA 2JXMB 4A3IB 1EY8A 1EY9A 1ML0D 2L11A 1A3TA 1TKWB 5JVG3 1FNWA 2EJGC 1HPCA 2IX1A 1SFOB 4X3TA 4BA2I 2ZT9C 1H9MA 1JICA 4X3SA 4RHRA 1TS5A 2O5JC 4RKBA 4XIGS 3J7AF 5M3MB 4QMGA 4OO1G 2D62A 3GTKB 4IUNA 4K5VA 5G3LD 2EVBA 1Z47A 1EYDA 2KQ3A 1O7YA 2QF7A 5EJWA 2E2JB 2NVTB 2JSOA 1TS3A 2RSOA 3VR2A 4CJ1B 2MPMA 4IN3A 1PRTD 5CBEE 3OIPA 1D6EC 4NMZA 1ESRA 1M4VA 4FO2A 2JEAI 1JB3A 2E2DC 3A55A 3R93A 2VNUD 3OW7A 2MHVA 2F0EA 4BA1I 4XT3B 1ZKOA 3M3YB 3MXPA 1I4PA 3HRZC 5KNDA 1AZQA 5C4XB 2L4NA 1A6XA 1A15A 3OMCA 4C3JG 1Q8IA 2X69A 5TSSA 4TSSA 4ILWA 3PUXA 1CI3M 3MXGA 2ZXRA 1LT3D 4F88A 3Q0AA 4ZUJA 1R9TB 3VR6A 1OXUA 3MA2B 1F2ZA 4U673 1G8ZD 4Q5VA 1SBBB 2Q8TA 3K59A 4RGOS 1DOKA 4PNYA 3MAQA 3E5SA 5D14A 3R3OA 1SAPA 3HP3A 1BDOA 3BDOA 4QUFA 4PQXA 2EY1A 3BYYB 1ZEQX 1NSNS 2VB3X 1ET9A 3NWSA 3TN2A 5IGGA 4CGYB 2NVYB 1GUWA 1F2LA 4G4KA 4O42A 3KBXA 1HQMC 3EA6A 3I72A 2EJFC 1SE2A 5J22A 1SEBD 3MVVA 2R7ZB 4CJ2C 2F0JA 1CA5A 4UAIA 1U4MA 1AFPA 1HA6A 5IT9E 5I2YA 1HXYD 5IGEA 2NZ1D 3MXUA 1XXGA 2Y0SB 4A3EB 4IALA 3M4OB 1PZJD 1EZ8A 1E0BA 2PZUA 3A8KE 3H09A 3H0GB 1GJXA 1STBA 1SYGA 1S5ED 1SNCA 2WINB 2EYFA 3M85A 3DHQA 1F2YA 5ISRA 1LTAD 1B1ZA 2F0GA 3SHLA 2E2HB 4FF2A 3G7LA 4O1NA 3SR1A 3NTIA 3GTJB 2YU9B 1JWUD 1KTKA 5IGCA 5JOBA 5CGKA 5KYLA 3S2DB 1QWYA 2O4XA 4KY5A 1Y8OB 1I4RA 1O80A 1HCZA 2E75C 1HFGA 1D5ZC 2L9HA 2F0PA 1BQQT 3J81E 2XN9C 2VXWA 4ODGA 3NTKA 5C0XG 2F0NA 2QCPX 3K0YA 5ELFA 3I4LA 4FP5D 4TKOB 2LKVA 5KGUA 2BE5C 5E4XA 3NP8A 4X3KA 3T51B 4QCLA 2JP1A 2M2LA 3BYTB 2FMMA 4HCSA 2BOSA 1GUSA 1WTXA 2Q8RE 5FO7B 1NR4A 1JOKA 2R93B 1Q1EA 4OL7A 1BF4A 3D4WA 1C8CA 5BN3A 5KEEA 3KK7A 1SYDA 1AEXA 1PMRA 4ZKCB 1B53A 3I91A 2JA5B 2L55A 5EPKA 3IL8A 3EVQA 4RKLA 5FO9B 4EQPA 3RZDB 4K6LA 2JA7B 4EVOA 1BCPD 3DEOA 4OIKA 5JEAJ 2N88A 1TWCB 4Z9CB 1BXTA 2O2LD 4OGQC 2BE5D 4DF7A 4G7ZC 5K5PA 1EU3A 2EPBA 4HMIA 1G2SA 1G291 3CQZB 2Z4HA 1SNPA 2XNAC 5I2XA 1FYCA 4YIJA 5ELCA 3WOEA 4EQOA 1EFID 1O7ZA 1BO0A 1LT4D 5EBDA 4H44C 5I9PA 1VMCA 5ELBA 1B9MA 2C9OA 4ABNA 3PO2B 3NUCA 2AUJD 5IGDA 3S15B 3RUZA 2VUMB 2R3ZA 2D2CC 1K8MA 2KECA 1X3PA 1Z6HA 3DWQA 5EBCA 5C5LA 1JE4A 1E2ZA 4A3GB 3QG1A 3R2TA 2R61A 4IQZA 3SK5A 2Z8LA 2WKDA 1Y1WB 2MJ8A 2K7VA 1WD0A 1KDCA 2HQEA 5CMDA 2EY2A 3V2TA 5LL6S 5I9OA 2NTSA 2CW0D 2JA6B 3RLFA 3GTOB 1LACA 3SK6A 4XQQA 5JEAH 1HTPA 3TP6A 2L1BA 1Q90A 2EY5A 4M1UB 4L6TB 2D9UA 5IIFA 2B2UC 1C48A 4RWSC 2EXZA 2EYLA 2HCCA 1Z7TA 1AP0A 3O13A 4NP5A 2NN6I 5AFWA 3GTMB 3UI2A 4J1MA 2FHTA 1A3UA 1JR0D 1V8QA 4F87A 2K5QA 2D5DA 3MFYA 3WDNA 4NKLA 1I50B 3ND9A 2IPKD 4QF4A 4HTHA 1WTPA 1CZGA 1MD2D 2SDFA 5KNCA 1UUPA 3OWEB 2O5IC 2NB0A 4QUCA 4K6DA 1I6HB 3HZXA 2KHSA 4LAAA 4BWGB 4FYDA 1NAPA 1HRJA 5I6YA 3QOLA 1DCZA 2XSCA 4IFDJ 5D3DA 5CV6A 1LLRD 2A74C 1AW7A 1ZXTA 1MSGA 2EZVA 1JOOA 2VB2X 3GP7A 1PTOB 1E2WA 1T5EA 3E0JA 2DNEA 2A68D 4C3HB 1RODA 3DM1A 1IYUA 5M3FB 4L8JA 1LV9A 4JK1C 2MUYA 2B2WA 4PMCA 2J7ZA 2EYHA 1FNUA 3M4YA 2JA8B 4AYBB 1ENCA 3OHXC 1SYEA 3DUZA 1FGBD 1QCBD 2F0WA 4ZKBB 1Q3LA 4KN7C 3SE0A 1VCIA 4C2MB 3HS0C 1PTOF 4R9WA 2F0OA 2OXPA 1PFMA 4BBSB 1Y69U 1PZID 3K5NA 3OPOA 2B63B 5A35A 4DAVA 4KV6A 3C3LA 3GV3A 4IZ8A 1PFBA 2F0DA 2WACA 4KI0A 1X3QA 4QB4A 3QO2A 1SNOA 2KUMA 1U9RA 3F2UA 3QWNA 2KEEA 2RDGA 4OO1I 1K8OA 1TR5A 4RCNA 2KCCA 2IJ0A 1PZKD 3P7JA 1HHVA 3CRLC 4IFDH 4K5XA 3S14B 3A54A 3VR4A 1MGSA 1H9RA 4KKUA 1NCVA 2X6LA 2CVRA 4KMUC 2XRQD 4RGMA 1ZYRC 5D65A 4V190 2IX0A 3HKZB 4ZRZA 5CC4A 1K83B 3IKJA 3HOZB 3A8JE 1CTMA 4K2KA 4KHVA 2PCFB 3HOUB 5I6WA 5C0XJ 3SEBA 1KNAA 2B2TA 5K36H 4BY7B 1VF5C 2PW7A 3SXHA 3RZOB 4M8AA 1ET6A 1OXXK 5CV4A 4HR7B 4CHTB 1TWAB 2DN8A 2LMCB 3H3VC 4ZAIA 5C4HA 1DZ1A 4DXFA 1NR2A 1B44D 2DY7A 4KTAA 3LWUA 2KJXA 5DAUA 2RQXA 3JAML 3GQBA 2Q8IB 2L5TA 2ICIA 3TDQA 1RF2D 4IFDI 3N6RA 1Y1VB 3T56B 3HOVB 1DOMA 2B2UA 1SNQA 1IHZA 4EGVA 2AWNA 3BG3A 4R8IA 2J4XA 4Q0FA 4C3JB 2CQAA 4LMQD 1S5FD 3V05A 3VA5A 1EY0A 4DFAA 2H1EA 2I07B 5M9OA 1RJTA 1SYFA 3NBHA 4L63B 1TY0A 2BA0A 5C4ZA 5EPLA 2QDBA 3BVGA 2PNRC 4PMWA 2JEBI 3KLRA 3BZDB 5C0XH 4DK0A 3D6WA 4A3MB 3HG9A 1E2VA 1EEFD 1KABA 3ITPA 1JC7A 3CRKC 5CV8A 1AZPA 5IT9L 2I46A 4DNTB 3GO5A 2V4DA 1EQVA 2AQ1B 4K2LA 1H9SB 4BBRB 1PFNA 5C5MA 3H94A 4H0LC 4K8JA 2AQ3B 2A6HC 1V1PB 3E6ZX 3S9WA 1I4GA 3Q23A 1WTWA 1BBXC 2B2VA 1RCVD 1GUTA 3TBIB 2EE1A 1F9SA 2B2YA 4A3JB 2PO4A 1VF7A 1LTSD 1WTOA 2E74C 1OO9B 1STHA 3C2PA 5DM63 1SNDA 1GUOA 1TS4A 4I65A 3C1FA 4RGTA 4TRDA 4UDUC 4TQUS 2JE6I 1U4PA 2B2WC 3A56A 3DEPA 2AWOA 4HMJA 1XYIA 5E4WC 1B2TA 3G6JB 2EYMA 4N9TA 2WKCA 2BDOA 5CYUA 3J7AV 1CT1D 1EY4A 3CU7A 5LHY1 2RA4A 1WD1A 2F0QA 2XRSD 1H9SA 1OXTA 2A6HD 1H9KA 3TSSA 5C0XI 1KNEA 1HTLD 2IL8A 2KA7A 1V1PA 5C3WA 5KIXA 4KD4A 3MTSA 5FKAC 1YNNC 4CKBA 4B9WA 1TY2A 4KD3A 2YYZA 1WCMB 3K5OA 5A2QL 1TS2A 1STYA 5C6AA 3R8BA 3FDTA 2RSNA 4KJOA 1PTOC 3FMCA 1IKLA 3PIP3 4KK7A 4Y7NB 3S1NB 1V43A 5C44B 1DYQA 4C1NI 1GXDC 2HCIA 3S1QB 1EEID 3FKIB 1S4ZA 1MI2A 2FJ2A 1IL8A 4LK1C 2PZWA 4C3IB 3PMFA 2K01A 1PTOH 5CBAE 2QKIC 3PO3B 1D1KA 3IFDA 1X32A 4KKTA 2NN6H 4KHZA 4DAYA 3EQLC 2TMPA 1TWGB 2NVQB 1EIHA 2A69C 1I6VC 1EYAA 3OWFA 1QG7A 1Y8NB 2AQ2B 2HDMA 2K1BA 1QNKA 3L3OC 5NUCA 5BN4A 1G91A 1G6ZA 2B2TC 1WTRA 1BR9A 1LTRD 5J39A 3NPPA 5EKLA 3K5MA 3H91A 3A8IE 4CBVA 1JWMD 4DXGA 3ERQA 3FPPA 2NUCA 3MHBA 3NE5B 1GUNA 3LWEA 2M00A 3KLSX 1KDAA 5FK9C 1DOLA 2WAQB 1JQYD 5FLXL 2K03A 3AB9A 3D4DA 2PPBC 2WIIB 1FD7D 4PMBA 3TP5A 1ENAA 5ELDA 1RD9D 3I8ZA 4BY1B 1FNVA 4ZK9B 1LT6D 2A69D 2A6EC 4F7XA 5JJZA 4OHJA 4ME5A 2K32A 1A3VA 4XT1B 2ZXPA 4ZYSA 3NHHA 3KBGA 4C3HG 3TMEA 3HOXB 4U68A 2XIWA 3RD4A 3LX0A 3P75A 2F0LA 2F0SA 2WV6D 4RGNA 4MN3A 1TVXA 4CKCA 4FF4A 5HGTA 1U4LA 3HGBA 3AU7A 2B8GA 3K6OA 4RHSA 2WP8J 1EL0A 3BDLA 3DMUA 3J80L 2JYOA 1CA6A 4B08A 3EJIA 2L0CA 3A7LA 1UAPA 5COYA 1Q1BA 3Q24A 1WTQA 4OO1H 4RCOA 4J8QA 3IFTA 3EFXD 4XXEA 3K5LA 3S17B 1RTNA 1SSOA 1LTGD 3U9OA 3GD7A 3S1RB 3SVMA 1GHKA 4WJWA 3ONAB 2OF1A 3H6MA 4K14A 2BCOA 1O7LA 1A2UA 3HOWB 3TZUA 2HUGA 3V96A 1W6JA 3QOJA 3ZYYX 4C56C 5JEAG 4IURA 4KN4C 3Q6SA 3PUWA 1M8AA 1KLGD 2RDFA 4FF1A 1HQRD 2B2VC 2WB1B 2QILA 3GV6A 1RHPA 5J1ZA 5EKKA 1SJHD 2B2YC 3BVMA 5CV9A 2H4OA 1U4RA 4KY7A 2LS01 3T13A 3S1MB 2C5CA 4V0BA 1V1OA 2F0KA 1LABA 3ND8A 1EWHA 3K7AB 2BA1A 2RDHA 1H9JA 2M9VA 5EQ0A 2J0TD 1DM0B 5EGTA 4KY6A 2KOLA 2EYPA 5ELEA 5IOCA 1SYCA 2NTTA 1KLUD 3MXNA 2X6GA 5KNBA 2NYZD 3GTQB 2Z4IA 2A73B 1ICWA 3OSOA 2SNSA 2EYJA 2EY6A 1JOQA 2MGSA 4FXKC 1JCKB 4E6IA 5CORA 5M5YB 2RKSA 1B3AA 2B39A 2PYKA 3VYTA 4G7OC 1ILPA 4KKSA 2OT2A 1BOSA 5BN5A 1R4PB 4DU9A 2AUKA 4BS9A 4ID6A 3J7YW 2G9DA 5CR3A 3MZ5A 4XTCS 3MWYW 3T4AC 4DAPA 1CZWA 5DEHA 1IYVA 1I3QB 3D8GA 3EROA 1SDFA 5E1FA 4PV1C 4G57A 1B50A 4B9XA 3GTPB 5FOBB 1RDPD 2SOBA 5JPNC 3NXWA 2F0TA 2FINB 1QOHA 3I3CA 4R8NA 1CM9A 3FVQA 2KEDA 3FEWX 1RKNA 1S5BD 4XYOA 1LTBD 5C3EB 4A3KB 1AN8A 3NQTA 3TP7A 3PUZA 3JAME 2FFKB 1TWHB 1XX8A 2EOTA 1LO5D 3I4NB 3DWPA 4G7HC 5C3XA 1ZYRD 3MC0B 3DXJC 3SDZA 3C46A 2N55A 2F03A 4IFDG 1EU4A 2K28A 4HEDA 4K5WA 2E2IB 1KAAA 1OXVA 2SEBD 1EIGA 3KLSA 4WRDA 3L7ZC 2R6GA 3VR5A 2F0UA 2XWBB 3D4RA 1EZ6A 1CFMA 3T53B 5LL6X 4CJ0B 1F9QA 1ONLA 1G2TA 2NBFA 3X3MA 1D2BA 4C1NK 4FF3A 1O78A 1I4HA 1STGA 3OMGA 1TIID 4NDXA 4CKEA 3BS1A 1FR3A 3X3NA 2PZTA 3Q22A 1PRTB 3VYSA 2NWGA 2B8FA 5T1IA 1QILA 1XTCD 1TWFB 3K58A 5K36G 1R4QB 1BUVT 2DY8A 2F4IA 2Z1CA 3URYA 2G9HD 4RH6A 3RMHA 1MSHA 1EY5A 4GZYC 4FNFA 5G3LF 2F1MA 4IUQA 1HFNA 4A3DB 1QNUA 3OIQA 2LFNA 2K5WA 1PRTF 2DNCA 3AMUA 3PUYA 4ZLTF 5JAVA 4A3FB 1CK1A 4XQNA 3D3RA 1D5XC 1QB5D 2EJMA 2XVSA 3I4MB 4HN7A 1YNJC 5EPJA 1DJRD 5KRUA 4FXGC 2MP1A 4WFN3 3NTHA 1F77A 3W3AA 2F0HA 2RBMA 1VDZA 4FXDA 2PW5A 1GUGA 5M5XB 5M5WB 3FPUB 5FO8B 4XYQA 1LTID 3CHBD 2ENBA 3NSWA 1EOTA 4HSVA 5HURA 1HUNA 3KF8A 1PXUA 1BCPC 3D31A 4C3IG 4K8IA 3I90A 1Y8PB 4X3UA 3QJYA 5EKIA 1WVLA 3NK9A 5A2QE 4IUPA 1BNZA 4KJNA 1J8IA 3S2HB 1OXSC 1ESFA 3IAYA 3J81L 2PMZB 1IW7C 4FVMA 2GA4B 2BDNA 5DM73 1QE6A 2F0VA 3M7NA 1SE4A 3GTGB 5JPMC 3P20A 2F0MA 2A5HA 1YNJD 3VR3A 3HEJA 1S5DD 4ULLA 3FRPB 3R2IA 2NVXB 3A7AB 4EQNA 4S3SA 1MBYA 2ICEC 2OEOA 3BDCA 3I70A 2ZXOA 5KYIA 2R92B 3NBIA 5CV7A 3W2DA 1I4QA 4OIJA 5I4DA 1TT2A 4DNRB 1W6KA 2ID0A 3KUPA 1RTOA 2L12A 5DNFA 1SE3A 1STAA 3QIAA 4MHEA 1JWSD 1SJED 1PDQA 3QB3A 1CHPD 1YNND 2PQEA 1IW7D 1XWEA 3DWAA 3MFGA 3LNNA 1B4OA 3PUVA 4N9PA 1EWCA 1DD2A 1NUCA 3K57A 2EDGA 2RVLA 1TQOA 2CW0C 4H13C 1GHJA 2LY7A 5FLXE 1PTOD 3S16B 3TZDA 3TP8A 3OOCA 2F3VA 5IGFA 1JORA 3SK4A 2FMCA 3VYUA 4QIWB 1EY7A 4DA2A 1J9OA 3GTLB 4I7ZC 2F3WA 4H7BA 4DN4M 1F2MA 5D3IB 1UEAB 1SMYC 1CQVA 3MEHA 1Q12A 3SK8A 2IW3A 3HOYB 1LT5D 3M7GA 5F2DA 1VMPA 3VA7A 2KCNA 5IODA 4P2CB 3N52A 2K05A 3PIO3 2KVMA 2EYOA 2NN6G 3U9SA 3L9AX 1LTTD 4HCEA 2K6AA 1D1IA 3J80E 4F8MA 4NW2A 5C4JB 2K33A 4IUVA 2K5DA 1SNMA 4HAEA 2K04A 1BCPB 1CQFA 3C1EA 1S5CD 4RAUC 1PYWD 2IWHA 2A68C 4ZUIA 4A3BB 1STNA 2SNMA 1CHQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PCF B;  3GD7 A;  3LNN A;  4OO1 G;  1BDO A;  2JEB I;  3BDO A;  3KLR A;  3M4Y A;  3FPP A;  1HTP A;  1DXM A;  2D62 A;  3PUV A;  4DK0 A;  5JEA H;  5C0X H;  1GHK A;  1O78 A;  1QJO A;  1YNN C;  2EVB A;  3NE5 B;  1DD2 A;  1GUN A;  2EDG A;  1E2V A;  1Q90 A;  4XTC S;  1O7L A;  4OGQ C;  3TZU A;  2BE5 D;  5K36 H;  2CW0 C;  2QF7 A;  3I73 A;  3D31 A;  1GHJ A;  1FR3 A;  1VF5 C;  2YYZ A;  4H13 C;  5JEA G;  3CRK C;  1Y8P B;  3AB9 A;  4G7Z C;  1IYV A;  1Y8O B;  3QJY A;  2B8F A;  4DNT B;  4KN7 C;  3SE0 A;  4KN4 C;  2PPB C;  3PUW A;  1G29 1;  2V4D A;  2A6E D;  3OOC A;  1VCI A;  5K36 G;  1HCZ A;  2E75 C;  3VR2 A;  1H9S B;  4PV1 C;  1Z7T A;  1HQM C;  2E76 C;  3I72 A;  2EJF C;  2NN6 I;  1FYC A;  1OXS C;  3H94 A;  1OXX K;  4H0L C;  3FMC A;  2IT1 A;  4HR7 B;  2JEA I;  2A69 D;  2A6H C;  2A6E C;  1V8Q A;  1IW7 C;  2DN8 A;  2LMC B;  3OW7 A;  1Y69 U;  1V43 A;  2D5D A;  3MFY A;  4DK1 A;  4GZY C;  2K32 A;  3M7N A;  3WDN A;  3OPO A;  3ND9 A;  4BA1 I;  2F1M A;  5C0X G;  1LAB A;  1ZKO A;  4I7Z C;  5A35 A;  3ND8 A;  4LJZ C;  4H44 C;  3P20 A;  1B9N A;  3I4L A;  3LWU A;  1EWH A;  4TKO B;  3VR3 A;  1B9M A;  5KNC A;  2BA1 A;  2BE5 C;  1GUT A;  4KI0 A;  5KND A;  1H9J A;  1TU2 B;  1SMY C;  3GQB A;  3PUZ A;  2O5I C;  3MXU A;  3T51 B;  2Q8I B;  2L5T A;  4LK1 C;  4XIG S;  2AUJ D;  3A7A B;  1A6X A;  1VF7 A;  3N6R A;  1Q12 A;  1GUS A;  2E74 C;  1K8O A;  4RCN A;  3A8K E;  2KCC A;  4G7H C;  3T56 B;  2DNC A;  3CRL C;  4KKT A;  2NN6 H;  3VA7 A;  1GJX A;  4IFD H;  1GUO A;  4KHZ A;  1DCZ A;  3PUY A;  3VR4 A;  1Q1E A;  3DXJ C;  3EQL C;  5KNB A;  3PV0 A;  3HGB A;  1H9R A;  3PUX A;  3SDZ A;  4KKU A;  3BG3 A;  2A69 C;  1I6V C;  1CI3 M;  2D2C C;  2B8G A;  4TQU S;  1Y8N B;  4JBW A;  1K8M A;  4KMU C;  2NN6 G;  2JE6 I;  2JXM B;  3U9S A;  4IFD G;  3M85 A;  1Z6H A;  5BN3 A;  2EJM A;  1ZYR C;  1E2Z A;  3VR6 A;  3QG1 A;  1OXU A;  2AWO A;  4IQZ A;  4DNR B;  1E2W A;  1PMR A;  1T5E A;  1OXV A;  1TKW B;  1YNJ C;  5BN4 A;  2DNE A;  2A68 D;  2EJG C;  3A7L A;  3L7Z C;  2K33 A;  1HPC A;  2R6G A;  2BDO A;  3QIA A;  3VR5 A;  4G7O C;  1Q1B A;  2K7V A;  1IYU A;  3IKJ A;  2ZT9 C;  4KKS A;  4BA2 I;  1H9M A;  3D4R A;  4L8J A;  1H9S A;  1OXT A;  3W3A A;  4OO1 H;  2A6H D;  2BA0 A;  1H9K A;  3IFT A;  2O5J C;  5BN5 A;  1VDZ A;  1CFM A;  1IW7 D;  3A8I E;  3T53 B;  2A68 C;  3A8J E;  1GUG A;  4JK1 C;  1CTM A;  1ONL A;  2AUK A;  2PNR C;  3RLF A;  2KA7 A;  1LAC A; 
#chains in the Genus database with same CATH topology
 1I4X A;  3T16 A;  3VYR A;  1DXM A;  5T1G A;  4JI8 Q;  3F2D A;  1QJO A;  2VQF Q;  3ERS X;  4DGZ A;  1SMY D;  3I73 A;  1DON A;  1O7I A;  5JVH 3;  2ZJP A;  2HDL A;  4LF6 L;  3NQI A;  1C4Q A;  1D5M C;  4PZ6 A;  4BBS G;  2F0I A;  4IUT A;  3CCR A;  1SXT A;  4MIU A;  2A6E D;  4XQJ A;  5CV5 A;  2EIF A;  5IWA Q;  4IUU A;  1HA5 A;  5C3E H;  2GVB A;  2E76 C;  4HSP A;  3BVZ A;  1R9T H;  2B63 G;  2CHB D;  1EQT A;  1STE A;  2IT1 A;  2R7F A;  1EFW A;  1L0X B;  4A93 B;  1F9P A;  1UNS A;  4GN5 A;  1BBW A;  2AKW B;  1BCP F;  4DK1 A;  1IKM A;  4JI3 L;  1PVO A;  1SYB A;  4IJL A;  4J6H A;  1GOZ A;  4JBM A;  2A1A A;  1KDB A;  4LJZ C;  2ZTC A;  2IX3 A;  1B9N A;  1II3 A;  1EYC A;  4RA8 A;  3NWT A;  2QEJ C;  2TSS A;  4WOR A;  5AJ3 L;  1EY6 A;  1A2T A;  3CCM A;  1TU2 B;  4XDX A;  2DUD A;  4QY7 A;  1F9R A;  2F0F A;  4ZQ3 A;  4IOC A;  4LF9 Q;  4JC0 A;  3ZJY C;  1T5X D;  4RFB A;  3CKI B;  2VQE L;  1ENF A;  3P1H A;  4AH6 A;  1PRT C;  3D6C A;  2RHQ B;  5DLQ E;  3WOF A;  2UXD L;  2MQH A;  1WTV A;  3PV0 A;  4JI8 L;  5E3F A;  1HUM A;  2XWJ B;  3QR8 A;  5IGB A;  3HKZ G;  1L0Y B;  2VQF L;  1D8L A;  1ILQ A;  1PLF A;  4JBW A;  2JXM B;  4A3I B;  1EY8 A;  1ICF B;  1EY9 A;  5FJ8 H;  4DV3 L;  1ML0 D;  2JQO A;  2L11 A;  4NPS A;  2R7Z H;  1A3T A;  1TKW B;  5JVG 3;  3HOZ G;  4UP8 A;  3U4V A;  2Q2I A;  3BZC A;  5IWA L;  1FNW A;  2EJG C;  1HPC A;  1NMF A;  2IX1 A;  2K4K A;  1SFO B;  4QJF A;  4X3T A;  1TXY A;  4BA2 I;  1XJV A;  2ZT9 C;  1H9M A;  1JIC A;  4X3S A;  4RHR A;  1TS5 A;  1N36 L;  2O5J C;  4ZCK A;  1TWF H;  4RKB A;  4UP7 A;  4XIG S;  2ALY B;  5M3M B;  3J7A F;  4QMG A;  4OO1 G;  4A3E H;  1JT8 A;  2D62 A;  3GTK B;  4IUN A;  4K5V A;  5G3L D;  4DK3 C;  3M4O H;  2EVB A;  1Z47 A;  1EYD A;  4A3K G;  2KQ3 A;  2WB1 E;  4OEM B;  1O7Y A;  2CH4 W;  1JE5 A;  2QF7 A;  1U5K A;  5EJW A;  4MZ9 A;  2E2J B;  2NVT B;  2JSO A;  1TS3 A;  4LF9 L;  1IXR A;  2RSO A;  1NTG A;  3VR2 A;  1GM5 A;  4CJ1 B;  2MPM A;  4IN3 A;  2H5X A;  3T1H Q;  1PRT D;  4NXN Q;  5CBE E;  3OIP A;  1D6E C;  1YJW A;  1M1K C;  4NMZ A;  1CKO A;  3UE1 A;  1ESR A;  1M4V A;  4FO2 A;  2JEA I;  1JB3 A;  2E2D C;  3A55 A;  3R93 A;  4YCU A;  2VNU D;  3OW7 A;  2MHV A;  4LF5 Q;  3I56 A;  2E2H H;  2F0E A;  4BA1 I;  4XT3 B;  1ZKO A;  4R4C A;  2PQA B;  3DLL A;  1Y1V G;  2UUB Q;  3M3Y B;  3MXP A;  2YU9 H;  1I4P A;  3HRZ C;  5KND A;  1AZQ A;  1K8G A;  2CCZ A;  5C4X B;  3AFP A;  4YY3 Q;  2L4N A;  3NEM A;  1A6X A;  1A15 A;  3OMC A;  1YZ6 A;  3S2D H;  2F3I A;  4OWX B;  4C3J G;  2OTJ A;  1JJC B;  1P16 A;  1EIF A;  1Q8I A;  2X69 A;  5TSS A;  3K8A A;  4TSS A;  4ILW A;  1PFS A;  3PUX A;  1CI3 M;  4JI2 L;  3MXG A;  2ZXR A;  1LT3 D;  4F88 A;  3Q0A A;  1A8V A;  4ZUJ A;  1R9T B;  2RHS B;  3VR6 A;  1OXU A;  2MO1 A;  3MA2 B;  1F2Z A;  4U67 3;  1G8Z D;  4Q5V A;  1SBB B;  2Q8T A;  3K59 A;  2WFW A;  2I0Q A;  4RGO S;  1NBW A;  1DOK A;  2MO0 A;  4PNY A;  3MAQ A;  5GQO A;  1MIU A;  3T1Y L;  3E5S A;  5D14 A;  4A3M G;  3R3O A;  1A63 A;  1SAP A;  3HP3 A;  5JJK A;  1FGU A;  1BDO A;  4EQ5 A;  3BDO A;  2PNH A;  3E3X A;  4QUF A;  3RLO A;  4PQX A;  2UUB L;  2EY1 A;  3BYY B;  1XTD A;  2JA9 A;  1ZEQ X;  2R93 H;  1NSN S;  3PIP A;  2VB3 X;  2PQA A;  3A74 A;  1ET9 A;  3NWS A;  3TN2 A;  5IGG A;  4CGY B;  2NVY B;  3W5O A;  1GUW A;  1F2L A;  1MJE A;  4FDB A;  1BVS A;  4G4K A;  2XTI A;  3KBX A;  4O42 A;  1HR0 Q;  1HQM C;  3EA6 A;  3I72 A;  3CC2 A;  2EJF C;  3NEL A;  1SE2 A;  5J22 A;  1SEB D;  3MVV A;  2R7Z B;  1MKH A;  4CJ2 C;  5IYB G;  3KJP A;  2F0J A;  3UDF A;  1CA5 A;  3H3V H;  1B7Y B;  4UAI A;  3AEV A;  4QL5 A;  4ALP A;  4A3J G;  1U4M A;  4JCV E;  2B29 A;  3KF6 B;  2R92 H;  1AFP A;  1HA6 A;  5IT9 E;  5I2Y A;  4JI0 Q;  1HXY D;  3U4Z A;  1W2B A;  5IGE A;  2JA7 H;  4DUZ Q;  2NZ1 D;  3MXU A;  4DR4 Q;  1XXG A;  2Y0S B;  4A3E B;  4IAL A;  3M4O B;  1Q8K A;  1PZJ D;  1EZ8 A;  4IO9 A;  1E0B A;  2PZU A;  3A8K E;  1TWC H;  2ZTD A;  3H09 A;  4YWL A;  3LGJ A;  3H0G B;  2UU9 L;  1GJX A;  2KHJ A;  1QUQ B;  1STB A;  1SYG A;  1S5E D;  1SNC A;  2WIN B;  4GKJ Q;  3CQZ H;  2EYF A;  3M85 A;  3DHQ A;  1F2Y A;  4X62 Q;  2QDL A;  5ISR A;  4LUZ A;  1LTA D;  4A3C H;  1SMX A;  1B1Z A;  5GAE C;  1X3E A;  4GS3 A;  2F0G A;  1HR0 L;  3SHL A;  2E2H B;  4FF2 A;  3F8T A;  3G7L A;  4B3T Q;  3J81 i;  4O1N A;  1HJP A;  4EX5 A;  1QVF A;  3SR1 A;  3NTI A;  3GTJ B;  2YU9 B;  1M90 C;  1HNZ Q;  1JWU D;  3OTO Q;  1KTK A;  1WCM G;  5IGC A;  5JOB A;  3PO2 H;  5CGK A;  5KYL A;  4X65 Q;  4JI4 Q;  4K0K L;  1PA6 A;  3S2D B;  1QWY A;  4PZ7 A;  2Y0S E;  4YCW A;  3KF6 A;  1X55 A;  4GOP B;  2VUM H;  4DR4 L;  2KEN A;  2O4X A;  4KY5 A;  4DV7 Q;  1Y8O B;  1I4R A;  1O80 A;  1NJI C;  1HCZ A;  2E75 C;  2KBN A;  4L5T A;  1HFG A;  4R4Q A;  4GN3 B;  1D5Z C;  2L9H A;  2ZJQ A;  2LXJ A;  5C44 G;  2F0P A;  2N78 A;  1BQQ T;  1YVC A;  3H3V I;  1KHI A;  3J81 E;  4GKJ L;  3FKI G;  3HOY H;  1QUQ A;  2XN9 C;  2VXW A;  4ODG A;  1GKH A;  3NTK A;  5C0X G;  2F0N A;  2QCP X;  3K0Y A;  1VQI A;  5ELF A;  3I4L A;  4FP5 D;  4TKO B;  3PO3 G;  2LKV A;  1IBL L;  5KGU A;  2BE5 C;  5E4X A;  5GAH C;  3NP8 A;  4X3K A;  3W1B A;  3T51 B;  4B3T L;  4QCL A;  2JP1 A;  2M2L A;  3BYT B;  2FMM A;  4HCS A;  2BOS A;  1GUS A;  1WTX A;  4X6A H;  2UXC Q;  2Q8R E;  5FO7 B;  1NR4 A;  5C4J H;  1JOK A;  3CME A;  3OTO L;  2R93 B;  3I55 A;  1XNR Q;  1Q1E A;  3ULL A;  4OL7 A;  4X65 L;  1BF4 A;  4JI4 L;  3D4W A;  4OON A;  1NE3 A;  1C8C A;  5BN3 A;  5KEE A;  4A3B H;  4P71 A;  2VS1 A;  3CF5 A;  3KK7 A;  1SYD A;  1AEX A;  1PMR A;  2G5D A;  4ZKC B;  4GOP A;  1VQJ A;  1B53 A;  3I91 A;  2JA5 B;  2L55 A;  3CW2 C;  4JPB W;  3A0J A;  5EPK A;  3G71 A;  3IL8 A;  1CUK A;  3CC7 A;  1QZG A;  5EAY A;  3EVQ A;  4RKL A;  4Y52 H;  4DR5 L;  5FO9 B;  4EQP A;  1N32 L;  3RZD B;  1U0L A;  4K6L A;  2JA7 B;  3AFQ A;  4EVO A;  4POG A;  1BCP D;  3DEO A;  2UUC L;  1PH8 A;  4OIK A;  5JEA J;  1I6H H;  2N88 A;  4A93 H;  1TWC B;  4Z9C B;  3BZK A;  1HNX Q;  1BXT A;  2O2L D;  4OGQ C;  5ELO A;  2BE5 D;  4WJ4 A;  4BY1 G;  4DF7 A;  4HID A;  1P8L A;  1VQM A;  2DJF C;  1PH9 A;  4G7Z C;  5K5P A;  1EU3 A;  2EPB A;  2A19 A;  2PMZ E;  4HMI A;  2HQL A;  1G2S A;  1G29 1;  2UXC L;  3CQZ B;  2RCF A;  2Z4H A;  1SNP A;  1XNR L;  1YJ9 A;  4YWK A;  2XNA C;  5I2X A;  1FYC A;  2K75 A;  4YIJ A;  2XGT A;  5ELC A;  3WOE A;  4EQO A;  2P5Z X;  1EFI D;  1O7Z A;  5FLM G;  4C3H H;  1BO0 A;  1XMO Q;  1LT4 D;  5M3F H;  1PYS B;  1J5E Q;  5EBD A;  4H44 C;  5I9P A;  5IP7 G;  1VMC A;  1HNW Q;  5ELB A;  1GO3 E;  1B9M A;  4JV5 Q;  2C9O A;  4A3I H;  4ABN A;  3PO2 B;  3NUC A;  2AUJ D;  5IGD A;  2JA8 H;  5L37 A;  1YHB A;  3J7A 5;  3CPF A;  3S15 B;  3RUZ A;  2VUM B;  1SFO H;  2R3Z A;  2A8V A;  2D2C C;  1HNX L;  1K8M A;  2KEC A;  1X3P A;  1Z6H A;  4CDC C;  3DWQ A;  5EBC A;  5C5L A;  5IP9 G;  2ES2 A;  2UUA Q;  1E2Z A;  1JE4 A;  4A3G B;  3UE0 A;  3QG1 A;  2EQS A;  3R2T A;  2R61 A;  4IQZ A;  3SK5 A;  4NB3 A;  2Z8L A;  2QGQ A;  2WKD A;  3GTK H;  4DV6 Q;  4R1J A;  5GAD C;  3U50 C;  4P74 A;  1Y1W B;  2MJ8 A;  2K7V A;  2B63 H;  1WD0 A;  1KDC A;  2NVT H;  2HQE A;  5CMD A;  2EY2 A;  2E5L Q;  3V2T A;  5LL6 S;  1SRU A;  5I9O A;  4P72 A;  1XMO L;  2NTS A;  2CW0 D;  2Q2U A;  3RLF A;  2JA6 B;  3GTO B;  1LAC A;  3FP9 A;  3SK6 A;  4XQQ A;  5JEA H;  1HTP A;  1J5E L;  1OTC A;  4ME3 A;  3TP6 A;  1HNW L;  2L1B A;  1Q90 A;  1K3R A;  2EY5 A;  2WB1 G;  4M1U B;  4JV5 L;  4L6T B;  2BH8 A;  2D9U A;  4QIW E;  5IIF A;  3S14 H;  4LUO A;  2B2U C;  1C48 A;  4RWS C;  2EXZ A;  2YV5 A;  1VQO A;  2EYL A;  2HCC A;  5LMU Q;  1Z7T A;  1AP0 A;  3O13 A;  4NP5 A;  2NN6 I;  5AFW A;  3GTM B;  3UI2 A;  4J1M A;  1E7Z A;  2FHT A;  5C4X H;  1A3U A;  1JR0 D;  1V8Q A;  4F87 A;  1KRS A;  3WWV A;  2K5Q A;  4IPH A;  2D5D A;  3MFY A;  3CCJ A;  2UUA L;  1K83 H;  3WDN A;  4NKL A;  1I50 B;  3ND9 A;  2IPK D;  4MTK A;  1GVP A;  2DGY A;  4QF4 A;  4HTH A;  1WTP A;  1CZG A;  1MD2 D;  3HOZ H;  1HZC A;  2SDF A;  5KNC A;  1UUP A;  1NMG A;  3OWE B;  1N8R C;  2O5I C;  2NB0 A;  4UP9 A;  1JMC A;  4QUC A;  1NY4 A;  1MHW C;  4JW0 A;  1VQL A;  4K6D A;  3HOU H;  1I6H B;  2E5L L;  3HZX A;  2KHS A;  4LAA A;  4BWG B;  4FYD A;  1NAP A;  1XNQ Q;  1HRJ A;  4BY7 H;  5I6Y A;  3QOL A;  1DCZ A;  2XSC A;  4IFD J;  5D3D A;  5CV6 A;  3I2Z A;  2IHF A;  1LLR D;  2A74 C;  1AW7 A;  3RZO H;  3JAM c;  1ZXT A;  2Z6B A;  4DR2 L;  1MSG A;  2EZV A;  1N9W A;  1JOO A;  1Q46 A;  2VB2 X;  3GP7 A;  5IYC G;  4LNQ A;  2KCM A;  1PTO B;  1E2W A;  1T5E A;  3E0J A;  1TWA H;  2DNE A;  2A68 D;  2ZTE A;  5LMU L;  4C3H B;  1ROD A;  3DM1 A;  1IYU A;  1C7Y A;  5M3F B;  2HIX A;  4L8J A;  1VS0 A;  3CCS A;  1XPU A;  1UE5 A;  2NVY H;  1LV9 A;  4A3L G;  4JK1 C;  2MUY A;  2B2W A;  4PMC A;  2J7Z A;  2EYH A;  1FNU A;  3M4Y A;  1WOC A;  4OXP A;  2JA8 B;  4AYB B;  1ENC A;  3OHX C;  1UE1 A;  3HOV H;  3DUZ A;  1SYE A;  1FGB D;  1QCB D;  4A76 A;  2F0W A;  1Q3L A;  4ZKB B;  4OX9 Q;  4KN7 C;  3SE0 A;  3OYY A;  1VCI A;  1X54 A;  4C2M B;  3HS0 C;  4QQB X;  1PTO F;  2NZO A;  4R9W A;  2F0O A;  2OXP A;  1PFM A;  2IHE A;  4POF A;  4BBS B;  5C3E G;  4JYA Q;  1YIT A;  1Y69 U;  1PZI D;  3K5N A;  1X3G A;  3D0F A;  3KLW A;  5IT9 c;  3OPO A;  3H0G H;  2B63 B;  2HT1 A;  5A35 A;  4DAV A;  4KV6 A;  2RF4 A;  3I4N G;  3C3L A;  3GV3 A;  4NXM Q;  4IZ8 A;  1PFB A;  2F0D A;  2WAC A;  4KI0 A;  3CCQ A;  1X3Q A;  1E1O A;  4QB4 A;  3QO2 A;  1SNO A;  2KUM A;  1U9R A;  3F2U A;  4DV2 Q;  3QWN A;  2KEE A;  3KJO A;  1VQP A;  2RDG A;  1N33 Q;  4OO1 I;  1K8O A;  1TR5 A;  1RIP A;  4RCN A;  2KCC A;  4GOP C;  4B3M Q;  2IJ0 A;  2Q2T A;  1A0I A;  1PZK D;  3P7J A;  1HHV A;  4LW1 A;  3CRL C;  4IFD H;  4K5X A;  3S14 B;  3A54 A;  3VR4 A;  1MGS A;  1H9R A;  4KKU A;  3DM3 A;  1NCV A;  2X6L A;  4JBK A;  2CVR A;  4KMU C;  2XRQ D;  5GRO A;  4RGM A;  4BBR H;  5IYD G;  1L1O B;  3GTJ H;  1ZYR C;  3AQQ A;  5D65 A;  3GDE A;  4OX9 L;  4V19 0;  2CKZ B;  2IX0 A;  1VQE A;  5J3B A;  3HKZ B;  3I4O A;  4ZRZ A;  4LFA Q;  5FJ8 G;  5CC4 A;  1K83 B;  3IKJ A;  4H02 A;  1Q7Y C;  2R7Z G;  1EOV A;  4YCV A;  1K0S A;  1XMQ Q;  3KOJ A;  3TEH B;  4JYA L;  3HOZ B;  3A8J E;  1CTM A;  4K2K A;  5IYB H;  4KHV A;  2NZH A;  2JN4 A;  2PCF B;  3Q8D A;  4A3J H;  3HOU B;  5I6W A;  5C0X J;  3SEB A;  1N34 Q;  3MEF A;  3A5U A;  2MNA A;  4NXM L;  3UDI A;  5GAG C;  2MFI A;  1KNA A;  4CDF C;  2B2T A;  5K36 H;  4BY7 B;  3T1H L;  1VF5 C;  2PW7 A;  2Y0S G;  4NXN L;  4A3E G;  4LF8 Q;  4DV2 L;  3SXH A;  3NEN A;  1N33 L;  3RZO B;  1WJJ A;  4M8A A;  3NBH B;  4B3M L;  4HJ7 A;  1LTL A;  4LF5 L;  3BU2 A;  1ET6 A;  5E7N A;  3K0X A;  1YEZ A;  3TS0 A;  1OXX K;  5CV4 A;  4HR7 B;  4CHT B;  3G48 A;  1TWA B;  2DN8 A;  2LMC B;  4A3D G;  3H3V C;  4ZAI A;  2K52 A;  5C4H A;  1DZ1 A;  4DXF A;  2N49 A;  1NR2 A;  4YY3 L;  1B44 D;  2DY7 A;  1L1O A;  4KTA A;  3LWU A;  2KJX A;  4LFA L;  5DAU A;  2RQX A;  3JAM L;  3GQB A;  3CCE A;  2Q8I B;  2L5T A;  4A3F G;  2ICI A;  3TDQ A;  1RF2 D;  1K9M C;  4IFD I;  3N6R A;  4IOA A;  1PV4 A;  1Y1V B;  3PF4 A;  1VQF A;  2JA5 H;  3T56 B;  3HOV B;  2VW9 A;  1DOM A;  3STB C;  3I4M G;  1WCM H;  4OWW B;  4R4I A;  2B2U A;  4BXX G;  1SNQ A;  1IHZ A;  3AYH B;  2AWN A;  3BG3 A;  4EGV A;  1N34 L;  4R8I A;  2J4X A;  4Q0F A;  4C3J B;  3RZD H;  2CQA A;  4LMQ D;  4LF8 L;  1S5F D;  3V05 A;  3VA5 A;  1EY0 A;  4DFA A;  2H1E A;  2I07 B;  3ER0 A;  1VQ7 A;  1VQG A;  2EXD A;  5M9O A;  4Y7N H;  3S1N H;  5IE8 A;  1EIY B;  5C44 H;  5HY6 A;  1RJT A;  1SYF A;  3NBH A;  4L63 B;  1E1T A;  1TY0 A;  2BA0 A;  5C4Z A;  1PH3 A;  4O2D A;  1K73 C;  3CC4 A;  5EPL A;  2QDB A;  3BVG A;  2PNR C;  4PMW A;  2JEB I;  3KLR A;  3BZD B;  4C3I H;  5C0X H;  4DK0 A;  3D6W A;  4A3M B;  3HG9 A;  1E2V A;  2BH2 A;  1EEF D;  1KAB A;  2AMC B;  3ITP A;  5IY0 A;  1JC7 A;  3CRK C;  5CV8 A;  1AZP A;  2NVQ H;  5IT9 L;  2I46 A;  1SLJ A;  4DNT B;  3GO5 A;  2V4D A;  1EQV A;  2AQ1 B;  4K2L A;  1H9S B;  4BBR B;  1GD7 A;  1PFN A;  3STB D;  2VZA A;  5C5M A;  3H94 A;  4H0L C;  4K8J A;  2HD3 A;  2AQ3 B;  1BBU A;  2A6H C;  1HZA A;  1V1P B;  1YHA A;  3E6Z X;  5FLX c;  4JI0 L;  2CFM A;  3S9W A;  3S15 H;  1VQ9 A;  4DUZ L;  1I4G A;  3Q23 A;  4HJ5 A;  1EYG A;  1PH6 A;  1WTW A;  1BBX C;  2B2V A;  1ASZ A;  2LXK A;  1XPR A;  4R4T A;  2HHH Q;  2QA4 A;  1RCV D;  1GUT A;  3TBI B;  3PIO A;  2R92 G;  1EWI A;  2EE1 A;  1F9S A;  4GKK Q;  2B2Y A;  3E0E A;  4A3G H;  4A3J B;  2PO4 A;  1VF7 A;  1LTS D;  1WTO A;  3L0O A;  2ASB A;  1KD1 C;  2E74 C;  1OO9 B;  1STH A;  2JA7 G;  2HIV A;  3CCV A;  1FVI A;  2F52 A;  3C2P A;  2CH4 A;  5DM6 3;  4N8X 1;  1SND A;  1GUO A;  4X62 L;  1TS4 A;  4I65 A;  1Y1W H;  3C1F A;  4RGT A;  4TRD A;  4DV4 Q;  4UDU C;  4TQU S;  2JE6 I;  1U4P A;  4UY8 C;  4R4O A;  1VQ5 A;  3GTO H;  2B2W C;  2JA6 H;  3A56 A;  3DEP A;  2AWO A;  3RNU A;  4HMJ A;  1XYI A;  3U58 A;  2L15 A;  5E4W C;  1UEB A;  1Y14 B;  1B2T A;  3G6J B;  2EYM A;  4N9T A;  1XPO A;  2WKC A;  1HNZ L;  2BDO A;  5CYU A;  3J7A V;  4JI5 Q;  1CT1 D;  3CPW A;  4DV1 Q;  1EY4 A;  1VQA A;  3CU7 A;  4A3C G;  5LHY 1;  2RA4 A;  1X3F A;  1WD1 A;  2F0Q A;  3BJU A;  1L2F A;  1OXT A;  1H9S A;  2XRS D;  1WTH A;  2A6H D;  1H9K A;  4DAY B;  1YHQ A;  1JJG A;  4MNO A;  3TSS A;  5C0X I;  1KNE A;  1HTL D;  2IL8 A;  1H95 A;  3HOX H;  3J80 c;  5FLM H;  4HJ9 A;  3A5Z B;  2KA7 A;  1V1P A;  1RL2 A;  5C3W A;  5KIX A;  3GTM H;  4DV7 L;  4KD4 A;  3MTS A;  5FKA C;  3W1G A;  2K5H A;  2QW7 A;  1YJN A;  1YNN C;  4CKB A;  5IP7 H;  4L5S A;  4B9W A;  2HHH L;  4RMF A;  1TY2 A;  1B8A A;  4KD3 A;  2YYZ A;  1WCM B;  3K5O A;  3IRB A;  2CWA A;  1I50 H;  3FHW A;  5A2Q L;  1TS2 A;  1STY A;  1CKN B;  4UHV A;  5C6A A;  4IPG A;  3R8B A;  1X6O A;  2VUM G;  2YTV A;  3FDT A;  3J7Z C;  4DR7 Q;  2RSN A;  4KJO A;  1PTO C;  2YTY A;  4B3R Q;  3FMC A;  1IKL A;  3PIP 3;  4DV4 L;  3E9H A;  3F2C A;  1W3S A;  1VQ4 A;  2Z0S A;  4KK7 A;  4Y7N B;  3S1N B;  1V43 A;  2I5M X;  1IL2 A;  5C44 B;  1DYQ A;  4C1N I;  1GXD C;  1IZ6 A;  5BR8 Q;  3CD6 A;  2HCI A;  3HOY G;  4X66 Q;  3S1Q B;  1CSQ A;  1EEI D;  2I5H A;  3FKI B;  1S4Z A;  1MI2 A;  2FJ2 A;  1C0A A;  4DV1 L;  1IL8 A;  4LK1 C;  3S1R H;  2PZW A;  1X9N A;  4C3I B;  4DR1 Q;  3PMF A;  2K01 A;  4HIK A;  1PTO H;  5CBA E;  1E3P A;  1YI2 A;  1V9P A;  2QKI C;  3PO3 B;  3HOW H;  1D1K A;  3IFD A;  1X32 A;  4KKT A;  2NN6 H;  4KHZ A;  4DAY A;  3EQL C;  2TMP A;  1TWG B;  2NVQ B;  4DNI A;  1SN8 A;  2Q2H A;  1EIH A;  2A69 C;  1I6V C;  1EYA A;  3OWF A;  1QG7 A;  1Y8N B;  1IBM Q;  3UDX A;  1EQR A;  2AQ2 B;  2HDM A;  2K1B A;  1I5F A;  3KYH C;  1PH4 A;  1QNK A;  2OTL A;  3L3O C;  5NUC A;  5BN4 A;  1G91 A;  4A3B G;  3CCL A;  1G6Z A;  1CKN A;  3S1M H;  2B2T C;  1WTR A;  4B3R L;  1BR9 A;  1LTR D;  4WJ3 M;  5J39 A;  3NPP A;  4IPC A;  5EKL A;  3EN2 A;  4JG2 A;  3K7A H;  3K5M A;  3H91 A;  3A8I E;  4CBV A;  4C2M H;  1JWM D;  1IYJ B;  4KHP Q;  1UE7 A;  4DXG A;  1G51 A;  3F1Z A;  1HH2 P;  3ERQ A;  3FPP A;  2NUC A;  3HKS A;  2I5L X;  3K80 C;  3MHB A;  3NE5 B;  1GUN A;  4BBS H;  3LWE A;  2M00 A;  3KLS X;  1KDA A;  1DOL A;  2WAQ B;  5FK9 C;  1JQY D;  5FLX L;  4DR1 L;  2K03 A;  3AB9 A;  3D4D A;  2PPB C;  1VQH A;  2GVA A;  3JC6 6;  4A93 G;  2WII B;  1FD7 D;  4PMB A;  3TP5 A;  1ENA A;  1L1O C;  5ELD A;  1RD9 D;  3I8Z A;  4JOI A;  4BY1 B;  3PSI A;  1FNV A;  4ZK9 B;  1LT6 D;  2A69 D;  2A6E C;  4F7X A;  5JJZ A;  1CKM A;  2K5V A;  1IBM L;  4OHJ A;  4ME5 A;  2K32 A;  3M4Q A;  1A3V A;  4N8F A;  4XT1 B;  4PG3 A;  4LWC A;  2ZXP A;  4ZYS A;  4J15 A;  3NHH A;  3KBG A;  4C3H G;  3TME A;  3HOX B;  4U68 A;  2XIW A;  5M3F G;  2OWO A;  1NNX A;  3RD4 A;  3LX0 A;  4AQY Q;  3P75 A;  4LF4 Q;  2F0L A;  2F0S A;  2WV6 D;  4RGN A;  3UDG A;  4MN3 A;  1TVX A;  4CKC A;  4A3I G;  4FF4 A;  4KHP L;  4A4I A;  3I7F A;  5HGT A;  4B3S Q;  2JA8 G;  1U4L A;  3HGB A;  3AU7 A;  2WAQ E;  4IPD A;  4DV6 L;  2B8G A;  3K6O A;  4RHS A;  2WP8 J;  1EL0 A;  3BDL A;  3DMU A;  1FL0 A;  3J80 L;  2JYO A;  1PH2 A;  4LFB Q;  2UXD Q;  3GTP H;  3G4S A;  1CA6 A;  4B08 A;  4DPG A;  1B70 B;  4DR6 Q;  3EJI A;  2L0C A;  3A7L A;  1UAP A;  5COY A;  3ULP A;  5M3M G;  4DV3 Q;  1Q1B A;  3H15 A;  3Q24 A;  5HGQ A;  3L2P A;  1WTQ A;  1ASY A;  1LUZ A;  1AE2 A;  3MXN B;  4OO1 H;  4RCO A;  4J8Q A;  3IFT A;  3EFX D;  4XXE A;  3K5L A;  3S17 B;  1RTN A;  1VQC A;  1SSO A;  4A3K H;  1K8A C;  4HIO A;  1LTG D;  3U9O A;  2K50 A;  1TWH H;  3GD7 A;  3S1R B;  1QVG A;  3SVM A;  1GHK A;  1N36 Q;  4LF7 Q;  2YTX A;  3ONA B;  2OF1 A;  4WJW A;  3H6M A;  2JJQ A;  3PQI A;  4K14 A;  2BCO A;  1O7L A;  1A2U A;  3I4N H;  3HOW B;  3TZU A;  2HUG A;  3V96 A;  1W6J A;  3QOJ A;  3ZYY X;  4C56 C;  5JEA G;  4IUR A;  4AQY L;  4LF4 L;  1WYD A;  4DK6 C;  4KN4 C;  3Q6S A;  4TVA B;  3PUW A;  1K28 A;  1M8A A;  1LM0 A;  1KLG D;  1HR0 W;  2RDF A;  4FF1 A;  1HQR D;  2B2V C;  2WB1 B;  2QIL A;  3GV6 A;  4B3S L;  2RCN A;  1RHP A;  5J1Z A;  1JJ2 A;  2E2I H;  5EKK A;  1SJH D;  4O0A A;  2B2Y C;  1HZ9 A;  3BVM A;  1AE3 A;  5CV9 A;  2H4O A;  1Y1V H;  2OQ0 A;  1YBY A;  1U4R A;  4KY7 A;  5IYD H;  2LS0 1;  3T13 A;  3S1M B;  2C5C A;  4V0B A;  1V1O A;  4LFB L;  5C4X G;  2F0K A;  1LAB A;  1SRO A;  3J81 j;  5LMN W;  3ND8 A;  1X65 A;  2F4V Q;  3EIV A;  1EWH A;  3K7A B;  4DR6 L;  1XNQ L;  1I94 Q;  2BA1 A;  2RDH A;  4C3J H;  1H9J A;  2M9V A;  5EQ0 A;  2J0T D;  1DM0 B;  5EGT A;  4KY6 A;  2KOL A;  2EYP A;  5ELE A;  2K14 A;  5IOC A;  1C9O A;  1SYC A;  2NTT A;  1KLU D;  4HJ8 A;  3MXN A;  1EQQ A;  3HOU G;  2X6G A;  5KNB A;  2NYZ D;  3GTQ B;  1KXL A;  4LF7 L;  2Z4I A;  2ZM6 Q;  2A73 B;  2AHO B;  3K7U C;  1ICW A;  3OSO A;  2D0O A;  2JK8 A;  4BY7 G;  2SNS A;  2EYJ A;  2EY6 A;  1JOQ A;  2MGS A;  4FXK C;  1JCK B;  4E6I A;  4P75 A;  5COR A;  4DV5 Q;  3OW2 A;  4JI2 Q;  5M5Y B;  2RKS A;  1B3A A;  4A3M H;  4L5R C;  3RN2 A;  2B39 A;  2PYK A;  3VYT A;  4G7O C;  1ILP A;  4KKS A;  2OT2 A;  4AYB E;  3KDF B;  4JBJ A;  3HFZ B;  1X56 A;  4QGU A;  1BOS A;  5BN5 A;  2DJG C;  5JJI A;  1R4P B;  2D0P A;  4DU9 A;  4A3D H;  2AUK A;  2LSS A;  3RR5 A;  4DR3 Q;  4BS9 A;  4ID6 A;  3J7Y W;  2F4V L;  3T1Y Q;  2G9D A;  5CR3 A;  3MZ5 A;  4XTC S;  4YHH Q;  3MWY W;  1I94 L;  3JAM i;  3T4A C;  3TRE A;  4JVZ A;  3E9I A;  4GN4 B;  4DAP A;  1CZW A;  5DEH A;  4A3F H;  1I3Q B;  1IYV A;  3D8G A;  2CQO A;  3ERO A;  4GLV B;  1SDF A;  3HOV G;  4YWM A;  5E1F A;  4PV1 C;  4G57 A;  1DGS A;  3VDY A;  1B50 A;  3I4M H;  4B9X A;  3CXC A;  3GTP B;  5FOB B;  4BXX H;  2ZM6 L;  1RDP D;  2SOB A;  3M4P A;  5JPN C;  3NXW A;  2F0T A;  2FIN B;  1QOH A;  3I3C A;  4R8N A;  1CM9 A;  3FVQ A;  2B3G A;  4GNX B;  2KED A;  4DV5 L;  3FEW X;  3ICE A;  2UXB Q;  1RKN A;  1S5B D;  4XYO A;  1LTB D;  5C3E B;  3H0G G;  1AN8 A;  3NQT A;  5M5X H;  4A3K B;  1AH9 A;  3TP7 A;  3PUZ A;  3JAM E;  2FFK B;  1KRT A;  1TWH B;  1XX8 A;  5M5W H;  3J81 c;  1G6P A;  1J6Q A;  2EOT A;  1UE6 A;  1LO5 D;  3I4N B;  3DWP A;  4G7H C;  1EUJ A;  3KDF A;  3RN5 A;  1D7Q A;  5C3X A;  4DR3 L;  1ZYR D;  3MC0 B;  3DXJ C;  2GN5 A;  2PI2 E;  3HKZ E;  3SDZ A;  3C46 A;  4I7A A;  2N55 A;  4YHH L;  1PH7 A;  2F03 A;  4IFD G;  2UU9 Q;  3S2H H;  3TS2 A;  1EU4 A;  2K28 A;  3CP0 A;  4HED A;  4K5W A;  1Q81 C;  2PI2 A;  2E2I B;  1KAA A;  1XMQ L;  1OXV A;  2SEB D;  4BBR G;  1EIG A;  3S24 A;  3KLS A;  4WRD A;  3L7Z C;  2R6G A;  4HIM A;  3VR5 A;  1VQK A;  2F0U A;  3GTG H;  2XWB B;  3D4R A;  1KC8 C;  4GLA C;  3G6E A;  1EZ6 A;  1Z9F A;  3TQY A;  1CFM A;  3T53 B;  4GLX A;  5LL6 X;  2Z6K A;  4CJ0 B;  1F9Q A;  1ONL A;  1G2T A;  2NBF A;  2NVX H;  2IY5 B;  3X3M A;  4JOI C;  2UXB L;  1D2B A;  1YNX A;  4C1N K;  4FF3 A;  1O78 A;  1I4H A;  1STG A;  3OMG A;  1TII D;  4GNX A;  4NDX A;  4CKE A;  4KLK A;  3BS1 A;  1FR3 A;  3X3N A;  4OWT B;  2PZT A;  3Q22 A;  1PRT B;  3VYS A;  2NWG A;  4CDD C;  1S72 A;  4K0K Q;  5LMN Q;  2B8F A;  5T1I A;  1KQS A;  1QIL A;  1XTC D;  2V1C C;  3S1Q H;  1T9H A;  1TWF B;  3K58 A;  5K36 G;  3SGI A;  3FKI H;  1R4Q B;  4LFC Q;  1BUV T;  2DY8 A;  1FJG Q;  2F4I A;  2Z1C A;  3URY A;  2G9H D;  1HZB A;  4RH6 A;  3RMH A;  2KHI A;  1MSH A;  1EY5 A;  3PO3 H;  4GZY C;  1PYB A;  4FNF A;  5G3L F;  1A62 A;  2F1M A;  3KF8 B;  1TWG H;  4IUQ A;  1Q82 C;  2R93 G;  1HFN A;  4DAM A;  1IBK Q;  1VQB A;  4A3D B;  4MTN A;  1QNU A;  3OIQ A;  2LFN A;  1WI5 A;  2K5W A;  1PRT F;  1IBL Q;  2DNC A;  3AMU A;  3PUY A;  4ZLT F;  5JAV A;  2KCT A;  2OCE A;  4A3F B;  3S16 H;  2JA5 G;  1CK1 A;  2R7D A;  4XQN A;  3D3R A;  1D5X C;  1QB5 D;  3F2B A;  2EJM A;  4L5Q A;  2XVS A;  3I4M B;  4HN7 A;  5LMN L;  1K3B C;  2N8N A;  1YNJ C;  5EPJ A;  4LFC L;  1DJR D;  4OEL B;  4JI7 Q;  5KRU A;  4FXG C;  1FJG L;  2MP1 A;  1VQD A;  4WFN 3;  3GTL H;  1SR3 A;  1UWV A;  3NTH A;  3PGZ A;  1F77 A;  3W3A A;  2F0H A;  2RBM A;  1VDZ A;  3M9B A;  4FXD A;  1KIX A;  2PW5 A;  1GUG A;  5M5X B;  4IJH A;  4BY1 H;  5M5W B;  3FPU B;  5FO8 B;  4XYQ A;  1LTI D;  3CHB D;  4DR5 Q;  2ENB A;  2ATW A;  1N32 Q;  3NSW A;  1EOT A;  4HSV A;  5HUR A;  1IBK L;  1HUN A;  2VY3 A;  3KF8 A;  1S3O A;  1PXU A;  1BCP C;  2E8G A;  3D31 A;  4C3I G;  4K8I A;  3I90 A;  1Y8P B;  1QZH A;  4X3U A;  2UUC Q;  3QJY A;  5EKI A;  1WVL A;  3NK9 A;  5A2Q E;  4IUP A;  1BNZ A;  4KJN A;  1J8I A;  2ZJR A;  1L0W A;  3S2H B;  2Z9H A;  3EBE A;  1OXS C;  1ESF A;  3IAY A;  3J81 L;  3CCU A;  2PMZ B;  1IW7 C;  4FVM A;  2GA4 B;  2BDN A;  5DM7 3;  1PHJ A;  1QE6 A;  3RLN A;  2K5N A;  2F0V A;  3M7N A;  3PO2 G;  1SE4 A;  4GKK L;  1Q86 C;  3GTG B;  5JPM C;  3P20 A;  2F0M A;  2A5H A;  1YNJ D;  3VR3 A;  1JB7 A;  3B6Y A;  4JI7 L;  3HEJ A;  1S5D D;  4PZ8 A;  4ULL A;  3FRP B;  3R2I A;  1S40 A;  2NVX B;  4AIM A;  3A7A B;  4EQN A;  4S3S A;  2VL6 A;  1MBY A;  2ICE C;  3PF5 A;  2OEO A;  3BDC A;  3I70 A;  2ZXO A;  1V1Q A;  1VQN A;  4A3G G;  5KYI A;  1YIJ A;  2R92 B;  5IP9 H;  3NBI A;  5CV7 A;  4LUV A;  3W2D A;  2OQK A;  4HJA A;  2WAQ G;  3S17 H;  1BKB A;  1I4Q A;  1Y1W G;  4JI5 L;  1VQ8 A;  4OIJ A;  5I4D A;  1TT2 A;  3ULJ A;  4DNR B;  1W6K A;  2ID0 A;  2FXQ A;  4JI1 Q;  3KUP A;  1RTO A;  2L12 A;  5DNF A;  4DV0 Q;  1SE3 A;  2JA6 G;  1STA A;  3QIA A;  5H1S E;  4MHE A;  1JWS D;  4APV A;  1SJE D;  1PDQ A;  3QB3 A;  1CHP D;  1YNN D;  2PQE A;  1IW7 D;  1XWE A;  3DWA A;  3MFG A;  1VQ6 A;  4A75 A;  3LNN A;  2CWP A;  4JI6 Q;  4X64 Q;  1B4O A;  3PUV A;  4P73 A;  4N9P A;  1EWC A;  1DD2 A;  1NUC A;  3HOX G;  3K57 A;  3K81 C;  2EDG A;  2RVL A;  1TQO A;  2CW0 C;  4H13 C;  1GHJ A;  2LY7 A;  4DR7 L;  5FLX E;  1PTO D;  3KFU A;  1WFQ A;  3S16 B;  1QVC A;  3TZD A;  3TP8 A;  3OOC A;  2F3V A;  5IGF A;  1JOR A;  3SK4 A;  5JJL A;  4CDE C;  2FMC A;  4DUY Q;  3VYU A;  4QIW B;  5BR8 L;  2QEX A;  1E22 A;  4X66 L;  4RG1 A;  1EY7 A;  3CMA A;  3J80 i;  4DA2 A;  1J9O A;  3GTL B;  4I7Z C;  2F3W A;  4H7B A;  4DN4 M;  3GTQ H;  1F2M A;  4JI1 L;  5D3I B;  4DV0 L;  1UEA B;  1SMY C;  5M3M H;  4LF6 Q;  4UPA A;  1CQV A;  3MEH A;  1Q12 A;  3SK8 A;  2IW3 A;  3HOY B;  1PH5 A;  1LT5 D;  5M5Y H;  3M7G A;  5F2D A;  1VMP A;  3VA7 A;  2KCN A;  5IOD A;  4JI6 L;  1KL9 A;  4P2C B;  4X64 L;  3N52 A;  2E2J H;  2N3S A;  1LYL A;  2K05 A;  5IYC H;  3PIO 3;  3HOW G;  2KVM A;  2EYO A;  1SE8 A;  2NN6 G;  3U9S A;  3L9A X;  5ELN A;  1LTT D;  4HCE A;  4JI3 Q;  2Z6K C;  2K6A A;  1D1I A;  3J80 E;  1CSP A;  1PH1 A;  3PCO B;  3TRZ A;  4F8M A;  2C35 B;  4NW2 A;  5C4J B;  4DR2 Q;  1MJC A;  5AJ3 Q;  2K33 A;  4IUV A;  4DUY L;  4GNX C;  4A3L H;  2K5D A;  1E24 A;  1KAW A;  1SNM A;  4HAE A;  2K04 A;  1BCP B;  1CQF A;  3C1E A;  4DKA C;  1K0R A;  1I3Q H;  1S5C D;  4AYB G;  4RAU C;  1PYW D;  2IWH A;  3M3Y H;  2A68 C;  1B3Q A;  4ZUI A;  2VQE Q;  4A3B B;  1STN A;  2SNM A;  3CAM A;  1CHQ D; 
#chains in the Genus database with same CATH homology
 1I4X A;  3T16 A;  3VYR A;  1DXM A;  5T1G A;  1QJO A;  4DGZ A;  1SMY D;  3I73 A;  1DON A;  5JVH 3;  2HDL A;  3NQI A;  1C4Q A;  1D5M C;  2F0I A;  4IUT A;  1SXT A;  4MIU A;  2A6E D;  4XQJ A;  5CV5 A;  4IUU A;  1HA5 A;  2E76 C;  4HSP A;  3BVZ A;  2CHB D;  1EQT A;  1STE A;  2IT1 A;  1L0X B;  4A93 B;  1F9P A;  1UNS A;  1BCP F;  4DK1 A;  1IKM A;  1SYB A;  4J6H A;  1GOZ A;  1KDB A;  4LJZ C;  2IX3 A;  1B9N A;  1II3 A;  1EYC A;  4RA8 A;  3NWT A;  2QEJ C;  2TSS A;  4WOR A;  1EY6 A;  1A2T A;  1TU2 B;  4XDX A;  1F9R A;  2F0F A;  4ZQ3 A;  1T5X D;  4RFB A;  3CKI B;  1ENF A;  3P1H A;  1PRT C;  3D6C A;  3WOF A;  1WTV A;  3PV0 A;  5E3F A;  1HUM A;  2XWJ B;  5IGB A;  1L0Y B;  1ILQ A;  1PLF A;  4JBW A;  2JXM B;  4A3I B;  1EY8 A;  1EY9 A;  1ML0 D;  2L11 A;  1A3T A;  1TKW B;  5JVG 3;  1FNW A;  2EJG C;  1HPC A;  2IX1 A;  1SFO B;  4X3T A;  4BA2 I;  2ZT9 C;  1H9M A;  1JIC A;  4X3S A;  4RHR A;  1TS5 A;  2O5J C;  4RKB A;  4XIG S;  3J7A F;  5M3M B;  4QMG A;  4OO1 G;  2D62 A;  3GTK B;  4IUN A;  4K5V A;  5G3L D;  2EVB A;  1Z47 A;  1EYD A;  2KQ3 A;  1O7Y A;  2QF7 A;  5EJW A;  2E2J B;  2NVT B;  2JSO A;  1TS3 A;  2RSO A;  3VR2 A;  4CJ1 B;  2MPM A;  4IN3 A;  1PRT D;  5CBE E;  3OIP A;  1D6E C;  4NMZ A;  1ESR A;  1M4V A;  4FO2 A;  2JEA I;  1JB3 A;  2E2D C;  3A55 A;  3R93 A;  2VNU D;  3OW7 A;  2MHV A;  2F0E A;  4BA1 I;  4XT3 B;  1ZKO A;  3M3Y B;  3MXP A;  1I4P A;  3HRZ C;  5KND A;  1AZQ A;  5C4X B;  2L4N A;  1A6X A;  1A15 A;  3OMC A;  4C3J G;  1Q8I A;  2X69 A;  5TSS A;  4TSS A;  4ILW A;  3PUX A;  1CI3 M;  3MXG A;  2ZXR A;  1LT3 D;  4F88 A;  3Q0A A;  4ZUJ A;  1R9T B;  3VR6 A;  1OXU A;  3MA2 B;  1F2Z A;  4U67 3;  1G8Z D;  4Q5V A;  1SBB B;  2Q8T A;  3K59 A;  4RGO S;  1DOK A;  4PNY A;  3MAQ A;  3E5S A;  5D14 A;  3R3O A;  1SAP A;  3HP3 A;  1BDO A;  3BDO A;  4QUF A;  4PQX A;  2EY1 A;  3BYY B;  1ZEQ X;  1NSN S;  2VB3 X;  1ET9 A;  3NWS A;  3TN2 A;  5IGG A;  4CGY B;  2NVY B;  1GUW A;  1F2L A;  4G4K A;  4O42 A;  3KBX A;  1HQM C;  3EA6 A;  3I72 A;  2EJF C;  1SE2 A;  5J22 A;  1SEB D;  3MVV A;  2R7Z B;  4CJ2 C;  2F0J A;  1CA5 A;  4UAI A;  1U4M A;  1AFP A;  1HA6 A;  5IT9 E;  5I2Y A;  1HXY D;  5IGE A;  2NZ1 D;  3MXU A;  1XXG A;  2Y0S B;  4A3E B;  4IAL A;  3M4O B;  1PZJ D;  1EZ8 A;  1E0B A;  2PZU A;  3A8K E;  3H09 A;  3H0G B;  1GJX A;  1STB A;  1SYG A;  1S5E D;  1SNC A;  2WIN B;  2EYF A;  3M85 A;  3DHQ A;  1F2Y A;  5ISR A;  1LTA D;  1B1Z A;  2F0G A;  3SHL A;  2E2H B;  4FF2 A;  3G7L A;  4O1N A;  3SR1 A;  3NTI A;  3GTJ B;  2YU9 B;  1JWU D;  1KTK A;  5IGC A;  5JOB A;  5CGK A;  5KYL A;  3S2D B;  1QWY A;  2O4X A;  4KY5 A;  1Y8O B;  1I4R A;  1O80 A;  1HCZ A;  2E75 C;  1HFG A;  1D5Z C;  2L9H A;  2F0P A;  1BQQ T;  3J81 E;  2XN9 C;  2VXW A;  4ODG A;  3NTK A;  5C0X G;  2F0N A;  2QCP X;  3K0Y A;  5ELF A;  3I4L A;  4FP5 D;  4TKO B;  2LKV A;  5KGU A;  2BE5 C;  5E4X A;  3NP8 A;  4X3K A;  3T51 B;  4QCL A;  2JP1 A;  2M2L A;  3BYT B;  2FMM A;  4HCS A;  2BOS A;  1GUS A;  1WTX A;  2Q8R E;  5FO7 B;  1NR4 A;  1JOK A;  2R93 B;  1Q1E A;  4OL7 A;  1BF4 A;  3D4W A;  1C8C A;  5BN3 A;  5KEE A;  3KK7 A;  1SYD A;  1AEX A;  1PMR A;  4ZKC B;  1B53 A;  3I91 A;  2JA5 B;  2L55 A;  5EPK A;  3IL8 A;  3EVQ A;  4RKL A;  5FO9 B;  4EQP A;  3RZD B;  4K6L A;  2JA7 B;  4EVO A;  1BCP D;  3DEO A;  4OIK A;  5JEA J;  2N88 A;  1TWC B;  4Z9C B;  1BXT A;  2O2L D;  4OGQ C;  2BE5 D;  4DF7 A;  4G7Z C;  5K5P A;  1EU3 A;  2EPB A;  4HMI A;  1G2S A;  1G29 1;  3CQZ B;  2Z4H A;  1SNP A;  2XNA C;  5I2X A;  1FYC A;  4YIJ A;  5ELC A;  3WOE A;  4EQO A;  1EFI D;  1O7Z A;  1BO0 A;  1LT4 D;  5EBD A;  4H44 C;  5I9P A;  1VMC A;  5ELB A;  1B9M A;  2C9O A;  4ABN A;  3PO2 B;  3NUC A;  2AUJ D;  5IGD A;  3S15 B;  3RUZ A;  2VUM B;  2R3Z A;  2D2C C;  1K8M A;  2KEC A;  1X3P A;  1Z6H A;  3DWQ A;  5EBC A;  5C5L A;  1JE4 A;  1E2Z A;  4A3G B;  3QG1 A;  3R2T A;  2R61 A;  4IQZ A;  3SK5 A;  2Z8L A;  2WKD A;  1Y1W B;  2MJ8 A;  2K7V A;  1WD0 A;  1KDC A;  2HQE A;  5CMD A;  2EY2 A;  3V2T A;  5LL6 S;  5I9O A;  2NTS A;  2CW0 D;  2JA6 B;  3RLF A;  3GTO B;  1LAC A;  3SK6 A;  4XQQ A;  5JEA H;  1HTP A;  3TP6 A;  2L1B A;  1Q90 A;  2EY5 A;  4M1U B;  4L6T B;  2D9U A;  5IIF A;  2B2U C;  1C48 A;  4RWS C;  2EXZ A;  2EYL A;  2HCC A;  1Z7T A;  1AP0 A;  3O13 A;  4NP5 A;  2NN6 I;  5AFW A;  3GTM B;  3UI2 A;  4J1M A;  2FHT A;  1A3U A;  1JR0 D;  1V8Q A;  4F87 A;  2K5Q A;  2D5D A;  3MFY A;  3WDN A;  4NKL A;  1I50 B;  3ND9 A;  2IPK D;  4QF4 A;  4HTH A;  1WTP A;  1CZG A;  1MD2 D;  2SDF A;  5KNC A;  1UUP A;  3OWE B;  2O5I C;  2NB0 A;  4QUC A;  4K6D A;  1I6H B;  3HZX A;  2KHS A;  4LAA A;  4BWG B;  4FYD A;  1NAP A;  1HRJ A;  5I6Y A;  3QOL A;  1DCZ A;  2XSC A;  4IFD J;  5D3D A;  5CV6 A;  1LLR D;  2A74 C;  1AW7 A;  1ZXT A;  1MSG A;  2EZV A;  1JOO A;  2VB2 X;  3GP7 A;  1PTO B;  1E2W A;  1T5E A;  3E0J A;  2DNE A;  2A68 D;  4C3H B;  1ROD A;  3DM1 A;  1IYU A;  5M3F B;  4L8J A;  1LV9 A;  4JK1 C;  2MUY A;  2B2W A;  4PMC A;  2J7Z A;  2EYH A;  1FNU A;  3M4Y A;  2JA8 B;  4AYB B;  1ENC A;  3OHX C;  1SYE A;  3DUZ A;  1FGB D;  1QCB D;  2F0W A;  4ZKB B;  1Q3L A;  4KN7 C;  3SE0 A;  1VCI A;  4C2M B;  3HS0 C;  1PTO F;  4R9W A;  2F0O A;  2OXP A;  1PFM A;  4BBS B;  1Y69 U;  1PZI D;  3K5N A;  3OPO A;  2B63 B;  5A35 A;  4DAV A;  4KV6 A;  3C3L A;  3GV3 A;  4IZ8 A;  1PFB A;  2F0D A;  2WAC A;  4KI0 A;  1X3Q A;  4QB4 A;  3QO2 A;  1SNO A;  2KUM A;  1U9R A;  3F2U A;  3QWN A;  2KEE A;  2RDG A;  4OO1 I;  1K8O A;  1TR5 A;  4RCN A;  2KCC A;  2IJ0 A;  1PZK D;  3P7J A;  1HHV A;  3CRL C;  4IFD H;  4K5X A;  3S14 B;  3A54 A;  3VR4 A;  1MGS A;  1H9R A;  4KKU A;  1NCV A;  2X6L A;  2CVR A;  4KMU C;  2XRQ D;  4RGM A;  1ZYR C;  5D65 A;  4V19 0;  2IX0 A;  3HKZ B;  4ZRZ A;  5CC4 A;  1K83 B;  3IKJ A;  3HOZ B;  3A8J E;  1CTM A;  4K2K A;  4KHV A;  2PCF B;  3HOU B;  5I6W A;  5C0X J;  3SEB A;  1KNA A;  2B2T A;  5K36 H;  4BY7 B;  1VF5 C;  2PW7 A;  3SXH A;  3RZO B;  4M8A A;  1ET6 A;  1OXX K;  5CV4 A;  4HR7 B;  4CHT B;  1TWA B;  2DN8 A;  2LMC B;  3H3V C;  4ZAI A;  5C4H A;  1DZ1 A;  4DXF A;  1NR2 A;  1B44 D;  2DY7 A;  4KTA A;  3LWU A;  2KJX A;  5DAU A;  2RQX A;  3JAM L;  3GQB A;  2Q8I B;  2L5T A;  2ICI A;  3TDQ A;  1RF2 D;  4IFD I;  3N6R A;  1Y1V B;  3T56 B;  3HOV B;  1DOM A;  2B2U A;  1SNQ A;  1IHZ A;  4EGV A;  2AWN A;  3BG3 A;  4R8I A;  2J4X A;  4Q0F A;  4C3J B;  2CQA A;  4LMQ D;  1S5F D;  3V05 A;  3VA5 A;  1EY0 A;  4DFA A;  2H1E A;  2I07 B;  5M9O A;  1RJT A;  1SYF A;  3NBH A;  4L63 B;  1TY0 A;  2BA0 A;  5C4Z A;  5EPL A;  2QDB A;  3BVG A;  2PNR C;  4PMW A;  2JEB I;  3KLR A;  3BZD B;  5C0X H;  4DK0 A;  3D6W A;  4A3M B;  3HG9 A;  1E2V A;  1EEF D;  1KAB A;  3ITP A;  1JC7 A;  3CRK C;  5CV8 A;  1AZP A;  5IT9 L;  2I46 A;  4DNT B;  3GO5 A;  2V4D A;  1EQV A;  2AQ1 B;  4K2L A;  1H9S B;  4BBR B;  1PFN A;  5C5M A;  3H94 A;  4H0L C;  4K8J A;  2AQ3 B;  2A6H C;  1V1P B;  3E6Z X;  3S9W A;  1I4G A;  3Q23 A;  1WTW A;  1BBX C;  2B2V A;  1RCV D;  1GUT A;  3TBI B;  2EE1 A;  1F9S A;  2B2Y A;  4A3J B;  2PO4 A;  1VF7 A;  1LTS D;  1WTO A;  2E74 C;  1OO9 B;  1STH A;  3C2P A;  5DM6 3;  1SND A;  1GUO A;  1TS4 A;  4I65 A;  3C1F A;  4RGT A;  4TRD A;  4UDU C;  4TQU S;  2JE6 I;  1U4P A;  2B2W C;  3A56 A;  3DEP A;  2AWO A;  4HMJ A;  1XYI A;  5E4W C;  1B2T A;  3G6J B;  2EYM A;  4N9T A;  2WKC A;  2BDO A;  5CYU A;  3J7A V;  1CT1 D;  1EY4 A;  3CU7 A;  5LHY 1;  2RA4 A;  1WD1 A;  2F0Q A;  2XRS D;  1H9S A;  1OXT A;  2A6H D;  1H9K A;  3TSS A;  5C0X I;  1KNE A;  1HTL D;  2IL8 A;  2KA7 A;  1V1P A;  5C3W A;  5KIX A;  4KD4 A;  3MTS A;  5FKA C;  1YNN C;  4CKB A;  4B9W A;  1TY2 A;  4KD3 A;  2YYZ A;  1WCM B;  3K5O A;  5A2Q L;  1TS2 A;  1STY A;  5C6A A;  3R8B A;  3FDT A;  2RSN A;  4KJO A;  1PTO C;  3FMC A;  1IKL A;  3PIP 3;  4KK7 A;  4Y7N B;  3S1N B;  1V43 A;  5C44 B;  1DYQ A;  4C1N I;  1GXD C;  2HCI A;  3S1Q B;  1EEI D;  3FKI B;  1S4Z A;  1MI2 A;  2FJ2 A;  1IL8 A;  4LK1 C;  2PZW A;  4C3I B;  3PMF A;  2K01 A;  1PTO H;  5CBA E;  2QKI C;  3PO3 B;  1D1K A;  3IFD A;  1X32 A;  4KKT A;  2NN6 H;  4KHZ A;  4DAY A;  3EQL C;  2TMP A;  1TWG B;  2NVQ B;  1EIH A;  2A69 C;  1I6V C;  1EYA A;  3OWF A;  1QG7 A;  1Y8N B;  2AQ2 B;  2HDM A;  2K1B A;  1QNK A;  3L3O C;  5NUC A;  5BN4 A;  1G91 A;  1G6Z A;  2B2T C;  1WTR A;  1BR9 A;  1LTR D;  5J39 A;  3NPP A;  5EKL A;  3K5M A;  3H91 A;  3A8I E;  4CBV A;  1JWM D;  4DXG A;  3ERQ A;  3FPP A;  2NUC A;  3MHB A;  3NE5 B;  1GUN A;  3LWE A;  2M00 A;  3KLS X;  1KDA A;  5FK9 C;  1DOL A;  2WAQ B;  1JQY D;  5FLX L;  2K03 A;  3AB9 A;  3D4D A;  2PPB C;  2WII B;  1FD7 D;  4PMB A;  3TP5 A;  1ENA A;  5ELD A;  1RD9 D;  3I8Z A;  4BY1 B;  1FNV A;  4ZK9 B;  1LT6 D;  2A69 D;  2A6E C;  4F7X A;  5JJZ A;  4OHJ A;  4ME5 A;  2K32 A;  1A3V A;  4XT1 B;  2ZXP A;  4ZYS A;  3NHH A;  3KBG A;  4C3H G;  3TME A;  3HOX B;  4U68 A;  2XIW A;  3RD4 A;  3LX0 A;  3P75 A;  2F0L A;  2F0S A;  2WV6 D;  4RGN A;  4MN3 A;  1TVX A;  4CKC A;  4FF4 A;  5HGT A;  1U4L A;  3HGB A;  3AU7 A;  2B8G A;  3K6O A;  4RHS A;  2WP8 J;  1EL0 A;  3BDL A;  3DMU A;  3J80 L;  2JYO A;  1CA6 A;  4B08 A;  3EJI A;  2L0C A;  3A7L A;  1UAP A;  5COY A;  1Q1B A;  3Q24 A;  1WTQ A;  4OO1 H;  4RCO A;  4J8Q A;  3IFT A;  3EFX D;  4XXE A;  3K5L A;  3S17 B;  1RTN A;  1SSO A;  1LTG D;  3U9O A;  3GD7 A;  3S1R B;  3SVM A;  1GHK A;  4WJW A;  3ONA B;  2OF1 A;  3H6M A;  4K14 A;  2BCO A;  1O7L A;  1A2U A;  3HOW B;  3TZU A;  2HUG A;  3V96 A;  1W6J A;  3QOJ A;  3ZYY X;  4C56 C;  5JEA G;  4IUR A;  4KN4 C;  3Q6S A;  3PUW A;  1M8A A;  1KLG D;  2RDF A;  4FF1 A;  1HQR D;  2B2V C;  2WB1 B;  2QIL A;  3GV6 A;  1RHP A;  5J1Z A;  5EKK A;  1SJH D;  2B2Y C;  3BVM A;  5CV9 A;  2H4O A;  1U4R A;  4KY7 A;  2LS0 1;  3T13 A;  3S1M B;  2C5C A;  4V0B A;  1V1O A;  2F0K A;  1LAB A;  3ND8 A;  1EWH A;  3K7A B;  2BA1 A;  2RDH A;  1H9J A;  2M9V A;  5EQ0 A;  2J0T D;  1DM0 B;  5EGT A;  4KY6 A;  2KOL A;  2EYP A;  5ELE A;  5IOC A;  1SYC A;  2NTT A;  1KLU D;  3MXN A;  2X6G A;  5KNB A;  2NYZ D;  3GTQ B;  2Z4I A;  2A73 B;  1ICW A;  3OSO A;  2SNS A;  2EYJ A;  2EY6 A;  1JOQ A;  2MGS A;  4FXK C;  1JCK B;  4E6I A;  5COR A;  5M5Y B;  2RKS A;  1B3A A;  2B39 A;  2PYK A;  3VYT A;  4G7O C;  1ILP A;  4KKS A;  2OT2 A;  1BOS A;  5BN5 A;  1R4P B;  4DU9 A;  2AUK A;  4BS9 A;  4ID6 A;  3J7Y W;  2G9D A;  5CR3 A;  3MZ5 A;  4XTC S;  3MWY W;  3T4A C;  4DAP A;  1CZW A;  5DEH A;  1IYV A;  1I3Q B;  3D8G A;  3ERO A;  1SDF A;  5E1F A;  4PV1 C;  4G57 A;  1B50 A;  4B9X A;  3GTP B;  5FOB B;  1RDP D;  2SOB A;  5JPN C;  3NXW A;  2F0T A;  2FIN B;  1QOH A;  3I3C A;  4R8N A;  1CM9 A;  3FVQ A;  2KED A;  3FEW X;  1RKN A;  1S5B D;  4XYO A;  1LTB D;  5C3E B;  4A3K B;  1AN8 A;  3NQT A;  3TP7 A;  3PUZ A;  3JAM E;  2FFK B;  1TWH B;  1XX8 A;  2EOT A;  1LO5 D;  3I4N B;  3DWP A;  4G7H C;  5C3X A;  1ZYR D;  3MC0 B;  3DXJ C;  3SDZ A;  3C46 A;  2N55 A;  2F03 A;  4IFD G;  1EU4 A;  2K28 A;  4HED A;  4K5W A;  2E2I B;  1KAA A;  1OXV A;  2SEB D;  1EIG A;  3KLS A;  4WRD A;  3L7Z C;  2R6G A;  3VR5 A;  2F0U A;  2XWB B;  3D4R A;  1EZ6 A;  1CFM A;  3T53 B;  5LL6 X;  4CJ0 B;  1F9Q A;  1ONL A;  1G2T A;  2NBF A;  3X3M A;  1D2B A;  4C1N K;  4FF3 A;  1O78 A;  1I4H A;  1STG A;  3OMG A;  1TII D;  4NDX A;  4CKE A;  3BS1 A;  1FR3 A;  3X3N A;  2PZT A;  3Q22 A;  1PRT B;  3VYS A;  2NWG A;  2B8F A;  5T1I A;  1QIL A;  1XTC D;  1TWF B;  3K58 A;  5K36 G;  1R4Q B;  1BUV T;  2DY8 A;  2F4I A;  2Z1C A;  3URY A;  2G9H D;  4RH6 A;  3RMH A;  1MSH A;  1EY5 A;  4GZY C;  4FNF A;  5G3L F;  2F1M A;  4IUQ A;  1HFN A;  4A3D B;  1QNU A;  3OIQ A;  2LFN A;  2K5W A;  1PRT F;  2DNC A;  3AMU A;  3PUY A;  4ZLT F;  5JAV A;  4A3F B;  1CK1 A;  4XQN A;  3D3R A;  1D5X C;  1QB5 D;  2EJM A;  2XVS A;  3I4M B;  4HN7 A;  1YNJ C;  5EPJ A;  1DJR D;  5KRU A;  4FXG C;  2MP1 A;  4WFN 3;  3NTH A;  1F77 A;  3W3A A;  2F0H A;  2RBM A;  1VDZ A;  4FXD A;  2PW5 A;  1GUG A;  5M5X B;  5M5W B;  3FPU B;  5FO8 B;  4XYQ A;  1LTI D;  3CHB D;  2ENB A;  3NSW A;  1EOT A;  4HSV A;  5HUR A;  1HUN A;  3KF8 A;  1PXU A;  1BCP C;  3D31 A;  4C3I G;  4K8I A;  3I90 A;  1Y8P B;  4X3U A;  3QJY A;  5EKI A;  1WVL A;  3NK9 A;  5A2Q E;  4IUP A;  1BNZ A;  4KJN A;  1J8I A;  3S2H B;  1OXS C;  1ESF A;  3IAY A;  3J81 L;  2PMZ B;  1IW7 C;  4FVM A;  2GA4 B;  2BDN A;  5DM7 3;  1QE6 A;  2F0V A;  3M7N A;  1SE4 A;  3GTG B;  5JPM C;  3P20 A;  2F0M A;  2A5H A;  1YNJ D;  3VR3 A;  3HEJ A;  1S5D D;  4ULL A;  3FRP B;  3R2I A;  2NVX B;  3A7A B;  4EQN A;  4S3S A;  1MBY A;  2ICE C;  2OEO A;  3BDC A;  3I70 A;  2ZXO A;  5KYI A;  2R92 B;  3NBI A;  5CV7 A;  3W2D A;  1I4Q A;  4OIJ A;  5I4D A;  1TT2 A;  4DNR B;  1W6K A;  2ID0 A;  3KUP A;  1RTO A;  2L12 A;  5DNF A;  1SE3 A;  1STA A;  3QIA A;  4MHE A;  1JWS D;  1SJE D;  1PDQ A;  3QB3 A;  1CHP D;  1YNN D;  2PQE A;  1IW7 D;  1XWE A;  3DWA A;  3MFG A;  3LNN A;  1B4O A;  3PUV A;  4N9P A;  1EWC A;  1DD2 A;  1NUC A;  3K57 A;  2EDG A;  2RVL A;  1TQO A;  2CW0 C;  4H13 C;  1GHJ A;  2LY7 A;  5FLX E;  1PTO D;  3S16 B;  3TZD A;  3TP8 A;  3OOC A;  2F3V A;  5IGF A;  1JOR A;  3SK4 A;  2FMC A;  3VYU A;  4QIW B;  1EY7 A;  4DA2 A;  1J9O A;  3GTL B;  4I7Z C;  2F3W A;  4H7B A;  4DN4 M;  1F2M A;  5D3I B;  1UEA B;  1SMY C;  1CQV A;  3MEH A;  1Q12 A;  3SK8 A;  2IW3 A;  3HOY B;  1LT5 D;  3M7G A;  5F2D A;  1VMP A;  3VA7 A;  2KCN A;  5IOD A;  4P2C B;  3N52 A;  2K05 A;  3PIO 3;  2KVM A;  2EYO A;  2NN6 G;  3U9S A;  3L9A X;  1LTT D;  4HCE A;  2K6A A;  1D1I A;  3J80 E;  4F8M A;  4NW2 A;  5C4J B;  2K33 A;  4IUV A;  2K5D A;  1SNM A;  4HAE A;  2K04 A;  1BCP B;  1CQF A;  3C1E A;  1S5C D;  4RAU C;  1PYW D;  2IWH A;  2A68 C;  4ZUI A;  4A3B B;  1STN A;  2SNM A;  1CHQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...