2EJFC

Crystal structure of the biotin protein ligase (mutations r48a and k111a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
NVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 12
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ejfC00
1H9MA 1GUNA 1Z6HA 2DNCA 1CI3M 3MXUA 1Y8OB 1CTMA 2PNRC 3AB9A 3MFYA 1E2WA 4IFDG 3PUZA 3W3AA 4DNTB 1VDZA 2BDOA 1H9RA 2D2CC 2EDGA 1V8QA 3TZUA 2ZT9C 1Q90A 4KKTA 1IW7C 1Z7TA 2B8GA 3EQLC 4RCNA 3VR3A 2EVBA 4XTCS 1VCIA 3OW7A 3ND9A 5K36H 1Y69U 1GJXA 2KCCA 3LNNA 1QJOA 4G7ZC 1LABA 1O78A 2DN8A 2EJMA 2E74C 3L7ZC 1DXMA 3PUYA 2F1MA 4H44C 1E2VA 1E2ZA 4OO1H 4JK1C 2QF7A 3M4YA 1DCZA 1B9MA 1TKWB 2LMCB 2BE5D 4L8JA 1G291 4GZYC 1ONLA 1Y8NB 5A35A 1IYVA 1YNNC 1GHKA 3QIAA 5KNDA 1K8MA 2R6GA 2KA7A 1OXVA 3OOCA 2BA1A 3A8IE 2A6HD 1K8OA 3I72A 4I7ZC 4DK1A 4TQUS 1FR3A 4G7OC 2BA0A 4G7HC 2CW0C 1HQMC 3VR5A 3WDNA 1VF5C 4LK1C 3VA7A 3PUVA 4BA1I 4TKOB 1Q12A 2A69D 1V43A 3VR6A 1I6VC 3A7LA 1BDOA 3FPPA 5JEAH 3ND8A 3T53B 1SMYC 2PPBC 5K36G 1DD2A 1O7LA 1Y8PB 3H94A 2D5DA 5C0XH 1PMRA 3FMCA 3IKJA 2BE5C 3QJYA 3N6RA 1TU2B 2B8FA 2E75C 5BN5A 1HCZA 4XIGS 3M85A 3M7NA 4OO1G 1A6XA 1GUGA 2EJFC 1T5EA 2V4DA 3CRLC 1HTPA 1LACA 3GQBA 3PUWA 1FYCA 2NN6H 2A6ED 3BG3A 2O5JC 1GHJA 1OXTA 2E76C 3T51B 4KKSA 2A6HC 5KNBA 2Q8IB 4HR7B 4KMUC 1Q1EA 2DNEA 4H0LC 2IT1A 4LJZC 2D62A 3OPOA 2EJGC 1OXUA 3QG1A 5BN3A 3VR4A 1H9SA 3P20A 2YYZA 2A68D 1H9KA 2JEBI 2A69C 1B9NA 2JE6I 4H13C 2JXMB 1IYUA 1OXXK 1ZKOA 2L5TA 3LWUA 3RLFA 2K7VA 2K33A 2AWOA 3PUXA 2AUJD 4KN7C 2JEAI 2K32A 3CRKC 3VR2A 3T56B 4IFDH 1GUTA 4DNRB 4KKUA 1VF7A 4PV1C 4IQZA 5JEAG 1HPCA 3D31A 3I73A 4OGQC 1EWHA 5KNCA 1H9SB 3HGBA 5C0XG 4KI0A 3D4RA 2A6EC 1Q1BA 4BA2I 2O5IC 1IW7D 4KHZA 4KN4C 1CFMA 2PCFB 1YNJC 3BDOA 3KLRA 2NN6G 3A8JE 1OXSC 5BN4A 1ZYRC 3IFTA 2A68C 3U9SA 3GD7A 3A7AB 3NE5B 4JBWA 4DK0A 1GUSA 3PV0A 3SE0A 1GUOA 2NN6I 3DXJC 1H9JA 3A8KE 3SDZA 2AUKA 3I4LA
chains in the Genus database with same CATH superfamily
5JJIA 4YIJA 1C8CA 1EYDA 1Y8OB 4GN3B 1U4RA 1KAWA 5J3BA 3MFYA 2QDLA 2NVYB 5IWAQ 4U673 1K83H 4A3GH 3HOWB 1XXGA 4IUNA 1Y69U 1TWGH 2PO4A 1ESRA 2QILA 2EJMA 2YTYA 5C3EG 1KDBA 3RZOH 4CDCC 4QIWE 2VW9A 1SROA 1X9NA 1TS5A 2LMCB 4LFBQ 1G291 2KCMA 4XQNA 1TWAH 1F2YA 2SNMA 1C4QA 1YNNC 4IUVA 3OMGA 4NXNL 5A35A 5C5LA 3J7YW 2F52A 3AYHB 1KTKA 2BA1A 3IAYA 4DV4Q 4IUTA 2JA5H 2E2HH 2NYZD 4OWXB 3K8AA 1UWVA 2MP1A 4TKOB 4X66L 1FNUA 1U0LA 4A3MB 3FDTA 1BVSA 1XPUA 3ND8A 3T53B 2Q8RE 1EFID 4JI2L 1PTOC 4A3IB 1EQVA 4BXXG 4B9XA 4C3HG 2EYHA 2XSCA 4ZUJA 3GQBA 5JAVA 1RL2A 4ABNA 1DJRD 1FYCA 3U58A 5IYDH 3UDFA 1M4VA 3S15H 4J1MA 1W6KA 2R92H 2IT1A 2R7ZB 1MIUA 2XWBB 3IRBA 5BN3A 4POGA 3TMEA 3VR4A 3MEHA 4GS3A 1QZGA 4AYBB 2JE6I 4NMZA 5IP7G 4ZK9B 5F2DA 5C3WA 4DV1Q 2IL8A 3GO5A 2EYLA 1Q7YC 1HR0L 2JEAI 3UDGA 3PO3B 2WAQB 5E3FA 2FFKB 5CV4A 4KI0A 3K6OA 3C2PA 4A3EG 3I4NG 2K5VA 3BDOA 5AFWA 3I4MB 1V1QA 3DUZA 3FP9A 1HZ9A 4JOIA 3ULPA 4BWGB 3BZDB 3U9SA 4LFCL 3NE5B 3V96A 2F0OA 4APVA 4N9PA 3GTGH 4V190 1CZWA 4BBSG 3U9OA 4P74A 4HAEA 3PF4A 1QILA 2K01A 3I4LA 1ESFA 2CH4A 1F9QA 1TT2A 5IIFA 3OTOQ 3S24A 4LF5Q 2PNRC 2UUBL 2B2UA 3CCEA 4LF7Q 1RTOA 3E5SA 3W3AA 1HA6A 1VDZA 3NELA 3TZUA 5JPMC 1CQVA 1I94Q 2HIXA 2E8GA 4WJ3M 1RCVD 1CUKA 2FJ2A 4NW2A 1SE2A 2F0JA 2K6AA 1IBKQ 1IXRA 1DXMA 3EN2A 4DF7A 4DV5Q 1B2TA 2R93B 2EYJA 1MJEA 1Y8NB 4DR4Q 2XGTA 1YNND 1O7IA 5G3LD 3I56A 4NPSA 4DAVA 1QVFA 4NXML 5IYBG 2K75A 4ULLA 2JA6H 4G7OC 2BA0A 2F0SA 3MXGA 4ODGA 4POFA 5NUCA 3HOUB 1MGSA 2A69D 1QUQA 3Q6SA 5FLXE 2VNUD 3SHLA 5E4XA 3H0GB 4P72A 1HR0W 3S2HB 1JT8A 2K1BA 2XWJB 4CJ0B 3F2BA 4ME3A 3ICEA 4KTAA 2E5LQ 5GADC 1O7YA 4DNIA 3CKIB 1PZJD 3QJYA 3EIVA 3N6RA 4R1JA 1N34L 4DAMA 1JB7A 3AU7A 4BY7H 2B29A 1WTOA 2EYFA 2NN6H 1S5BD 2RA4A 2WB1B 2D0OA 3H3VC 3UE1A 3OW2A 2G5DA 5I2YA 5M5XH 4XQJA 1C7YA 3HOVB 3QG1A 1CQFA 2IX0A 3CP0A 3M4QA 4WJWA 4N8X1 5A2QE 4UP9A 3VDYA 1SE3A 2EXZA 1X3EA 1QVCA 1Y1WH 1A2TA 1VQEA 1OO9B 2J4XA 1MHWC 2HUGA 4DV2Q 3DEPA 4PZ8A 4R4IA 4QGUA 2G9DA 2ICEC 5J22A 2N49A 1JCKB 4DAYB 1LLRD 3PO2G 2LSSA 1SLJA 1I3QH 2IW3A 4DV3L 1IBLQ 3IFTA 2Z9HA 1SAPA 3L0OA 4X65L 1WTQA 5EPKA 4LUZA 1H9JA 5BR8Q 3GTQB 1W2BA 2DUDA 5EGTA 3M4OH 1AH9A 3ITPA 4DAYA 4LUOA 3PMFA 1MKHA 5C4JB 2LS01 5EKLA 2Z4HA 3FKIB 2VQFL 4JI1Q 1ET9A 5IP9H 2B2WC 1ASYA 4V0BA 4DNTB 4DR2L 3VR3A 4GN4B 2VZAA 4A3CG 2XNAC 3K80C 1PH2A 4IFDI 5C0XI 1GJXA 1TWCH 5JJLA 3M4PA 3NWSA 5D65A 1A62A 1EUJA 3SR1A 1X3PA 3G48A 1JC7A 2Q8TA 4L8JA 1AP0A 2Z4IA 4A3DB 4GN5A 1K8MA 3S17H 1D1IA 4DKAC 1VQIA 2JA8G 2EE1A 2RBMA 4G7HC 3JAME 1ASZA 2F0WA 1V1OA 2NVYH 1I50B 2ZTDA 2RCFA 4DN4M 1DOKA 1BDOA 4ZAIA 1Y1VB 2XRQD 4DV6Q 1DD2A 2OCEA 1RDPD 5IE8A 5KGUA 2AMCB 1SEBD 1A0IA 3I70A 4JV5Q 2J0TD 3NBIA 4XIGS 2JP1A 4KD4A 1BNZA 1B44D 5J39A 2B3GA 4KKSA 5KNBA 2N3SA 5D3DA 4A3BB 3RUZA 3P20A 3T16A 5CYUA 2KHIA 1IBMQ 4QIWB 1KXLA 1B9NA 2JXMB 1I6HB 1SMXA 2L5TA 1TS3A 2UUAL 4JI6L 3EA6A 4BY1G 3G71A 3HOYB 1SYGA 3NK9A 1E3PA 1XNQQ 4A3MH 1CK1A 3R2IA 5JEAG 3LWEA 4R9WA 3OIQA 2RDHA 1BOSA 5M5YB 5KNCA 1H9SB 4A3IH 5EAYA 1YJ9A 3NTHA 1KD1C 1XNRQ 2LXJA 4EVOA 2ATWA 4HMIA 1A2UA 1FGUA 3OMCA 4LWCA 4LF6Q 4K5WA 3GD7A 4I65A 3VA5A 1AFPA 2UXCL 1VQAA 1F2ZA 2AHOB 2BCOA 4IPDA 4JOIC 4OXPA 4PNYA 1N32L 2DNCA 1RHPA 4TSSA 3VYRA 4DUZQ 1GO3E 1YHBA 1YJWA 1XYIA 1Y14B 1TWGB 3PIO3 4GKKQ 1EZ6A 4K0KQ 1DOMA 2B8GA 5IWAL 3SK6A 2F0VA 1NMFA 4L5QA 5ELNA 4ZLTF 4M1UB 2B2UC 3KF6B 2B2TA 1I4PA 1II3A 1JOKA 3DWPA 3FRPB 2YU9H 4FF4A 3PQIA 1SNQA 2PI2A 1B53A 3KF6A 5KNDA 4LFBL 4GLAC 1VQPA 4ALPA 3CCRA 2E2HB 3NBHB 3J80c 1U9RA 1D5ZC 2V1CC 2PZUA 2ENBA 2YTXA 3I7FA 1E7ZA 3K7AH 3NQIA 2I5LX 1Q3LA 1IYJB 3NBHA 2SNSA 3D4DA 2FINB 4FDBA 1EY6A 1O7LA 3MFGA 4AYBE 1JOOA 3ULJA 3K5NA 1V1PA 1TVXA 2R92B 4X62L 3QO2A 1HZAA 3E9HA 2R93H 2WAQE 3TDQA 3J81E 1OXTA 1N33Q 1DM0B 2PQEA 2IWHA 4E6IA 3MA2B 1Q81C 4LJZC 2KECA 1OXUA 5IGGA 2YYZA 2JEBI 4FNFA 2RDGA 1ENCA 5E4WC 3MXPA 3A54A 3CC7A 4YY3Q 3HOUH 1JQYD 4DV1L 2AUJD 2KEDA 5IT9E 1X3FA 3CRKC 3G6EA 1GUTA 2Y0SE 4RMFA 3I73A 4C1NK 5CV5A 1UEAB 2A6EC 2H5XA 4KN4C 1LTLA 4Q5VA 2C9OA 4IOAA 1ENAA 2N8NA 4C3HB 1EU4A 1Z47A 3BVMA 3GTGB 1PYWD 4RKBA 3FEWX 2E2DC 3E0EA 2DY8A 3RZDH 1L0WA 3KLWA 2RDFA 4RGTA 4X6AH 2A5HA 4K6DA 1X65A 5C6AA 1CTMA 3S1QH 5I9PA 2B2VA 2R61A 1JE4A 3F1ZA 3PUZA 2F4VQ 2MPMA 3TBIB 4KKTA 1K8AC 4L5SA 3KFUA 3TQYA 2CW0D 2FXQA 1I94L 1XMOL 3O13A 1SRUA 4M8AA 1JJGA 1RKNA 5FO8B 1IBKL 2QF7A 2E2IB 2KENA 1FNVA 4DV5L 1EY7A 5IYCG 2A73B 1SDFA 5I2XA 2KVMA 3NQTA 4DR4L 1WYDA 1JMCA 2M2LA 2PZWA 4I7ZC 4S3SA 5C4JH 2K5QA 1LV9A 5E7NA 3FKIH 2WB1E 4GKJQ 3A56A 2NTSA 3FPPA 2Z8LA 2CCZA 2CFMA 4JI8Q 3PF5A 4BY7B 1Y8PB 4J6HA 1NR4A 1PMRA 2E5LL 4QL5A 1YVCA 5BN5A 4Y52H 2O2LD 2OF1A 3CRLC 2TMPA 5M5XB 1BR9A 2IPKD 1GHJA 4NDXA 2E76C 1VQJA 3W2DA 2D62A 4A75A 3C3LA 4ZKBB 1H9KA 2JA7G 2F0QA 1FJGL 1EEFD 3D4WA 4RGNA 3PIPA 1I50H 1Z9FA 1SYCA 1Y1VH 4AIMA 2JN4A 5IGCA 3CCUA 3IL8A 4C1NI 1XTCD 1MSHA 1I3QB 1TWHH 3DWQA 1IW7D 4KHZA 5C4XH 4TRDA 5M9OA 2O5IC 5M3MB 1ML0D 1NMGA 5FKAC 4XQQA 1OXSC 1FL0A 3WOFA 1LTBD 1OTCA 3M4OB 1ZYRC 4DR1Q 3F2CA 5IGDA 4PZ6A 3I2ZA 1NE3A 2HDMA 4A3BH 2DJGC 1D5XC 1RIPA 2XVSA 3U50C 3FVQA 4JI0Q 1GUNA 1Q82C 1PRTD 3GTJH 2CVRA 3HOYH 3KJOA 4OWTB 1XJVA 1IKLA 1TS4A 1MD2D 4IFDG 1I4GA 2NZ1D 4MZ9A 1LTID 2EDGA 3GV6A 4JI1L 4C3JH 2ZT9C 5FJ8G 1UE7A 2K03A 5M5YH 1VCIA 4RGMA 3ND9A 5LL6S 1BCPD 1D6EC 4BBRG 3BYYB 1SYEA 4HCEA 5M3FG 1NSNS 1SMYD 4H44C 3BDLA 3S17B 2FMCA 3PIOA 4HJ7A 1RTNA 3MWYW 2B2TC 1SFOB 4F8MA 5GAEC 1S5ED 1VQKA 1KRTA 3HOXG 1IL2A 3H09A 1C0AA 2L12A 2PZTA 4BA1I 4QMGA 1Q12A 1B50A 1D5MC 1VQFA 3G7LA 4CDDC 1N9WA 2K5WA 2F0NA 2BH2A 2R7DA 5I9OA 4IUPA 4UAIA 4JC0A 5C0XH 1F9SA 3RD4A 4DV6L 3IKJA 3DM1A 4J8QA 4JV5L 1VS0A 3TP6A 3OWFA 1U4MA 5FOBB 4CBVA 3A74A 3TEHB 3ZYYX 4H0LC 4RWSC 2VL6A 4ID6A 3H6MA 3W1GA 2B39A 4FXDA 1E0BA 2PMZE 2A69C 4B3SQ 3D8GA 2HIVA 2ES2A 1SE8A 1OXXK 2JA8B 4I7AA 5AJ3Q 2F0FA 3PUXA 4IPCA 1KHIA 1Q86C 1PLFA 4X64Q 1EYAA 3OIPA 1VF7A 3D31A 1XNQL 2K14A 3FPUB 1QE6A 1EIHA 5COYA 4BA2I 3MZ5A 5CV9A 1JWMD 1ZXTA 1WOCA 1BO0A 4CDEC 2P5ZX 1XNRL 1WI5A 1ZYRD 3K7UC 2GVAA 1K3BC 4LF6L 4IUQA 1NUCA 3LX0A 1J6QA 1HUMA 3S2DH 4A93B 3STBC 2PI2E 2AUKA 1TIID 2NVXH 1JWUD 3UDXA 1CI3M 4ZQ3A 4DGZA 1PV4A 4JI5Q 4IPHA 1E2WA 2OTJA 1G6PA 4GOPB 2L4NA 2K05A 1SXTA 4C3IB 3CU7A 4K0KL 2EVBA 4X3SA 4ZUIA 3HOZG 3OW7A 3S16B 1CA5A 2B2VC 2VXWA 2F3IA 1LABA 3L9AX 3SK8A 1LM0A 2DN8A 3CAMA 2YU9B 4GOPA 4C3HH 2Y0SB 1PH1A 5HGQA 3MEFA 1WD1A 1DCZA 1EY9A 3KDFA 4JPBW 4Q0FA 3I90A 4B08A 4EQ5A 1STBA 1GHKA 3E6ZX 1BBUA 1BBXC 3J7AF 3K7AB 2RQXA 3DHQA 2R6GA 2KA7A 2NTTA 5JVG3 2FMMA 5C0XJ 5T1IA 4ZKCB 1WD0A 2C5CA 5IP7H 3URYA 4AH6A 3VR5A 4JCVE 2WINB 3AMUA 1V43A 1C9OA 1I6VC 5EPJA 3KUPA 4LMQD 1G91A 4RG1A 1L2FA 1G6ZA 4X3TA 2DJFC 1GUWA 5LMNQ 2L9HA 4A3JB 3I4NH 1TU2B 2KQ3A 4OO1G 3HRZC 4R4QA 4HTHA 4OEMB 1EYCA 2E2IH 1HA5A 1QUQB 2K52A 3BG3A 4P71A 1XMQQ 2MJ8A 4HN7A 2QDBA 2NVTB 4YWLA 5FLXL 5CV8A 1N33L 2MO1A 5HY6A 5CV6A 4BBSH 3W5OA 2PW5A 1YITA 1CA6A 3LWUA 1CSPA 4KHPL 1QNUA 3A0JA 1L0XB 4B9WA 2Z0SA 4JI3L 5IY0A 1ICFB 3K5LA 4CJ1B 1SR3A 4A3LG 2GN5A 1EWHA 2F0IA 2QKIC 1S5DD 5GAHC 4DK3C 4A3KB 1KIXA 1KLGD 1CKOA 1EWIA 5CMDA 1AN8A 3T1YQ 3KOJA 2VUMG 3RZDB 3EFXD 3Q8DA 2L11A 5A2QL 1V9PA 1DGSA 3RLNA 2CQAA 3STBD 1NNXA 3S1QB 2AWNA 1WCMG 3SDZA 1ILPA 4OELB 4LF8Q 2UXDQ 4MIUA 2AQ3B 2ZTCA 4YCUA 5FO9B 4PZ7A 4DFAA 4LF4Q 3T13A 1PRTB 4F88A 3BVGA 2BDOA 4LW1A 1H9RA 3H15A 1K0RA 1HNZQ 2F4VL 3NENA 1VQ9A 1UUPA 3WOEA 3JC66 2M00A 4OL7A 5M3MH 2QGQA 2Q2HA 1BCPB 5JJZA 4JK1C 1PFMA 2F0DA 2HDLA 4IZ8A 2MUYA 1IYVA 1WTVA 2RCNA 1K3RA 3DM3A 1X6OA 4NP5A 5KIXA 2HT1A 1TY2A 3SK4A 4F7XA 4KY7A 1LT6D 1T9HA 3M3YH 3WDNA 2KJXA 1KL9A 2HCCA 3A7LA 3J80i 4RFBA 4GKJL 3C1FA 3G6JB 1PH8A 4RA8A 4HJ8A 1XTDA 1TY0A 2OQKA 3HOWG 1A6XA 1CKNA 3PUWA 2UU9L 2I46A 1LACA 1JWSD 2HQLA 3PO2H 5JOBA 3KBXA 3GTLB 2A19A 2EY6A 3JAML 4IURA 3T51B 3M9BA 1KNEA 2ZJQA 2DNEA 1S40A 1SBBB 4EQPA 1I4XA 3I3CA 1SFOH 4DUYL 3MTSA 4X3UA 4H13C 2LY7A 1G2TA 1AW7A 5DLQE 5LHY1 2F0KA 1CHPD 3TS2A 2K32A 4XT1B 3T56B 3GTMB 2JYOA 4KKUA 4JI7L 1J9OA 2PNHA 1TWHB 4FXKC 4OIKA 3V05A 5C4XB 4YHHQ 4KJNA 2XTIA 4FO2A 4CKEA 1PYBA 5C3XA 3PIP3 2IY5B 2ID0A 2RVLA 1GVPA 1R4PB 4A4IA 1UE5A 3TP5A 2SDFA 1KLUD 5M5WB 5EBCA 1NCVA 2SOBA 4WORA 4R4OA 1GUSA 1P16A 1BUVT 5CORA 3KJPA 3KK7A 2KCNA 3BZCA 2KHJA 2A1AA 1YBYA 3A8KE 5ELCA 1FGBD 3GTJB 4NXNQ 5I6WA 2ZM6Q 3DMUA 2R7ZG 2JA7B 3ONAB 2WKCA 4C3JB 4LF9Q 3C46A 2JA8H 1EY5A 3TN2A 4RHSA 4YWKA 4DR7Q 4O2DA 1T5XD 3V2TA 1C48A 2PMZB 4MHEA 2OXPA 2ALYB 3PO3G 2KCCA 3K58A 2KBNA 3P7JA 5LL6X 3A5UA 3GTPH 3KLSX 3I4OA 3CQZB 2F0UA 2BE5D 2B63G 3I4MG 4GZYC 2WACA 3NHHA 4A93H 5IGEA 3QR8A 4GOPC 1A15A 1I4HA 3KF8A 5FLMG 4DR3Q 4UY8C 1NBWA 2A6HD 2CHBD 4TQUS 1VQCA 2CW0C 3U4ZA 4BY1H 3PUVA 3UDIA 1JJCB 1HR0Q 2L1BA 4C3IH 1K28A 5JEAH 1PFSA 5K36G 3HKZG 3S16H 3CW2C 2D5DA 2ZJRA 2BH8A 3F8TA 5CBAE 3QWNA 1PH9A 5E1FA 3BDCA 4LUVA 1S5FD 4ILWA 3C1EA 4OX9Q 4K8JA 1E24A 1O80A 2Z6BA 1EQQA 1PH3A 4FF3A 3NEMA 3CMAA 3OPOA 4LFCQ 1N36Q 4L5RC 1SYFA 4DV4L 4JBJA 4CKCA 1V1PB 5EPLA 4KY5A 3RLFA 3HOXB 4B3SL 1HFNA 4KN7C 2NWGA 1PRTF 3VR2A 4K14A 4PMCA 3D6WA 1SNOA 3J81L 1VQMA 1AZPA 2XIWA 2HCIA 4X64L 5IODA 2HHHQ 3HGBA 5C3EB 3H0GG 1WFQA 4A3JH 4RCOA 1VQ7A 4NB3A 1P8LA 1SE4A 2IX3A 4OO1I 5J1ZA 1BCPF 3S2DB 3R2TA 1UE1A 3CPWA 2NVTH 3A7AB 5IT9L 1HTLD 2KHSA 2NVXB 2NN6I 3DXJC 1TQOA 5D3IB 3S1NB 4XT3B 4IJLA 1Q8IA 4HIDA 2OT2A 3HOVG 4NXMQ 3ZJYC 2QA4A 4DU9A 1LTGD 5HGTA 1VQOA 1PFBA 5JPNC 1NAPA 3I91A 3WWVA 1IW7C 5FLXc 3UE0A 2F03A 1EEID 1EOTA 3H3VI 3NTIA 4XTCS 3KBGA 4A3KH 4ZRZA 3RN5A 3TP7A 4R4CA 1O78A 2JSOA 1E2VA 3Q24A 2PQAB 4JBMA 1N34Q 3L2PA 3M4YA 2VY3A 4WFN3 1TS2A 4MTKA 2FHTA 1PFNA 2RSNA 3DWAA 1CT1D 5TSSA 1PRTC 2A8VA 2Z1CA 5JEAJ 2RHSB 1G8ZD 2F0EA 2PQAA 5FK9C 3OTOL 4LF5L 1YEZA 2IJ0A 4QUCA 4LF7L 4KJOA 4A3FG 4FF2A 1L1OA 1VF5C 3VA7A 4QCLA 5FO7B 1QCBD 1K9MC 1BCPC 3MXNA 2KEEA 2JJQA 4A3EB 3I4NB 1B70B 1SMYC 2WIIB 5C4HA 1KDAA 3CF5A 1RD9D 1U4PA 3MC0B 3IFDA 5JJKA 3NXWA 1EIGA 4IOCA 3D3RA 2E75C 3M7NA 5ELBA 5LMNL 4FXGC 4O42A 1F9PA 4BBSB 3NP8A 4HR7B 1JB3A 4KMUC 4DR6Q 2CH4W 4XXEA 4A3DG 1EIYB 1E1TA 1ZKOA 1KAAA 1GM5A 2K33A 2AWOA 1ICWA 2AKWB 4FP5D 3S1RH 4CKBA 3S9WA 4PV1C 2EYPA 3R8BA 1XWEA 1LTSD 1Q1BA 3A5ZB 4QQBX 1M1KC 3BYTB 3T1YL 4QUFA 4H02A 3GTLH 1WJJA 2A74C 5IGFA 4GNXA 4DK0A 3PV0A 2I5MX 4K8IA 1A3UA 1HNWQ 3CHBD 1D2BA 5CR3A 1KABA 1H9MA 4A3BG 1D1KA 4HCSA 1NJIC 4LF8L 1CSQA 3JAMc 3E9IA 3GTMH 5DM73 4UPAA 4LF4L 4DV2L 1ET6A 3RMHA 1HNZL 3K81C 2E74C 1IBLL 2VUMB 5LMNW 1LYLA 1B9MA 2NZOA 2X69A 5C44G 4EQNA 5M5WH 1JJ2A 1IKMA 4Y7NH 1EQRA 5BR8L 3K5MA 1I4QA 4UP8A 4HIMA 3HZXA 3P75A 1WVLA 4DAPA 3M3YB 1QNKA 2KUMA 3EVQA 1QZHA 2JA7H 4DK1A 2Q2IA 2NUCA 3GV3A 2N78A 3HKSA 1GD7A 5L37A 4J15A 4UP7A 4YWMA 4JI6Q 3R3OA 1SJED 4A3GG 2PPBC 5KYIA 1QWYA 1EYGA 3I8ZA 3PO2B 2EQSA 3M85A 3CXCA 3VYSA 3CQZH 1FNWA 1MJCA 1F2MA 4HIKA 2EY1A 3FHWA 1HNXQ 4XYOA 4U68A 3KLSA 1BXTA 3S14B 3OYYA 4OWWB 1HUNA 2EJGC 4UDUC 4FYDA 2F0PA 2K5DA 4HJAA 1J5EQ 4B3TQ 2L15A 4B3MQ 2JA5G 1IYUA 3NSWA 2CQOA 2MHVA 1RJTA 3CPFA 4IN3A 1QB5D 3Q23A 4FVMA 4IFDH 4EX5A 3CCJA 1HQRD 3QB3A 5FJ8H 5I6YA 4JYAQ 2X6GA 2H1EA 4YHHL 5EQ0A 1MBYA 4BBRH 2EY2A 5C5MA 3AQQA 3OWEB 2ASBA 2OTLA 5EJWA 3KLRA 4PMBA 5M3FH 1VQ8A 5IYDG 5BN4A 2KOLA 3QOJA 2JK8A 4C2MH 2R92G 3CCLA 4JBWA 3GTOH 2TSSA 2J7ZA 1GKHA 1IBML 1R9TB 3CCSA 1SYDA 1I4RA 2OQ0A 3CCMA 3HOXH 2WV6D 5T1GA 2ZM6L 3UI2A 2BDNA 4LF9L 1MSGA 1STHA 4C56C 4DR7L 4RCNA 3EQLC 4N8FA 5D14A 3S1MH 3TREA 2WKDA 4R8NA 5C3EH 4GLXA 3GTPB 1QJOA 1XX8A 3K57A 1B7YB 1VQDA 3NTKA 4JW0A 3GTKH 1GXDC 1ENFA 1RF2D 1Q8KA 1YNXA 4DXGA 1KNAA 4X62Q 3J81c 3S1NH 4A76A 1X3QA 1OXVA 1PTOH 2EOTA 3ERSX 3OOCA 4BY1B 3B6YA 1DYQA 3QOLA 4DUZL 4DR3L 1E22A 4OHJA 1FR3A 3DLLA 5DEHA 1U5KA 4GKKL 1LUZA 2ICIA 1X32A 3KDFB 3E0JA 1X56A 5IT9c 2QEJC 4LFAQ 1N8RC 1B1ZA 1UE6A 2BOSA 4BXXH 1L1OC 2GA4B 2PW7A 2K50A 2EJFC 2RKSA 3J80L 1A3TA 4OX9L 2B63B 4IFDJ 1Q1EA 2N88A 3J80E 3VYUA 5GROA 1PZKD 2AQ1B 3HP3A 1MI2A 2CWPA 2A68D 1O7ZA 1EOVA 2CWAA 2QEXA 1N36L 4L63B 1HHVA 2JA6G 4KLKA 5ELEA 1YHAA 2IHFA 2UXBQ 1PDQA 2NVQH 4IQZA 1LT3D 1BBWA 4A3EH 4RGOS 4DV7Q 4OGQC 2OWOA 3HOZH 2B2YA 5LMUQ 1TR5A 4LAAA 3X3NA 5IGBA 3HKZB 3CMEA 4RKLA 2HHHL 4BY7G 1XMOQ 4JVZA 2JQOA 4P75A 2MFIA 2NN6G 1G51A 2UUCQ 1IL8A 2EIFA 2MQHA 3CCQA 2L55A 4IUUA 1GUOA 2ZTEA 5CV7A 1S4ZA 2SEBD 1JICA 1PA6A 2F0LA 1Z6HA 4YY3L 4GNXC 1YI2A 5KEEA 3AB9A 4P2CB 1Y1WG 2Z6KA 1STAA 3RN2A 1VQ4A 4OONA 1DONA 4N9TA 3HG9A 3RLOA 2RHQB 3LNNA 1EL0A 3RNUA 3PUYA 3J7A5 2VQEQ 4OO1H 1PTOD 3P1HA 5M3MG 2LFNA 1E1OA 5IYBH 3CC2A 4WJ4A 2EYOA 4CGYB 2K5NA 1FD7D 2OEOA 1X55A 3I72A 3SGIA 1EQTA 5K5PA 1LO5D 3CC4A 1EZ8A 5IP9G 4LK1C 1WTRA 1FJGQ 1ILQA 4XDXA 1PZID 2I07B 3H91A 1QVGA 1JE5A 3H3VH 1VQ5A 1R4QB 4A3LH 2EZVA 2K04A 2BE5C 4CHTB 1HCZA 4K2LA 3BU2A 2VUMH 1VMPA 1WTWA 2A6HC 4RAUC 5C4ZA 1LTAD 1F77A 4KD3A 4DR6L 4DV0Q 1WCMH 3S1RB 4JI4Q 3F2DA 1CKNB 4DR5Q 4YCVA 3TS0A 1YZ6A 4AQYQ 2E2JH 4A3FB 1AE2A 1SN8A 4JI8L 4L6TB 3M7GA 3U4VA 1LTTD 4B3RQ 1AEXA 5DM63 3L3OC 5CBEE 3T1HQ 1SNDA 1IHZA 1HH2P 1YNJC 1PHJA 5ELDA 1NY4A 4X3KA 2G9HD 1CM9A 2XRSD 2YV5A 3OHXC 3S14H 3HFZB 1HJPA 4O0AA 2Q2TA 3K59A 1ZEQX 1CKMA 1HNWL 3AFPA 3PSIA 4K5XA 5ISRA 3K0XA 3TSSA 4KK7A 4A3MG 4A3CH 3PCOB 2QCPX 2D2CC 3EJIA 1Q90A 2F0HA 1Z7TA 2AQ2B 4HJ5A 2MGSA 4A3IG 2WP8J 2F4IA 1KQSA 2DGYA 5EKKA 2H4OA 4IPGA 4KV6A 4Y7NB 3KYHC 2NZHA 4OIJA 2F1MA 3HOWH 1E2ZA 4DR1L 4FF1A 3J81j 1HZCA 1JR0D 3RR5A 1PH6A 5H1SE 1LTRD 4K5VA 1VMCA 1R9TH 4EGVA 2K5HA 4JI0L 5HURA 4AYBG 4YCWA 1K8OA 4A93G 3PGZA 4EQOA 3SEBA 3GDEA 4X66Q 2KCTA 4K2KA 1PH5A 1EIFA 1SNCA 3HS0C 1S5CD 5DAUA 2WAQG 4HJ9A 4CDFC 1AZQA 3CCVA 4JI2Q 3KF8B 1VQNA 1JOQA 3H94A 4L5TA 2EXDA 3FMCA 4C3IG 3TRZA 2D9UA 1STYA 2RSOA 1GUGA 2LXKA 1T5EA 1TWFB 1HTPA 1VQBA 4BS9A 2O5JC 3EBEA 5C44B 2L0CA 4G4KA 2Y0SG 4LNQA 3ERQA 1QOHA 1HNXL 2IX1A 1H9SA 4RHRA 1RODA 2I0QA 1SSOA 2D0PA 3SXHA 2R3ZA 4P73A 4R8IA 2ZXRA 2R7ZH 4CJ2C 1J5EL 2K4KA 1WTXA 2K7VA 4B3TL 1KDCA 4B3ML 1W6JA 1G2SA 3HEJA 4DNRB 1M8AA 1XPRA 4BBRB 1HPCA 1D8LA 1EY8A 1A3VA 2F3VA 4MN3A 1K83B 4QJFA 3MHBA 4A3GB 5M3FB 1F9RA 3PO3H 3D0FA 1LT4D 2NB0A 1XPOA 2HD3A 4JYAL 4PG3A 4C2MB 4MTNA 1X54A 1YNJD 4ZCKA 3RZOB 3GTOB 2R93G 3A8JE 4A3JG 4HEDA 4JBKA 1YIJA 2B2YC 2B63H 3I4MH 1TWAB 5ELOA 3X3MA 5FLMH 4R4TA 3A55A 1VQ6A 4PMWA 1SNPA 5AJ3L 2UUBQ 4DXFA 2XN9C 3NWTA 3HOUG 2JA5B 3K0YA 4PQXA 3S1MB 5CGKA 1VQGA 5IOCA 4HMJA 1K73C 1FVIA 1KRSA 3GTKB 5K36H 1Q46A 1F2LA 1M90C 2F0MA 1YJNA 2MNAA 4A3KG 2Z6KC 3JAMi 3N52A 1WTPA 3NUCA 1BKBA 1PH4A 2WB1G 3E3XA 1B3QA 1STEA 1S72A 1PTOB 1ONLA 4KHVA 3S15B 3D6CA 3TP8A 3QIAA 2C35B 3J7AV 3A8IE 3SK5A 4JI5L 4G57A 1HQMC 1PYSB 2EPBA 4KHPQ 1STNA 3VR6A 1U4LA 1KC8C 4JI3Q 1DZ1A 2ZXOA 3J7ZC 3G4SA 4LFAL 4IJHA 2X6LA 3ULLA 3H0GH 3T4AC 3S2HH 1SJHD 5EBDA 1AE3A 2B8FA 1UNSA 1L1OB 1W3SA 1EWCA 2JA9A 1JORA 4DA2A 1L0YB 1TXYA 3MXNB 1D7QA 4QY7A 1NR2A 3W1BA 1I5FA 3HKZE 4JG2A 3MVVA 3NPPA 1H95A 4F87A 2NVQB 3HOVH 3FKIG 4IALA 5KRUA 1B4OA 3HOZB 3SVMA 1BF4A 2UXBL 2PYKA 2K28A 4RH6A 5EKIA 4IO9A 3D4RA 2QW7A 4DV7L 1CZGA 3MAQA 3Q22A 1K8GA 3R93A 5LMUL 4WRDA 1HXYD 4DV3Q 1XMQL 3EROA 2F0TA 2YTVA 4X65Q 1VQLA 2UUCL 2EY5A 3GP7A 2ZXPA 2VQFQ 3MXUA 3BVZA 2JA6B 3GTQH 4DR2Q 4A3FH 4UHVA 4GNXB 4ZYSA 1V8QA 1Y1VG 5GAGC 1STGA 4XYQA 3CD6A 4Z9CB 3OSOA 4G7ZC 2F0GA 5C4XG 4O1NA 3L7ZC 2N55A 5IYCH 1UAPA 5DNFA 1A63A 2VQEL 3DEOA 1TKWB 2UU9Q 1HZBA 5GQOA 1QG7A 1UEBA 3AFQA 3ER0A 3F2UA 2UXDL 2WFWA 4A3DH 1BQQT 5KYLA 4DUYQ 1SNMA 3HOYG 2LKVA 4H7BA 2MO0A 1DOLA 4DK6C 1PH7A 3J81i 4KY6A 4ME5A 1EFWA 1EU3A 4HSPA 4C3JG 2VB2X 1Y1WB 4TVAB 5JVH3 2I5HA 2VS1A 3K5OA 1WTHA 1HFGA 4JI7Q 1B8AA 2CKZB 3TZDA 3BS1A 4GLVB 4NKLA 1GOZA 1IZ6A 4MNOA 2V4DA 2A6ED 2VB3X 1WCMB 2Q8IB 1HRJA 5ELFA 4HIOA 1A8VA 4K6LA 5I4DA 2UUAQ 2E2JB 2NBFA 3BZKA 2GVBA 4DV0L 1SYBA 2O4XA 1EY0A 1YHQA 4JI4L 4DPGA 1LT5D 2ZJPA 1PVOA 1J8IA 1CHQD 4DR5L 1I6HH 5G3LF 3LGJA 3BJUA 4AQYL 2Q2UA 2F3WA 4QF4A 2IHEA 1K0SA 2M9VA 2HQEA 5C0XG 1TWCB 4B3RL 1VQHA 1NTGA 1PXUA 3Q0AA 2R7FA 1B3AA 3T1HL 1CFMA 2PCFB 1X3GA 1TWFH 2RF4A 1S3OA 3AEVA 5CC4A 2UXCQ 5C44H 2A68C 4QB4A 1PTOF 3SE0A 2B2WA 4HSVA 2EYMA 3VYTA 2DY7A 3I55A 1N32Q 1EY4A
chains in the Genus database with same CATH topology
4YIJA 1C8CA 1EYDA 1Y8OB 1U4RA 3MFYA 2NVYB 4U673 3HOWB 1XXGA 4IUNA 1Y69U 2PO4A 1ESRA 2QILA 2EJMA 1KDBA 1TS5A 2LMCB 1G291 4XQNA 1F2YA 2SNMA 1C4QA 1YNNC 4IUVA 3OMGA 5A35A 5C5LA 3J7YW 1KTKA 2BA1A 3IAYA 4IUTA 2NYZD 2MP1A 4TKOB 1FNUA 4A3MB 3FDTA 3ND8A 3T53B 2Q8RE 1EFID 1PTOC 4A3IB 1EQVA 4B9XA 4C3HG 2EYHA 2XSCA 4ZUJA 3GQBA 5JAVA 4ABNA 1DJRD 1FYCA 1M4VA 4J1MA 1W6KA 2IT1A 2R7ZB 2XWBB 5BN3A 3TMEA 3VR4A 3MEHA 4AYBB 2JE6I 4NMZA 4ZK9B 5F2DA 5C3WA 2IL8A 3GO5A 2EYLA 2JEAI 3PO3B 2WAQB 5E3FA 2FFKB 5CV4A 4KI0A 3K6OA 3C2PA 3BDOA 5AFWA 3I4MB 3DUZA 4BWGB 3BZDB 3U9SA 3NE5B 3V96A 2F0OA 4N9PA 4V190 1CZWA 3U9OA 4HAEA 1QILA 2K01A 3I4LA 1ESFA 1F9QA 1TT2A 5IIFA 2PNRC 2B2UA 1RTOA 3E5SA 3W3AA 1HA6A 1VDZA 3TZUA 5JPMC 1CQVA 1RCVD 2FJ2A 4NW2A 1SE2A 2F0JA 2K6AA 1DXMA 4DF7A 1B2TA 2R93B 2EYJA 1Y8NB 1YNND 5G3LD 4DAVA 4ULLA 4G7OC 2BA0A 2F0SA 3MXGA 4ODGA 5NUCA 3HOUB 1MGSA 2A69D 3Q6SA 5FLXE 2VNUD 3SHLA 5E4XA 3H0GB 3S2HB 2K1BA 2XWJB 4CJ0B 4KTAA 1O7YA 3CKIB 1PZJD 3QJYA 3N6RA 3AU7A 1WTOA 2EYFA 2NN6H 1S5BD 2RA4A 2WB1B 3H3VC 5I2YA 4XQJA 3HOVB 3QG1A 1CQFA 2IX0A 4WJWA 5A2QE 1SE3A 2EXZA 1A2TA 1OO9B 2J4XA 2HUGA 3DEPA 2G9DA 2ICEC 5J22A 1JCKB 1LLRD 2IW3A 3IFTA 1SAPA 1WTQA 5EPKA 1H9JA 3GTQB 5EGTA 3ITPA 4DAYA 3PMFA 5C4JB 2LS01 5EKLA 2Z4HA 3FKIB 1ET9A 2B2WC 4V0BA 4DNTB 3VR3A 2XNAC 4IFDI 5C0XI 1GJXA 5D65A 3NWSA 3SR1A 1X3PA 1JC7A 2Q8TA 4L8JA 1AP0A 2Z4IA 4A3DB 1K8MA 1D1IA 2EE1A 2RBMA 4G7HC 3JAME 2F0WA 1V1OA 1I50B 4DN4M 1DOKA 1BDOA 4ZAIA 1Y1VB 2XRQD 1DD2A 1RDPD 5KGUA 1SEBD 3I70A 2J0TD 3NBIA 4XIGS 2JP1A 4KD4A 1BNZA 1B44D 5J39A 4KKSA 5KNBA 5D3DA 4A3BB 3RUZA 3P20A 3T16A 5CYUA 4QIWB 1B9NA 2JXMB 1I6HB 2L5TA 1TS3A 3EA6A 3HOYB 1SYGA 3NK9A 1CK1A 3R2IA 5JEAG 3LWEA 4R9WA 3OIQA 2RDHA 1BOSA 5M5YB 5KNCA 1H9SB 3NTHA 4EVOA 4HMIA 1A2UA 3OMCA 4K5WA 3GD7A 4I65A 3VA5A 1AFPA 1F2ZA 4PNYA 2BCOA 2DNCA 1RHPA 4TSSA 3VYRA 1XYIA 1TWGB 3PIO3 1EZ6A 1DOMA 2B8GA 3SK6A 2F0VA 4ZLTF 4M1UB 2B2UC 2B2TA 1I4PA 1II3A 1JOKA 3DWPA 3FRPB 4FF4A 1SNQA 1B53A 5KNDA 2E2HB 1U9RA 1D5ZC 2PZUA 2ENBA 3NQIA 1Q3LA 3NBHA 2SNSA 3D4DA 2FINB 1EY6A 1O7LA 3MFGA 1JOOA 3K5NA 1V1PA 1TVXA 2R92B 3QO2A 3TDQA 3J81E 1OXTA 1DM0B 2PQEA 2IWHA 4E6IA 3MA2B 4LJZC 2KECA 1OXUA 5IGGA 2YYZA 2JEBI 4FNFA 2RDGA 1ENCA 5E4WC 3MXPA 3A54A 1JQYD 2AUJD 2KEDA 5IT9E 3CRKC 1GUTA 3I73A 4C1NK 5CV5A 1UEAB 2A6EC 4KN4C 4Q5VA 2C9OA 1ENAA 4C3HB 1EU4A 1Z47A 3BVMA 3GTGB 1PYWD 4RKBA 3FEWX 2E2DC 2DY8A 2RDFA 4RGTA 2A5HA 4K6DA 5C6AA 1CTMA 5I9PA 2B2VA 2R61A 1JE4A 3PUZA 2MPMA 3TBIB 4KKTA 2CW0D 3O13A 4M8AA 1RKNA 5FO8B 2QF7A 2E2IB 1FNVA 1EY7A 2A73B 1SDFA 5I2XA 2KVMA 3NQTA 2M2LA 2PZWA 4I7ZC 4S3SA 2K5QA 1LV9A 3A56A 2NTSA 3FPPA 2Z8LA 4BY7B 1Y8PB 4J6HA 1NR4A 1PMRA 5BN5A 2O2LD 2OF1A 3CRLC 2TMPA 5M5XB 1BR9A 2IPKD 1GHJA 4NDXA 2E76C 3W2DA 2D62A 3C3LA 4ZKBB 1H9KA 2F0QA 1EEFD 3D4WA 4RGNA 1SYCA 5IGCA 3IL8A 4C1NI 1XTCD 1MSHA 1I3QB 3DWQA 1IW7D 4KHZA 2O5IC 4TRDA 5M9OA 5M3MB 1ML0D 5FKAC 4XQQA 1OXSC 3WOFA 1LTBD 3M4OB 1ZYRC 5IGDA 2HDMA 1D5XC 2XVSA 3FVQA 1GUNA 1PRTD 2CVRA 1IKLA 1TS4A 1MD2D 4IFDG 1I4GA 2NZ1D 1LTID 2EDGA 3GV6A 2ZT9C 2K03A 1VCIA 4RGMA 3ND9A 5LL6S 1BCPD 1D6EC 3BYYB 1SYEA 4HCEA 1NSNS 1SMYD 4H44C 3BDLA 3S17B 2FMCA 1RTNA 3MWYW 2B2TC 1SFOB 4F8MA 1S5ED 3H09A 2L12A 2PZTA 4BA1I 4QMGA 1Q12A 1B50A 1D5MC 3G7LA 2K5WA 2F0NA 5I9OA 4IUPA 4UAIA 5C0XH 1F9SA 3RD4A 3IKJA 3DM1A 4J8QA 3TP6A 3OWFA 1U4MA 5FOBB 4CBVA 3ZYYX 4H0LC 4RWSC 4ID6A 3H6MA 4FXDA 2B39A 1E0BA 2A69C 3D8GA 1OXXK 2JA8B 2F0FA 3PUXA 1PLFA 1EYAA 3OIPA 1VF7A 3D31A 3FPUB 1QE6A 1EIHA 5COYA 4BA2I 3MZ5A 5CV9A 1JWMD 1ZXTA 1BO0A 1ZYRD 4IUQA 1NUCA 3LX0A 1HUMA 4A93B 2AUKA 1TIID 1JWUD 1CI3M 4ZQ3A 4DGZA 1E2WA 2L4NA 2K05A 1SXTA 4C3IB 3CU7A 2EVBA 4X3SA 4ZUIA 3OW7A 3S16B 1CA5A 2B2VC 2VXWA 3SK8A 1LABA 3L9AX 2DN8A 2YU9B 2Y0SB 1WD1A 1DCZA 1EY9A 4Q0FA 4B08A 3I90A 1STBA 1GHKA 3E6ZX 1BBXC 3J7AF 3K7AB 2RQXA 3DHQA 2R6GA 2KA7A 2NTTA 5JVG3 2FMMA 5C0XJ 5T1IA 4ZKCB 1WD0A 2C5CA 3URYA 3VR5A 2WINB 3AMUA 1V43A 1I6VC 5EPJA 3KUPA 4LMQD 1G91A 1G6ZA 4X3TA 1GUWA 2L9HA 4A3JB 1TU2B 2KQ3A 4OO1G 3HRZC 4HTHA 1EYCA 1HA5A 3BG3A 2MJ8A 4HN7A 2QDBA 2NVTB 5FLXL 5CV8A 5CV6A 2PW5A 1CA6A 3LWUA 1QNUA 1L0XB 4B9WA 3K5LA 4CJ1B 1EWHA 2F0IA 2QKIC 1S5DD 4A3KB 1KLGD 5CMDA 1AN8A 3RZDB 3EFXD 2L11A 5A2QL 2CQAA 3S1QB 2AWNA 3SDZA 1ILPA 4MIUA 2AQ3B 5FO9B 4DFAA 3T13A 1PRTB 4F88A 3BVGA 2BDOA 1H9RA 1UUPA 3WOEA 2M00A 4OL7A 1BCPB 5JJZA 4JK1C 1PFMA 2F0DA 2HDLA 4IZ8A 2MUYA 1IYVA 1WTVA 4NP5A 5KIXA 1TY2A 3SK4A 4F7XA 4KY7A 1LT6D 3WDNA 2KJXA 2HCCA 3A7LA 4RFBA 3C1FA 3G6JB 4RA8A 1TY0A 1A6XA 3PUWA 2I46A 1LACA 1JWSD 5JOBA 3KBXA 3GTLB 2EY6A 3JAML 4IURA 3T51B 1KNEA 2DNEA 1SBBB 4EQPA 1I4XA 3I3CA 3MTSA 4X3UA 4H13C 2LY7A 1G2TA 1AW7A 5LHY1 2F0KA 1CHPD 2K32A 4XT1B 3T56B 3GTMB 2JYOA 4KKUA 1J9OA 4FXKC 1TWHB 4OIKA 3V05A 5C4XB 4KJNA 4FO2A 4CKEA 5C3XA 3PIP3 2ID0A 2RVLA 1R4PB 3TP5A 2SDFA 1KLUD 5M5WB 5EBCA 1NCVA 2SOBA 4WORA 1GUSA 1BUVT 5CORA 2KCNA 3KK7A 3GTJB 3A8KE 5ELCA 1FGBD 5I6WA 3DMUA 2JA7B 3ONAB 2WKCA 4C3JB 3C46A 1EY5A 3TN2A 4RHSA 1T5XD 3V2TA 1C48A 2PMZB 4MHEA 2OXPA 2KCCA 3K58A 3P7JA 5LL6X 3KLSX 3CQZB 2F0UA 2BE5D 4GZYC 2WACA 3NHHA 5IGEA 1A15A 1I4HA 3KF8A 2A6HD 2CHBD 4TQUS 2CW0C 3PUVA 2L1BA 5JEAH 5K36G 2D5DA 5CBAE 3QWNA 5E1FA 3BDCA 1S5FD 4ILWA 3C1EA 4K8JA 1O80A 4FF3A 3OPOA 1SYFA 4CKCA 1V1PB 5EPLA 4KY5A 3RLFA 3HOXB 1HFNA 4KN7C 2NWGA 1PRTF 3VR2A 4K14A 4PMCA 3D6WA 1SNOA 3J81L 1AZPA 2XIWA 2HCIA 5IODA 3HGBA 5C3EB 4RCOA 2IX3A 1SE4A 4OO1I 5J1ZA 1BCPF 3S2DB 3R2TA 3A7AB 5IT9L 1HTLD 2KHSA 2NVXB 2NN6I 3DXJC 1TQOA 5D3IB 3S1NB 4XT3B 1Q8IA 2OT2A 4DU9A 1LTGD 5HGTA 1PFBA 5JPNC 1NAPA 3I91A 1IW7C 2F03A 1EEID 1EOTA 3NTIA 4XTCS 3KBGA 4ZRZA 3TP7A 1O78A 2JSOA 1E2VA 3Q24A 3M4YA 4WFN3 1TS2A 2FHTA 1PFNA 2RSNA 3DWAA 1CT1D 5TSSA 1PRTC 2Z1CA 5JEAJ 1G8ZD 2F0EA 5FK9C 2IJ0A 4QUCA 4FF2A 4KJOA 1VF5C 3VA7A 4QCLA 5FO7B 1QCBD 1BCPC 3MXNA 2KEEA 4A3EB 3I4NB 1SMYC 2WIIB 5C4HA 1KDAA 1RD9D 1U4PA 3MC0B 3IFDA 3NXWA 1EIGA 3D3RA 2E75C 3M7NA 5ELBA 4FXGC 4O42A 1F9PA 4BBSB 3NP8A 4HR7B 1JB3A 4KMUC 4XXEA 1ZKOA 1KAAA 2K33A 2AWOA 1ICWA 4FP5D 4CKBA 3S9WA 4PV1C 2EYPA 3R8BA 1XWEA 1LTSD 1Q1BA 3BYTB 4QUFA 2A74C 5IGFA 4DK0A 3PV0A 4K8IA 1A3UA 3CHBD 1D2BA 5CR3A 1KABA 1H9MA 1D1KA 4HCSA 5DM73 1ET6A 3RMHA 2E74C 2VUMB 2X69A 1B9MA 4EQNA 1IKMA 3K5MA 1I4QA 3HZXA 3P75A 1WVLA 4DAPA 3M3YB 1QNKA 2KUMA 3EVQA 4DK1A 2NUCA 3GV3A 3R3OA 1SJED 2PPBC 5KYIA 1QWYA 3I8ZA 3PO2B 3M85A 3VYSA 1FNWA 1F2MA 2EY1A 4XYOA 4U68A 3KLSA 1BXTA 3S14B 1HUNA 2EJGC 4UDUC 4FYDA 2F0PA 2K5DA 1IYUA 3NSWA 2MHVA 1RJTA 4IN3A 1QB5D 3Q23A 4FVMA 4IFDH 1HQRD 3QB3A 5I6YA 2X6GA 2H1EA 5EQ0A 1MBYA 2EY2A 5C5MA 3OWEB 5EJWA 3KLRA 4PMBA 5BN4A 2KOLA 3QOJA 4JBWA 2TSSA 2J7ZA 1R9TB 1SYDA 1I4RA 2WV6D 5T1GA 3UI2A 2BDNA 1MSGA 1STHA 4C56C 4RCNA 3EQLC 5D14A 2WKDA 4R8NA 3GTPB 1QJOA 1XX8A 3K57A 3NTKA 1GXDC 1ENFA 1RF2D 4DXGA 1KNAA 1X3QA 1OXVA 1PTOH 2EOTA 3OOCA 4BY1B 1DYQA 3QOLA 4OHJA 1FR3A 5DEHA 2ICIA 1X32A 3E0JA 2QEJC 1B1ZA 2BOSA 2GA4B 2PW7A 2EJFC 2RKSA 3J80L 1A3TA 2B63B 4IFDJ 1Q1EA 2N88A 3J80E 3VYUA 1PZKD 2AQ1B 3HP3A 1MI2A 2A68D 1O7ZA 4L63B 1HHVA 5ELEA 1PDQA 4IQZA 1LT3D 4RGOS 4OGQC 2B2YA 1TR5A 4LAAA 3X3NA 5IGBA 3HKZB 4RKLA 2NN6G 1IL8A 2L55A 4IUUA 5CV7A 1GUOA 1S4ZA 2SEBD 1JICA 2F0LA 1Z6HA 5KEEA 3AB9A 4P2CB 1STAA 1DONA 4N9TA 3HG9A 3LNNA 1EL0A 3PUYA 4OO1H 1PTOD 3P1HA 2LFNA 2EYOA 4CGYB 1FD7D 2OEOA 3I72A 1EQTA 5K5PA 1LO5D 1EZ8A 4LK1C 1WTRA 1ILQA 4XDXA 1PZID 2I07B 3H91A 1R4QB 2EZVA 2K04A 2BE5C 4CHTB 1HCZA 4K2LA 1VMPA 1WTWA 2A6HC 4RAUC 5C4ZA 1LTAD 1F77A 4KD3A 3S1RB 4A3FB 4L6TB 3M7GA 1LTTD 1AEXA 5DM63 3L3OC 5CBEE 1SNDA 1IHZA 1YNJC 5ELDA 4X3KA 2G9HD 1CM9A 2XRSD 3OHXC 3K59A 1ZEQX 4K5XA 5ISRA 3TSSA 4KK7A 2QCPX 2D2CC 3EJIA 1Q90A 2F0HA 1Z7TA 2AQ2B 2MGSA 2WP8J 2F4IA 5EKKA 2H4OA 4KV6A 4Y7NB 4OIJA 2F1MA 1E2ZA 4FF1A 1JR0D 1LTRD 4K5VA 1VMCA 4EGVA 5HURA 1K8OA 4EQOA 3SEBA 4K2KA 1SNCA 3HS0C 1S5CD 5DAUA 1AZQA 1JOQA 3H94A 3FMCA 4C3IG 2D9UA 1STYA 2RSOA 1GUGA 1T5EA 1TWFB 1HTPA 4BS9A 2O5JC 5C44B 2L0CA 4G4KA 3ERQA 1QOHA 2IX1A 1H9SA 4RHRA 1RODA 1SSOA 3SXHA 2R3ZA 4R8IA 2ZXRA 4CJ2C 1WTXA 2K7VA 1KDCA 1W6JA 1G2SA 3HEJA 4DNRB 1M8AA 4BBRB 4MN3A 1HPCA 1EY8A 1A3VA 2F3VA 1K83B 3MHBA 4A3GB 5M3FB 1F9RA 1LT4D 2NB0A 4C2MB 1YNJD 3RZOB 3GTOB 3A8JE 4HEDA 2B2YC 1TWAB 3X3MA 3A55A 4PMWA 1SNPA 4DXFA 2XN9C 3NWTA 2JA5B 3K0YA 4PQXA 3S1MB 5CGKA 5IOCA 4HMJA 3GTKB 5K36H 1F2LA 2F0MA 3N52A 1WTPA 3NUCA 1STEA 1PTOB 1ONLA 4KHVA 3S15B 3D6CA 3TP8A 3QIAA 3J7AV 3A8IE 3SK5A 4G57A 1HQMC 2EPBA 1STNA 3VR6A 1U4LA 1DZ1A 2ZXOA 2X6LA 3T4AC 1SJHD 5EBDA 2B8FA 1UNSA 1EWCA 1JORA 4DA2A 1L0YB 1NR2A 3MVVA 3NPPA 4F87A 2NVQB 4IALA 5KRUA 1B4OA 3HOZB 3SVMA 1BF4A 2PYKA 2K28A 4RH6A 5EKIA 3D4RA 1CZGA 3MAQA 3Q22A 3R93A 4WRDA 1HXYD 3EROA 2F0TA 2EY5A 3GP7A 2ZXPA 3MXUA 3BVZA 2JA6B 4ZYSA 1V8QA 1STGA 4XYQA 4Z9CB 3OSOA 4G7ZC 2F0GA 4O1NA 3L7ZC 2N55A 1UAPA 5DNFA 3DEOA 1TKWB 1QG7A 3F2UA 1BQQT 5KYLA 1SNMA 2LKVA 4H7BA 1DOLA 4KY6A 4ME5A 1EU3A 4HSPA 4C3JG 2VB2X 1Y1WB 5JVH3 3K5OA 1HFGA 3TZDA 3BS1A 4NKLA 1GOZA 2V4DA 2A6ED 2VB3X 1WCMB 2Q8IB 1HRJA 5ELFA 4K6LA 5I4DA 2E2JB 2NBFA 1SYBA 2O4XA 1EY0A 1LT5D 1J8IA 1CHQD 5G3LF 2F3WA 4QF4A 2M9VA 2HQEA 5C0XG 1TWCB 1PXUA 3Q0AA 1B3AA 1CFMA 2PCFB 5CC4A 2A68C 4QB4A 1PTOF 3SE0A 2B2WA 4HSVA 2EYMA 3VYTA 2DY7A 1EY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9M A;  1GUN A;  1Z6H A;  2DNC A;  1CI3 M;  3MXU A;  1Y8O B;  1CTM A;  2PNR C;  3AB9 A;  3MFY A;  1E2W A;  4IFD G;  3PUZ A;  3W3A A;  4DNT B;  1VDZ A;  2BDO A;  1H9R A;  2D2C C;  2EDG A;  1V8Q A;  3TZU A;  2ZT9 C;  1Q90 A;  4KKT A;  1IW7 C;  1Z7T A;  2B8G A;  3EQL C;  4RCN A;  3VR3 A;  2EVB A;  4XTC S;  1VCI A;  3OW7 A;  3ND9 A;  5K36 H;  1Y69 U;  1GJX A;  2KCC A;  3LNN A;  1QJO A;  4G7Z C;  1LAB A;  1O78 A;  2DN8 A;  2EJM A;  2E74 C;  3L7Z C;  1DXM A;  3PUY A;  2F1M A;  4H44 C;  1E2V A;  1E2Z A;  4OO1 H;  4JK1 C;  2QF7 A;  3M4Y A;  1DCZ A;  1B9M A;  1TKW B;  2LMC B;  2BE5 D;  4L8J A;  1G29 1;  4GZY C;  1ONL A;  1Y8N B;  5A35 A;  1IYV A;  1YNN C;  1GHK A;  3QIA A;  5KND A;  1K8M A;  2R6G A;  2KA7 A;  1OXV A;  3OOC A;  2BA1 A;  3A8I E;  2A6H D;  1K8O A;  3I72 A;  4I7Z C;  4DK1 A;  4TQU S;  1FR3 A;  4G7O C;  2BA0 A;  4G7H C;  2CW0 C;  1HQM C;  3VR5 A;  3WDN A;  1VF5 C;  4LK1 C;  3VA7 A;  3PUV A;  4BA1 I;  4TKO B;  1Q12 A;  2A69 D;  1V43 A;  3VR6 A;  1I6V C;  3A7L A;  1BDO A;  3FPP A;  5JEA H;  3ND8 A;  3T53 B;  1SMY C;  2PPB C;  5K36 G;  1DD2 A;  1O7L A;  1Y8P B;  3H94 A;  2D5D A;  5C0X H;  1PMR A;  3FMC A;  3IKJ A;  2BE5 C;  3QJY A;  3N6R A;  1TU2 B;  2B8F A;  2E75 C;  5BN5 A;  1HCZ A;  4XIG S;  3M85 A;  3M7N A;  4OO1 G;  1A6X A;  1GUG A;  2EJF C;  1T5E A;  2V4D A;  3CRL C;  1HTP A;  1LAC A;  3GQB A;  3PUW A;  1FYC A;  2NN6 H;  2A6E D;  3BG3 A;  2O5J C;  1GHJ A;  1OXT A;  2E76 C;  3T51 B;  4KKS A;  2A6H C;  5KNB A;  2Q8I B;  4HR7 B;  4KMU C;  1Q1E A;  2DNE A;  4H0L C;  2IT1 A;  4LJZ C;  2D62 A;  3OPO A;  2EJG C;  1OXU A;  3QG1 A;  5BN3 A;  3VR4 A;  1H9S A;  3P20 A;  2YYZ A;  2A68 D;  1H9K A;  2JEB I;  2A69 C;  1B9N A;  2JE6 I;  4H13 C;  2JXM B;  1IYU A;  1OXX K;  1ZKO A;  2L5T A;  3LWU A;  3RLF A;  2K7V A;  2K33 A;  2AWO A;  3PUX A;  2AUJ D;  4KN7 C;  2JEA I;  2K32 A;  3CRK C;  3VR2 A;  3T56 B;  4IFD H;  1GUT A;  4DNR B;  4KKU A;  1VF7 A;  4PV1 C;  4IQZ A;  5JEA G;  1HPC A;  3D31 A;  3I73 A;  4OGQ C;  1EWH A;  5KNC A;  1H9S B;  3HGB A;  5C0X G;  4KI0 A;  3D4R A;  2A6E C;  1Q1B A;  4BA2 I;  2O5I C;  1IW7 D;  4KHZ A;  4KN4 C;  1CFM A;  2PCF B;  1YNJ C;  3BDO A;  3KLR A;  2NN6 G;  3A8J E;  1OXS C;  5BN4 A;  1ZYR C;  3IFT A;  2A68 C;  3U9S A;  3GD7 A;  3A7A B;  3NE5 B;  4JBW A;  4DK0 A;  1GUS A;  3PV0 A;  3SE0 A;  1GUO A;  2NN6 I;  3DXJ C;  1H9J A;  3A8K E;  3SDZ A;  2AUK A;  3I4L A; 
#chains in the Genus database with same CATH topology
 5JJI A;  4YIJ A;  1C8C A;  1EYD A;  1Y8O B;  4GN3 B;  1U4R A;  1KAW A;  5J3B A;  3MFY A;  2QDL A;  2NVY B;  5IWA Q;  4U67 3;  1K83 H;  4A3G H;  3HOW B;  1XXG A;  4IUN A;  1Y69 U;  1TWG H;  2PO4 A;  1ESR A;  2QIL A;  2EJM A;  2YTY A;  5C3E G;  1KDB A;  3RZO H;  4CDC C;  4QIW E;  2VW9 A;  1SRO A;  1X9N A;  1TS5 A;  2LMC B;  4LFB Q;  1G29 1;  2KCM A;  4XQN A;  1TWA H;  1F2Y A;  2SNM A;  1C4Q A;  1YNN C;  4IUV A;  3OMG A;  4NXN L;  5A35 A;  5C5L A;  3J7Y W;  2F52 A;  3AYH B;  1KTK A;  2BA1 A;  3IAY A;  4DV4 Q;  4IUT A;  2JA5 H;  2E2H H;  2NYZ D;  4OWX B;  3K8A A;  1UWV A;  2MP1 A;  4TKO B;  4X66 L;  1FNU A;  1U0L A;  4A3M B;  3FDT A;  1BVS A;  1XPU A;  3ND8 A;  3T53 B;  2Q8R E;  1EFI D;  4JI2 L;  1PTO C;  4A3I B;  1EQV A;  4BXX G;  4B9X A;  4C3H G;  2EYH A;  2XSC A;  4ZUJ A;  3GQB A;  5JAV A;  1RL2 A;  4ABN A;  1DJR D;  1FYC A;  3U58 A;  5IYD H;  3UDF A;  1M4V A;  3S15 H;  4J1M A;  1W6K A;  2R92 H;  2IT1 A;  2R7Z B;  1MIU A;  2XWB B;  3IRB A;  5BN3 A;  4POG A;  3TME A;  3VR4 A;  3MEH A;  4GS3 A;  1QZG A;  4AYB B;  2JE6 I;  4NMZ A;  5IP7 G;  4ZK9 B;  5F2D A;  5C3W A;  4DV1 Q;  2IL8 A;  3GO5 A;  2EYL A;  1Q7Y C;  1HR0 L;  2JEA I;  3UDG A;  3PO3 B;  2WAQ B;  5E3F A;  2FFK B;  5CV4 A;  4KI0 A;  3K6O A;  3C2P A;  4A3E G;  3I4N G;  2K5V A;  3BDO A;  5AFW A;  3I4M B;  1V1Q A;  3DUZ A;  3FP9 A;  1HZ9 A;  4JOI A;  3ULP A;  4BWG B;  3BZD B;  3U9S A;  4LFC L;  3NE5 B;  3V96 A;  2F0O A;  4APV A;  4N9P A;  3GTG H;  4V19 0;  1CZW A;  4BBS G;  3U9O A;  4P74 A;  4HAE A;  3PF4 A;  1QIL A;  2K01 A;  3I4L A;  1ESF A;  2CH4 A;  1F9Q A;  1TT2 A;  5IIF A;  3OTO Q;  3S24 A;  4LF5 Q;  2PNR C;  2UUB L;  2B2U A;  3CCE A;  4LF7 Q;  1RTO A;  3E5S A;  3W3A A;  1HA6 A;  1VDZ A;  3NEL A;  3TZU A;  5JPM C;  1CQV A;  1I94 Q;  2HIX A;  2E8G A;  4WJ3 M;  1RCV D;  1CUK A;  2FJ2 A;  4NW2 A;  1SE2 A;  2F0J A;  2K6A A;  1IBK Q;  1IXR A;  1DXM A;  3EN2 A;  4DF7 A;  4DV5 Q;  1B2T A;  2R93 B;  2EYJ A;  1MJE A;  1Y8N B;  4DR4 Q;  2XGT A;  1YNN D;  1O7I A;  5G3L D;  3I56 A;  4NPS A;  4DAV A;  1QVF A;  4NXM L;  5IYB G;  2K75 A;  4ULL A;  2JA6 H;  4G7O C;  2BA0 A;  2F0S A;  3MXG A;  4ODG A;  4POF A;  5NUC A;  3HOU B;  1MGS A;  2A69 D;  1QUQ A;  3Q6S A;  5FLX E;  2VNU D;  3SHL A;  5E4X A;  3H0G B;  4P72 A;  1HR0 W;  3S2H B;  1JT8 A;  2K1B A;  2XWJ B;  4CJ0 B;  3F2B A;  4ME3 A;  3ICE A;  4KTA A;  2E5L Q;  5GAD C;  1O7Y A;  4DNI A;  3CKI B;  1PZJ D;  3QJY A;  3EIV A;  3N6R A;  4R1J A;  1N34 L;  4DAM A;  1JB7 A;  3AU7 A;  4BY7 H;  2B29 A;  1WTO A;  2EYF A;  2NN6 H;  1S5B D;  2RA4 A;  2WB1 B;  2D0O A;  3H3V C;  3UE1 A;  3OW2 A;  2G5D A;  5I2Y A;  5M5X H;  4XQJ A;  1C7Y A;  3HOV B;  3QG1 A;  1CQF A;  2IX0 A;  3CP0 A;  3M4Q A;  4WJW A;  4N8X 1;  5A2Q E;  4UP9 A;  3VDY A;  1SE3 A;  2EXZ A;  1X3E A;  1QVC A;  1Y1W H;  1A2T A;  1VQE A;  1OO9 B;  2J4X A;  1MHW C;  2HUG A;  4DV2 Q;  3DEP A;  4PZ8 A;  4R4I A;  4QGU A;  2G9D A;  2ICE C;  5J22 A;  2N49 A;  1JCK B;  4DAY B;  1LLR D;  3PO2 G;  2LSS A;  1SLJ A;  1I3Q H;  2IW3 A;  4DV3 L;  1IBL Q;  3IFT A;  2Z9H A;  1SAP A;  3L0O A;  4X65 L;  1WTQ A;  5EPK A;  4LUZ A;  1H9J A;  5BR8 Q;  3GTQ B;  1W2B A;  2DUD A;  5EGT A;  3M4O H;  1AH9 A;  3ITP A;  4DAY A;  4LUO A;  3PMF A;  1MKH A;  5C4J B;  2LS0 1;  5EKL A;  2Z4H A;  3FKI B;  2VQF L;  4JI1 Q;  1ET9 A;  5IP9 H;  2B2W C;  1ASY A;  4V0B A;  4DNT B;  4DR2 L;  3VR3 A;  4GN4 B;  2VZA A;  4A3C G;  2XNA C;  3K80 C;  1PH2 A;  4IFD I;  5C0X I;  1GJX A;  1TWC H;  5JJL A;  3M4P A;  3NWS A;  5D65 A;  1A62 A;  1EUJ A;  3SR1 A;  1X3P A;  3G48 A;  1JC7 A;  2Q8T A;  4L8J A;  1AP0 A;  2Z4I A;  4A3D B;  4GN5 A;  1K8M A;  3S17 H;  1D1I A;  4DKA C;  1VQI A;  2JA8 G;  2EE1 A;  2RBM A;  4G7H C;  3JAM E;  1ASZ A;  2F0W A;  1V1O A;  2NVY H;  1I50 B;  2ZTD A;  2RCF A;  4DN4 M;  1DOK A;  1BDO A;  4ZAI A;  1Y1V B;  2XRQ D;  4DV6 Q;  1DD2 A;  2OCE A;  1RDP D;  5IE8 A;  5KGU A;  2AMC B;  1SEB D;  1A0I A;  3I70 A;  4JV5 Q;  2J0T D;  3NBI A;  4XIG S;  2JP1 A;  4KD4 A;  1BNZ A;  1B44 D;  5J39 A;  2B3G A;  4KKS A;  5KNB A;  2N3S A;  5D3D A;  4A3B B;  3RUZ A;  3P20 A;  3T16 A;  5CYU A;  2KHI A;  1IBM Q;  4QIW B;  1KXL A;  1B9N A;  2JXM B;  1I6H B;  1SMX A;  2L5T A;  1TS3 A;  2UUA L;  4JI6 L;  3EA6 A;  4BY1 G;  3G71 A;  3HOY B;  1SYG A;  3NK9 A;  1E3P A;  1XNQ Q;  4A3M H;  1CK1 A;  3R2I A;  5JEA G;  3LWE A;  4R9W A;  3OIQ A;  2RDH A;  1BOS A;  5M5Y B;  5KNC A;  1H9S B;  4A3I H;  5EAY A;  1YJ9 A;  3NTH A;  1KD1 C;  1XNR Q;  2LXJ A;  4EVO A;  2ATW A;  4HMI A;  1A2U A;  1FGU A;  3OMC A;  4LWC A;  4LF6 Q;  4K5W A;  3GD7 A;  4I65 A;  3VA5 A;  1AFP A;  2UXC L;  1VQA A;  1F2Z A;  2AHO B;  2BCO A;  4IPD A;  4JOI C;  4OXP A;  4PNY A;  1N32 L;  2DNC A;  1RHP A;  4TSS A;  3VYR A;  4DUZ Q;  1GO3 E;  1YHB A;  1YJW A;  1XYI A;  1Y14 B;  1TWG B;  3PIO 3;  4GKK Q;  1EZ6 A;  4K0K Q;  1DOM A;  2B8G A;  5IWA L;  3SK6 A;  2F0V A;  1NMF A;  4L5Q A;  5ELN A;  4ZLT F;  4M1U B;  2B2U C;  3KF6 B;  2B2T A;  1I4P A;  1II3 A;  1JOK A;  3DWP A;  3FRP B;  2YU9 H;  4FF4 A;  3PQI A;  1SNQ A;  2PI2 A;  1B53 A;  3KF6 A;  5KND A;  4LFB L;  4GLA C;  1VQP A;  4ALP A;  3CCR A;  2E2H B;  3NBH B;  3J80 c;  1U9R A;  1D5Z C;  2V1C C;  2PZU A;  2ENB A;  2YTX A;  3I7F A;  1E7Z A;  3K7A H;  3NQI A;  2I5L X;  1Q3L A;  1IYJ B;  3NBH A;  2SNS A;  3D4D A;  2FIN B;  4FDB A;  1EY6 A;  1O7L A;  3MFG A;  4AYB E;  1JOO A;  3ULJ A;  3K5N A;  1V1P A;  1TVX A;  2R92 B;  4X62 L;  3QO2 A;  1HZA A;  3E9H A;  2R93 H;  2WAQ E;  3TDQ A;  3J81 E;  1OXT A;  1N33 Q;  1DM0 B;  2PQE A;  2IWH A;  4E6I A;  3MA2 B;  1Q81 C;  4LJZ C;  2KEC A;  1OXU A;  5IGG A;  2YYZ A;  2JEB I;  4FNF A;  2RDG A;  1ENC A;  5E4W C;  3MXP A;  3A54 A;  3CC7 A;  4YY3 Q;  3HOU H;  1JQY D;  4DV1 L;  2AUJ D;  2KED A;  5IT9 E;  1X3F A;  3CRK C;  3G6E A;  1GUT A;  2Y0S E;  4RMF A;  3I73 A;  4C1N K;  5CV5 A;  1UEA B;  2A6E C;  2H5X A;  4KN4 C;  1LTL A;  4Q5V A;  2C9O A;  4IOA A;  1ENA A;  2N8N A;  4C3H B;  1EU4 A;  1Z47 A;  3BVM A;  3GTG B;  1PYW D;  4RKB A;  3FEW X;  2E2D C;  3E0E A;  2DY8 A;  3RZD H;  1L0W A;  3KLW A;  2RDF A;  4RGT A;  4X6A H;  2A5H A;  4K6D A;  1X65 A;  5C6A A;  1CTM A;  3S1Q H;  5I9P A;  2B2V A;  2R61 A;  1JE4 A;  3F1Z A;  3PUZ A;  2F4V Q;  2MPM A;  3TBI B;  4KKT A;  1K8A C;  4L5S A;  3KFU A;  3TQY A;  2CW0 D;  2FXQ A;  1I94 L;  1XMO L;  3O13 A;  1SRU A;  4M8A A;  1JJG A;  1RKN A;  5FO8 B;  1IBK L;  2QF7 A;  2E2I B;  2KEN A;  1FNV A;  4DV5 L;  1EY7 A;  5IYC G;  2A73 B;  1SDF A;  5I2X A;  2KVM A;  3NQT A;  4DR4 L;  1WYD A;  1JMC A;  2M2L A;  2PZW A;  4I7Z C;  4S3S A;  5C4J H;  2K5Q A;  1LV9 A;  5E7N A;  3FKI H;  2WB1 E;  4GKJ Q;  3A56 A;  2NTS A;  3FPP A;  2Z8L A;  2CCZ A;  2CFM A;  4JI8 Q;  3PF5 A;  4BY7 B;  1Y8P B;  4J6H A;  1NR4 A;  1PMR A;  2E5L L;  4QL5 A;  1YVC A;  5BN5 A;  4Y52 H;  2O2L D;  2OF1 A;  3CRL C;  2TMP A;  5M5X B;  1BR9 A;  2IPK D;  1GHJ A;  4NDX A;  2E76 C;  1VQJ A;  3W2D A;  2D62 A;  4A75 A;  3C3L A;  4ZKB B;  1H9K A;  2JA7 G;  2F0Q A;  1FJG L;  1EEF D;  3D4W A;  4RGN A;  3PIP A;  1I50 H;  1Z9F A;  1SYC A;  1Y1V H;  4AIM A;  2JN4 A;  5IGC A;  3CCU A;  3IL8 A;  4C1N I;  1XTC D;  1MSH A;  1I3Q B;  1TWH H;  3DWQ A;  1IW7 D;  4KHZ A;  5C4X H;  4TRD A;  5M9O A;  2O5I C;  5M3M B;  1ML0 D;  1NMG A;  5FKA C;  4XQQ A;  1OXS C;  1FL0 A;  3WOF A;  1LTB D;  1OTC A;  3M4O B;  1ZYR C;  4DR1 Q;  3F2C A;  5IGD A;  4PZ6 A;  3I2Z A;  1NE3 A;  2HDM A;  4A3B H;  2DJG C;  1D5X C;  1RIP A;  2XVS A;  3U50 C;  3FVQ A;  4JI0 Q;  1GUN A;  1Q82 C;  1PRT D;  3GTJ H;  2CVR A;  3HOY H;  3KJO A;  4OWT B;  1XJV A;  1IKL A;  1TS4 A;  1MD2 D;  4IFD G;  1I4G A;  2NZ1 D;  4MZ9 A;  1LTI D;  2EDG A;  3GV6 A;  4JI1 L;  4C3J H;  2ZT9 C;  5FJ8 G;  1UE7 A;  2K03 A;  5M5Y H;  1VCI A;  4RGM A;  3ND9 A;  5LL6 S;  1BCP D;  1D6E C;  4BBR G;  3BYY B;  1SYE A;  4HCE A;  5M3F G;  1NSN S;  1SMY D;  4H44 C;  3BDL A;  3S17 B;  2FMC A;  3PIO A;  4HJ7 A;  1RTN A;  3MWY W;  2B2T C;  1SFO B;  4F8M A;  5GAE C;  1S5E D;  1VQK A;  1KRT A;  3HOX G;  1IL2 A;  3H09 A;  1C0A A;  2L12 A;  2PZT A;  4BA1 I;  4QMG A;  1Q12 A;  1B50 A;  1D5M C;  1VQF A;  3G7L A;  4CDD C;  1N9W A;  2K5W A;  2F0N A;  2BH2 A;  2R7D A;  5I9O A;  4IUP A;  4UAI A;  4JC0 A;  5C0X H;  1F9S A;  3RD4 A;  4DV6 L;  3IKJ A;  3DM1 A;  4J8Q A;  4JV5 L;  1VS0 A;  3TP6 A;  3OWF A;  1U4M A;  5FOB B;  4CBV A;  3A74 A;  3TEH B;  3ZYY X;  4H0L C;  4RWS C;  2VL6 A;  4ID6 A;  3H6M A;  3W1G A;  2B39 A;  4FXD A;  1E0B A;  2PMZ E;  2A69 C;  4B3S Q;  3D8G A;  2HIV A;  2ES2 A;  1SE8 A;  1OXX K;  2JA8 B;  4I7A A;  5AJ3 Q;  2F0F A;  3PUX A;  4IPC A;  1KHI A;  1Q86 C;  1PLF A;  4X64 Q;  1EYA A;  3OIP A;  1VF7 A;  3D31 A;  1XNQ L;  2K14 A;  3FPU B;  1QE6 A;  1EIH A;  5COY A;  4BA2 I;  3MZ5 A;  5CV9 A;  1JWM D;  1ZXT A;  1WOC A;  1BO0 A;  4CDE C;  2P5Z X;  1XNR L;  1WI5 A;  1ZYR D;  3K7U C;  2GVA A;  1K3B C;  4LF6 L;  4IUQ A;  1NUC A;  3LX0 A;  1J6Q A;  1HUM A;  3S2D H;  4A93 B;  3STB C;  2PI2 E;  2AUK A;  1TII D;  2NVX H;  1JWU D;  3UDX A;  1CI3 M;  4ZQ3 A;  4DGZ A;  1PV4 A;  4JI5 Q;  4IPH A;  1E2W A;  2OTJ A;  1G6P A;  4GOP B;  2L4N A;  2K05 A;  1SXT A;  4C3I B;  3CU7 A;  4K0K L;  2EVB A;  4X3S A;  4ZUI A;  3HOZ G;  3OW7 A;  3S16 B;  1CA5 A;  2B2V C;  2VXW A;  2F3I A;  1LAB A;  3L9A X;  3SK8 A;  1LM0 A;  2DN8 A;  3CAM A;  2YU9 B;  4GOP A;  4C3H H;  2Y0S B;  1PH1 A;  5HGQ A;  3MEF A;  1WD1 A;  1DCZ A;  1EY9 A;  3KDF A;  4JPB W;  4Q0F A;  3I90 A;  4B08 A;  4EQ5 A;  1STB A;  1GHK A;  3E6Z X;  1BBU A;  1BBX C;  3J7A F;  3K7A B;  2RQX A;  3DHQ A;  2R6G A;  2KA7 A;  2NTT A;  5JVG 3;  2FMM A;  5C0X J;  5T1I A;  4ZKC B;  1WD0 A;  2C5C A;  5IP7 H;  3URY A;  4AH6 A;  3VR5 A;  4JCV E;  2WIN B;  3AMU A;  1V43 A;  1C9O A;  1I6V C;  5EPJ A;  3KUP A;  4LMQ D;  1G91 A;  4RG1 A;  1L2F A;  1G6Z A;  4X3T A;  2DJF C;  1GUW A;  5LMN Q;  2L9H A;  4A3J B;  3I4N H;  1TU2 B;  2KQ3 A;  4OO1 G;  3HRZ C;  4R4Q A;  4HTH A;  4OEM B;  1EYC A;  2E2I H;  1HA5 A;  1QUQ B;  2K52 A;  3BG3 A;  4P71 A;  1XMQ Q;  2MJ8 A;  4HN7 A;  2QDB A;  2NVT B;  4YWL A;  5FLX L;  5CV8 A;  1N33 L;  2MO1 A;  5HY6 A;  5CV6 A;  4BBS H;  3W5O A;  2PW5 A;  1YIT A;  1CA6 A;  3LWU A;  1CSP A;  4KHP L;  1QNU A;  3A0J A;  1L0X B;  4B9W A;  2Z0S A;  4JI3 L;  5IY0 A;  1ICF B;  3K5L A;  4CJ1 B;  1SR3 A;  4A3L G;  2GN5 A;  1EWH A;  2F0I A;  2QKI C;  1S5D D;  5GAH C;  4DK3 C;  4A3K B;  1KIX A;  1KLG D;  1CKO A;  1EWI A;  5CMD A;  1AN8 A;  3T1Y Q;  3KOJ A;  2VUM G;  3RZD B;  3EFX D;  3Q8D A;  2L11 A;  5A2Q L;  1V9P A;  1DGS A;  3RLN A;  2CQA A;  3STB D;  1NNX A;  3S1Q B;  2AWN A;  1WCM G;  3SDZ A;  1ILP A;  4OEL B;  4LF8 Q;  2UXD Q;  4MIU A;  2AQ3 B;  2ZTC A;  4YCU A;  5FO9 B;  4PZ7 A;  4DFA A;  4LF4 Q;  3T13 A;  1PRT B;  4F88 A;  3BVG A;  2BDO A;  4LW1 A;  1H9R A;  3H15 A;  1K0R A;  1HNZ Q;  2F4V L;  3NEN A;  1VQ9 A;  1UUP A;  3WOE A;  3JC6 6;  2M00 A;  4OL7 A;  5M3M H;  2QGQ A;  2Q2H A;  1BCP B;  5JJZ A;  4JK1 C;  1PFM A;  2F0D A;  2HDL A;  4IZ8 A;  2MUY A;  1IYV A;  1WTV A;  2RCN A;  1K3R A;  3DM3 A;  1X6O A;  4NP5 A;  5KIX A;  2HT1 A;  1TY2 A;  3SK4 A;  4F7X A;  4KY7 A;  1LT6 D;  1T9H A;  3M3Y H;  3WDN A;  2KJX A;  1KL9 A;  2HCC A;  3A7L A;  3J80 i;  4RFB A;  4GKJ L;  3C1F A;  3G6J B;  1PH8 A;  4RA8 A;  4HJ8 A;  1XTD A;  1TY0 A;  2OQK A;  3HOW G;  1A6X A;  1CKN A;  3PUW A;  2UU9 L;  2I46 A;  1LAC A;  1JWS D;  2HQL A;  3PO2 H;  5JOB A;  3KBX A;  3GTL B;  2A19 A;  2EY6 A;  3JAM L;  4IUR A;  3T51 B;  3M9B A;  1KNE A;  2ZJQ A;  2DNE A;  1S40 A;  1SBB B;  4EQP A;  1I4X A;  3I3C A;  1SFO H;  4DUY L;  3MTS A;  4X3U A;  4H13 C;  2LY7 A;  1G2T A;  1AW7 A;  5DLQ E;  5LHY 1;  2F0K A;  1CHP D;  3TS2 A;  2K32 A;  4XT1 B;  3T56 B;  3GTM B;  2JYO A;  4KKU A;  4JI7 L;  1J9O A;  2PNH A;  1TWH B;  4FXK C;  4OIK A;  3V05 A;  5C4X B;  4YHH Q;  4KJN A;  2XTI A;  4FO2 A;  4CKE A;  1PYB A;  5C3X A;  3PIP 3;  2IY5 B;  2ID0 A;  2RVL A;  1GVP A;  1R4P B;  4A4I A;  1UE5 A;  3TP5 A;  2SDF A;  1KLU D;  5M5W B;  5EBC A;  1NCV A;  2SOB A;  4WOR A;  4R4O A;  1GUS A;  1P16 A;  1BUV T;  5COR A;  3KJP A;  3KK7 A;  2KCN A;  3BZC A;  2KHJ A;  2A1A A;  1YBY A;  3A8K E;  5ELC A;  1FGB D;  3GTJ B;  4NXN Q;  5I6W A;  2ZM6 Q;  3DMU A;  2R7Z G;  2JA7 B;  3ONA B;  2WKC A;  4C3J B;  4LF9 Q;  3C46 A;  2JA8 H;  1EY5 A;  3TN2 A;  4RHS A;  4YWK A;  4DR7 Q;  4O2D A;  1T5X D;  3V2T A;  1C48 A;  2PMZ B;  4MHE A;  2OXP A;  2ALY B;  3PO3 G;  2KCC A;  3K58 A;  2KBN A;  3P7J A;  5LL6 X;  3A5U A;  3GTP H;  3KLS X;  3I4O A;  3CQZ B;  2F0U A;  2BE5 D;  2B63 G;  3I4M G;  4GZY C;  2WAC A;  3NHH A;  4A93 H;  5IGE A;  3QR8 A;  4GOP C;  1A15 A;  1I4H A;  3KF8 A;  5FLM G;  4DR3 Q;  4UY8 C;  1NBW A;  2A6H D;  2CHB D;  4TQU S;  1VQC A;  2CW0 C;  3U4Z A;  4BY1 H;  3PUV A;  3UDI A;  1JJC B;  1HR0 Q;  2L1B A;  4C3I H;  1K28 A;  5JEA H;  1PFS A;  5K36 G;  3HKZ G;  3S16 H;  3CW2 C;  2D5D A;  2ZJR A;  2BH8 A;  3F8T A;  5CBA E;  3QWN A;  1PH9 A;  5E1F A;  3BDC A;  4LUV A;  1S5F D;  4ILW A;  3C1E A;  4OX9 Q;  4K8J A;  1E24 A;  1O80 A;  2Z6B A;  1EQQ A;  1PH3 A;  4FF3 A;  3NEM A;  3CMA A;  3OPO A;  4LFC Q;  1N36 Q;  4L5R C;  1SYF A;  4DV4 L;  4JBJ A;  4CKC A;  1V1P B;  5EPL A;  4KY5 A;  3RLF A;  3HOX B;  4B3S L;  1HFN A;  4KN7 C;  2NWG A;  1PRT F;  3VR2 A;  4K14 A;  4PMC A;  3D6W A;  1SNO A;  3J81 L;  1VQM A;  1AZP A;  2XIW A;  2HCI A;  4X64 L;  5IOD A;  2HHH Q;  3HGB A;  5C3E B;  3H0G G;  1WFQ A;  4A3J H;  4RCO A;  1VQ7 A;  4NB3 A;  1P8L A;  1SE4 A;  2IX3 A;  4OO1 I;  5J1Z A;  1BCP F;  3S2D B;  3R2T A;  1UE1 A;  3CPW A;  2NVT H;  3A7A B;  5IT9 L;  1HTL D;  2KHS A;  2NVX B;  2NN6 I;  3DXJ C;  1TQO A;  5D3I B;  3S1N B;  4XT3 B;  4IJL A;  1Q8I A;  4HID A;  2OT2 A;  3HOV G;  4NXM Q;  3ZJY C;  2QA4 A;  4DU9 A;  1LTG D;  5HGT A;  1VQO A;  1PFB A;  5JPN C;  1NAP A;  3I91 A;  3WWV A;  1IW7 C;  5FLX c;  3UE0 A;  2F03 A;  1EEI D;  1EOT A;  3H3V I;  3NTI A;  4XTC S;  3KBG A;  4A3K H;  4ZRZ A;  3RN5 A;  3TP7 A;  4R4C A;  1O78 A;  2JSO A;  1E2V A;  3Q24 A;  2PQA B;  4JBM A;  1N34 Q;  3L2P A;  3M4Y A;  2VY3 A;  4WFN 3;  1TS2 A;  4MTK A;  2FHT A;  1PFN A;  2RSN A;  3DWA A;  1CT1 D;  5TSS A;  1PRT C;  2A8V A;  2Z1C A;  5JEA J;  2RHS B;  1G8Z D;  2F0E A;  2PQA A;  5FK9 C;  3OTO L;  4LF5 L;  1YEZ A;  2IJ0 A;  4QUC A;  4LF7 L;  4KJO A;  4A3F G;  4FF2 A;  1L1O A;  1VF5 C;  3VA7 A;  4QCL A;  5FO7 B;  1QCB D;  1K9M C;  1BCP C;  3MXN A;  2KEE A;  2JJQ A;  4A3E B;  3I4N B;  1B70 B;  1SMY C;  2WII B;  5C4H A;  1KDA A;  3CF5 A;  1RD9 D;  1U4P A;  3MC0 B;  3IFD A;  5JJK A;  3NXW A;  1EIG A;  4IOC A;  3D3R A;  2E75 C;  3M7N A;  5ELB A;  5LMN L;  4FXG C;  4O42 A;  1F9P A;  4BBS B;  3NP8 A;  4HR7 B;  1JB3 A;  4KMU C;  4DR6 Q;  2CH4 W;  4XXE A;  4A3D G;  1EIY B;  1E1T A;  1ZKO A;  1KAA A;  1GM5 A;  2K33 A;  2AWO A;  1ICW A;  2AKW B;  4FP5 D;  3S1R H;  4CKB A;  3S9W A;  4PV1 C;  2EYP A;  3R8B A;  1XWE A;  1LTS D;  1Q1B A;  3A5Z B;  4QQB X;  1M1K C;  3BYT B;  3T1Y L;  4QUF A;  4H02 A;  3GTL H;  1WJJ A;  2A74 C;  5IGF A;  4GNX A;  4DK0 A;  3PV0 A;  2I5M X;  4K8I A;  1A3U A;  1HNW Q;  3CHB D;  1D2B A;  5CR3 A;  1KAB A;  1H9M A;  4A3B G;  1D1K A;  4HCS A;  1NJI C;  4LF8 L;  1CSQ A;  3JAM c;  3E9I A;  3GTM H;  5DM7 3;  4UPA A;  4LF4 L;  4DV2 L;  1ET6 A;  3RMH A;  1HNZ L;  3K81 C;  2E74 C;  1IBL L;  2VUM B;  5LMN W;  1LYL A;  1B9M A;  2NZO A;  2X69 A;  5C44 G;  4EQN A;  5M5W H;  1JJ2 A;  1IKM A;  4Y7N H;  1EQR A;  5BR8 L;  3K5M A;  1I4Q A;  4UP8 A;  4HIM A;  3HZX A;  3P75 A;  1WVL A;  4DAP A;  3M3Y B;  1QNK A;  2KUM A;  3EVQ A;  1QZH A;  2JA7 H;  4DK1 A;  2Q2I A;  2NUC A;  3GV3 A;  2N78 A;  3HKS A;  1GD7 A;  5L37 A;  4J15 A;  4UP7 A;  4YWM A;  4JI6 Q;  3R3O A;  1SJE D;  4A3G G;  2PPB C;  5KYI A;  1QWY A;  1EYG A;  3I8Z A;  3PO2 B;  2EQS A;  3M85 A;  3CXC A;  3VYS A;  3CQZ H;  1FNW A;  1MJC A;  1F2M A;  4HIK A;  2EY1 A;  3FHW A;  1HNX Q;  4XYO A;  4U68 A;  3KLS A;  1BXT A;  3S14 B;  3OYY A;  4OWW B;  1HUN A;  2EJG C;  4UDU C;  4FYD A;  2F0P A;  2K5D A;  4HJA A;  1J5E Q;  4B3T Q;  2L15 A;  4B3M Q;  2JA5 G;  1IYU A;  3NSW A;  2CQO A;  2MHV A;  1RJT A;  3CPF A;  4IN3 A;  1QB5 D;  3Q23 A;  4FVM A;  4IFD H;  4EX5 A;  3CCJ A;  1HQR D;  3QB3 A;  5FJ8 H;  5I6Y A;  4JYA Q;  2X6G A;  2H1E A;  4YHH L;  5EQ0 A;  1MBY A;  4BBR H;  2EY2 A;  5C5M A;  3AQQ A;  3OWE B;  2ASB A;  2OTL A;  5EJW A;  3KLR A;  4PMB A;  5M3F H;  1VQ8 A;  5IYD G;  5BN4 A;  2KOL A;  3QOJ A;  2JK8 A;  4C2M H;  2R92 G;  3CCL A;  4JBW A;  3GTO H;  2TSS A;  2J7Z A;  1GKH A;  1IBM L;  1R9T B;  3CCS A;  1SYD A;  1I4R A;  2OQ0 A;  3CCM A;  3HOX H;  2WV6 D;  5T1G A;  2ZM6 L;  3UI2 A;  2BDN A;  4LF9 L;  1MSG A;  1STH A;  4C56 C;  4DR7 L;  4RCN A;  3EQL C;  4N8F A;  5D14 A;  3S1M H;  3TRE A;  2WKD A;  4R8N A;  5C3E H;  4GLX A;  3GTP B;  1QJO A;  1XX8 A;  3K57 A;  1B7Y B;  1VQD A;  3NTK A;  4JW0 A;  3GTK H;  1GXD C;  1ENF A;  1RF2 D;  1Q8K A;  1YNX A;  4DXG A;  1KNA A;  4X62 Q;  3J81 c;  3S1N H;  4A76 A;  1X3Q A;  1OXV A;  1PTO H;  2EOT A;  3ERS X;  3OOC A;  4BY1 B;  3B6Y A;  1DYQ A;  3QOL A;  4DUZ L;  4DR3 L;  1E22 A;  4OHJ A;  1FR3 A;  3DLL A;  5DEH A;  1U5K A;  4GKK L;  1LUZ A;  2ICI A;  1X32 A;  3KDF B;  3E0J A;  1X56 A;  5IT9 c;  2QEJ C;  4LFA Q;  1N8R C;  1B1Z A;  1UE6 A;  2BOS A;  4BXX H;  1L1O C;  2GA4 B;  2PW7 A;  2K50 A;  2EJF C;  2RKS A;  3J80 L;  1A3T A;  4OX9 L;  2B63 B;  4IFD J;  1Q1E A;  2N88 A;  3J80 E;  3VYU A;  5GRO A;  1PZK D;  2AQ1 B;  3HP3 A;  1MI2 A;  2CWP A;  2A68 D;  1O7Z A;  1EOV A;  2CWA A;  2QEX A;  1N36 L;  4L63 B;  1HHV A;  2JA6 G;  4KLK A;  5ELE A;  1YHA A;  2IHF A;  2UXB Q;  1PDQ A;  2NVQ H;  4IQZ A;  1LT3 D;  1BBW A;  4A3E H;  4RGO S;  4DV7 Q;  4OGQ C;  2OWO A;  3HOZ H;  2B2Y A;  5LMU Q;  1TR5 A;  4LAA A;  3X3N A;  5IGB A;  3HKZ B;  3CME A;  4RKL A;  2HHH L;  4BY7 G;  1XMO Q;  4JVZ A;  2JQO A;  4P75 A;  2MFI A;  2NN6 G;  1G51 A;  2UUC Q;  1IL8 A;  2EIF A;  2MQH A;  3CCQ A;  2L55 A;  4IUU A;  1GUO A;  2ZTE A;  5CV7 A;  1S4Z A;  2SEB D;  1JIC A;  1PA6 A;  2F0L A;  1Z6H A;  4YY3 L;  4GNX C;  1YI2 A;  5KEE A;  3AB9 A;  4P2C B;  1Y1W G;  2Z6K A;  1STA A;  3RN2 A;  1VQ4 A;  4OON A;  1DON A;  4N9T A;  3HG9 A;  3RLO A;  2RHQ B;  3LNN A;  1EL0 A;  3RNU A;  3PUY A;  3J7A 5;  2VQE Q;  4OO1 H;  1PTO D;  3P1H A;  5M3M G;  2LFN A;  1E1O A;  5IYB H;  3CC2 A;  4WJ4 A;  2EYO A;  4CGY B;  2K5N A;  1FD7 D;  2OEO A;  1X55 A;  3I72 A;  3SGI A;  1EQT A;  5K5P A;  1LO5 D;  3CC4 A;  1EZ8 A;  5IP9 G;  4LK1 C;  1WTR A;  1FJG Q;  1ILQ A;  4XDX A;  1PZI D;  2I07 B;  3H91 A;  1QVG A;  1JE5 A;  3H3V H;  1VQ5 A;  1R4Q B;  4A3L H;  2EZV A;  2K04 A;  2BE5 C;  4CHT B;  1HCZ A;  4K2L A;  3BU2 A;  2VUM H;  1VMP A;  1WTW A;  2A6H C;  4RAU C;  5C4Z A;  1LTA D;  1F77 A;  4KD3 A;  4DR6 L;  4DV0 Q;  1WCM H;  3S1R B;  4JI4 Q;  3F2D A;  1CKN B;  4DR5 Q;  4YCV A;  3TS0 A;  1YZ6 A;  4AQY Q;  2E2J H;  4A3F B;  1AE2 A;  1SN8 A;  4JI8 L;  4L6T B;  3M7G A;  3U4V A;  1LTT D;  4B3R Q;  1AEX A;  5DM6 3;  3L3O C;  5CBE E;  3T1H Q;  1SND A;  1IHZ A;  1HH2 P;  1YNJ C;  1PHJ A;  5ELD A;  1NY4 A;  4X3K A;  2G9H D;  1CM9 A;  2XRS D;  2YV5 A;  3OHX C;  3S14 H;  3HFZ B;  1HJP A;  4O0A A;  2Q2T A;  3K59 A;  1ZEQ X;  1CKM A;  1HNW L;  3AFP A;  3PSI A;  4K5X A;  5ISR A;  3K0X A;  3TSS A;  4KK7 A;  4A3M G;  4A3C H;  3PCO B;  2QCP X;  2D2C C;  3EJI A;  1Q90 A;  2F0H A;  1Z7T A;  2AQ2 B;  4HJ5 A;  2MGS A;  4A3I G;  2WP8 J;  2F4I A;  1KQS A;  2DGY A;  5EKK A;  2H4O A;  4IPG A;  4KV6 A;  4Y7N B;  3KYH C;  2NZH A;  4OIJ A;  2F1M A;  3HOW H;  1E2Z A;  4DR1 L;  4FF1 A;  3J81 j;  1HZC A;  1JR0 D;  3RR5 A;  1PH6 A;  5H1S E;  1LTR D;  4K5V A;  1VMC A;  1R9T H;  4EGV A;  2K5H A;  4JI0 L;  5HUR A;  4AYB G;  4YCW A;  1K8O A;  4A93 G;  3PGZ A;  4EQO A;  3SEB A;  3GDE A;  4X66 Q;  2KCT A;  4K2K A;  1PH5 A;  1EIF A;  1SNC A;  3HS0 C;  1S5C D;  5DAU A;  2WAQ G;  4HJ9 A;  4CDF C;  1AZQ A;  3CCV A;  4JI2 Q;  3KF8 B;  1VQN A;  1JOQ A;  3H94 A;  4L5T A;  2EXD A;  3FMC A;  4C3I G;  3TRZ A;  2D9U A;  1STY A;  2RSO A;  1GUG A;  2LXK A;  1T5E A;  1TWF B;  1HTP A;  1VQB A;  4BS9 A;  2O5J C;  3EBE A;  5C44 B;  2L0C A;  4G4K A;  2Y0S G;  4LNQ A;  3ERQ A;  1QOH A;  1HNX L;  2IX1 A;  1H9S A;  4RHR A;  1ROD A;  2I0Q A;  1SSO A;  2D0P A;  3SXH A;  2R3Z A;  4P73 A;  4R8I A;  2ZXR A;  2R7Z H;  4CJ2 C;  1J5E L;  2K4K A;  1WTX A;  2K7V A;  4B3T L;  1KDC A;  4B3M L;  1W6J A;  1G2S A;  3HEJ A;  4DNR B;  1M8A A;  1XPR A;  4BBR B;  1HPC A;  1D8L A;  1EY8 A;  1A3V A;  2F3V A;  4MN3 A;  1K83 B;  4QJF A;  3MHB A;  4A3G B;  5M3F B;  1F9R A;  3PO3 H;  3D0F A;  1LT4 D;  2NB0 A;  1XPO A;  2HD3 A;  4JYA L;  4PG3 A;  4C2M B;  4MTN A;  1X54 A;  1YNJ D;  4ZCK A;  3RZO B;  3GTO B;  2R93 G;  3A8J E;  4A3J G;  4HED A;  4JBK A;  1YIJ A;  2B2Y C;  2B63 H;  3I4M H;  1TWA B;  5ELO A;  3X3M A;  5FLM H;  4R4T A;  3A55 A;  1VQ6 A;  4PMW A;  1SNP A;  5AJ3 L;  2UUB Q;  4DXF A;  2XN9 C;  3NWT A;  3HOU G;  2JA5 B;  3K0Y A;  4PQX A;  3S1M B;  5CGK A;  1VQG A;  5IOC A;  4HMJ A;  1K73 C;  1FVI A;  1KRS A;  3GTK B;  5K36 H;  1Q46 A;  1F2L A;  1M90 C;  2F0M A;  1YJN A;  2MNA A;  4A3K G;  2Z6K C;  3JAM i;  3N52 A;  1WTP A;  3NUC A;  1BKB A;  1PH4 A;  2WB1 G;  3E3X A;  1B3Q A;  1STE A;  1S72 A;  1PTO B;  1ONL A;  4KHV A;  3S15 B;  3D6C A;  3TP8 A;  3QIA A;  2C35 B;  3J7A V;  3A8I E;  3SK5 A;  4JI5 L;  4G57 A;  1HQM C;  1PYS B;  2EPB A;  4KHP Q;  1STN A;  3VR6 A;  1U4L A;  1KC8 C;  4JI3 Q;  1DZ1 A;  2ZXO A;  3J7Z C;  3G4S A;  4LFA L;  4IJH A;  2X6L A;  3ULL A;  3H0G H;  3T4A C;  3S2H H;  1SJH D;  5EBD A;  1AE3 A;  2B8F A;  1UNS A;  1L1O B;  1W3S A;  1EWC A;  2JA9 A;  1JOR A;  4DA2 A;  1L0Y B;  1TXY A;  3MXN B;  1D7Q A;  4QY7 A;  1NR2 A;  3W1B A;  1I5F A;  3HKZ E;  4JG2 A;  3MVV A;  3NPP A;  1H95 A;  4F87 A;  2NVQ B;  3HOV H;  3FKI G;  4IAL A;  5KRU A;  1B4O A;  3HOZ B;  3SVM A;  1BF4 A;  2UXB L;  2PYK A;  2K28 A;  4RH6 A;  5EKI A;  4IO9 A;  3D4R A;  2QW7 A;  4DV7 L;  1CZG A;  3MAQ A;  3Q22 A;  1K8G A;  3R93 A;  5LMU L;  4WRD A;  1HXY D;  4DV3 Q;  1XMQ L;  3ERO A;  2F0T A;  2YTV A;  4X65 Q;  1VQL A;  2UUC L;  2EY5 A;  3GP7 A;  2ZXP A;  2VQF Q;  3MXU A;  3BVZ A;  2JA6 B;  3GTQ H;  4DR2 Q;  4A3F H;  4UHV A;  4GNX B;  4ZYS A;  1V8Q A;  1Y1V G;  5GAG C;  1STG A;  4XYQ A;  3CD6 A;  4Z9C B;  3OSO A;  4G7Z C;  2F0G A;  5C4X G;  4O1N A;  3L7Z C;  2N55 A;  5IYC H;  1UAP A;  5DNF A;  1A63 A;  2VQE L;  3DEO A;  1TKW B;  2UU9 Q;  1HZB A;  5GQO A;  1QG7 A;  1UEB A;  3AFQ A;  3ER0 A;  3F2U A;  2UXD L;  2WFW A;  4A3D H;  1BQQ T;  5KYL A;  4DUY Q;  1SNM A;  3HOY G;  2LKV A;  4H7B A;  2MO0 A;  1DOL A;  4DK6 C;  1PH7 A;  3J81 i;  4KY6 A;  4ME5 A;  1EFW A;  1EU3 A;  4HSP A;  4C3J G;  2VB2 X;  1Y1W B;  4TVA B;  5JVH 3;  2I5H A;  2VS1 A;  3K5O A;  1WTH A;  1HFG A;  4JI7 Q;  1B8A A;  2CKZ B;  3TZD A;  3BS1 A;  4GLV B;  4NKL A;  1GOZ A;  1IZ6 A;  4MNO A;  2V4D A;  2A6E D;  2VB3 X;  1WCM B;  2Q8I B;  1HRJ A;  5ELF A;  4HIO A;  1A8V A;  4K6L A;  5I4D A;  2UUA Q;  2E2J B;  2NBF A;  3BZK A;  2GVB A;  4DV0 L;  1SYB A;  2O4X A;  1EY0 A;  1YHQ A;  4JI4 L;  4DPG A;  1LT5 D;  2ZJP A;  1PVO A;  1J8I A;  1CHQ D;  4DR5 L;  1I6H H;  5G3L F;  3LGJ A;  3BJU A;  4AQY L;  2Q2U A;  2F3W A;  4QF4 A;  2IHE A;  1K0S A;  2M9V A;  2HQE A;  5C0X G;  1TWC B;  4B3R L;  1VQH A;  1NTG A;  1PXU A;  3Q0A A;  2R7F A;  1B3A A;  3T1H L;  1CFM A;  2PCF B;  1X3G A;  1TWF H;  2RF4 A;  1S3O A;  3AEV A;  5CC4 A;  2UXC Q;  5C44 H;  2A68 C;  4QB4 A;  1PTO F;  3SE0 A;  2B2W A;  4HSV A;  2EYM A;  3VYT A;  2DY7 A;  3I55 A;  1N32 Q;  1EY4 A; 
#chains in the Genus database with same CATH homology
 4YIJ A;  1C8C A;  1EYD A;  1Y8O B;  1U4R A;  3MFY A;  2NVY B;  4U67 3;  3HOW B;  1XXG A;  4IUN A;  1Y69 U;  2PO4 A;  1ESR A;  2QIL A;  2EJM A;  1KDB A;  1TS5 A;  2LMC B;  1G29 1;  4XQN A;  1F2Y A;  2SNM A;  1C4Q A;  1YNN C;  4IUV A;  3OMG A;  5A35 A;  5C5L A;  3J7Y W;  1KTK A;  2BA1 A;  3IAY A;  4IUT A;  2NYZ D;  2MP1 A;  4TKO B;  1FNU A;  4A3M B;  3FDT A;  3ND8 A;  3T53 B;  2Q8R E;  1EFI D;  1PTO C;  4A3I B;  1EQV A;  4B9X A;  4C3H G;  2EYH A;  2XSC A;  4ZUJ A;  3GQB A;  5JAV A;  4ABN A;  1DJR D;  1FYC A;  1M4V A;  4J1M A;  1W6K A;  2IT1 A;  2R7Z B;  2XWB B;  5BN3 A;  3TME A;  3VR4 A;  3MEH A;  4AYB B;  2JE6 I;  4NMZ A;  4ZK9 B;  5F2D A;  5C3W A;  2IL8 A;  3GO5 A;  2EYL A;  2JEA I;  3PO3 B;  2WAQ B;  5E3F A;  2FFK B;  5CV4 A;  4KI0 A;  3K6O A;  3C2P A;  3BDO A;  5AFW A;  3I4M B;  3DUZ A;  4BWG B;  3BZD B;  3U9S A;  3NE5 B;  3V96 A;  2F0O A;  4N9P A;  4V19 0;  1CZW A;  3U9O A;  4HAE A;  1QIL A;  2K01 A;  3I4L A;  1ESF A;  1F9Q A;  1TT2 A;  5IIF A;  2PNR C;  2B2U A;  1RTO A;  3E5S A;  3W3A A;  1HA6 A;  1VDZ A;  3TZU A;  5JPM C;  1CQV A;  1RCV D;  2FJ2 A;  4NW2 A;  1SE2 A;  2F0J A;  2K6A A;  1DXM A;  4DF7 A;  1B2T A;  2R93 B;  2EYJ A;  1Y8N B;  1YNN D;  5G3L D;  4DAV A;  4ULL A;  4G7O C;  2BA0 A;  2F0S A;  3MXG A;  4ODG A;  5NUC A;  3HOU B;  1MGS A;  2A69 D;  3Q6S A;  5FLX E;  2VNU D;  3SHL A;  5E4X A;  3H0G B;  3S2H B;  2K1B A;  2XWJ B;  4CJ0 B;  4KTA A;  1O7Y A;  3CKI B;  1PZJ D;  3QJY A;  3N6R A;  3AU7 A;  1WTO A;  2EYF A;  2NN6 H;  1S5B D;  2RA4 A;  2WB1 B;  3H3V C;  5I2Y A;  4XQJ A;  3HOV B;  3QG1 A;  1CQF A;  2IX0 A;  4WJW A;  5A2Q E;  1SE3 A;  2EXZ A;  1A2T A;  1OO9 B;  2J4X A;  2HUG A;  3DEP A;  2G9D A;  2ICE C;  5J22 A;  1JCK B;  1LLR D;  2IW3 A;  3IFT A;  1SAP A;  1WTQ A;  5EPK A;  1H9J A;  3GTQ B;  5EGT A;  3ITP A;  4DAY A;  3PMF A;  5C4J B;  2LS0 1;  5EKL A;  2Z4H A;  3FKI B;  1ET9 A;  2B2W C;  4V0B A;  4DNT B;  3VR3 A;  2XNA C;  4IFD I;  5C0X I;  1GJX A;  5D65 A;  3NWS A;  3SR1 A;  1X3P A;  1JC7 A;  2Q8T A;  4L8J A;  1AP0 A;  2Z4I A;  4A3D B;  1K8M A;  1D1I A;  2EE1 A;  2RBM A;  4G7H C;  3JAM E;  2F0W A;  1V1O A;  1I50 B;  4DN4 M;  1DOK A;  1BDO A;  4ZAI A;  1Y1V B;  2XRQ D;  1DD2 A;  1RDP D;  5KGU A;  1SEB D;  3I70 A;  2J0T D;  3NBI A;  4XIG S;  2JP1 A;  4KD4 A;  1BNZ A;  1B44 D;  5J39 A;  4KKS A;  5KNB A;  5D3D A;  4A3B B;  3RUZ A;  3P20 A;  3T16 A;  5CYU A;  4QIW B;  1B9N A;  2JXM B;  1I6H B;  2L5T A;  1TS3 A;  3EA6 A;  3HOY B;  1SYG A;  3NK9 A;  1CK1 A;  3R2I A;  5JEA G;  3LWE A;  4R9W A;  3OIQ A;  2RDH A;  1BOS A;  5M5Y B;  5KNC A;  1H9S B;  3NTH A;  4EVO A;  4HMI A;  1A2U A;  3OMC A;  4K5W A;  3GD7 A;  4I65 A;  3VA5 A;  1AFP A;  1F2Z A;  4PNY A;  2BCO A;  2DNC A;  1RHP A;  4TSS A;  3VYR A;  1XYI A;  1TWG B;  3PIO 3;  1EZ6 A;  1DOM A;  2B8G A;  3SK6 A;  2F0V A;  4ZLT F;  4M1U B;  2B2U C;  2B2T A;  1I4P A;  1II3 A;  1JOK A;  3DWP A;  3FRP B;  4FF4 A;  1SNQ A;  1B53 A;  5KND A;  2E2H B;  1U9R A;  1D5Z C;  2PZU A;  2ENB A;  3NQI A;  1Q3L A;  3NBH A;  2SNS A;  3D4D A;  2FIN B;  1EY6 A;  1O7L A;  3MFG A;  1JOO A;  3K5N A;  1V1P A;  1TVX A;  2R92 B;  3QO2 A;  3TDQ A;  3J81 E;  1OXT A;  1DM0 B;  2PQE A;  2IWH A;  4E6I A;  3MA2 B;  4LJZ C;  2KEC A;  1OXU A;  5IGG A;  2YYZ A;  2JEB I;  4FNF A;  2RDG A;  1ENC A;  5E4W C;  3MXP A;  3A54 A;  1JQY D;  2AUJ D;  2KED A;  5IT9 E;  3CRK C;  1GUT A;  3I73 A;  4C1N K;  5CV5 A;  1UEA B;  2A6E C;  4KN4 C;  4Q5V A;  2C9O A;  1ENA A;  4C3H B;  1EU4 A;  1Z47 A;  3BVM A;  3GTG B;  1PYW D;  4RKB A;  3FEW X;  2E2D C;  2DY8 A;  2RDF A;  4RGT A;  2A5H A;  4K6D A;  5C6A A;  1CTM A;  5I9P A;  2B2V A;  2R61 A;  1JE4 A;  3PUZ A;  2MPM A;  3TBI B;  4KKT A;  2CW0 D;  3O13 A;  4M8A A;  1RKN A;  5FO8 B;  2QF7 A;  2E2I B;  1FNV A;  1EY7 A;  2A73 B;  1SDF A;  5I2X A;  2KVM A;  3NQT A;  2M2L A;  2PZW A;  4I7Z C;  4S3S A;  2K5Q A;  1LV9 A;  3A56 A;  2NTS A;  3FPP A;  2Z8L A;  4BY7 B;  1Y8P B;  4J6H A;  1NR4 A;  1PMR A;  5BN5 A;  2O2L D;  2OF1 A;  3CRL C;  2TMP A;  5M5X B;  1BR9 A;  2IPK D;  1GHJ A;  4NDX A;  2E76 C;  3W2D A;  2D62 A;  3C3L A;  4ZKB B;  1H9K A;  2F0Q A;  1EEF D;  3D4W A;  4RGN A;  1SYC A;  5IGC A;  3IL8 A;  4C1N I;  1XTC D;  1MSH A;  1I3Q B;  3DWQ A;  1IW7 D;  4KHZ A;  2O5I C;  4TRD A;  5M9O A;  5M3M B;  1ML0 D;  5FKA C;  4XQQ A;  1OXS C;  3WOF A;  1LTB D;  3M4O B;  1ZYR C;  5IGD A;  2HDM A;  1D5X C;  2XVS A;  3FVQ A;  1GUN A;  1PRT D;  2CVR A;  1IKL A;  1TS4 A;  1MD2 D;  4IFD G;  1I4G A;  2NZ1 D;  1LTI D;  2EDG A;  3GV6 A;  2ZT9 C;  2K03 A;  1VCI A;  4RGM A;  3ND9 A;  5LL6 S;  1BCP D;  1D6E C;  3BYY B;  1SYE A;  4HCE A;  1NSN S;  1SMY D;  4H44 C;  3BDL A;  3S17 B;  2FMC A;  1RTN A;  3MWY W;  2B2T C;  1SFO B;  4F8M A;  1S5E D;  3H09 A;  2L12 A;  2PZT A;  4BA1 I;  4QMG A;  1Q12 A;  1B50 A;  1D5M C;  3G7L A;  2K5W A;  2F0N A;  5I9O A;  4IUP A;  4UAI A;  5C0X H;  1F9S A;  3RD4 A;  3IKJ A;  3DM1 A;  4J8Q A;  3TP6 A;  3OWF A;  1U4M A;  5FOB B;  4CBV A;  3ZYY X;  4H0L C;  4RWS C;  4ID6 A;  3H6M A;  4FXD A;  2B39 A;  1E0B A;  2A69 C;  3D8G A;  1OXX K;  2JA8 B;  2F0F A;  3PUX A;  1PLF A;  1EYA A;  3OIP A;  1VF7 A;  3D31 A;  3FPU B;  1QE6 A;  1EIH A;  5COY A;  4BA2 I;  3MZ5 A;  5CV9 A;  1JWM D;  1ZXT A;  1BO0 A;  1ZYR D;  4IUQ A;  1NUC A;  3LX0 A;  1HUM A;  4A93 B;  2AUK A;  1TII D;  1JWU D;  1CI3 M;  4ZQ3 A;  4DGZ A;  1E2W A;  2L4N A;  2K05 A;  1SXT A;  4C3I B;  3CU7 A;  2EVB A;  4X3S A;  4ZUI A;  3OW7 A;  3S16 B;  1CA5 A;  2B2V C;  2VXW A;  3SK8 A;  1LAB A;  3L9A X;  2DN8 A;  2YU9 B;  2Y0S B;  1WD1 A;  1DCZ A;  1EY9 A;  4Q0F A;  4B08 A;  3I90 A;  1STB A;  1GHK A;  3E6Z X;  1BBX C;  3J7A F;  3K7A B;  2RQX A;  3DHQ A;  2R6G A;  2KA7 A;  2NTT A;  5JVG 3;  2FMM A;  5C0X J;  5T1I A;  4ZKC B;  1WD0 A;  2C5C A;  3URY A;  3VR5 A;  2WIN B;  3AMU A;  1V43 A;  1I6V C;  5EPJ A;  3KUP A;  4LMQ D;  1G91 A;  1G6Z A;  4X3T A;  1GUW A;  2L9H A;  4A3J B;  1TU2 B;  2KQ3 A;  4OO1 G;  3HRZ C;  4HTH A;  1EYC A;  1HA5 A;  3BG3 A;  2MJ8 A;  4HN7 A;  2QDB A;  2NVT B;  5FLX L;  5CV8 A;  5CV6 A;  2PW5 A;  1CA6 A;  3LWU A;  1QNU A;  1L0X B;  4B9W A;  3K5L A;  4CJ1 B;  1EWH A;  2F0I A;  2QKI C;  1S5D D;  4A3K B;  1KLG D;  5CMD A;  1AN8 A;  3RZD B;  3EFX D;  2L11 A;  5A2Q L;  2CQA A;  3S1Q B;  2AWN A;  3SDZ A;  1ILP A;  4MIU A;  2AQ3 B;  5FO9 B;  4DFA A;  3T13 A;  1PRT B;  4F88 A;  3BVG A;  2BDO A;  1H9R A;  1UUP A;  3WOE A;  2M00 A;  4OL7 A;  1BCP B;  5JJZ A;  4JK1 C;  1PFM A;  2F0D A;  2HDL A;  4IZ8 A;  2MUY A;  1IYV A;  1WTV A;  4NP5 A;  5KIX A;  1TY2 A;  3SK4 A;  4F7X A;  4KY7 A;  1LT6 D;  3WDN A;  2KJX A;  2HCC A;  3A7L A;  4RFB A;  3C1F A;  3G6J B;  4RA8 A;  1TY0 A;  1A6X A;  3PUW A;  2I46 A;  1LAC A;  1JWS D;  5JOB A;  3KBX A;  3GTL B;  2EY6 A;  3JAM L;  4IUR A;  3T51 B;  1KNE A;  2DNE A;  1SBB B;  4EQP A;  1I4X A;  3I3C A;  3MTS A;  4X3U A;  4H13 C;  2LY7 A;  1G2T A;  1AW7 A;  5LHY 1;  2F0K A;  1CHP D;  2K32 A;  4XT1 B;  3T56 B;  3GTM B;  2JYO A;  4KKU A;  1J9O A;  4FXK C;  1TWH B;  4OIK A;  3V05 A;  5C4X B;  4KJN A;  4FO2 A;  4CKE A;  5C3X A;  3PIP 3;  2ID0 A;  2RVL A;  1R4P B;  3TP5 A;  2SDF A;  1KLU D;  5M5W B;  5EBC A;  1NCV A;  2SOB A;  4WOR A;  1GUS A;  1BUV T;  5COR A;  2KCN A;  3KK7 A;  3GTJ B;  3A8K E;  5ELC A;  1FGB D;  5I6W A;  3DMU A;  2JA7 B;  3ONA B;  2WKC A;  4C3J B;  3C46 A;  1EY5 A;  3TN2 A;  4RHS A;  1T5X D;  3V2T A;  1C48 A;  2PMZ B;  4MHE A;  2OXP A;  2KCC A;  3K58 A;  3P7J A;  5LL6 X;  3KLS X;  3CQZ B;  2F0U A;  2BE5 D;  4GZY C;  2WAC A;  3NHH A;  5IGE A;  1A15 A;  1I4H A;  3KF8 A;  2A6H D;  2CHB D;  4TQU S;  2CW0 C;  3PUV A;  2L1B A;  5JEA H;  5K36 G;  2D5D A;  5CBA E;  3QWN A;  5E1F A;  3BDC A;  1S5F D;  4ILW A;  3C1E A;  4K8J A;  1O80 A;  4FF3 A;  3OPO A;  1SYF A;  4CKC A;  1V1P B;  5EPL A;  4KY5 A;  3RLF A;  3HOX B;  1HFN A;  4KN7 C;  2NWG A;  1PRT F;  3VR2 A;  4K14 A;  4PMC A;  3D6W A;  1SNO A;  3J81 L;  1AZP A;  2XIW A;  2HCI A;  5IOD A;  3HGB A;  5C3E B;  4RCO A;  2IX3 A;  1SE4 A;  4OO1 I;  5J1Z A;  1BCP F;  3S2D B;  3R2T A;  3A7A B;  5IT9 L;  1HTL D;  2KHS A;  2NVX B;  2NN6 I;  3DXJ C;  1TQO A;  5D3I B;  3S1N B;  4XT3 B;  1Q8I A;  2OT2 A;  4DU9 A;  1LTG D;  5HGT A;  1PFB A;  5JPN C;  1NAP A;  3I91 A;  1IW7 C;  2F03 A;  1EEI D;  1EOT A;  3NTI A;  4XTC S;  3KBG A;  4ZRZ A;  3TP7 A;  1O78 A;  2JSO A;  1E2V A;  3Q24 A;  3M4Y A;  4WFN 3;  1TS2 A;  2FHT A;  1PFN A;  2RSN A;  3DWA A;  1CT1 D;  5TSS A;  1PRT C;  2Z1C A;  5JEA J;  1G8Z D;  2F0E A;  5FK9 C;  2IJ0 A;  4QUC A;  4FF2 A;  4KJO A;  1VF5 C;  3VA7 A;  4QCL A;  5FO7 B;  1QCB D;  1BCP C;  3MXN A;  2KEE A;  4A3E B;  3I4N B;  1SMY C;  2WII B;  5C4H A;  1KDA A;  1RD9 D;  1U4P A;  3MC0 B;  3IFD A;  3NXW A;  1EIG A;  3D3R A;  2E75 C;  3M7N A;  5ELB A;  4FXG C;  4O42 A;  1F9P A;  4BBS B;  3NP8 A;  4HR7 B;  1JB3 A;  4KMU C;  4XXE A;  1ZKO A;  1KAA A;  2K33 A;  2AWO A;  1ICW A;  4FP5 D;  4CKB A;  3S9W A;  4PV1 C;  2EYP A;  3R8B A;  1XWE A;  1LTS D;  1Q1B A;  3BYT B;  4QUF A;  2A74 C;  5IGF A;  4DK0 A;  3PV0 A;  4K8I A;  1A3U A;  3CHB D;  1D2B A;  5CR3 A;  1KAB A;  1H9M A;  1D1K A;  4HCS A;  5DM7 3;  1ET6 A;  3RMH A;  2E74 C;  2VUM B;  2X69 A;  1B9M A;  4EQN A;  1IKM A;  3K5M A;  1I4Q A;  3HZX A;  3P75 A;  1WVL A;  4DAP A;  3M3Y B;  1QNK A;  2KUM A;  3EVQ A;  4DK1 A;  2NUC A;  3GV3 A;  3R3O A;  1SJE D;  2PPB C;  5KYI A;  1QWY A;  3I8Z A;  3PO2 B;  3M85 A;  3VYS A;  1FNW A;  1F2M A;  2EY1 A;  4XYO A;  4U68 A;  3KLS A;  1BXT A;  3S14 B;  1HUN A;  2EJG C;  4UDU C;  4FYD A;  2F0P A;  2K5D A;  1IYU A;  3NSW A;  2MHV A;  1RJT A;  4IN3 A;  1QB5 D;  3Q23 A;  4FVM A;  4IFD H;  1HQR D;  3QB3 A;  5I6Y A;  2X6G A;  2H1E A;  5EQ0 A;  1MBY A;  2EY2 A;  5C5M A;  3OWE B;  5EJW A;  3KLR A;  4PMB A;  5BN4 A;  2KOL A;  3QOJ A;  4JBW A;  2TSS A;  2J7Z A;  1R9T B;  1SYD A;  1I4R A;  2WV6 D;  5T1G A;  3UI2 A;  2BDN A;  1MSG A;  1STH A;  4C56 C;  4RCN A;  3EQL C;  5D14 A;  2WKD A;  4R8N A;  3GTP B;  1QJO A;  1XX8 A;  3K57 A;  3NTK A;  1GXD C;  1ENF A;  1RF2 D;  4DXG A;  1KNA A;  1X3Q A;  1OXV A;  1PTO H;  2EOT A;  3OOC A;  4BY1 B;  1DYQ A;  3QOL A;  4OHJ A;  1FR3 A;  5DEH A;  2ICI A;  1X32 A;  3E0J A;  2QEJ C;  1B1Z A;  2BOS A;  2GA4 B;  2PW7 A;  2EJF C;  2RKS A;  3J80 L;  1A3T A;  2B63 B;  4IFD J;  1Q1E A;  2N88 A;  3J80 E;  3VYU A;  1PZK D;  2AQ1 B;  3HP3 A;  1MI2 A;  2A68 D;  1O7Z A;  4L63 B;  1HHV A;  5ELE A;  1PDQ A;  4IQZ A;  1LT3 D;  4RGO S;  4OGQ C;  2B2Y A;  1TR5 A;  4LAA A;  3X3N A;  5IGB A;  3HKZ B;  4RKL A;  2NN6 G;  1IL8 A;  2L55 A;  4IUU A;  5CV7 A;  1GUO A;  1S4Z A;  2SEB D;  1JIC A;  2F0L A;  1Z6H A;  5KEE A;  3AB9 A;  4P2C B;  1STA A;  1DON A;  4N9T A;  3HG9 A;  3LNN A;  1EL0 A;  3PUY A;  4OO1 H;  1PTO D;  3P1H A;  2LFN A;  2EYO A;  4CGY B;  1FD7 D;  2OEO A;  3I72 A;  1EQT A;  5K5P A;  1LO5 D;  1EZ8 A;  4LK1 C;  1WTR A;  1ILQ A;  4XDX A;  1PZI D;  2I07 B;  3H91 A;  1R4Q B;  2EZV A;  2K04 A;  2BE5 C;  4CHT B;  1HCZ A;  4K2L A;  1VMP A;  1WTW A;  2A6H C;  4RAU C;  5C4Z A;  1LTA D;  1F77 A;  4KD3 A;  3S1R B;  4A3F B;  4L6T B;  3M7G A;  1LTT D;  1AEX A;  5DM6 3;  3L3O C;  5CBE E;  1SND A;  1IHZ A;  1YNJ C;  5ELD A;  4X3K A;  2G9H D;  1CM9 A;  2XRS D;  3OHX C;  3K59 A;  1ZEQ X;  4K5X A;  5ISR A;  3TSS A;  4KK7 A;  2QCP X;  2D2C C;  3EJI A;  1Q90 A;  2F0H A;  1Z7T A;  2AQ2 B;  2MGS A;  2WP8 J;  2F4I A;  5EKK A;  2H4O A;  4KV6 A;  4Y7N B;  4OIJ A;  2F1M A;  1E2Z A;  4FF1 A;  1JR0 D;  1LTR D;  4K5V A;  1VMC A;  4EGV A;  5HUR A;  1K8O A;  4EQO A;  3SEB A;  4K2K A;  1SNC A;  3HS0 C;  1S5C D;  5DAU A;  1AZQ A;  1JOQ A;  3H94 A;  3FMC A;  4C3I G;  2D9U A;  1STY A;  2RSO A;  1GUG A;  1T5E A;  1TWF B;  1HTP A;  4BS9 A;  2O5J C;  5C44 B;  2L0C A;  4G4K A;  3ERQ A;  1QOH A;  2IX1 A;  1H9S A;  4RHR A;  1ROD A;  1SSO A;  3SXH A;  2R3Z A;  4R8I A;  2ZXR A;  4CJ2 C;  1WTX A;  2K7V A;  1KDC A;  1W6J A;  1G2S A;  3HEJ A;  4DNR B;  1M8A A;  4BBR B;  4MN3 A;  1HPC A;  1EY8 A;  1A3V A;  2F3V A;  1K83 B;  3MHB A;  4A3G B;  5M3F B;  1F9R A;  1LT4 D;  2NB0 A;  4C2M B;  1YNJ D;  3RZO B;  3GTO B;  3A8J E;  4HED A;  2B2Y C;  1TWA B;  3X3M A;  3A55 A;  4PMW A;  1SNP A;  4DXF A;  2XN9 C;  3NWT A;  2JA5 B;  3K0Y A;  4PQX A;  3S1M B;  5CGK A;  5IOC A;  4HMJ A;  3GTK B;  5K36 H;  1F2L A;  2F0M A;  3N52 A;  1WTP A;  3NUC A;  1STE A;  1PTO B;  1ONL A;  4KHV A;  3S15 B;  3D6C A;  3TP8 A;  3QIA A;  3J7A V;  3A8I E;  3SK5 A;  4G57 A;  1HQM C;  2EPB A;  1STN A;  3VR6 A;  1U4L A;  1DZ1 A;  2ZXO A;  2X6L A;  3T4A C;  1SJH D;  5EBD A;  2B8F A;  1UNS A;  1EWC A;  1JOR A;  4DA2 A;  1L0Y B;  1NR2 A;  3MVV A;  3NPP A;  4F87 A;  2NVQ B;  4IAL A;  5KRU A;  1B4O A;  3HOZ B;  3SVM A;  1BF4 A;  2PYK A;  2K28 A;  4RH6 A;  5EKI A;  3D4R A;  1CZG A;  3MAQ A;  3Q22 A;  3R93 A;  4WRD A;  1HXY D;  3ERO A;  2F0T A;  2EY5 A;  3GP7 A;  2ZXP A;  3MXU A;  3BVZ A;  2JA6 B;  4ZYS A;  1V8Q A;  1STG A;  4XYQ A;  4Z9C B;  3OSO A;  4G7Z C;  2F0G A;  4O1N A;  3L7Z C;  2N55 A;  1UAP A;  5DNF A;  3DEO A;  1TKW B;  1QG7 A;  3F2U A;  1BQQ T;  5KYL A;  1SNM A;  2LKV A;  4H7B A;  1DOL A;  4KY6 A;  4ME5 A;  1EU3 A;  4HSP A;  4C3J G;  2VB2 X;  1Y1W B;  5JVH 3;  3K5O A;  1HFG A;  3TZD A;  3BS1 A;  4NKL A;  1GOZ A;  2V4D A;  2A6E D;  2VB3 X;  1WCM B;  2Q8I B;  1HRJ A;  5ELF A;  4K6L A;  5I4D A;  2E2J B;  2NBF A;  1SYB A;  2O4X A;  1EY0 A;  1LT5 D;  1J8I A;  1CHQ D;  5G3L F;  2F3W A;  4QF4 A;  2M9V A;  2HQE A;  5C0X G;  1TWC B;  1PXU A;  3Q0A A;  1B3A A;  1CFM A;  2PCF B;  5CC4 A;  2A68 C;  4QB4 A;  1PTO F;  3SE0 A;  2B2W A;  4HSV A;  2EYM A;  3VYT A;  2DY7 A;  1EY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...