2EJNA

Structural characterization of the tetrameric form of the major cat allergen fel d 1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
146
structure length
146
Chain Sequence
MEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSLLDKIYTSPLCVKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKDCMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the tetrameric form of the major cat allergen Fel d 1
pubmed doi rcsb
molecule keywords Major allergen I polypeptide chain 1, chain 2
molecule tags Allergen
source organism Felis catus
total genus 60
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09252 Feld-I_B Allergen Fel d I-B chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.50 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Histone Acetyltransferase; Chain A 2ejnA00
1ZKRA 2EJNA 1PUOA
chains in the Genus database with same CATH superfamily
4YBMA 5C7NA 5EWVA 5AD2A 4NYWA 3LJWA 4ZC9A 2DVQA 5A5RA 3UVDA 5TB6A 4O7CA 5LKXA 3K2JA 5F2PA 4TU4A 5G4SA 5E9IA 1WUGA 3DWYA 4HXKA 1WUMA 3UV5A 5BT5A 4Q0OA 4MR4A 3VKGA 2D9EA 2YQDA 4UIWA 4MEPA 5CQ6A 5KTXA 5DFDA 3U5MA 5FE3A 4CLBA 5F25A 5HQ6A 4OGIA 3SVGA 5AMEA 4N4FA 4CL9A 1E6IA 4HXSA 5D3HA 3UV2A 5CQ3A 5BT3A 4CUTA 4QC1A 5LJ0A 4RVRA 4YY4A 3LQIA 4UIYA 4QUUA 5FBXA 3ZYUA 5HRWA 2FSAA 4QSWA 4Z1SA 4O77A 3QZTA 5CQTA 4NR8A 5DW2A 4A9JA 4O72A 3G0JA 4UIUA 5DKCA 5EVAA 5KTWA 2RFJA 4MR3A 5I1QA 4YATA 3G0LA 5LJ2A 3DAIA 4LYIA 3P1EA 2WP2A 4YH4A 5DY7A 3FKMX 4O7BA 2YEKA 3LXJA 5CRMA 4ZQLA 5FE1A 4O74A 5EISA 5FDZA 3MB4A 5CUBA 5COIA 5EICA 5I7YA 4YYDA 5DYUA 3UV4A 4J3IA 5IBNA 5FE0A 5EK9A 5E9YA 4NR7A 5HENA 4UIVA 4QR3A 3D1DA 3P1DA 4PCIA 4N4IA 3I3JA 4BW2A 5A5QA 4HXNA 4BW3A 4Y03A 5E9LA 4TT4A 2RO1A 3AQAA 4XUAA 4QYLA 5EWHA 5H1UA 1PUOA 2YYNA 4QR4A 4A9IA 5D3NA 2YEMA 4YC9A 5E0RA 4HBWA 4HXLA 4PCEA 4DONA 4UYFA 5CFWA 3U5LA 3IU6A 5ENHA 5CQ5A 5LUUA 5K29A 1X0JA 5HFRA 5CUGA 4XUBA 5F36A 5CQ7A 5A5OA 4XYAA 3SVFA 3D7CA 5IIDA 4QSVA 5J0DA 4YABA 4LRGA 2DVRA 2GRCA 5IGLA 5FE7A 4TT6A 4QSUA 4BW1A 5DBMA 4TU6A 5KO4A 4IR4A 4WIVA 3JVMA 3P1FA 2MJVB 3UVYA 4NUCA 4NQNA 5EI4A 5F1HA 3UVXA 1N72A 5D3TA 5DKHA 5IG6A 3IU5A 4KV4A 4O78A 5ENBA 4NQMA 5E74A 4NYVA 5EPBA 3UW9A 4YYMA 5A83A 1EQFA 2OSSA 5AD3A 2I7KA 5CZGA 5EGUA 5ENCA 4Q0NA 5F60A 3U5OA 5EP7A 5CP5A 5C4QA 5I83A 5KU3A 2F6NA 5CUEA 2RS9B 2E7NA 5E73A 5DKDA 5E9VA 4AKHA 4XY8A 4N3WA 5D3PA 3HMFA 5D0CA 4TYLA 5E3DA 4PS5A 4N4GA 5BT4A 5CU8A 4OUFA 5HQ5A 5F62A 5D3JA 4NRAA 3S91A 5IGNA 5HRXA 3QZSA 4NR6A 2DWWA 3QZVA 4MR6A 4QEVA 5A81A 5EPRA 5DYAA 2RNXA 4NUDA 3S92A 5L98A 5HQ7A 5EPSA 3O36A 5C85A 4A9EA 5E9MA 5D3SA 5JI8A 2L85A 2L84A 1JSPB 5I80A 5HJCA 4A9MA 5LVRA 2R0YA 3O37A 5FE4A 4TT2A 5FFYA 4LZ2A 3SVHA 3GG3A 3U5PA 5F61A 5ENEA 5L8TA 4BHWA 3P1CA 4UIXA 5E9KA 4HXOA 5A5NA 2L5EA 3O34A 3ERRA 4PKLA 4X2IA 4ZW1A 4NS5A 4YYNA 5A85A 4C66A 4HXRA 5D26A 2I8NA 4MEQA 5EQ1A 5A7CA 4NXJA 5FG6A 5EWWA 3UVWA 4A9LA 5D25A 5FG4A 4HXMA 5F5ZA 2OUOA 4F3IA 4J1PA 2R0VA 4UIZA 4PY6A 5L8UA 2RNYA 4UITA 5FB1A 5FG5A 4NR5A 5I7XA 5I86A 4Z1QA 4HBVA 4WHUA 4BJXA 5ENIA 2YW5A 4IR5A 5F1LA 4YH3A 3HMHA 5A5PA 4NRCA 4MEOA 3MQMA 5FE6A 5HLSA 4A9NA 4CURA 3MB3A 2OO1A 2YDWA 4CUSA 2G4AA 4N4HA 5HEMA 4HXPA 4Z6HA 4QSTA 2R0SA 2YELA 4QUTA 3U5JA 4QR5A 3U5KA 4QEWA 2DKWA 4LZRA 4IOQA 5KTUA 4YK0A 5DFBA 3HMEA 5H1VA 4LYWA 2NXBA 2F6JA 4AKIA 4QYDA 4A9FA 5LJ1A 4CFLA 5FE2A 4QZSA 2DVVA 2H60A 5HFQA 4LR6A 5LVQA 5FE9A 4A9OA 2WP1A 2R10A 5G4RA 5A5SA 4O75A 4QC3A 4YBSA 4CUUA 4AI6A 4TZ2A 5D24A 4YYIA 5EWCA 4ALGA 4QSXA 4NUEA 4IR6A 4O7EA 5D7XA 5DYXA 5I40A 5DX4A 4MR5A 5ENFA 5ETDA 5I88A 5FH8A 1F68A 4LC2A 4NRBA 4IOOA 3MULA 5EV9A 3TLPA 5FE8A 4O76A 4YYGA 5EM3A 2DATA 3JVKA 4QSRA 4YADA 2LSPB 2RI7A 4O70A 5DFCA 5L97A 2E3KA 1ZKRA 3O35A 3JVJA 3Q2EA 3MUKA 5H85A 5FH7A 4AKNA 4UYDA 5IGMA 5DW1A 5DLZA 4MENA 4LDFA 4YAXA 4QSSA 4YBTA 5E7DA 5FH6A 4UYEA 3O33A 4GPJA 4CFKA 4J0SA 5KHMA 4QY4A 4QSQA 3MXFA 5L96A 4QB3A 4CUPA 3NXBA 5H1TA 5HM0A 4NR4A 5DYCA 1JM4B 5EU1A 4XY9A 4TS8A 5ACYA 1ZS5A 5IGKA 4UYFB 4YY6A 5F3AA 4KV1A 3LQHA 5CTLA 4YYJA 4PTBA 3Q2FA 4O7FA 5I89A 4QBMA 4KCXA 2RNWA 5HCLA 5LKUA 4TTEA 2N9GA 4Z93A 5CRZA 4J0RA 3D1BA 5CUDA 5FFWA 5CGPA 4WHWA 4ALHA 5D3LA 4LZSA 5HELA 5C89A 5LKTA 5CPEA 4O71A 3AADA 3P5OA 4A9KA 4TZ8A 5L99A 5F63A 5II2A 2DVSA 4HBYA 3ONIA 4A9HA 2EJNA 5ETBA 3JVLA 5CY9A 2D82A 2E7OA 5I29A 5CUCA 5JWMA 4NR9A 4UYHA 5CQAA 5CQ8A 3VKHA 5TCMA 5CQ4A 4C67A 4QSPA 4IORA 5E3GA 4YYKA 3U5NA 4IR3A 4TQNA 5CUAA 5II1A 5DLXA 4QEUA 5C87A 4UYGA 5CS8A 5ENGA 4CUQA 3LQJA 5C8GA 4O7AA 4E96A 5FB0A 5FFVA 5D3RA 4FLPA 4AKGA 4NYXA 4QNSA 5ENJA 2KTBB 5HRVA 4Z6IA 5A82A 4YYHA 5EA1A 4BW4A 4HBXA 4LYSA 5AMFA 3RCWA 5FE5A 5EWDA 5LKZA 4OGJA
chains in the Genus database with same CATH topology
4AI6A 4AKIA 1PUOA 3D1DA 3VKGA 1ZKRA 2EJNA 3ERRA 3VKHA 4AKHA 3D1BA 4AKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKR A;  2EJN A;  1PUO A; 
#chains in the Genus database with same CATH topology
 4YBM A;  5C7N A;  5EWV A;  5AD2 A;  4NYW A;  3LJW A;  4ZC9 A;  2DVQ A;  5A5R A;  3UVD A;  5TB6 A;  4O7C A;  5LKX A;  3K2J A;  5F2P A;  4TU4 A;  5G4S A;  5E9I A;  1WUG A;  3DWY A;  4HXK A;  1WUM A;  3UV5 A;  5BT5 A;  4Q0O A;  4MR4 A;  3VKG A;  2D9E A;  2YQD A;  4UIW A;  4MEP A;  5CQ6 A;  5KTX A;  5DFD A;  3U5M A;  5FE3 A;  4CLB A;  5F25 A;  5HQ6 A;  4OGI A;  3SVG A;  5AME A;  4N4F A;  4CL9 A;  1E6I A;  4HXS A;  5D3H A;  3UV2 A;  5CQ3 A;  5BT3 A;  4CUT A;  4QC1 A;  5LJ0 A;  4RVR A;  4YY4 A;  3LQI A;  4UIY A;  4QUU A;  5FBX A;  3ZYU A;  5HRW A;  2FSA A;  4QSW A;  4Z1S A;  4O77 A;  3QZT A;  5CQT A;  4NR8 A;  5DW2 A;  4A9J A;  4O72 A;  3G0J A;  4UIU A;  5DKC A;  5EVA A;  5KTW A;  2RFJ A;  4MR3 A;  5I1Q A;  4YAT A;  3G0L A;  5LJ2 A;  3DAI A;  4LYI A;  3P1E A;  2WP2 A;  4YH4 A;  5DY7 A;  3FKM X;  4O7B A;  2YEK A;  3LXJ A;  5CRM A;  4ZQL A;  5FE1 A;  4O74 A;  5EIS A;  5FDZ A;  3MB4 A;  5CUB A;  5COI A;  5EIC A;  5I7Y A;  4YYD A;  5DYU A;  3UV4 A;  4J3I A;  5IBN A;  5FE0 A;  5EK9 A;  5E9Y A;  4NR7 A;  5HEN A;  4UIV A;  4QR3 A;  3D1D A;  3P1D A;  4PCI A;  4N4I A;  3I3J A;  4BW2 A;  5A5Q A;  4HXN A;  4BW3 A;  4Y03 A;  5E9L A;  4TT4 A;  2RO1 A;  3AQA A;  4XUA A;  4QYL A;  5EWH A;  5H1U A;  1PUO A;  2YYN A;  4QR4 A;  4A9I A;  5D3N A;  2YEM A;  4YC9 A;  5E0R A;  4HBW A;  4HXL A;  4PCE A;  4DON A;  4UYF A;  5CFW A;  3U5L A;  3IU6 A;  5ENH A;  5CQ5 A;  5LUU A;  5K29 A;  1X0J A;  5HFR A;  5CUG A;  4XUB A;  5F36 A;  5CQ7 A;  5A5O A;  4XYA A;  3SVF A;  3D7C A;  5IID A;  4QSV A;  5J0D A;  4YAB A;  4LRG A;  2DVR A;  2GRC A;  5IGL A;  5FE7 A;  4TT6 A;  4QSU A;  4BW1 A;  5DBM A;  4TU6 A;  5KO4 A;  4IR4 A;  4WIV A;  3JVM A;  3P1F A;  2MJV B;  3UVY A;  4NUC A;  4NQN A;  5EI4 A;  5F1H A;  3UVX A;  1N72 A;  5D3T A;  5DKH A;  5IG6 A;  3IU5 A;  4KV4 A;  4O78 A;  5ENB A;  4NQM A;  5E74 A;  4NYV A;  5EPB A;  3UW9 A;  4YYM A;  5A83 A;  1EQF A;  2OSS A;  5AD3 A;  2I7K A;  5CZG A;  5EGU A;  5ENC A;  4Q0N A;  5F60 A;  3U5O A;  5EP7 A;  5CP5 A;  5C4Q A;  5I83 A;  5KU3 A;  2F6N A;  5CUE A;  2RS9 B;  2E7N A;  5E73 A;  5DKD A;  5E9V A;  4AKH A;  4XY8 A;  4N3W A;  5D3P A;  3HMF A;  5D0C A;  4TYL A;  5E3D A;  4PS5 A;  4N4G A;  5BT4 A;  5CU8 A;  4OUF A;  5HQ5 A;  5F62 A;  5D3J A;  4NRA A;  3S91 A;  5IGN A;  5HRX A;  3QZS A;  4NR6 A;  2DWW A;  3QZV A;  4MR6 A;  4QEV A;  5A81 A;  5EPR A;  5DYA A;  2RNX A;  4NUD A;  3S92 A;  5L98 A;  5HQ7 A;  5EPS A;  3O36 A;  5C85 A;  4A9E A;  5E9M A;  5D3S A;  5JI8 A;  2L85 A;  2L84 A;  1JSP B;  5I80 A;  5HJC A;  4A9M A;  5LVR A;  2R0Y A;  3O37 A;  5FE4 A;  4TT2 A;  5FFY A;  4LZ2 A;  3SVH A;  3GG3 A;  3U5P A;  5F61 A;  5ENE A;  5L8T A;  4BHW A;  3P1C A;  4UIX A;  5E9K A;  4HXO A;  5A5N A;  2L5E A;  3O34 A;  3ERR A;  4PKL A;  4X2I A;  4ZW1 A;  4NS5 A;  4YYN A;  5A85 A;  4C66 A;  4HXR A;  5D26 A;  2I8N A;  4MEQ A;  5EQ1 A;  5A7C A;  4NXJ A;  5FG6 A;  5EWW A;  3UVW A;  4A9L A;  5D25 A;  5FG4 A;  4HXM A;  5F5Z A;  2OUO A;  4F3I A;  4J1P A;  2R0V A;  4UIZ A;  4PY6 A;  5L8U A;  2RNY A;  4UIT A;  5FB1 A;  5FG5 A;  4NR5 A;  5I7X A;  5I86 A;  4Z1Q A;  4HBV A;  4WHU A;  4BJX A;  5ENI A;  2YW5 A;  4IR5 A;  5F1L A;  4YH3 A;  3HMH A;  5A5P A;  4NRC A;  4MEO A;  3MQM A;  5FE6 A;  5HLS A;  4A9N A;  4CUR A;  3MB3 A;  2OO1 A;  2YDW A;  4CUS A;  2G4A A;  4N4H A;  5HEM A;  4HXP A;  4Z6H A;  4QST A;  2R0S A;  2YEL A;  4QUT A;  3U5J A;  4QR5 A;  3U5K A;  4QEW A;  2DKW A;  4LZR A;  4IOQ A;  5KTU A;  4YK0 A;  5DFB A;  3HME A;  5H1V A;  4LYW A;  2NXB A;  2F6J A;  4AKI A;  4QYD A;  4A9F A;  5LJ1 A;  4CFL A;  5FE2 A;  4QZS A;  2DVV A;  2H60 A;  5HFQ A;  4LR6 A;  5LVQ A;  5FE9 A;  4A9O A;  2WP1 A;  2R10 A;  5G4R A;  5A5S A;  4O75 A;  4QC3 A;  4YBS A;  4CUU A;  4AI6 A;  4TZ2 A;  5D24 A;  4YYI A;  5EWC A;  4ALG A;  4QSX A;  4NUE A;  4IR6 A;  4O7E A;  5D7X A;  5DYX A;  5I40 A;  5DX4 A;  4MR5 A;  5ENF A;  5ETD A;  5I88 A;  5FH8 A;  1F68 A;  4LC2 A;  4NRB A;  4IOO A;  3MUL A;  5EV9 A;  3TLP A;  5FE8 A;  4O76 A;  4YYG A;  5EM3 A;  2DAT A;  3JVK A;  4QSR A;  4YAD A;  2LSP B;  2RI7 A;  4O70 A;  5DFC A;  5L97 A;  2E3K A;  1ZKR A;  3O35 A;  3JVJ A;  3Q2E A;  3MUK A;  5H85 A;  5FH7 A;  4AKN A;  4UYD A;  5IGM A;  5DW1 A;  5DLZ A;  4MEN A;  4LDF A;  4YAX A;  4QSS A;  4YBT A;  5E7D A;  5FH6 A;  4UYE A;  3O33 A;  4GPJ A;  4CFK A;  4J0S A;  5KHM A;  4QY4 A;  4QSQ A;  3MXF A;  5L96 A;  4QB3 A;  4CUP A;  3NXB A;  5H1T A;  5HM0 A;  4NR4 A;  5DYC A;  1JM4 B;  5EU1 A;  4XY9 A;  4TS8 A;  5ACY A;  1ZS5 A;  5IGK A;  4UYF B;  4YY6 A;  5F3A A;  4KV1 A;  3LQH A;  5CTL A;  4YYJ A;  4PTB A;  3Q2F A;  4O7F A;  5I89 A;  4QBM A;  4KCX A;  2RNW A;  5HCL A;  5LKU A;  4TTE A;  2N9G A;  4Z93 A;  5CRZ A;  4J0R A;  3D1B A;  5CUD A;  5FFW A;  5CGP A;  4WHW A;  4ALH A;  5D3L A;  4LZS A;  5HEL A;  5C89 A;  5LKT A;  5CPE A;  4O71 A;  3AAD A;  3P5O A;  4A9K A;  4TZ8 A;  5L99 A;  5F63 A;  5II2 A;  2DVS A;  4HBY A;  3ONI A;  4A9H A;  2EJN A;  5ETB A;  3JVL A;  5CY9 A;  2D82 A;  2E7O A;  5I29 A;  5CUC A;  5JWM A;  4NR9 A;  4UYH A;  5CQA A;  5CQ8 A;  3VKH A;  5TCM A;  5CQ4 A;  4C67 A;  4QSP A;  4IOR A;  5E3G A;  4YYK A;  3U5N A;  4IR3 A;  4TQN A;  5CUA A;  5II1 A;  5DLX A;  4QEU A;  5C87 A;  4UYG A;  5CS8 A;  5ENG A;  4CUQ A;  3LQJ A;  5C8G A;  4O7A A;  4E96 A;  5FB0 A;  5FFV A;  5D3R A;  4FLP A;  4AKG A;  4NYX A;  4QNS A;  5ENJ A;  2KTB B;  5HRV A;  4Z6I A;  5A82 A;  4YYH A;  5EA1 A;  4BW4 A;  4HBX A;  4LYS A;  5AMF A;  3RCW A;  5FE5 A;  5EWD A;  5LKZ A;  4OGJ A; 
#chains in the Genus database with same CATH homology
 4AI6 A;  4AKI A;  1PUO A;  3D1D A;  3VKG A;  1ZKR A;  2EJN A;  3ERR A;  3VKH A;  4AKH A;  3D1B A;  4AKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...