2EJNA

Structural characterization of the tetrameric form of the major cat allergen fel d 1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
146
structure length
146
Chain Sequence
MEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSLLDKIYTSPLCVKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKDCMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major allergen I polypeptide chain 1, chain 2
publication title Structural characterization of the tetrameric form of the major cat allergen Fel d 1
pubmed doi rcsb
source organism Felis catus
molecule tags Allergen
total genus 60
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09252 Feld-I_B Allergen Fel d I-B chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.50 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Histone Acetyltransferase; Chain A 2ejnA00
1ZKRA 2EJNA 1PUOA
chains in the Genus database with same CATH superfamily
2YEKA 5EV9A 5DYUA 4PY6A 4Q0OA 4YH3A 5F25A 4A9EA 2YW5A 5EA1A 4CL9A 3FKMX 5F63A 3GG3A 3LQIA 3MXFA 5CQ8A 5FDZA 4A9NA 3P1CA 5L99A 5I1QA 4O76A 5LKXA 2KTBB 5D3RA 2GRCA 5F3AA 3QZSA 2DVVA 4QR5A 5D3SA 5C87A 5FE1A 2R0YA 4O7CA 5DKHA 2DVRA 5I89A 5FB1A 4TT2A 5KTXA 4Z93A 5HEMA 5LJ2A 4YK0A 3RCWA 5EICA 4MR6A 5E9IA 2DVQA 5D3TA 3LQJA 4BW3A 2LSPB 5LJ0A 2E3KA 4YYJA 4NR7A 5A5PA 5E9LA 4YAXA 3O33A 4UYFB 3O34A 5I7XA 4MEPA 5H85A 4O78A 4YC9A 4PTBA 2YELA 4PS5A 4CUQA 4E96A 5EP7A 5F1HA 5I29A 5BT3A 5ENGA 5ACYA 4QC1A 3UVYA 3UW9A 4TTEA 5IIDA 5ETDA 5IGNA 5IG6A 4LDFA 4QNSA 4QEVA 4BJXA 4O7FA 4PCEA 4TYLA 5LJ1A 5EI4A 3U5OA 5I7YA 5ENFA 4NRAA 5FE2A 4GPJA 4UITA 3O37A 4UIYA 3ONIA 5ENIA 4NUEA 3LQHA 4HXMA 4J0RA 5EWWA 4XY9A 5HFQA 4TS8A 4AKHA 5HQ7A 4CURA 5FE7A 4UYEA 5FB0A 5FE6A 4LR6A 4YYHA 2YYNA 4O7BA 5CP5A 5IBNA 5JWMA 5CUAA 5EK9A 3VKHA 4QC3A 5HRVA 3G0JA 4QEUA 5CUDA 5LKUA 5CGPA 3S91A 4A9OA 4X2IA 4YYDA 5EPBA 3MQMA 1EQFA 2D82A 4O77A 3U5KA 1E6IA 4A9LA 3JVLA 2EJNA 5CU8A 5E74A 3LXJA 4MR4A 3P1EA 4XUBA 4XUAA 4Y03A 3TLPA 4CLBA 4HXPA 4LZRA 4NRBA 5FE3A 5HRXA 5I40A 4NR4A 2FSAA 5FE0A 1N72A 5DLXA 2RNWA 4O75A 5K29A 2NXBA 3LJWA 4IR4A 2DATA 5DBMA 4Z1SA 4TU4A 4NR8A 4XY8A 4N4IA 4UYGA 2R0VA 4OUFA 5EPSA 5BT5A 5FE5A 4TT4A 4CUTA 3G0LA 3IU5A 2I8NA 4QSXA 5L8UA 3MUKA 4IOOA 4O71A 4QBMA 5E9KA 5JI8A 5EQ1A 5H1VA 5EVAA 5L98A 3U5MA 4A9MA 5CQAA 2OO1A 4YATA 3MULA 2N9GA 2RO1A 5CQ4A 5FH7A 4NR5A 5FE4A 1F68A 4O72A 5DYAA 3AADA 4J3IA 3ERRA 5CQ3A 4NS5A 5D3LA 5TB6A 5E7DA 4QEWA 5FG4A 3NXBA 4IORA 4HBVA 4KCXA 5DW2A 5DYCA 4UYFA 5HLSA 4A9HA 3QZTA 4UYHA 5KO4A 4YH4A 5KHMA 4YBSA 4TU6A 5D25A 5FE8A 4UIVA 5I83A 5HQ5A 5A7CA 1WUMA 4O70A 5F5ZA 5EPRA 5FFWA 5COIA 5AMEA 4N3WA 3MB3A 3Q2EA 5DFBA 4LZ2A 5EWHA 4CUSA 5G4SA 2YDWA 4ALGA 5C89A 4Z6IA 3D1BA 5DKDA 4TQNA 5DX4A 5DLZA 3UVXA 5LVRA 4NXJA 5HQ6A 3P5OA 2L85A 2DKWA 5FH6A 3U5LA 3ZYUA 2OUOA 4IR3A 5I88A 5A5OA 3UVWA 5D3JA 5EWVA 5DW1A 5EWDA 2F6NA 5BT4A 5ENHA 4HXRA 1ZS5A 4MEQA 4UIWA 2DWWA 4Z1QA 5FG6A 2WP1A 4YBTA 5KTWA 2I7KA 4O7AA 5E3GA 4HBYA 2H60A 5ENCA 5D0CA 4BW4A 4YYGA 5DFDA 4QYDA 3U5PA 4BW1A 5LKTA 4QSTA 4N4GA 4TZ2A 5ETBA 3JVJA 5IGMA 2OSSA 5EWCA 2E7NA 5EM3A 5C85A 4LZSA 4UIZA 5D3PA 5DFCA 5L8TA 4NQMA 5D3NA 3S92A 4HXKA 5L96A 5A85A 3UV4A 5CQTA 3UV5A 4FLPA 5CRMA 4OGIA 4HXOA 5F2PA 4MEOA 5E9VA 5CS8A 4MR3A 2RNXA 4ZW1A 4BW2A 4QZSA 5CUBA 5LUUA 4QB3A 4UIXA 3O36A 4J0SA 4PCIA 2R10A 4QUUA 4C67A 2RI7A 5A5RA 5J0DA 4ZQLA 5DYXA 5ENJA 3HMFA 5FG5A 4AI6A 3UV2A 5CRZA 4QUTA 4KV1A 5I80A 5F36A 4N4FA 4WHWA 4A9IA 4YABA 3Q2FA 5ENEA 4YBMA 4LRGA 4YYNA 1ZKRA 2D9EA 5F61A 4YY6A 5EU1A 4HXSA 3JVMA 4QR4A 4QSPA 4TZ8A 4YADA 4CUPA 2YEMA 2E7OA 2R0SA 4Z6HA 5D26A 5HJCA 5C7NA 4NUCA 5FH8A 5H1UA 5CZGA 4CUUA 3VKGA 5TCMA 3SVHA 5DY7A 4ZC9A 4XYAA 4AKIA 4HXNA 5IGKA 5HM0A 5CTLA 5CQ5A 5II1A 4BHWA 5A5SA 5F60A 4YYKA 5E9MA 2YQDA 4QSVA 5IGLA 4DONA 4NQNA 4NRCA 2L84A 5F62A 4WHUA 5HCLA 4UYDA 3IU6A 4CFLA 3HMHA 4QY4A 4KV4A 4YYMA 3DWYA 5A5QA 3AQAA 4A9KA 5L97A 5A83A 5CQ7A 5FFYA 4YY4A 3U5JA 4HBXA 4QYLA 2L5EA 5EISA 5LVQA 4HXLA 5CUCA 4ALHA 4WIVA 3QZVA 3SVGA 5AD3A 5EGUA 5HFRA 1WUGA 5D24A 5KTUA 4A9FA 5H1TA 3I3JA 5AMFA 2DVSA 5HRWA 4OGJA 5CQ6A 3K2JA 4RVRA 2MJVB 1JM4B 4NYWA 5E9YA 3SVFA 4N4HA 4NR6A 4O7EA 5D7XA 5A82A 5G4RA 3D7CA 4NUDA 4IOQA 5CY9A 4LYSA 4J1PA 5LKZA 4NYVA 3P1DA 2RNYA 4HBWA 5I86A 5HELA 3JVKA 2F6JA 1PUOA 3U5NA 3O35A 5E0RA 4TT6A 5KU3A 4QSRA 4C66A 5AD2A 4LYWA 5DKCA 5E73A 3HMEA 5CUGA 5C8GA 1X0JA 2RS9B 4QSUA 4NYXA 5A5NA 1JSPB 4QSWA 3DAIA 4LC2A 5E3DA 4CFKA 4IR6A 4QR3A 3P1FA 4QSQA 2G4AA 5F1LA 3D1DA 4IR5A 4LYIA 5ENBA 4F3IA 3MB4A 5II2A 4MR5A 5HENA 4AKNA 4NR9A 4YYIA 4A9JA 5C4QA 4Q0NA 4QSSA 4UIUA 3UVDA 5FFVA 4O74A 5CFWA 5A81A 2RFJA 5FE9A 4AKGA 5CUEA 5CPEA 5FBXA 4PKLA 2WP2A 4MENA 5D3HA
chains in the Genus database with same CATH topology
4AI6A 1ZKRA 4AKHA 2EJNA 4AKGA 3D1DA 4AKIA 3VKHA 3ERRA 3VKGA 3D1BA 1PUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKR A;  2EJN A;  1PUO A; 
#chains in the Genus database with same CATH topology
 2YEK A;  5EV9 A;  5DYU A;  4PY6 A;  4Q0O A;  4YH3 A;  5F25 A;  4A9E A;  2YW5 A;  5EA1 A;  4CL9 A;  3FKM X;  5F63 A;  3GG3 A;  3LQI A;  3MXF A;  5CQ8 A;  5FDZ A;  4A9N A;  3P1C A;  5L99 A;  5I1Q A;  4O76 A;  5LKX A;  2KTB B;  5D3R A;  2GRC A;  5F3A A;  3QZS A;  2DVV A;  4QR5 A;  5D3S A;  5C87 A;  5FE1 A;  2R0Y A;  4O7C A;  5DKH A;  2DVR A;  5I89 A;  5FB1 A;  4TT2 A;  5KTX A;  4Z93 A;  5HEM A;  5LJ2 A;  4YK0 A;  3RCW A;  5EIC A;  4MR6 A;  5E9I A;  2DVQ A;  5D3T A;  3LQJ A;  4BW3 A;  2LSP B;  5LJ0 A;  2E3K A;  4YYJ A;  4NR7 A;  5A5P A;  5E9L A;  4YAX A;  3O33 A;  4UYF B;  3O34 A;  5I7X A;  4MEP A;  5H85 A;  4O78 A;  4YC9 A;  4PTB A;  2YEL A;  4PS5 A;  4CUQ A;  4E96 A;  5EP7 A;  5F1H A;  5I29 A;  5BT3 A;  5ENG A;  5ACY A;  4QC1 A;  3UVY A;  3UW9 A;  4TTE A;  5IID A;  5ETD A;  5IGN A;  5IG6 A;  4LDF A;  4QNS A;  4QEV A;  4BJX A;  4O7F A;  4PCE A;  4TYL A;  5LJ1 A;  5EI4 A;  3U5O A;  5I7Y A;  5ENF A;  4NRA A;  5FE2 A;  4GPJ A;  4UIT A;  3O37 A;  4UIY A;  3ONI A;  5ENI A;  4NUE A;  3LQH A;  4HXM A;  4J0R A;  5EWW A;  4XY9 A;  5HFQ A;  4TS8 A;  4AKH A;  5HQ7 A;  4CUR A;  5FE7 A;  4UYE A;  5FB0 A;  5FE6 A;  4LR6 A;  4YYH A;  2YYN A;  4O7B A;  5CP5 A;  5IBN A;  5JWM A;  5CUA A;  5EK9 A;  3VKH A;  4QC3 A;  5HRV A;  3G0J A;  4QEU A;  5CUD A;  5LKU A;  5CGP A;  3S91 A;  4A9O A;  4X2I A;  4YYD A;  5EPB A;  3MQM A;  1EQF A;  2D82 A;  4O77 A;  3U5K A;  1E6I A;  4A9L A;  3JVL A;  2EJN A;  5CU8 A;  5E74 A;  3LXJ A;  4MR4 A;  3P1E A;  4XUB A;  4XUA A;  4Y03 A;  3TLP A;  4CLB A;  4HXP A;  4LZR A;  4NRB A;  5FE3 A;  5HRX A;  5I40 A;  4NR4 A;  2FSA A;  5FE0 A;  1N72 A;  5DLX A;  2RNW A;  4O75 A;  5K29 A;  2NXB A;  3LJW A;  4IR4 A;  2DAT A;  5DBM A;  4Z1S A;  4TU4 A;  4NR8 A;  4XY8 A;  4N4I A;  4UYG A;  2R0V A;  4OUF A;  5EPS A;  5BT5 A;  5FE5 A;  4TT4 A;  4CUT A;  3G0L A;  3IU5 A;  2I8N A;  4QSX A;  5L8U A;  3MUK A;  4IOO A;  4O71 A;  4QBM A;  5E9K A;  5JI8 A;  5EQ1 A;  5H1V A;  5EVA A;  5L98 A;  3U5M A;  4A9M A;  5CQA A;  2OO1 A;  4YAT A;  3MUL A;  2N9G A;  2RO1 A;  5CQ4 A;  5FH7 A;  4NR5 A;  5FE4 A;  1F68 A;  4O72 A;  5DYA A;  3AAD A;  4J3I A;  3ERR A;  5CQ3 A;  4NS5 A;  5D3L A;  5TB6 A;  5E7D A;  4QEW A;  5FG4 A;  3NXB A;  4IOR A;  4HBV A;  4KCX A;  5DW2 A;  5DYC A;  4UYF A;  5HLS A;  4A9H A;  3QZT A;  4UYH A;  5KO4 A;  4YH4 A;  5KHM A;  4YBS A;  4TU6 A;  5D25 A;  5FE8 A;  4UIV A;  5I83 A;  5HQ5 A;  5A7C A;  1WUM A;  4O70 A;  5F5Z A;  5EPR A;  5FFW A;  5COI A;  5AME A;  4N3W A;  3MB3 A;  3Q2E A;  5DFB A;  4LZ2 A;  5EWH A;  4CUS A;  5G4S A;  2YDW A;  4ALG A;  5C89 A;  4Z6I A;  3D1B A;  5DKD A;  4TQN A;  5DX4 A;  5DLZ A;  3UVX A;  5LVR A;  4NXJ A;  5HQ6 A;  3P5O A;  2L85 A;  2DKW A;  5FH6 A;  3U5L A;  3ZYU A;  2OUO A;  4IR3 A;  5I88 A;  5A5O A;  3UVW A;  5D3J A;  5EWV A;  5DW1 A;  5EWD A;  2F6N A;  5BT4 A;  5ENH A;  4HXR A;  1ZS5 A;  4MEQ A;  4UIW A;  2DWW A;  4Z1Q A;  5FG6 A;  2WP1 A;  4YBT A;  5KTW A;  2I7K A;  4O7A A;  5E3G A;  4HBY A;  2H60 A;  5ENC A;  5D0C A;  4BW4 A;  4YYG A;  5DFD A;  4QYD A;  3U5P A;  4BW1 A;  5LKT A;  4QST A;  4N4G A;  4TZ2 A;  5ETB A;  3JVJ A;  5IGM A;  2OSS A;  5EWC A;  2E7N A;  5EM3 A;  5C85 A;  4LZS A;  4UIZ A;  5D3P A;  5DFC A;  5L8T A;  4NQM A;  5D3N A;  3S92 A;  4HXK A;  5L96 A;  5A85 A;  3UV4 A;  5CQT A;  3UV5 A;  4FLP A;  5CRM A;  4OGI A;  4HXO A;  5F2P A;  4MEO A;  5E9V A;  5CS8 A;  4MR3 A;  2RNX A;  4ZW1 A;  4BW2 A;  4QZS A;  5CUB A;  5LUU A;  4QB3 A;  4UIX A;  3O36 A;  4J0S A;  4PCI A;  2R10 A;  4QUU A;  4C67 A;  2RI7 A;  5A5R A;  5J0D A;  4ZQL A;  5DYX A;  5ENJ A;  3HMF A;  5FG5 A;  4AI6 A;  3UV2 A;  5CRZ A;  4QUT A;  4KV1 A;  5I80 A;  5F36 A;  4N4F A;  4WHW A;  4A9I A;  4YAB A;  3Q2F A;  5ENE A;  4YBM A;  4LRG A;  4YYN A;  1ZKR A;  2D9E A;  5F61 A;  4YY6 A;  5EU1 A;  4HXS A;  3JVM A;  4QR4 A;  4QSP A;  4TZ8 A;  4YAD A;  4CUP A;  2YEM A;  2E7O A;  2R0S A;  4Z6H A;  5D26 A;  5HJC A;  5C7N A;  4NUC A;  5FH8 A;  5H1U A;  5CZG A;  4CUU A;  3VKG A;  5TCM A;  3SVH A;  5DY7 A;  4ZC9 A;  4XYA A;  4AKI A;  4HXN A;  5IGK A;  5HM0 A;  5CTL A;  5CQ5 A;  5II1 A;  4BHW A;  5A5S A;  5F60 A;  4YYK A;  5E9M A;  2YQD A;  4QSV A;  5IGL A;  4DON A;  4NQN A;  4NRC A;  2L84 A;  5F62 A;  4WHU A;  5HCL A;  4UYD A;  3IU6 A;  4CFL A;  3HMH A;  4QY4 A;  4KV4 A;  4YYM A;  3DWY A;  5A5Q A;  3AQA A;  4A9K A;  5L97 A;  5A83 A;  5CQ7 A;  5FFY A;  4YY4 A;  3U5J A;  4HBX A;  4QYL A;  2L5E A;  5EIS A;  5LVQ A;  4HXL A;  5CUC A;  4ALH A;  4WIV A;  3QZV A;  3SVG A;  5AD3 A;  5EGU A;  5HFR A;  1WUG A;  5D24 A;  5KTU A;  4A9F A;  5H1T A;  3I3J A;  5AMF A;  2DVS A;  5HRW A;  4OGJ A;  5CQ6 A;  3K2J A;  4RVR A;  2MJV B;  1JM4 B;  4NYW A;  5E9Y A;  3SVF A;  4N4H A;  4NR6 A;  4O7E A;  5D7X A;  5A82 A;  5G4R A;  3D7C A;  4NUD A;  4IOQ A;  5CY9 A;  4LYS A;  4J1P A;  5LKZ A;  4NYV A;  3P1D A;  2RNY A;  4HBW A;  5I86 A;  5HEL A;  3JVK A;  2F6J A;  1PUO A;  3U5N A;  3O35 A;  5E0R A;  4TT6 A;  5KU3 A;  4QSR A;  4C66 A;  5AD2 A;  4LYW A;  5DKC A;  5E73 A;  3HME A;  5CUG A;  5C8G A;  1X0J A;  2RS9 B;  4QSU A;  4NYX A;  5A5N A;  1JSP B;  4QSW A;  3DAI A;  4LC2 A;  5E3D A;  4CFK A;  4IR6 A;  4QR3 A;  3P1F A;  4QSQ A;  2G4A A;  5F1L A;  3D1D A;  4IR5 A;  4LYI A;  5ENB A;  4F3I A;  3MB4 A;  5II2 A;  4MR5 A;  5HEN A;  4AKN A;  4NR9 A;  4YYI A;  4A9J A;  5C4Q A;  4Q0N A;  4QSS A;  4UIU A;  3UVD A;  5FFV A;  4O74 A;  5CFW A;  5A81 A;  2RFJ A;  5FE9 A;  4AKG A;  5CUE A;  5CPE A;  5FBX A;  4PKL A;  2WP2 A;  4MEN A;  5D3H A; 
#chains in the Genus database with same CATH homology
 4AI6 A;  1ZKR A;  4AKH A;  2EJN A;  4AKG A;  3D1D A;  4AKI A;  3VKH A;  3ERR A;  3VKG A;  3D1B A;  1PUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...