2EK1A

Crystal structure of rna-binding motif of human rna-binding protein 12
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
b'PTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLSGPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-binding protein 12
molecule tags Rna binding protein
source organism Homo sapiens
publication title Crystal structure of RNA-binding motif of human rna-binding protein 12
rcsb
total genus 15
structure length 79
sequence length 79
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ek1A00
3G9CA 2U2FA 1R8HA 3G8TA 3UE2A 1VBZA 2YH1A 1YHQS 1M5VC 4P6QA 1IQTA 1KOHA 2X1AA 1WELA 2RQ4A 2E5GA 2KI2A 4QQBA 2F3JA 2L08A 2MPUA 2LXUA 1WG1A 3MURP 2I2YA 2DIUA 3J7ZT 1WHWA 2MKSA 2MQQA 2MY8A 5DDQC 1JMTA 4UQTA 2DH7A 3VAGA 3NNAA 2YTCA 4F25A 2KYXA 2YKAA 1DHMA 5FJ4A 2DNYA 1DZ5A 2M8DB 1YJWS 2MQNA 2D9PA 2HYIB 1YI2S 3US5A 4TU7A 2RU3A 1QVFR 1NO8A 2DGSA 2O3DA 5D78A 3CC2S 1UFWA 2JWNA 1WHXA 3S7RA 3THPA 2YH0A 2KXNB 1JJ4A 2ZJRQ 2RUGA 4C4WA 3CULA 1UAWA 1VC6A 2N82B 2XS5A 3CCJS 4ZKAA 1HA1A 5ITHA 1U6FA 3Q2SC 4WFBQ 2M52A 3BS9A 2FPHX 2HGLA 2MQMA 5GAHU 2XSFA 2DHGA 2CQCA 4LJMA 2CPIA 3MI7X 1U2FA 2DHSA 1F9FA 3HI9A 4YB1P 1H6KX 3P5TL 1WTBA 2A3JA 1WG4A 2K3KA 1SXLA 2X1GA 2ADCA 4EGLA 2MY7A 2LA4A 1H2VZ 2G1DA 1Q86T 2MMYA 4Y0FA 1X5TA 2KU7A 3B4DA 2OTJS 2OSRA 3B4MA 4LIRA 5GVQA 2MZRA 4PKDB 4F26A 2ZJPQ 3ZZZA 3BO3A 2DNHA 2DITA 2CPDA 2VONA 3UWTA 3MUVP 2DISA 2YWKA 3VAKA 1SJRA 2HGNA 3VAIA 2L41A 4W90B 3R27A 3CXCR 1HL6A 3IWNC 4ERDA 2DNPA 4CH1A 5DM7Q 3Q2TC 5IM0B 2DNNA 2QEXS 2DK2A 1P1TA 4QU7A 2DGVA 4YUDA 1VQNS 1QM9A 1K9MT 2OIHA 1ZH5A 2RQCA 4FXVA 5GADU 1FO1A 1A7GE 2CQ0A 2FHOB 2CQGA 2DGXA 3MD1A 2MKIA 3PIOQ 3G8SA 4WFAQ 3UCUP 2KVIA 2LXIA 2EVZA 2N3OA 2DNOA 5MLCV 1X4GA 1U1KA 3TP2A 2OSQA 4FXWA 2LMIA 3H2UB 2MQOA 1WEZA 3MUTP 1VQMS 4CQ1A 1URNA 4J5OA 1WHYA 3SXLA 2DO0A 5LJ5Y 3VAJA 1H2TZ 3OW2R 2MKHA 2KM8B 3UD3P 1SJFA 2XNQA 5LXYA 3JB9k 2CQIA 2J76E 2M70A 1RK8A 3S6EA 1VQOS 1A9NB 4IOAQ 1H2UX 2M2BA 2LECA 4UY8T 2NLWA 3EGNA 4WF9Q 5EN1A 2MSTA 3NNCA 2X1BA 1VQ8S 1VQPS 3NNHA 2LCWA 1X0FA 2SXLA 5CXTA 2CPXA 5H1SV 4WIIA 3G6ES 2RS8A 2AD9A 4ED5A 3K0JA 2D9OA 2MZSA 2JX2A 2M4MA 3VALA 1FJ7A 2MSSA 2MJUA 2M88A 3CC4S 2DNLA 3DLLQ 5CYJA 2CJKA 1U1QA 4IO9Q 4U67Q 5HO4A 1Q81T 4C7QA 1M5OC 2PE8A 1N88A 1X4BA 3RW7A 2M7SA 3BO2A 3BO4A 3U1MA 1FJEB 2MKJA 1N54B 1FXLA 1KC8T 1Q7YT 1W2BR 2RT3A 3CF5Q 2MHNA 3CCMS 5LXRA 2MKKA 1U1MA 3CPWR 3H2VE 2GO9A 3MUMP 2DGUA 1YJNS 1X4DA 1VC5A 2HZCA 1X4AA 2F9DA 1HD1A 2E44A 4TLQA 2WBRA 3N9UC 2DO4A 1OO0B 1X4FA 1SJ3P 2MGZB 3S8SA 1M5KC 2DIVA 3RW6A 5DM6Q 2AYEA 3V4MA 2CQBA 2J0QD 3IRWP 2HGMA 2CPHA 1U1OA 3CCRS 1KOOA 5IM0A 2MXYA 5CA5A 2M9KA 2FC8A 2MZJA 2MB0B 1HD0A 2RVJA 2U1AA 2L9WA 1L3KA 5IFMA 2FC9A 4IUFA 2RRBA 2E5HA 1WI6A 2PEHA 1X4HA 4W92B 1FT8A 2DNQA 3CCLS 4OZ0A 5GAEU 3NS5A 2MYFA 1X5PA 3CD6S 2LEBA 1OIAA 1OPIA 2MZTA 5GMKa 2KRRA 3FEXB 2ERRA 2UP1A 3CMES 1CVJA 1VQKS 4BS2A 2KFYA 1X5SA 4A8XA 4Y00A 1P27B 1M1KT 2BOPA 5GAGU 1WEXA 4CH0S 1FJCA 1WG5A 2KG0A 2QA4S 1D8ZA 1M5PC 1X4EA 4IOCQ 2FY1A 2G0CA 2EK6A 2MZ1A 2EK1A 5DDPC 4CIOA 2CQHA 3I56S 4WCEQ 2VOOA 1OWXA 2CQPA 1WF0A 3LPYA 1Q82T 3R1LA 1VQ5S 2J0SD 1R8PA 2OTLS 3CCSS 3PIPQ 3EX7B 1N8RT 2LEAA 1PO6A 5LSLA 3CC7S 2Q79A 2JRSA 1YJ9S 4PRFA 2LQ5A 2N7CA 2J8AA 2CQDA 4C0OC 2DGTA 2KHCA 3S01A 2JVRA 1FNXH 4M5DB 4TU8A 1KQSR 5JVHQ 4QU6A 4WFNQ 2DGWA 2KM8C 1YTYA 1VQ9S 2RS2A 3TYTA 1WF1A 1S79A 3NS6A 1VQLS 3CCQS 1NJIT 2DHAA 2E5JA 1YIJS 1VBYA 2AYMA 5D77A 3CCUS 2MKCA 1U6BA 3D2WA 3SDEA 2K8GA 1JJHA 1YITS 4RU2A 2CPJA 2DH8A 3R1HA 3BEGB 3I55S 1B7FA 2M8HA 2KT5A 3MOJB 4TU9A 1RKJA 1DBDA 2MGZA 4Z2XA 5HL7Q 5LJ3Y 1K73T 5DETA 2BZ2A 1VQ4S 1SJ4P 1X4CA 1NU4A 2V94A 3G4SS 5IQQA 4QPTA 2KN4A 2MQLA 3TO8A 1KD1T 2GHPA 1PGZA 2DH9A 1X5OA 1U1LA 1JJ2R 2F9JA 2XS7A 1U1RA 1G2EA 2DNGA 2DGOA 1K8AT 1YWXA 1VQ6S 2XB2D 1SJQA 4WKRA 2VOPA 3NMRA 3ULHA 2MQPA 2MZQA 2ZJQQ 1DRZA 1WEYA 4PR6A 2X1FA 3CCVS 1QVGR 2B0GA 2RRAA 1VC0A 2VODA 1WI8A 2DGQA 2D3OR 2JVOA 5BJRA 3VAFA 3HHNB 2KXHA 2CQ2A 2CPFA 3CCES 2CQ3A 2KXFA 2RNEA 1M90T 4LMZA 2G4BA 3THTA 3ZZYA 1ZZFA 2HVZA 5DDRC 2DB1A 2KG1A 3P49B 2DNKA 1S72S 1WF2A 3MDFA 3VF0B 3UCGA 3FEYB 3VAMA 4OZ1A 1ZZNA 3CTRA 3P3DA 2M0GB 2NZ4A 2N3LA 2LKZA 1N52B 3SMZA 2XNRA 1UP1A 3MD3A 3CMAS 2CQ4A 1VBXA 5LSOA 1D9AA 5DDOC 2ADBA 3DXBA 1U1PA 3VAHA 3SDEB 2KH9A 2CPEA 2LA6A 1BY9A 1UW4A 2DNRA 3U1LA 3UCZP 2CPYA 5JVGQ 2CPZA 3L3CA 3G71S 2LYVA 4V19X 3UD4P 3EGZA 2DNZA 2AYGA 1FHTA 1O0PA 1VQ7S 1AUDA 2I38A 3P6YC 1XN9A 2QFJA 2OJ3A 4YOEA 4F02A 3G96A 2XS2A 2KRBA 2DHXA 2E5IA 2AYBA 2DNMA 3CUNA 1WHVA 3MXHP 3LQVA 1WWHA 2MJNA 2CQ1A 3J7YU 1U1NA
chains in the Genus database with same CATH superfamily
3CDBA 3I87A 3LO3A 3UDVA 2I6WA 2A6OA 3UE2A 4OI0A 3MEDB 2DR8A 2WW8A 2P6SA 3POTB 3HFZB 1VBZA 4IQXA 5E2QA 3LAKA 1TK8A 4N8NA 3JAMY 2XYGB 1MN7A 2B7CB 1Q95G 1YJUA 2HWTA 4P6QA 4LVOP 4C8YA 2KVQE 4ILLA 3QAEA 3FBFA 1RLDA 4MIBA 4A8YA 3V4IA 1IQTA 2QLJB 2NZCA 2O67A 2R3VA 3GR1A 1ZPVA 2BE7D 3DRPA 1WELA 2RQ4A 2E5GA 3AAWB 3M2UB 3T5HA 2R8GA 2H48B 4DPWA 4CRJA 4ECUA 1WG1A 2I2YA 3O2IA 2DIUA 2IVMA 3N6MA 2HPUA 4RWWA 3SBMA 4Q7AA 2UUWA 4CLKA 3J7ZT 4DV1F 4LRAA 1WOPA 1XERA 2MY8A 3L7PA 2HBYB 4OX8A 2R9LA 4OHYA 4UQTA 3QIPA 5E41A 1D9DA 2Y9HA 1PYSB 4QZVB 3VAGA 1C1CB 1B70B 1Q4RA 2RDJA 4CYUA 5CD4A 4O23A 3V4IB 3I5AA 2H3EB 1HLWA 1QJHA 4K5SA 2DNYA 1TTHB 2MKYA 1ELOA 1NXIA 2MQNA 2VV5A 3LPEA 3GG0A 3SSRA 1TUVA 2E66A 1HBNB 4I7FB 1GX5A 2RU3A 2L3MA 4B9LA 1HNIA 1TKTA 2JSXA 1NO8A 2XSJB 4M5MA 1TFYA 3QFWA 3CC2S 4N41A 2AW0A 4UY85 3ZTRA 3J80U 2FB0A 1NKCA 3S7RA 3PO5A 1YJ7A 2YH0A 4ZJQA 4A8KA 2ZJRQ 1ZOTA 2V8PA 2DR7A 1WC1A 1TZ0A 1VC6A 4OI1A 2K1RA 1RHUB 3MM8A 4UQGA 4I6YA 2XS5A 2Q43A 3I32A 4M5GA 1FFWB 3C16A 4ZKAA 3CJ3A 5ITHA 4JI2J 3IS9A 1U6FA 4WFBQ 2M52A 1FESA 2KT2A 2FPHX 4I56A 4B9SA 1CEZA 4M94A 2MQMA 3CCZA 5A0YA 3WHIA 2DHGA 4DPYA 1S4EA 3RBXA 1S1VA 1T95A 4DV7J 4DFPA 4ECZA 5D4LA 3RUBL 2DHSA 2AJFE 2HWIA 4BC9A 5LMUJ 1HNZJ 2HVDA 5IOLA 2ZZMA 5D6GA 2IYIA 4ZVUB 4J9NA 1N34F 4JYAF 1CJVB 1IR1A 3D68A 4NOHA 4PXDA 4NPOA 1S6UA 2OEMA 4BCAA 5M2PA 1Q1KA 3IG1A 4ZVQB 3WIUA 2FZGB 1IN0A 2HHVA 4EGLA 5DJBA 1RYRA 4B3MF 2G1DA 3A8KA 1Q86T 2DR6A 4JI1F 3GYNA 1N33J 2OTJS 2NS1B 4USUA 4K0KF 3B4MA 1FNOA 2F65A 4TY8A 5E33A 1X7VA 2ZJPQ 1RT7A 3ITHB 2YWWA 1F6TA 1CJVA 2AT1B 3I0RB 5EX0A 3HMJG 2EW9A 3BO3A 3SV3A 2E9ZA 1JLQB 3CJKB 3PW5A 2LEPA 2LU1A 4JI4J 2BKPA 1U0SA 2J0XA 4K4TA 1FRLA 3P8BB 4DCPB 4LF6J 4G3IA 1CS4A 4ZVFA 4GKKJ 4XPEA 2Y1LB 4DUYF 2B9YA 1SJRA 4NI2A 1FFSB 3T41A 3DOMB 5EX3A 2ZH5A 3VAKA 1N6QA 1NMEB 3G82B 3GLJA 3OFHA 4PAAA 4U7UK 4Y2KA 3VAIA 2CVIA 4QIFA 1FI4A 2Z2YB 1RAFB 1RP5A 4ZHRB 3M4XA 3IWNC 1CULB 1C2PA 1HWJA 1U2CA 4ENOA 3J7YI 3HVAA 4KQZA 4CH1A 3HFVA 2FLLA 5AXMA 4HT7A 3KK3A 4PUOB 2BQ3A 2YKMB 2VG6A 2OMOA 1RT6B 1EETB 1HI1A 2JJ4D 4NE9C 3KHGA 4ZA1A 5D0GA 2AGQA 2W7AA 3W65A 4DV3J 3MPWA 2ZH2A 2DGVA 2OEJA 3OL6A 3M32A 3BB5A 3H98A 4LF4J 2HHTA 5B0BA 1X0PA 3OUYB 2FVCA 1ZH5A 4F8RA 3TX8A 4FXVA 5HLFA 4O3SA 2ZWPA 2BABA 1URRA 2HBQB 3I5CA 3GG1A 2PIIA 1RHJB 3VGTA 4WFAQ 1RT6A 4QR1A 1VRUB 5ETLA 1C1BA 3JSMB 2OUGA 1RHMB 4YY3J 2DNOA 4DR1J 1RTJB 1DARA 3IAM9 2NSCA 3C8YA 3ONQA 2QC3A 2GS8A 4GVBB 3BGRA 1FVSA 2OSQA 2LMIA 2CJQA 2VH7A 1LWFA 1RI7A 3H2UB 5KFLA 4DL0C 4CQ1A 1VK8A 3D54A 2AWZA 1YLXA 3SXLA 2ATCB 3TQEA 1X9WA 1G1XA 2YX7A 3AOCA 3VAJA 1H2TZ 4Y34A 3LTOA 1OQ6A 1S6PB 3SZ2A 1T03A 1PJ5A 4DV5F 4NEZA 3UD3P 1NJWA 3ETOA 4JI6J 2KFZA 4M5NA 4UZCA 4GMKA 1SJFA 1GMWD 1FCAA 2RKIB 3KNGA 1S49A 1RKIA 4X65F 4X4PA 3F44A 1KEKA 4B3MJ 3ICLA 3PO4A 4DV6J 1FE0A 2FJDB 5KOXA 3IWXA 2WVCA 2M2BA 4H4MA 4UY8T 4X66F 1U1KA 3EGNA 4EBDA 2CKWA 2FYXA 1T05A 4WF9Q 2MSTA 1FKPA 4OYOA 3NNHA 5HAOA 4ZVPB 5EGYA 3OQ2A 1PSDA 3FRZA 2EFOA 3A13A 2Y0BB 2JEGA 2HHSA 2W4PA 1RT7B 4DV7F 4BLGA 2RS8A 2WSFC 3I96A 4HACA 3IBWA 3SV4A 1C0UB 2D9OA 2MZSA 3HHLA 4YB5A 4R8UB 5HMWA 3BSOA 3AJ2A 2CWKA 3CCWA 1V3RA 2E29A 2M88A 3CJTA 4XDDA 5BXIA 1G6BA 2GAGC 3EZOA 3TUPA 2MQ8A 3NGKA 3DLLQ 3KHLA 4DUZJ 3OR2A 4IQMA 2B43A 4P71A 2UUBJ 1M5OC 2XI2A 4IR1A 2QO3A 4F0MA 2FZKB 5L9XA 3GFXA 2VD3A 4OYZA 4TYAA 4K4XA 1X4BA 1IKXB 1ZAVA 1ZS6A 2KYZA 3G82A 4LIWA 3M9MB 2M7SA 1C0UA 3MEEB 4M95A 1WD6A 2QV6A 3ILIA 3OFGA 2M3DA 3MM6B 4U8YA 1FXLA 3O3LA 1Q7YT 5KG1A 4LUBA 1W2BR 4JV5F 1UVIA 1Y7PA 1KQKA 2YNHB 2MHNA 4HLBA 1NKBA 4IOAQ 2MKKA 3NL0A 1B64A 4EYHB 2Z2ZA 3ZNJ1 3UR0A 1RACB 5G0RB 4C97A 2N4DA 1FA0A 4NZ0A 2G2OA 4RNHA 3CE8A 2C3YA 2B7BB 4Q5VA 2C2ZB 3MUMP 3QJPA 3HM9A 3GIMA 3ZFVA 3Q22A 1X4DA 1UCNA 4RW9B 3QATA 1HBOB 4DS5A 1X4AA 3BBCA 3CIZA 2PA3A 4KR0B 1VK3A 4NMXA 5KFDA 3KDNA 3G6XA 1HD1A 3OJUA 4FF2A 4NLPA 4TLQA 3KG4A 5CQGA 1RHQB 1WC3A 2QN6B 4PPZA 5EWFA 3LA0A 4PG7A 5A8KA 4BDPA 2YPZA 2W25A 3PNIA 4USHA 3C6TA 3HVTA 1KSPA 1XR5A 2QFIA 4OI4A 3W8GA 3JQKA 4BHQA 1O8BA 2W7OA 4M5DA 3KOAA 3LP2B 2YKOA 1T02A 4OL8A 1TMJA 4UZBA 4JBCA 4U95A 1Q8KA 2B5JA 4KHPJ 1Q16B 3R8YA 4WFZA 4ES1A 3FSXA 4URGA 5IT9U 2UUCJ 4LFBJ 1UWBA 2W9AA 2PFDA 2HGMA 2QLBB 3R5JB 4CTAB 5J2NA 1U1OA 1GTEA 1KOOA 3F0NA 5IM0A 1X8DA 3D9BA 4K5RA 2NXCA 4WU3A 2DPIA 2ZKUA 2O01C 4DBQA 5HBMB 3R6LB 2FHMA 3GV7B 4ZVTB 2YXLA 2ZVIA 2L9WA 2WHOA 3RB4A 3IBFB 1QSSA 4Q0BB 4ID8A 2HHUA 3AOAA 2C1EB 4FN5A 1BQXA 4QBUA 2BOAA 4LFAF 3QWPA 2DNQA 3CCLS 1EP4B 4JI8F 3M6WA 3SCIE 1HHSA 1HI0P 1ZM4A 1GXUA 3W3SA 2MYFA 2E1RA 3Q24A 3TUJC 4YR0A 3RAQA 1SV5B 4WBFA 3M8QA 2LEBA 2F8MA 2ASYA 1OIAA 2BRKA 3DLKB 3A8IA 2KRRA 2W4CA 2HVEA 4PZVA 4DPTA 5GMKa 1REVA 2DR5A 4DU8A 3EUNA 2JOQA 2VA3A 1CVJA 4WP9A 2ZBPA 1RTHB 4BS2A 2KFYA 1D8YA 1N0VC 4A8XA 5F8JA 1SCJB 1NDLA 4ALZA 3OHAA 2UUAJ 2RU9A 4R5PA 2HLTA 3QO9A 5J2PB 3T5KA 2BOPA 1WDDA 3EVWA 5HATA 1IWAA 2GQ2A 2HFNA 1AFJA 4KGVB 1WG5A 3PYEA 3NGUA 2UZAA 4P10A 4KV8A 1X4EA 2H5JB 1OY8A 2VPXB 3JQJA 1KR4A 2G0CA 5H9FJ 3D1QA 9ATCB 3TZZA 4DR2F 2QA4G 1UA1A 3Q8VA 1NJYA 2EK1A 5DDPC 4NYZA 1EB0A 1I51B 3I56S 1RAAB 2E5LF 2VOOA 2GCFA 2I0XA 3NKYA 4LFCF 1OS5A 3LPYA 4DV4F 3BDPA 1VQ5S 4MIAA 2QLFB 1G4CA 1F2HA 2J6UA 1R8PA 4JI0F 3AODA 2C2OB 2IFXA 1SIZA 3PIPQ 2I9SA 1UWAA 3EX7B 1N8RT 1RGVA 3OPKA 2OFGX 3CC7S 3DRYA 4ZP8A 3GZ7A 2Q79A 2JRSA 2J9EA 2VICA 4ZK7M 2B4UA 3DI6A 1L5UA 2MLZA 2UVVA 4RL1A 2QLXA 2WVEA 4J9KA 1S1XB 2Z56B 4ED2A 1DURA 4DPOA 2JVRA 1FNXH 5F3TA 3G6VA 3C2PA 4M5DB 3G87A 4FYDA 2J9DE 3FFIA 3MCSA 3JS9A 4OX6A 4P73A 4PXBA 1KQSR 2BXJA 5L9NA 4QU6A 3TZWA 4R0EA 4H4OB 4IH7A 1LEOA 4X84A 3MFIA 1CJKB 2KM8C 1YTYA 2RS2A 5IC4B 3NGRA 2B8QA 4OHWA 5D3GB 3DOKB 2V2VA 2R8HA 1Q5VA 2F63A 4TVAB 1NB2A 1RAIB 3A8JA 3PZPA 4L74A 3CCQS 5H9EK 1IUJA 2E5JA 2ZEJA 1KHVA 4O4GB 4B3OB 1VBYA 2BE9B 2ZOGA 2RD5C 2JC1A 1KLMB 3MTJA 5E0OA 1X31C 2RH3A 3DLEB 5KFVA 4EZ9A 1U6BA 3SDEA 3ZZRA 2FQQB 1N6QB 1W26A 3GB0A 4KGMA 1WORA 4DSJA 5JUMA 1RHRB 2IRXA 3BKUA 2WB1D 3LANA 4ILRA 5KG3A 1PYOB 3ZZOA 3V6KA 2J6TA 3H8YA 1TAUA 1OY9A 2DY1A 4X2BA 1CULA 4HTIA 2KT5A 1IKYB 2JLFA 2RUSA 2ZH9A 4C3KA 2GAHC 2YWHA 4PWUA 4Z7YA 3DLKA 3JSBA 1GMWA 5DG8A 1K73T 5DETA 2OD6A 4MYUA 3B6BA 3RU0A 3MAHA 3NBPA 1EZZB 4CLLA 1SJ4P 2VJUA 1D1UA 5IQQA 2ATLA 2MQLA 4DSEA 4M5LA 2GHVC 1IJEB 3CIMA 4DPUA 4WPAA 1EJ7L 4X4VA 2CRLA 2FY8A 4ZIVA 4IRCA 5DQHA 2DH9A 2YKPA 1X5OA 1YGYA 3QFHA 1JJ2R 4O3PA 5CZXA 4X65J 3J7A1 5AE3A 3MMAA 2Y1JA 1WC0A 1RTZA 1DJ0A 1WOOA 1TKDA 5D0HA 2XB2D 3JAMU 1E6VA 2V68A 2VC1A 1DQ8A 2V4JA 3NAHA 4NZ6A 4HDHA 2ZJQQ 2KZZA 4X64J 4YEAA 2DVIA 4KBIA 4PR6A 1CJUA 1HHQA 2QTWA 3CCVS 5DG7A 2X1FA 2QGFB 1FX2A 1N5TA 3MFHA 4IRKA 1QDUB 3NOGA 4MAKA 2VODA 2KTQA 5BJRA 1S7IA 2AMCB 4ZJLA 3HHNB 4K4ZA 2GV1A 2PMHA 2Z2MA 4L6V3 5IXUA 2DRAA 1PJ6A 3FNNA 1TUGB 2IBOA 3CCES 3E01A 2KXFA 2J0QD 3JSRA 3TA0A 5AXKA 3OTDA 5D15A 4WWSA 3KUEA 3DI6B 2IM1A 1V3ZA 4CWBA 1HQEB 1ZZFA 4LF8F 3T3FA 5DQGA 3PW4A 3P49B 2OO4A 4C48A 4G1QB 4DSKA 2F1FA 1HIYA 3MDFA 5ETKA 4N5SA 2W7PA 4FS2A 3QT7A 3UCGA 1AFIA 3CDEA 1ZZNA 3P3DA 3T6JA 1H7XA 2EBGA 4NASA 4NLUA 4OZ2A 3DN9A 3EDQB 4F36A 3IGNA 5GAHI 2W9BB 3PW7A 1N52B 2B4OA 5IZHA 4YHHJ 3PKYA 3RB3A 3TWZA 1RLCL 2K3IA 3SQGB 3GQCA 1FWLA 2KJVA 4DPXA 3M30A 1EHWA 2IDEA 2GVDB 4PEOA 5LOQA 3CMAS 1VIOA 4O44A 5F8NA 3BSAA 1UVJA 1ZAWA 2LFVA 4WE1B 1F5BA 1NSPA 3DXBA 1U1PA 3VAHA 1TKZB 3I9ZA 1TL3B 2YY3A 3MPYA 1F5CA 3MM7A 4ETXA 3PW0A 1J5EF 2CIMA 4J91A 3SDEB 1SH2A 2D41A 5B09A 5DG9A 2KH9A 3MGJA 5DZ6A 1NKEA 2FLPA 3KHRA 3BSCA 3U1LA 4FF4A 1NJZA 2W9BA 2CPYA 1R27B 3BF4A 4LF1A 5KG0A 2ZH6A 1FDDA 4F4AA 4GO7X 1IKYA 2RSQA 4DV2J 4AXIA 1Y5LB 3GE9A 3LP1A 2AYGA 2HHHF 4DX8H 2UXCJ 3DOLA 2R7OA 1O0PA 2AIRB 2F8HA 3NCRA 3TJ8A 1VQ7S 4M63A 2G0IA 2DCUB 2I38A 5C25B 1YRUA 4KFBB 3OJSA 1M5HA 4QIEA 4EFAC 2LQJA 2IRUA 2G0JA 3IAS9 3QRPA 2DXEA 4NLOA 4MH8A 4OYAA 1WHVA 4UUXA 3DRRA 4A4JA 3BJYA 3MXHP 1B0PA 4RW9A 5L1IA 1HPZA 3KNAA 4ZLNA 4PCQA 3Q89A 5T7LA 3DOLB 1R6YA 3TAMB 4F04B 1H73A 5A8WA 4X4QA 2AGOA 5K14A 4LF9F 4NX9A 1K47A 4C3MA 3HKZD 4BWJA 1R8HA 4LR9A 1Y9OA 3RR7A 2VC0A 2J9DA 2C22A 4ZJOA 2NPIA 4KGXB 1HW9A 4K59A 3LWMA 2OAUA 3BYPA 4FP9A 4NA1A 3MR3A 4H4KC 1LXJA 5DLFA 2C2DA 4DUZF 3W2VA 1KS2A 2HK2A 3BH6B 1M5VC 4K4UA 2CNLB 4DV6F 3W1YC 1LW0B 4N77A 3PHTA 4P9SA 3M2RA 3Q83A 2O66A 4O3QA 2LLZA 4ED0A 1RABB 1C4AA 2YNFA 1VR6A 3PRVA 4U6PA 2FIUA 2L08A 4KO0A 2MPUA 1KWMA 2R7RA 2B9WA 5I3UB 5IWAJ 1W2IA 3HT3A 2R8KA 2CZ9A 3OFEA 5KFKA 1Z2ZA 3SIPB 2XLKA 3C66A 3IR7B 2AV5A 2ACMA 5DS7A 5D8HB 1SC6A 1UFLA 1Y11A 3CJ8A 5A8RA 4H54A 3NNAA 2HVHA 4OV1A 2KYXA 4WU2A 4DR5J 2HVIA 5FJ4A 2A2DA 2M8DB 1EAYC 2EKNA 3CJ5A 4BBYA 3PYFA 4IFVA 4MK7A 4JV2A 4MFBA 4KHMA 5KG2A 1Z1ZA 2VG7A 3US5A 5HROB 2WOMB 2XWXA 5BR8J 1I3OB 1NDPA 3M6VA 1S7HA 4ZCIA 2O3DA 2EI5A 4RNOA 2NXUA 4TXSA 4C8KA 4J9OA 2JWNA 1WHXA 2XY7A 3OL9A 1RTHA 4C2MA 4NLXA 3T1YF 4NLVA 3DDIA 2RUGA 4C4WA 5DZ7A 1RT3A 2Y1IA 3PX6A 4DFMA 2N82B 5KFBA 5IC6B 3SI8A 3O8WA 3FBEA 2Q6CA 2AZ1A 2AJ1A 3JSYA 3MOZA 4HT5A 2UXCF 1SQGA 3AOBA 3Q2SC 2EFQA 4DFKA 1SL2A 4LFAJ 1J27A 2XSFA 1IM6A 1RE1B 2DT9A 3D6MB 3GYGA 1KKHA 3PCOB 3UQSA 1LW2A 3DCAA 3H5UA 4LJMA 2CPIA 1KDNA 3AB4B 1Z4UA 3BGOP 4TQSA 2XQCA 1F0XA 2BJ1A 1RT3B 2YKQA 3ISZA 3CJ4A 3MI7X 4HR2A 3R9LA 1U2FA 2BM1A 1FF2A 1SKUB 3MM8B 4L75A 1H6KX 2AX1A 4YB1P 4A8MP 1MNEA 3MMBB 4JI5F 2LU2A 3OVSA 2APOA 5B7WA 2WCXA 3ET6A 1MMDA 2LVWA 3R5BA 4LQ9A 5F8LA 4YR2A 2BM0A 1U8SA 1JWWA 3NEKA 3DU6A 4ZCKA 1VS3A 2MY7A 2DKOB 5C42B 1TL5A 3AXKA 1VCTA 2JHEA 2ILZA 3RTVA 1X5TA 1SH0A 3OR1B 2HAFA 2OSRA 1BUXA 2VKZG 2GMJA 2V6AA 4PKDB 3FFIB 2JL9A 3H0PA 4MKVA 3H5SA 2NR0A 2DNHA 2BJ9A 2GIFA 4NA2A 3M1VA 1R0AA 2ZBRA 1U0HA 2BKNA 2ZDPA 4O3OA 3WIVA 3CDAA 4K4WA 1UW9A 5KG4A 4DDFA 3FCHA 3BZQA 5GMEA 2R8JA 4DN0A 2D7SA 4LR7A 1U8WA 2VONA 3RBDA 3I5BA 4KH1B 4F0HA 1L3UA 1BQMB 2OELA 2GIRA 3R7BB 3AA9A 2PFFB 1M1HA 2HGNA 3I4PA 1N36F 4DQSA 2QX0A 2HNYA 4OLOA 5K8NA 3HVRA 3MECA 5DRKA 2AU0A 2L41A 1DQ9A 4C9DA 2CG8A 2QJ3A 3CDUA 3KJNB 4FBTA 3CXCR 3T5JA 3QMQA 3FSIA 3Q8SB 3VGUA 3D7SB 4A46A 4DV1J 5J1EB 5B0EA 4YS2A 3BSNA 3BM7A 4RW7A 1RYSA 1KLNA 3WZ0A 2C2KB 2XWYA 3OXLA 1QD1A 2VB6A 5IT0A 2RE1A 4DV3F 1UJ5A 4DFJA 4GC6A 3BGLA 3QT8A 3IFEA 3Q2TC 4ETZA 1AROP 1TAQA 4P75A 4P2FA 4QU7A 2WOMA 4NL5A 4EWTA 1A6LA 3ZTSA 2OFHX 1Q8BA 2FZCB 4YUDA 1Y5NB 1K1SA 1QM9A 1RAJA 2HNDB 5D0RA 4YQWA 4DL7A 3KJFB 3GJRB 4IKAA 4QPXA 1LWCA 3DXSX 3HF5A 1A7GE 2CQ0A 2CJYB 3BYRA 4RW7B 5KT4A 3D28A 1NH7A 1JLGB 1GEHA 3E2EA 4X4NA 3FMWA 2ZH8A 2CJAA 3G8SA 1U2RA 1NK7A 1N34J 1RU2A 2G2ZA 2V8HA 1WSRA 3C16B 3UCUP 3TARA 2KVIA 2XHWA 3D0IE 2KL8A 5FIIA 5MLCV 1CBKA 5K8MA 3TW0A 1X4GA 2R2SA 5AJ3J 3J81j 4DSFA 2MQOA 4NRTA 3MUTP 3VVTA 3ADAC 5BR8F 3D6HB 4HHUA 2MLYA 2H54B 2DO0A 3EGVA 1S1VB 3WX8A 3PW2A 2HQDA 2MKHA 3VWSA 4RBUA 1XTZA 1FDNA 3PRDA 2KM8B 2BKOA 5AE1A 3IN5A 1IBLF 1BWEA 3CJ0A 1XWLA 3OXGA 3EXCX 5HVFA 2XNQA 4C6AA 3PEJA 1VI7A 3JB9k 2M70A 2J76E 4KHRA 2VFUA 5ETVA 3L9ZA 3AFGA 4RU9A 2ZH4A 3Q8RB 1S10A 3ET6B 1HYSA 1HWLA 2N4CA 1HNIB 1RTJA 1TKTB 2FJWA 1H2UX 3MCMA 2ZH1A 2LECA 3GSDA 5GADI 1FDBA 2EFNA 1PYTA 4QR0A 4C8MA 1H72C 2BW7A 4P7TA 3NNCA 2X1BA 2WVBA 2XHCA 2OH2A 1VQPS 3KJQB 1FXDA 1X0FA 5H1SV 1KFDA 4WIIA 4ED5A 1KONA 4KH0B 4LRFA 1SKSA 1HYSB 2BJEA 1CC8A 3FJ2A 3IS9B 4A8FA 3PR5B 2MJUA 2QIFA 2VFVA 4CLZA 2BACA 3TJ9A 2UXBJ 4QW8A 3DKDA 5K5MA 3FQLA 5HJYA 5J2MB 5CYJA 1U1QA 4IO9Q 2VBWA 1TK5A 4RNFA 2RB7A 3IRXA 1CS4B 2YPYA 5FLXY 2HWHA 2E7VA 1FEEA 1SL0A 3QJJA 3FBCA 1PILA 3C14B 4V1Ak 4WE1A 2HS4A 2RQMA 5AXLA 2XY6A 4TQRA 3LP0A 3CJQA 3MM5A 4RJVA 4KKOB 2RHQB 1E6YA 1CG2A 2XI3A 4UUWA 3BO2A 3BO4A 4YN3B 1FJEB 2E7XA 3H2LA 2VFTA 5C2CA 1GNKA 3HT0A 2JFKA 2XMUA 3ETMA 4AL5A 3DM2A 2RT3A 3GYXB 5AXNA 3KK3B 3OR2B 4ELUA 1PG5B 4IG0B 4L76A 4DR6F 2HW3A 2IJFA 3W9JA 1C4CA 2PA8D 2EFVA 2XYPB 4PG8A 2FJVA 2Z2LA 2GO9A 5A6WA 4YMEA 3ITHA 2DGUA 3FC9A 1X9MA 3K5PA 1VQ9S 2J0WA 1ROFA 2E7WA 2BVZA 1YKWA 3MM6A 1NBEB 5HLFB 5GAEI 2YVSA 2ZBIA 4O0IA 4RKUC 3IR6B 3LGNA 4OHXA 1ZYQA 4U7UD 4CT8A 1JLGA 1U48A 2W1BA 1F60B 1C1BB 4RX6A 3TJAA 1OO0B 4UF4A 1X4FA 1KQFB 5DQIA 5T7LB 3SYZA 1LWEA 3ZXWA 2MGZB 3S8SA 1SJ3P 1ZM2A 3EGZA 4P52A 4RBTA 2DIVA 5CYQB 2KHDA 3RW6A 5DM6Q 1QE1B 3UI3A 2ROPA 2AYEA 3TVYA 2BANA 4G65A 1SIWB 4ZVHA 5KOWA 2VU5A 1YJTA 2QSWA 1U25A 2BV3A 3TI0A 1NLKL 2HRTA 4TYBA 2CPHA 1HBUB 1HWUA 4F4KA 4R0JA 1VISA 2RKIA 1VFJA 3QGHA 5CA5A 4DV5J 3K5OA 2MZJA 3CCTA 1HD0A 3LW5C 3O44A 3CJ2A 4B3TF 4A48A 2U1AA 4HHJA 1WKLA 4I2PB 3TEHB 3TUIC 5IFMA 5HANA 4J9RA 2ZNZA 3HJVA 4LT6A 1SI9A 4O0NA 3OXFA 1WC4A 1X4HA 2DCLA 4G1IA 4M5HA 3AQOA 4OZLA 1FT8A 5E3RA 3V2UC 4Q44A 1S9EA 2HAIA 2G9OA 2IVYA 3FGVA 4ANEA 1OSCA 4JV1A 2PO4A 4QIWD 3FKBA 1X5PA 1VOMA 1OMSA 1Q8LA 1R89A 1YRXA 1C0TA 4X4TA 2QMXA 2UU9J 2UP1A 3FEXB 2ERRA 1OSDA 2VA2A 2DXFA 2C2NA 2IAJA 4J9UE 4W4MA 1AUSL 2WAQD 3N5BA 3PJWA 3IRXB 2HZAA 1GH8A 2IM3A 1UJ4A 2BX6A 1ZAXA 2V4QA 4C8NA 3UN3A 3ZZPA 5J1PA 3QPIA 3AB2B 1AA1B 1M1KT 2HFUA 4ICLA 3BQ2A 1J5OA 1IXKA 3LP0B 1WEXA 3KLGB 3EXYA 3PKMA 3C6UB 4CH0S 3W66A 2BDPA 4FS1A 3SQOP 1D8ZA 1ZPWX 4K4YA 2IA0A 4H4MB 2ZZTA 1M5PC 2UUCF 1WC5A 2JZ5A 4DF8A 2FY1A 1FTCA 3HHLD 2HKEA 2EK6A 2C3PA 2MZ1A 4RW4B 2VBXA 2W2QP 2YWGA 2A2CA 2RJZA 4Q2LA 2RQKA 2NXJA 1JLCA 1KBRA 2AJ4A 2DXDA 3OTBA 4IG3B 4USKA 4ES2A 2V2ZA 1Q82T 1XQIA 2HFVA 2RAQA 3UDEA 3HP6A 2F7VA 2I5JA 1IVZA 1T3OA 5F0UA 3FEZA 2CZVC 4MJKA 1UPPA 1ZA1B 3Q23A 4IFYA 5M2UA 1VHIA 4ATNA 1MG7A 3LGMA 2VQFJ 1TV6A 1RTDA 3KLFB 4DQQA 4DR1F 2KHCA 4ZLJA 3MF5A 4USIA 4F4YA 5C42A 1N36J 1S59A 2UV8G 2PI5A 1TQLA 5K9FA 1IKXA 1PC4A 2FDNA 1NDCA 2JH3A 3VQSA 2I5JB 4EU0A 5JVHQ 2ZM6F 3KLHA 4WK1A 3QSIA 2Z8QA 4CT9A 2CDRB 4NZ7A 1X9SA 2ALYB 1S0VA 5F9NA 3I0RA 4KGKA 3TYTA 1RWNB 3G6YA 4JB8B 3N5FA 2VJVA 1R43A 1T94A 2BUNA 2RF2A 1JLQA 3BKFA 4UW2A 3CJKA 4RUHA 5IWAF 1S79A 3G86A 1RU1A 2QA2A 2DHAA 1FKOA 1YZ6A 4ID5B 4ZP7A 2EWHA 2JFDA 3HHEA 2W9CB 5KFWA 4HYKA 1GQEA 5D77A 3CCUS 4M5KA 3C15B 2BBEA 1RWWB 4DXLA 3KK2A 2QL7B 1NK0A 2Y3YA 3KMQA 1YITS 1JJHA 3FVYA 3Q8YA 4LF6F 2DH8A 3BH7B 1CC7A 2OPPB 4N8OA 1RWPB 3GTYX 3PR4A 2BR0A 5BYQA 2FGOA 4PQAA 5KT2A 3I55S 2FVPA 2OD4A 4FZVA 5B0FA 1HBMB 3THVA 4K2JA 4TU9A 3D3CJ 1DBDA 4K4VA 1XJWB 1S0NA 3OTOF 4DS4A 3DRPB 1C0TB 3M2UA 4P2SA 2XLJA 2K7KA 5HL7Q 2Z0GA 3K58A 1KLMA 2BZ2A 1REVB 4PABA 4PWDA 1M5SA 2WVDA 4DOZA 4IH6A 3BDEA 1Y4ZB 4CO2A 3G4SS 1Q53A 4QPTA 3HD1A 1U49A 3WC2A 4DR3J 3W63A 3M32B 4ITSA 3B54A 2GFFA 4IOBA 4IR9A 1S99A 1TL1B 1M1GA 3KLGA 2E1CA 4YFUA 1B4SA 3SSSA 1K8AT 1VQ6S 3HK2A 1SJQA 1TL7A 2VFRA 3GJTB 3PG9A 4MTPA 4ZITA 4OI3A 1CJTB 4QIVA 2VOPA 3MM9B 2Q6BA 4I2QB 4DI6A 1JLFB 1RAEB 2HQ3A 3PTWA 5B0AA 3ULHA 1MWYA 2VQEF 1B3TA 1DRZA 3UFCX 4B9TA 1DTTB 4KY3A 2P5VA 4BC7A 1KTQA 5CZVA 4CLTA 4WFYA 4DEZA 4DG1B 2B0GA 1TL1A 3HHDA 1VC0A 1NDKA 5D4OA 4F7VA 1WI8A 3CVKA 4OX7A 2JVOA 4C11A 4AD6A 2WK4A 1SV5A 3D1OA 1T03B 1UVKA 2C2EA 1BWVA 1PC5A 3CB4A 5I3QA 4DF4A 2YWEA 5CYMA 3KJVB 2CZ4A 1P8GA 3MM9A 4B3RF 4C0BA 1E6VB 2VPZB 4TN2A 1VLYA 3UVJB 1IM4A 2FJAB 3ZZYA 3MWBA 1MMNA 2HVZA 4C0HA 1SH3A 5DDRC 2KG1A 1TK0A 2YKNA 1S1XA 5AJ3F 1R3NA 5A2QY 2FVQA 2DNKA 2QMWA 4Q43A 4ECTA 4KIAA 3DLBA 3UN2A 4A8WA 4OZ1A 2A18A 4Y6IA 2M0GB 4HI2A 1JQGA 2NZ4A 2R2TA 1O6XA 3DMJB 4YDXA 1S5ZA 1CJKA 2PMZD 3HHLB 1TVRA 3SMZA 2XNRA 1LWXA 1UP1A 3IG1B 3OL8A 2P6TA 3MD3A 1OY6A 2DTJA 3NRBA 4FYWB 1VBXA 3OT9A 5ADZA 1D9AA 1TKXB 3CO0P 4RBVA 1TELA 4A8SA 2MTLA 1FKOB 4ID5A 2W9CA 2ADBA 4PWWA 1DLOA 4N56A 3GJQB 5HVHA 3K5MA 3IGVA 1S1WB 4UTGA 3UNYA 2VPYB 1FE4A 1S9GB 2VHGA 1JIHA 3UCZP 4NRUA 4PQUB 2VL1A 1EX8A 4Z7CA 3MEEA 5LM7E 1FK9B 1JKHB 3GMGA 3ENVA 3PACA 4WXWA 4IRDA 4IH5A 1UEKA 3EGWB 2GVDA 3UD4P 1HBMA 3BR8A 1LXNA 3C19A 1IR0A 1S4FA 3MPVA 4NYPA 4ZMMA 1FHTA 1XC9A 3J7AN 3TX0A 1IBKJ 2IY5B 4ECVA 1JLEB 1AUDA 1SUQB 2AJ2A 4LQ3A 4TKTA 1S1WA 5SZTA 2OJ3A 3GCWP 4QYZK 4YOEA 4I64A 3G96A 4FXDA 1S9GA 1UMJA 3ILLA 4OI2A 2DHXA 1FTRA 5ETOA 3TZXA 2BEFA 1VIXA 4KYZA 3QIDA 2B9EA 1JLBA 4RW8B 4I6WA 5KFGA 4WYWA 4NLRA 4DR4J 1AB8A 2HBZB 4CO3A 3R7SB 3V6JA 3HSDA 4NLQA 1JXVA 4G1PA 2HBRB 2NREA 4FF3A 2QLWA 3MMAB 4B3SF 3NCPA 3M9NB 1H74A 1D09B 5HI7A 3V5RA 3GFZA 1SVDA 2C2MB 1U7LA 1U1NA 5A8KB 4QWAA 1HWKA 3G9CA 1MMLA 3ENAA 4I2QA 3I82A 4OFZA 3G8TA 2HZVA 1A0OB 3NCQA 1TMMA 3M8RA 2YH1A 3H59A 2B9XA 4TLRA 2GHWA 1YHQS 4RW8A 4DUTA 3CDWA 4J37A 3BBBA 5I42B 2BANB 2RHSB 3Q86A 2WBMA 3QT6A 1S6OA 3TA2A 5EWGA 4FKXA 3H5XA 4CM2A 4C8LA 2P9EA 1KOHA 4ZPWR 2D3O1 4DSLA 4ELTA 4WTYA 3LWLA 4DV0F 4DQRA 4C3LA 3KUHA 4ECSA 4DCJB 1HKAA 1PBAA 2CFXA 5EUHA 1NK9A 2Z4PA 3MURP 1RDRA 4RUCA 2KG0A 4MKAA 4ZDNA 1HQEA 3KYLA 5KFAA 2P9GA 4AFFA 4B02A 3UPFA 4AQYF 1VQYA 2X3GA 2BQRA 4LF7F 1JMTA 2K06A 4OJ3A 1LWFB 2P8IA 3RBZA 2GX8A 1HNXJ 1NUEA 3DYAB 2AP6A 2PGCA 4F25A 4HEA9 5C7PA 4URSA 1DHMA 1RXOB 3QRQA 3J81U 2HMIB 2QL5B 1D0EA 1HMVA 4N7TA 2BRLA 1YJWS 2D9PA 1OJ4A 1N48A 2HYIB 4J7CA 2P2CB 1YI2S 2GVZB 2PN6A 4WK3A 1MWZA 4CO1A 3T5LA 4JI8J 4TU7A 3O5TB 2OLWA 4J9VA 3T1YJ 3DRSB 2XZWA 1BLUA 2DGSA 1KVIA 2VBYA 1EKSA 3V6DB 1TKXA 2UV8A 3D5MA 3LUYA 3M8PB 3THPA 5KFOA 4ED3A 1JJ4A 1FKAF 1PAEX 1FKPB 3T9NA 1J2VA 2HRUA 1PKUA 2ILYA 1FX4A 2VG5A 4NLSA 1UTAA 2G1HA 5F41A 1UAWA 4F3OA 4NCBA 2QL9B 3AHPA 4OZJA 2HHXA 4RW6A 2B8PA 2LDIA 3CCJS 4B9MA 2QZ8A 2V8GA 3E01B 3M2VB 2GVZA 2BMBA 3HJFA 3D4JA 1SL1A 2IA6A 3BGUA 1N32F 1KN6A 5ETRA 3RB0A 3FCWA 3LP1B 2HGLA 1LKZA 4I69A 1FNMA 5GAHU 4NXNJ 3GIRA 2CQCA 5KG6A 3SCLE 2EC0A 1JLEA 2QYGA 4F0KA 5C25A 4GC7A 3QLHB 1P9QC 1NZ8A 1TP7A 2OPRB 5CAAA 3DLGB 4RZRA 4X4OA 2ZBQA 5F8HA 1NB7A 1ZM3A 2ZVSA 4IG3A 4OZ5A 1VBKA 2R2UA 3T19A 2ZE2A 3V81A 1QAXA 1JXEA 3P5TL 1VHFA 3A12A 5E3CA 5E5NA 1WTBA 3DRRB 5JMNA 1WG4A 4LRBA 2ZH3A 2OKQA 2X1GA 1HR0F 1ACMB 4DR7F 1U02A 1H2VZ 2ZC3A 4EBCA 1RWUA 1RTDB 2H5IB 2UXDF 1BGXT 1GMUA 3F73A 2KU7A 5HP1A 3B4DA 4PPDA 1N5YA 2AF6A 2AJ0A 3OFFA 4HDGA 2BQUA 3SCJE 2NYHA 4LIRA 5GVQA 2MZRA 4U96A 4DHVA 1BE4A 1NPRA 4AXJA 4F26A 4NLDA 3ZZZA 4WYLA 4RNNA 3K8VA 2AQ4A 1YZ7A 5DO2A 3W7BA 3KLVA 2NPFA 3I4HX 1ITPA 3K57A 3HHKA 3M8SA 4JI3J 1VQSA 2NXEA 4R25A 7FDRA 5CCLA 3OTOJ 2C2RA 3AJ1A 2WZ1A 2W4DA 4OYMA 2WTFA 3NOCA 5LMNF 2DR9A 4KO0B 3MMCA 3KLIB 5GAGI 3C6TB 2CG4A 3HVTB 1V9OA 3R5AA 1GFWB 5L46A 1T8EA 2L9NA 5L8RC 1OPZA 1Y10A 2XZDB 3EE3A 1NK5A 4YR3A 1SPBP 1UETA 2ROEA 2VQFF 2ZBCA 3U1NA 3CEDA 4KB7A 5C24B 1R8AA 2ABYA 2DNPA 4E8UA 5DM7Q 2KZMA 2MHEA 2IVFB 3IO1A 3PX4A 1WTFA 2HMIA 1RTIB 4OYXA 1R8CA 2UVWA 1UKUA 3UW1A 4ZP6A 3TA1A 5IM0B 3OHBA 4JI5J 4MFBB 2DNNA 4BWMA 1P1TA 1XEZA 2F4FA 1RWOB 1PCAA 4DV0J 2AGPA 3DRSA 4I1TA 1SJ1A 4A8QA 2XMVA 2CJ9A 1TL4A 2WRMA 3MEKA 2RQCA 1FO1A 4WIQA 3EDRB 3UNGC 2ASDA 1LW0A 4OX9J 2FHOB 2CWXA 2CQGA 4J9SA 1EP4A 4F4ZA 4MK8A 3MD1A 1ZTWA 1Q8IA 5B0GA 3SEOA 1MW7A 1HI8A 1UJ6A 3H4BA 3VCDA 2ZDOA 2EVZA 5HQMA 1RQ0A 3NG8A 2N3OA 1LK7A 1HHTP 1YK9A 4OZ3A 3TP2A 3IP0A 3VGVA 4LF8J 1S97A 1JXLA 1JLFA 4FDFA 2HNDA 6FDRA 1C1CA 1WHYA 5LJ5Y 5A8RB 2YNIB 1BC6A 2V9KA 3HX9A 3OW2R 1IQZA 2D1CA 2HS3A 2HLUA 4HH1A 1FDAA 4R5PB 2AHOB 1QUPA 4DG1A 1K0TA 2KKHA 1DTQB 2CQIA 2EKYA 1RK8A 3D67A 4ZVSB 4DZ6A 1VQOS 1KRPA 1A9NB 3VVUA 1R31A 1VDHA 3JXOA 2JLEA 4DSIA 5RUBA 3VQTA 2FJXA 5IT4A 3U02A 3WC0A 2WONB 3W8PA 3LAMA 4ZLLA 5I4MA 1VQ8S 3IR5B 2D74B 1O5JA 2SXLA 3FK4A 5KFYA 1RT2A 1NRKA 4KSEB 2CPXA 5HMYA 2Z58B 3G6ES 5CXTA 2ZC4A 1DTQA 1FRXA 2Q3PA 2JX2A 3K5NA 1FJ7A 3SCKE 3ILJA 4ED8A 3R2DJ 5IT9Y 1UVMA 2VUGA 2UUBF 1NSQA 1HQ2A 3CC4S 2KB2A 5F8GA 2HHHJ 2DJWA 3QRRA 1TVRB 2AJQA 4NXMF 4FVCA 1T9WA 3D6FB 3PJXA 4MIWA 5L1KA 5HO4A 3RB6A 1XMOJ 4DL5A 1Q81T 4O44B 1BQMA 1G7CB 2BJ8A 4LRCA 4Y2CA 3NMAA 4ILMA 2R4FA 5E7OB 2V9WA 2PE8A 1ICEB 3F56A 3L7UA 1N88A 2GGPB 4L72B 5LMUF 3MMBA 4GRSA 2HNYB 4PXEA 3RW7A 2OPSA 5LMNJ 1TL3A 2F8EX 3R5GA 2QYCA 1P9YA 2LXFA 1RA7A 2MKJA 4LSNA 3MR5A 3A4TA 2R2RA 4KC5A 1JKHA 4L3KA 5IQ6A 1S9FA 1RTIA 3T1AA 3CCMS 1S0OA 3DOKA 3W9IA 3NGSA 1U1MA 3OR1A 4PG5A 3HLUA 8AT1B 4DJBA 1N33F 5BYRA 1SC4B 3H2VE 4Q2MA 4B3OA 2J8SA 4C98A 5KT7A 1SUQA 2H4YB 3MM5B 1I1GA 2XULA 3A1YG 4OX9F 5KT3A 3BV8A 3DLEA 1AZSB 2ZH7A 4FPIA 1VC5A 3GWCA 1HQUB 1LWCB 1F9HA 2HEKA 2HZCA 2YQ0A 3GSIA 1U0HB 2XZTB 4ECQA 3DM2B 4EI2A 3OTCA 5HK4A 3ZO7A 3T1HF 3R6GB 4O4RA 3JTOA 1HPZB 2H5EA 2Q1LA 3N9UC 2DO4A 4NCGA 2GZOA 3PY8A 1F5AA 2WW4A 4ELVA 3C46A 3MEDA 3HXMA 3DOMA 3QZ7A 3J81Y 1MWQA 1BMQB 4USVA 3JQMA 2Q66A 3CNQP 4RR5A 3TAQA 3PDNA 1TFWA 3HSGA 4ZHRA 4RPFA 4WZQA 4CNYA 4LBIA 2CDQA 2YNIA 3N6NA 2ZFHA 3V4MA 2IC3B 1HW8A 2FTRA 4OJHA 4X62J 2E1AA 3GR0A 1G3OA 4AUKA 5KFPA 1BD6A 4B9UA 2NSBA 4B9NA 4USWA 4NEYA 4Y2MA 4MMOA 4QWEA 2MXYA 4EUVA 4IDKB 3RAXA 1KNZA 3M8YA 1HNZF 4CCHA 4P72A 4DU7A 3OVBA 3GPAA 4LBPA 2MB0B 4LFCJ 4DL4A 2PT0A 3TAPA 1R8BA 1L3KA 3QIPB 1V5IB 2H65B 1WC6A 4IUFA 4EMDA 3HULA 2E5HA 1WI6A 2V4JB 2PEHA 3HVWA 3KXDA 2IC3A 4ECWA 5M2RA 4ZLPA 1RT4B 4OZ0A 5GAEU 1HBUA 1I5OB 2IM2A 3NS5A 1YG0A 3U27A 3U7JA 4IDKA 4J9QA 3WX4A 2G13A 3CD6S 2MZTA 5HQLA 3B8HA 1GXLA 4TY9A 4QCLA 2CA9A 2XLIA 1EKRA 1GT8A 2J7UA 4PYDA 2IRYA 1VQKS 4HHHA 3KDOA 4EBEA 3UDCA 4ZIWA 3D6TB 3EJMA 3NAIA 4JI1J 1QAYA 1LNQA 2XMTA 3AXMA 3FMBA 2HFZA 1D3WA 1P27B 2B6AB 2OPQA 3QNWB 5KFIA 4K8RA 3P45B 4QIGA 1NEEA 1KP6A 3A8EA 1QTMA 1XMBA 1EARA 2E9RX 1FJCA 5U47A 3HSJA 3MMJA 2W24A 3AD8C 3EMTA 4ZN3A 2XM3A 4CP5A 4RW6B 3VHQA 3R7NB 3RBEA 1ZETA 4U8VA 1UVLA 4LF5F 2ZZNA 2YX4A 4OIXA 1SBRA 2O1PA 5A0YB 2HSEB 2L48A 1RB0A 2VASA 1FWPA 3K89A 3ZZUA 1JX4A 2UXBF 4F2SA 3HZGA 3QBCA 4XDCA 4ZCLA 1NK4A 4WCEQ 2FVRA 3V6HA 1OWXA 1J5OB 1YBAA 1WF0A 1XBWA 2CQPA 3QAUA 5DLGA 4B3TJ 2F4VF 3QLHA 3R1LA 1AW0A 3PRBA 4Q8FA 4ZPCA 2E5LJ 3ZNUA 2OTLS 2IJNA 5DGBA 1HQUA 3W60A 4RUAA 1PO6A 5LSLA 5J2MA 4K50A 1Y3JA 1YJ9S 5L1JA 2CNNB 2DHHA 2N7CA 2IPOB 2J8AA 1VJWA 2V2KA 4QR2A 2CQDA 2DGTA 1N32J 4USJC 2ZD1B 3S01A 3D0HE 4M8LA 2JEFA 2AEFA 2ASLA 4DX6A 2ZITA 4C8ZA 4KPCA 1S1UB 4XAKA 4TU8A 3ZZ0A 5CYQA 1YDLA 3CT9A 1IBLJ 2KJWA 3DHXA 3MAQA 1BQNB 1Q7LB 3QWUA 3PEHA 4CM0A 2D69A 2Y1RI 1RT5A 4LR8A 1XMQF 3QYYA 3HDSA 3TR5A 2XMWA 1WF1A 2YX1A 4L73A 2GMLA 3EM1A 3M7VA 4QWCA 1B99A 3NS6A 3JYTA 4ED6A 5EHHA 1VQLS 2W2NP 2NYIA 2YBVA 1YIJS 2AYMA 2J6SA 1S6QA 2ZHBA 2CVEA 3D2WA 2K8GA 1WACA 4U9RA 3PVXA 1QSYA 3HKWA 1JNZB 1BQNA 1HNVB 1PBUA 1OQ3A 2JNJA 2UUAF 2A6MA 3PFOA 3MECB 3BEGB 4DR7J 4NMLA 3HPOA 1VRTB 4GO5X 1B7FA 1RT4A 2M8HA 3SFUA 3W2WB 3TZYA 2VG6B 3QGGA 5KFSA 4F2RA 1RKJA 4JI0J 5KFZA 1DQAA 2COLA 1YQHA 3HO1A 1GMVA 1HFEL 4OYWA 5LJ3Y 1UEVA 3OBIA 1S6QB 1S1TB 2CAJA 4LSZB 1X4CA 5E3QA 3D3BJ 1HARA 2KN4A 2B5JB 2IM0A 4HVZA 3TO8A 2GHPA 9RUBA 1IKVB 3P5BP 1LV5A 4KHPF 5KFMA 5J1NA 2JDJA 4ZPVR 3CGIA 2HFOA 4WJBA 1HNXF 4J9MA 1FJGJ 1YRTA 4OQJA 3TRGA 2DNGA 2DGOA 1YWXA 4J9LA 4J9PA 5HBMA 2KT3A 2V69A 4WKRA 2JC0A 3VZIA 1T9YA 4IFVB 3CD7A 2VDHA 4I2PA 2XMMA 2PDAA 4ES3A 3OSPA 4I4BA 3D1HA 2OP5A 3HD2A 2MZQA 4AE5A 1WEYA 1S6PA 3FDSA 3RG6A 1WDTA 3N01A 1QVGR 4Q45A 3QJLA 1Y5IB 3TVKA 4F4XA 2RRAA 4WP8A 3EVOA 3ZTQA 2D3OR 3KTQA 2D3UA 2OMLA 4OHVA 3ISNC 2KXHA 3VAFA 4CI0B 1NJXA 3M05A 3O1LA 2UXDJ 2ZUAA 4KGZB 2VF3A 2CPFA 4X62F 2CQ3A 2RNEA 4DCOB 1M90T 1MU2B 1VLOA 3MR2A 1SQFA 1T05B 2G4BA 3TEGA 3THTA 1MLAA 5A6PA 4ECXA 3RJMB 4LF2A 4DR3F 1ZM9A 4AL7A 3JYTB 3TQ1A 1EQMA 1S72S 5F9LA 3AA8A 4FNIA 3VAMA 3LF0A 4CYUB 1S57A 3BKTA 4C11B 2J7WA 4ZPDA 5F8MA 4B17A 2R8IA 3OUYA 2CXEA 2ZKTA 1RT2B 1FD8A 2R7TA 1UPMB 4KV8B 1QY7A 1RCXB 1MU2A 1RWKB 3WQPA 1FD2A 3TOQA 4DR2J 2PI4A 3UN5A 2CQ4A 5AT1B 2I8EA 1JLCB 3GIJA 1KVKA 3VV2B 4A47A 4KT0C 2ALZA 5DDOC 3Q8PB 1WNEA 3CO9A 3WDOA 3O6QA 1H38A 8ATCB 1L3VA 1F9EB 5ETNA 2XYHB 5KFTA 3ZC4A 2UVUA 1N4LA 2CPEA 2VKRA 1FVQA 3CMQA 1VGYA 2GGPA 2HQFA 1HNVA 1BY9A 2LA6A 3I0SB 1FRKA 1V5VA 5ETMA 4KKOA 4IFYB 4OHZA 3L3CA 1PAUB 1TV6B 4YB6A 5KTQA 3G71S 2LYVA 3W2WA 3T1HJ 5C2GA 2GNKA 3GILA 4QYRA 2UU9F 6AT1B 2F40A 2DNZA 1Z2LA 1SC3B 3BPSP 1WOSA 3I31A 3ELHA 1RBOB 1XIQA 1T9TA 3FRYA 3MEGA 2XG8A 4GKJJ 2L9DA 2XMAA 1U45A 2ZOMA 1XN9A 2FUG9 4W98A 2W01A 1NSAA 3KLHB 2XS2A 3K7RA 4F3MA 4F02A 1JNRB 2A10A 2DNMA 5HMZA 2AEMA 4KE5A 1FRIA 4CO5A 3B82A 3M6UA 4IO1A 1JJCB 1FK9A 2AX0A 4WKYA 1T3NA 1AZSA 5D3GA 1WWHA 2BJ3A 4JV5J 4DLEA 1Q5YA 3R97A 3IM8A 3T9ZA 3J7YU 1B0TA 1SB6A 4JI7F 2YNGA 2PD1A 4O4GA 1MN9A 3I9V9 1EETA 2H1YA 2U2FA 3C15A 1N5QA 3KK2B 2JEIA 1LWEB 1HNWJ 2WSEC 5L39A 2OPPA 3EYZA 1NZAA 3GV5B 2UVRA 4CLWA 1QAIA 4KPYA 3NWGA 4QWBA 4NXMJ 3AH6A 3HZEA 2GJ2A 2GIQA 2CJXB 4DN9A 3QGIA 2VQEJ 4LREA 3K8WA 4NCAA 2BE2B 2ZUGA 1NHUA 2H4WB 3E3XA 5C5JA 2XGPA 2X1AA 1KVJA 3W62A 2KI2A 3R5CA 4QQBA 3KHHA 5THWA 2F3JA 3PV8A 4FNHA 5CYMB 3KJVA 3ILOA 5GMDA 2GW8A 3KK1B 2LXUA 5KT5A 1Y00A 4WZMA 3KFWX 1WHWA 2MKSA 2MQQA 3A3NB 2YKNB 4DR4F 3IMQJ 5DDQC 1DFDA 1AYEA 5L38A 2AZ3A 2DH7A 1R0BG 4HKQA 3T6BA 1NK6A 2YTCA 2XCPA 1J5EJ 2R7QA 3PM9A 2YKAA 2BE2A 4I6AA 1NHKL 5B0DA 4PUOA 2VIHA 1DZ5A 2V8DA 4RO0A 2XEXA 4ECRA 5H9FK 4M5JA 2E1MC 2V8VA 1SQEA 5FD1A 5KFUA 3OV7A 3FCVA 2GQQA 3IC1A 3KK1A 4Q8EA 2Y0SD 4DV2F 1QVFR 1RJJA 5D78A 4JP8A 3W5ZA 1U4BA 1UFWA 4OJGA 4PG6A 3R3TA 4JUZA 4Y65A 2KXNB 2RILA 4LVNP 4OYIA 2DD8S 3CULA 3MCNA 5FDLA 4K0KJ 2HURA 4UOHA 4ICLB 2XGQA 4PQUA 1VRUA 2FD2A 4H4KA 1HA1A 3C6UA 4HACB 2BA9A 1U26A 2HS0A 4EK2A 4NXNF 4B3RJ 2V63A 2E1PA 1K1QA 3BS9A 2QMUB 3P4UB 2FJEB 4FVMA 3AD7C 3LALA 2RDDA 3BGRB 4AQYJ 1T11A 2LQ8A 3P96A 4G1QA 4JI2F 3M8PA 2ACYA 4NLGA 2R7VA 4CZCA 5FDLB 3C14A 1L3SA 1F9FA 1RBAA 3HI9A 1S77D 2C3OA 1UVNA 3H42A 1JB0C 4OV6A 1U6ZA 3TUZC 3H7HB 2A3JA 4LRDA 3ZTOA 3Q0AA 2NUUG 1WJ9A 3SQGA 1KFSA 2K3KA 1SXLA 2ADCA 4USMA 2LA4A 4LF5J 4LSLA 4D3GA 1XNQF 2YNGB 5JJBA 1XK8A 4IG0A 2MMYA 5LSRA 4Y0FA 3PYDA 1R7IA 3EPGA 1NM2A 1W7WA 3GCXP 4H4OA 5IV4A 1U47A 2EG2A 5FLXU 4WFXA 4ED7A 3VZHA 4HH0A 2RIJA 1GK8A 2DEJA 2X3DA 2F5GA 2G2YA 3M8ZA 4RUBA 3RAMA 7AT1B 1I94J 3N28A 5I42A 1QTNB 1VRQC 2XO7A 3X3UA 2QG9B 3PJ9A 1R6VA 2AEJA 4RWXA 1CLFA 1U24A 2DITA 3MPUB 5J2QB 3IM9A 3H40A 2CPDA 4FYXB 3Q8QB 2YKMA 1NNDA 3MAAB 3UWTA 2F4VJ 4FYYB 3H90A 3MUVP 2DISA 3NLCA 2WB4A 2YWKA 3ISND 2HG4A 1XMOF 5KFJA 2B51A 1RBLA 3CSKA 4JOUA 5B0CA 4GKKF 4XO0A 2C42A 2IYGA 4NYOA 1EQ0A 4W90B 3R27A 1QE1A 1RA6A 1HL6A 5E3AA 2HQCA 3KLEA 1B7YB 5ETTA 4ERDA 1Q78A 3N4WA 4CLUA 1VRTA 5HMXA 1Y0HA 4JV0A 3IWLA 3TAMA 4ZVEA 5A8WB 1XNRF 3UD5A 4CO0A 3MAAA 1JK9B 2X51A 4QJVA 1YBTA 2GO8A 1S76D 4U7CA 2QEXS 2DK2A 3JSMA 1VMBA 2QA1A 1FERA 3DDNA 4NWBA 4PWDB 1SC1B 1ZBTA 5CD4H 4CLPA 5ETPA 1VQNS 1RT1A 1RAOA 2J5AA 1K9MT 2OIHA 2CADA 5KFQA 5GADU 1HBOA 2QT7A 4ZPAA 1LFPA 1NPKA 4L3NA 4LF7J 3K0JA 2CNOB 1H98A 1LK5A 1RWVB 2DGXA 3KG0A 5KT6A 2MKIA 3PIOQ 1UFKA 1RAGB 3M2VA 3RYLA 1F2GA 4ZN1A 2DRDA 2LXIA 3M8QB 2FHJD 5I3UA 1CPZA 4OMFG 2PC6A 4NA3A 1CJTA 4FXWA 2HHQA 2IAJB 3MZIA 3UR3C 1WEZA 2W8LA 1VQMS 3HSZA 2V2QA 3IA0A 4HI1A 4J5OA 3W5XA 6FD1A 2XO6A 1P6TA 1PJ7A 1XR7A 3QT5A 2R7XA 2XBPA 2W2MP 2FGCA 1CQNA 1DTTA 2OPRA 4MT1A 2EPIA 2XMJA 3X1LB 1BHNA 1IBMJ 3IBCB 2D3ZA 5LXYA 2LQBA 5EWEA 3ZZTA 3S6EA 4DLGA 3DGPA 3OL7A 7FD1A 1NK8A 3UDLA 1XNQJ 3RGIA 2GC8A 3M6XA 4JI6F 4OYBA 2RRNA 3H20A 5G4DA 1NCLA 4E0DA 2NLWA 2DBBA 3V6DA 2Z30B 4LSLB 1MROB 2XTJP 3WBZA 1NAQA 4X4SA 4FKYA 5EN1A 4RW4A 5KAKA 2VG5B 1XMQJ 3L4BC 1RADB 1T7PA 2LCWA 1YJRA 1RUSA 1N5VA 4QOTA 2J9CA 1ZA2B 2GQCA 1XR6A 3GJSB 3DLHA 1T9VA 2AD9A 3DU5A 3GIKA 3CD0A 2POKA 3VALA 3DGPB 2IHR1 2M4MA 4B08A 2V4RA 1S48A 2JLGA 2MSSA 4P2MA 4XTTA 3NXZA 3CD5A 4DMZA 1VJQA 5K8PA 3N6LA 2DNLA 5HQ8A 1GTHA 1MROA 3W5YA 1JLAB 2WONA 1L3TA 2CJKA 3KLFA 4U67Q 3F41A 1LW2B 1K0VA 4CDIA 4C7QA 4MKYA 4MKBA 3KLIA 1CSJA 2PSZA 3DLGA 2A0FB 3TANA 4C8OA 2O5DA 3JTPA 5G0RA 1IWGA 4DL3A 1QSLA 4F4WA 2ZE2B 2QRRA 4J90A 2YQ3A 2V0NA 1NSKL 5KFEA 1I6JA 2FVSA 1FFGB 2AKWB 4CLFA 3U1MA 3I0SA 2XCAA 1N54B 2VZ9A 4PXCA 3EPIA 1KC8T 4MYTA 4LFBF 2BYCA 4ANDA 1T9UA 3OVAA 1JLAA 4ED4A 3CF5Q 5LXRA 2RF2B 2H9ZA 1RWMB 3EVMA 5KFCA 4KFBA 3CPWR 5HP1B 1LFWA 1YJVA 3TNVA 3KUGA 1T9XA 3FZBA 2BJDA 4GVLA 5F3ZA 5HVGA 2OGUA 2VDIA 1K44A 4AYBD 3QGPA 2HRYA 1YJNS 1RCOB 1RT1B 2WVFA 2HQIA 5KFRA 5MAOA 3LGHA 2IIHA 2W8KA 1JLBB 2F9DA 3QSYB 2E44A 1UWBB 3R2CJ 5LT5A 3N79A 2NUHA 2OEKA 1H0HB 2WBRA 4NLTA 4ZVOB 5J2NB 4CTAA 4YY3F 3GV8B 1URNA 1RAHB 3MMCB 1HNWF 3M8WA 1XNRJ 1M5KC 2RMLA 2UUTA 1P1LA 3BREA 4D3HA 5L1LA 3S1TA 4KRWA 4OZNA 4UOFA 3H5YA 5HN0A 1B0VA 1ULRA 3NBPB 4P2XA 1REGX 3OLAA 3TVZA 1KQGB 2VBZA 3MTKA 1IJFB 2VFSA 2J7KA 2CQBA 1KHWA 4CO4A 3G8QA 1UEUA 3MPDA 4FYVB 2YQ1A 5D4NA 4E98A 3IRWP 1RZMA 3CCRS 2W2OP 3EICA 1IBMF 1V6HA 3AD9C 3EZ5A 2M9KA 3HFKA 4FPRA 2FC8A 3KKFA 1CQMA 1TL7B 4LBHA 3BR9A 5CH7B 4I68A 2RVJA 1RISA 4DV4J 3L09A 2XY5A 1BXNA 4B9VA 3NY0A 3M9OB 2QA4S 2FC9A 5T41A 4DQPA 2RRBA 4N47A 4KJIA 3CMES 4W92B 4F67A 4K7QA 1CJUB 4OLPA 5K8OA 2V67A 3QO9B 5CABA 4URQU 3OSNA 4DUYJ 5J2PA 4AT1B 3J80Y 3LH2S 2VG7B 1X60A 3SSQA 4YB7A 2OHDA 1OPIA 2XSJA 1YBUA 3BQ0A 4ZVRB 4X64F 1FWKA 4X4RA 4K4SA 3UVJA 1X5SA 3PYGA 4Y2AA 5IV3A 4ANCA 2Y8WA 3MR7A 4EO6A 4Y00A 3NP5A 2K2PA 2GJIA 1WUUA 4ZVGA 2MDAA 4P74A 4A8OA 3OLBA 3SFGA 5GAGU 2QSFA 3DFEA 2IMWP 2B4PA 3BN7A 5ETSA 4CLYA 4EEYA 3FQKA 1FJGF 4GKJF 3RZAA 3DMJA 1IBCB 4UOGA 4LSNB 5D0EA 1R0CB 4OYPA 5LL6d 5B08A 2DY9A 4WTOB 4DX7A 2H51B 4IOCQ 1HR0J 2EFPA 2HK3A 4N76A 3LOUA 3M30B 4CIOA 1TUWA 2CQHA 3A3OB 2X7IA 3AY0A 2B6AA 2OPQB 2JEJA 1DLOB 2Y8YA 5T14A 1MSWD 3DNCA 4YDDB 1S12A 3MM7B 2J0SD 1F3FA 3CCSS 3W61A 2LEAA 4JI4F 2CNKB 2MLXA 3IXQA 3V81B 4QYZJ 5EDWA 2KFNA 2C3UA 1F1BB 3CJSA 4TNOA 1RWXB 4PRFA 2EEYA 2LQ5A 4ER8A 1DY3A 3I6PA 2EBEA 4Q0BA 3J7Z5 1TR0A 3DHWC 2C28A 1W25A 4C0OC 4F50A 1PIEA 2A1BA 3VR1A 4IYQA 2DEIA 4TY8B 4AL6A 1OYEA 3FBBA 1Y3KA 2QE5A 2PMWA 3DC2A 1N5YB 3A3PB 2V50A 3KG1A 4JI7J 4JI3F 1D9FA 3B78A 3GFYA 4WFNQ 1N56A 2DGWA 2K7JA 3CW2C 3M1VB 3PX0A 1R0AB 1EIYB 4LF4F 4OJ1A 4KTQA 2FHJA 2B4VA 4ZS6A 2FLOA 5HJXA 3KMSA 4ECYA 1WSVA 2FLNA 3FUYA 4O3RA 2CUYA 2HNZA 1IR2A 4M5IA 5D4PA 1GXTA 4P7VA 2GJFA 4NI2B 4Y2IA 3MR6A 4HTJA 5J2QA 5K20B 1NJIT 4DWIA 1S1UA 3RRHA 2EG1A 1IKWA 2CJBA 2MKCA 3NS7B 3PHEA 2B56A 4RU2A 2CPJA 3NWRA 2ZHAA 2E9TA 3R1HA 3MCOA 4OI6A 4DZDA 2HQGA 4KAIA 3FZ2A 2EFGA 4YHHF 1AT1B 4ED1A 2BJ7A 4FF1A 3KLEB 5C24A 2HNZB 5BYSA 4XIUA 2B3TB 2IDLA 3MOJB 5A2QU 4NCGB 4ZP9A 2I1RA 2N7YA 2C3MA 2V5HG 1FXRA 3M2RB 3N0VA 1UL3A 3PFEA 3R5DA 1GX6A 1Q79A 4Z2XA 4UT4A 3BN4A 2MGZA 3QQCD 3K5LA 3BQ1A 2PEBA 4I0WA 4F3QA 1IKWB 3EZUA 1SKRA 3H4DA 5HROA 1VQ4S 3BGFA 1NU4A 2V94A 3UO0A 3L7OA 1DAXA 2HHWA 1YX2A 1KD1T 1FRHA 1V3SA 4V19J 3DLJA 1NPPA 4X66J 1HWIA 1VYAA 1AXQA 2LQ9A 1PGZA 4USTA 3H25A 2M5YA 4S0MA 4WXOA 1U1LA 3ENQA 2F9JA 3DYAA 4E2FB 1U1RA 2XS7A 1G2EA 3RRGA 3OD2A 2EC2A 4O3NA 4G6VB 4CH7A 1OYDA 1UZDA 1HMVB 5JXSA 4GVBA 2WSCC 3DGVA 5HSPA 4QWDA 1O51A 4R8UA 3NMRA 1LOUA 2R7WA 3POTA 3RR8A 2R7SA 5DGAA 2CYYA 3Q8UA 2MQPA 1IKVA 1KTVA 4CNZA 5KFFA 4JYAJ 1S9EB 2ROGA 3HHLC 1FEHA 2HFSA 3AJDA 1LQ9A 3GP9A 3W2VB 4DL6A 1T0TV 5CHCB 5CCMA 4WP3A 2NQPA 2ZM6J 3E8OA 2DGQA 1M0SA 1N5SA 4XK8C 2CQ2A 5ETQA 2IBKA 2KDOA 4YP3A 4LF9J 5A76A 4PYAA 2MEWA 4LMZA 2XC9A 3GONA 1I94F 2FJBB 4RNMA 2FHKA 3NGTA 3NGDA 1FRMA 3PXGa 3BPDA 4RLEA 4MK9A 2DB1A 2ZD1A 2LDYA 8RUCA 1NH8A 4I67A 1YVFA 1WF2A 2OI2A 4ZPTR 3D66A 2R42A 2RDIA 3FEYB 3VF0B 1N0UA 3K2YA 5KFNA 1NHVA 1TKZA 1S0MA 2W2PP 3CTRA 2ZHOA 4DX5A 3BBFA 4M1KA 4UOCA 5KFHA 3E51A 3CWJA 3RRKA 3D0GE 4DL2A 2N3LA 1RT5B 1RHKB 1QUVA 1YSJA 2LKZA 3AQPA 4HL9A 3VGSA 1F3VA 1HBNA 4I7FA 3VTIA 5H9EJ 2DRBA 3K17A 3K59A 2GA7A 3GIIA 2Z57B 5LSOA 3OTEA 4QW9A 3GFHA 2DPJA 4DQIA 2ZNYA 4FBUA 3C3LA 2HIQA 5KFXA 4CLSA 3L95X 1U09A 1Q0NA 5F0WA 3DDKA 3FSYA 4ZCMA 2V34A 1E6YB 5KG7A 2K1RB 4PG4A 1QAJA 1RSCA 1UW4A 2DNRA 4EYIB 1SKWA 2HIYA 2OPSB 2IJRA 2VPWB 4EO8A 5JVGQ 5E3PA 2CPZA 2GMHA 2YNHA 2YWFA 5F8IA 4XPCA 2ZWOA 4V19X 5KG5A 3QZ8A 4NLWA 2ZOFA 4X4UA 1GAOA 3G2XA 3ZTPA 3W9HA 2ASJA 1TU0B 2P9CA 4ZOSA 5K14B 4NLYA 3GU0A 3P6YC 2QFJA 1S1TA 2BW2A 5I3PA 4DR5F 3CJRA 3KWMA 3JTNA 1IBKF 3ENWA 2EXUA 2NXNA 1H3DA 2KRBA 5SUHA 2E5IA 3W64A 2AYBA 2R7UA 4DR6J 1UA0A 5AE2A 3CUNA 1WKJA 4B3SJ 1UZHA 2HHPA 3EWGA 4Z37A 1ZTTA 2IMOA 1QLNA 2LP4A 4Y28C 1WKKA 3LQVA 2MJNA 2DYAA 2NCKL 4K2XA 1H7WA 2CQ1A 4Y3CA 3AT1B 3MHYA 5J1EA 2XMKA 4EZ6A 2KO1A 5IS2A 3MEGB 4ZPBA 1APSA 3DRXA 2YNFB 1FRJA 3LP2A 3HCXA
chains in the Genus database with same CATH topology
3CDBA 3I87A 3LO3A 3UE2A 4OI0A 3MEDB 2DR8A 2WW8A 2P6SA 3POTB 1VBZA 4IQXA 5E2QA 3LAKA 1TK8A 4N8NA 3JAMY 2B7CB 1YJUA 2HWTA 4P6QA 4LVOP 4C8YA 4ILLA 3QAEA 4MIBA 4A8YA 3V4IA 1IQTA 2O67A 3GR1A 1ZPVA 3DRPA 3M2UB 1WELA 2RQ4A 2E5GA 3AAWB 3T5HA 2R8GA 4ECUA 1WG1A 2I2YA 3O2IA 2DIUA 2IVMA 3N6MA 2HPUA 4RWWA 4Q7AA 2UUWA 3J7ZT 4DV1F 1XERA 2MY8A 3L7PA 4OX8A 2R9LA 4UQTA 3QIPA 5E41A 1D9DA 4QZVB 3VAGA 1C1CB 1Q4RA 2RDJA 4O23A 3V4IB 3I5AA 4K5SA 1QJHA 2DNYA 2VV5A 1ELOA 3SSRA 2MQNA 3GG0A 1TUVA 2E66A 1HBNB 4I7FB 1GX5A 2RU3A 2L3MA 4B9LA 1HNIA 1TKTA 2JSXA 1NO8A 2XSJB 1TFYA 3CC2S 4N41A 2AW0A 4UY85 2FB0A 1NKCA 3S7RA 3PO5A 2YH0A 4A8KA 2ZJRQ 1ZOTA 2DR7A 1TZ0A 1VC6A 4OI1A 2K1RA 3MM8A 4UQGA 2XS5A 4I6YA 2Q43A 3I32A 4ZKAA 3CJ3A 5ITHA 3IS9A 1U6FA 4WFBQ 2M52A 1FESA 2KT2A 2FPHX 4I56A 4B9SA 1CEZA 2MQMA 3CCZA 5A0YA 2DHGA 1S1VA 1T95A 4DFPA 4ECZA 5D4LA 2DHSA 2AJFE 2HWIA 4BC9A 5D6GA 2IYIA 1N34F 4J9NA 4JYAF 4PXDA 4NOHA 4BCAA 4NPOA 1S6UA 5M2PA 1Q1KA 3IG1A 1IN0A 2HHVA 4EGLA 5DJBA 1RYRA 4B3MF 2G1DA 1Q86T 4JI1F 3GYNA 2OTJS 2NS1B 4K0KF 3B4MA 1FNOA 4TY8A 5E33A 1X7VA 2ZJPQ 1RT7A 3ITHB 3I0RB 5EX0A 3HMJG 3BO3A 2EW9A 3SV3A 2E9ZA 1JLQB 3CJKB 3PW5A 2LEPA 2LU1A 2J0XA 4K4TA 1FRLA 4G3IA 4ZVFA 4XPEA 2B9YA 1SJRA 3VAKA 5EX3A 2ZH5A 1N6QA 3OFHA 3VAIA 4U7UK 4Y2KA 2CVIA 4QIFA 1RP5A 4ZHRB 3M4XA 3IWNC 3J7YI 1C2PA 1HWJA 3HVAA 4KQZA 4CH1A 2FLLA 5AXMA 4HT7A 3KK3A 4PUOB 2BQ3A 2YKMB 2VG6A 2OMOA 1RT6B 1EETB 1HI1A 2JJ4D 3KHGA 4ZA1A 2AGQA 2W7AA 3MPWA 2ZH2A 2DGVA 3OL6A 3M32A 3BB5A 3H98A 2HHTA 5B0BA 1X0PA 3OUYB 2FVCA 1ZH5A 4F8RA 3TX8A 4FXVA 5HLFA 4O3SA 2BABA 1URRA 3I5CA 3GG1A 2PIIA 4WFAQ 1RT6A 4QR1A 1VRUB 1C1BA 3JSMB 2DNOA 1RTJB 1DARA 3IAM9 2NSCA 3C8YA 3ONQA 1U1KA 4B3RF 3BGRA 1FVSA 2OSQA 2LMIA 2CJQA 2VH7A 1RI7A 1LWFA 3H2UB 5KFLA 4DL0C 4CQ1A 1VK8A 3D54A 2AWZA 4R8UB 3SXLA 1X9WA 1G1XA 2YX7A 3VAJA 1H2TZ 4Y34A 1T03A 1OQ6A 1S6PB 3SZ2A 4DV5F 3UD3P 1NJWA 3ETOA 1SJFA 4GMKA 4X65F 1FCAA 2RKIB 3KNGA 1S49A 1RKIA 4X4PA 3F44A 1KEKA 3ICLA 3PO4A 1FE0A 2FJDB 5KOXA 3IWXA 2M2BA 4H4MA 4UY8T 4X66F 3EGNA 4EBDA 2CKWA 1T05A 4WF9Q 2MSTA 1FKPA 3NNHA 5EGYA 3OQ2A 1PSDA 3FRZA 2EFOA 2HHSA 2JEGA 2W4PA 1RT7B 4DV7F 2RS8A 2WSFC 3I96A 3IBWA 3SV4A 1C0UB 2D9OA 2MZSA 3HHLA 4YB5A 3BSOA 5HMWA 3AJ2A 3CCWA 4DUYF 1V3RA 2E29A 2M88A 4XDDA 1G6BA 3NGKA 3DLLQ 3KHLA 3OR2A 4IQMA 2B43A 1M5OC 2XI2A 4IR1A 2QO3A 5L9XA 3GFXA 2VD3A 4TYAA 4K4XA 1X4BA 1IKXB 1ZAVA 2KYZA 4LIWA 3M9MB 2M7SA 1C0UA 3MEEB 4M95A 1WD6A 2QV6A 3OFGA 2M3DA 3MM6B 1FXLA 3O3LA 1Q7YT 5KG1A 4LUBA 1W2BR 4JV5F 1UVIA 1Y7PA 1KQKA 2YNHB 2MHNA 4HLBA 1NKBA 2MKKA 3NL0A 1B64A 4EYHB 3UR0A 5G0RB 4C97A 2N4DA 1FA0A 4NZ0A 4RNHA 3MUMP 3CE8A 2C3YA 2B7BB 4Q5VA 3QJPA 1CLFA 3HM9A 3GIMA 3ZFVA 3Q22A 1X4DA 4RW9B 1HBOB 4DS5A 1X4AA 3CIZA 3G6XA 2PA3A 4KR0B 1VK3A 5KFDA 1HD1A 3OJUA 4FF2A 4NLPA 4TLQA 3KG4A 5CQGA 4PPZA 5EWFA 4BDPA 5A8KA 4PG7A 2W25A 3PNIA 4USHA 3C6TA 3HVTA 1KSPA 1XR5A 2W7OA 4OI4A 4BHQA 1O8BA 4M5DA 3KOAA 3LP2B 2YKOA 1T02A 4OL8A 4JBCA 2B5JA 1Q16B 4ES1A 4WFZA 3FSXA 4URGA 1UWBA 2W9AA 2HGMA 4CTAB 5J2NA 1U1OA 1GTEA 1KOOA 5IM0A 1X8DA 4K5RA 4WU3A 2DPIA 2ZKUA 2O01C 4DBQA 5HBMB 2FHMA 3GV7B 2L9WA 2WHOA 3RB4A 1QSSA 4ID8A 2HHUA 4FN5A 4QBUA 1BQXA 4LFAF 3QWPA 2DNQA 3CCLS 1EP4B 4JI8F 3M6WA 3SCIE 1HHSA 1HI0P 1ZM4A 1GXUA 3W3SA 2MYFA 2E1RA 3Q24A 3TUJC 4YR0A 3RAQA 1SV5B 3M8QA 2LEBA 2F8MA 2ASYA 1OIAA 2BRKA 3DLKB 5B09A 2KRRA 2W4CA 5GMKa 2DR5A 3CMES 1REVA 3EUNA 2JOQA 2VA3A 1CVJA 1RTHB 4BS2A 2KFYA 1D8YA 1N0VC 4A8XA 5F8JA 4ALZA 3OHAA 2RU9A 4R5PA 2HLTA 3QO9A 5J2PB 2BOPA 2GQ2A 2HFNA 1AFJA 1WG5A 2UZAA 4KV8A 1X4EA 2VPXB 5H9FJ 1KR4A 2G0CA 3D1QA 4DR2F 1UA1A 2QA4G 1NJYA 2EK1A 5DDPC 4NYZA 3I56S 2E5LF 2VOOA 2GCFA 2I0XA 3NKYA 4LFCF 1OS5A 3LPYA 4DV4F 3BDPA 1VQ5S 4MIAA 2J6UA 1R8PA 4JI0F 2IFXA 1SIZA 3PIPQ 2I9SA 3EX7B 1N8RT 1RGVA 3OPKA 2OFGX 3CC7S 3DRYA 4ZP8A 3GZ7A 2Q79A 2JRSA 2J9EA 4ZK7M 2B4UA 3DI6A 1L5UA 2UVVA 2QLXA 4J9KA 1S1XB 4ED2A 1DURA 4DPOA 2JVRA 1FNXH 5F3TA 3G6VA 3C2PA 4M5DB 4FYDA 2J9DE 3FFIA 3MCSA 4OX6A 4PXBA 1KQSR 2BXJA 5L9NA 4QU6A 4R0EA 4H4OB 4IH7A 4X84A 3MFIA 2KM8C 1YTYA 2RS2A 4OHWA 5D3GB 3DOKB 2R8HA 3PZPA 3CCQS 1IUJA 2E5JA 1KHVA 4O4GB 4B3OB 1VBYA 2ZOGA 2RD5C 2JC1A 1KLMB 3MTJA 5E0OA 2RH3A 3DLEB 5KFVA 4EZ9A 1U6BA 3SDEA 3ZZRA 1N6QB 4KGMA 3GB0A 4DSJA 5JUMA 2IRXA 3LANA 4ILRA 2WB1D 5KG3A 3ZZOA 3V6KA 4X2BA 2J6TA 3H8YA 4HTIA 2KT5A 1IKYB 2JLFA 2ZH9A 4C3KA 2YWHA 4PWUA 3DLKA 3JSBA 5DG8A 1K73T 5DETA 2OD6A 4MYUA 3RU0A 3MAHA 3NBPA 1SJ4P 1D1UA 5IQQA 2ATLA 2MQLA 4DSEA 2GHVC 1IJEB 3CIMA 4X4VA 2CRLA 4IRCA 5DQHA 2DH9A 2YKPA 1X5OA 1YGYA 1JJ2R 4O3PA 5CZXA 3J7A1 5AE3A 3MMAA 2Y1JA 1DJ0A 1TKDA 2XB2D 1E6VA 2VC1A 1DQ8A 2V4JA 3NAHA 4NZ6A 4HDHA 2ZJQQ 2KZZA 4YEAA 2DVIA 4KBIA 4PR6A 2X1FA 3CCVS 5DG7A 1N5TA 3MFHA 4IRKA 4MAKA 2VODA 2KTQA 5BJRA 3HHNB 2GV1A 2PMHA 2Z2MA 4L6V3 5IXUA 2DRAA 3FNNA<