2EK5A

Crystal strucutre of the transcriptional factor from c.glutamicum at 2.2 angstrom resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
VPLYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGMFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted transcriptional regulators
publication title The structures of transcription factor CGL2947 from Corynebacterium glutamicum in two crystal forms: A novel homodimer assembling and the implication for effector-binding mode
pubmed doi rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Transcription
total genus 37
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ek5A00
1YIOA 1HKTA 2GA1A 1IW7F 1QBJA 2RKHA 4LLGF 3B02A 3HHGA 4HV5A 1F1ZA 2ISYA 4QWQA 2CG4A 4MHGA 3SZTA 4LGWA 3RKYA 1C0WA 1FBSA 2M30A 5DCMB 2BYVE 5L3GA 1FSHA 2NYXA 5JVTA 1VTNC 3GUDA 2BE5F 3GVAA 1UCRA 4A0XA 2TDXA 1TNSA 5CYVA 5A2QZ 4IRGA 1DPUA 4B8XA 2FOKA 4PCQA 2BEOA 4K2EA 1USTA 4EJWA 1GHCA 2DU9A 3JSPA 1LNWA 3KETA 3R4KA 3JSOA 5L3BA 2LNBA 2VBYA 4KNYA 2ZNZA 5LGUA 2BBYA 1HKQA 2PG4A 4LJZF 3R61A 4ESFA 4WCGA 1E17A 3K1MA 2XASA 2OU2A 5HDNA 1KU7A 5ICFA 4ASNA 1B59A 3EETA 3SZPA 4M9ZA 2XV4S 2VXZA 1XGSA 4D0PA 3P9KA 2K4JA 4S04A 5HS7A 3EYIA 4MEXF 1K6OA 3GEZA 1UB9A 2RVCA 5HVQC 4RGXA 5AIQA 4F7ZA 2ZO4A 4U88A 3JW4A 4FX0A 1IAWA 2QBYA 4Z2YA 1YO5C 4Q4ZF 3IWFA 5F6FA 4HAMA 2P6TA 1T39A 4ENKA 3DPTA 2CFXA 1XDUA 2Q0OA 4I2OA 4LG0A 3MAJA 4ZH4F 4MQVA 3BZ6A 2VOOA 2FXAA 2P4WA 4RB1A 4AIHA 2AS5F 2PFBA 3Q9VA 4BHPA 1SD6A 5D5XB 5ILUA 5JFRA 2OQRA 4UVAA 1T98A 3FXQA 5HDKA 5FFXA 3KEOA 3F8BA 1V4RA 4I0AA 1TLHB 5K5OA 1FP2A 2FBKA 1XSDA 1LEBA 1FC3A 2ISZA 2V6CA 2G9WA 3M7GA 3BJOA 3TO7A 2YU3A 4XLPF 4JQFA 2H27A 4ENMA 5D8LB 2GZWA 2KIUA 3FMSA 3VOEA 2H6CA 3QP5A 1FT9A 4HLXA 1U5TA 3BPVA 3ABTA 3V7SA 4S05A 3LA2A 1YFHA 4HF1A 2COMA 3CUQB 2PMUA 2HDCA 4KN7X 1KU3A 2L02A 1SFEA 1BN5A 1R5GA 2FNPA 4HYEA 3K1PA 2JPCA 3V4GA 4NB5A 1J7KA 1GVJA 2CQKA 2ETHA 2NNNA 1GXQA 4IHSA 3ZMTA 3LFKA 3T1BA 3WTXC 5E18F 1K7AA 5H20A 2Y75A 1J2XA 3CUQC 1W5SA 5FGMA 4AWXB 3RYPA 2DPDA 3FMRA 4BQAA 2EFNA 1Z6TA 1HBXG 5E17F 3IWZA 5LRSA 3IKTA 3I59B 1T38A 1HSTA 3NRVA 3DV8A 3OV8A 4HX8A 5J6XA 3ISPA 2XVCA 1XMKA 2H94A 2STWA 1X3UA 3HSRA 5J8CA 5D6EA 4ZYGA 2VBZA 5LHGA 5E1ZB 2IP2A 4I02A 1P92A 1WI9A 3D5LA 3V8LA 1YS6A 1AWCA 4U7DA 1D3YA 5IT3A 1I27A 1G4DA 1MJAA 2P5LC 4U7BA 1Y0UA 3GYHX 1MDMA 4Q5SF 3I4PA 3WTWC 2O6GE 4Y13A 1IN4A 4WXCA 4A2UA 5K1YA 2ADUA 1FZPB 5IT9Z 1LJ9A 5CVJA 3LWFA 2QZ8A 3D0SA 3W6JB 1BI2A 1HSJA 2DI3A 5E1XA 1XGNA 2MA3A 1XGMA 3E3VA 1WQ2A 2M8EA 4JBAA 2W57A 4RAZA 3F3XA 3TO9A 4BAYA 3EYYA 5DUIA 3M8EA 3TO6A 3J80K 1JGSA 3IRQA 4A0YA 4A5MA 5H6QA 1H0MA 3WGHA 2E1CA 3T8TA 1Z1DA 4JK1X 5DCFA 1T0FA 1XCVA 4IF4A 3MCZA 5DEQA 2K4BA 3FXUA 3SHFA 5LEKA 4P55A 1YG2A 4OINF 3LAPA 4M74A 2V1XA 4A0ZA 1BIBA 4IRIA 1HW2A 1W7PD 4LB6B 4NHJA 4GYGA 4NQWA 2ZFWA 4R79A 1TNTA 1WSUA 5DUKA 1B6AA 1JHHA 4UV8A 3BJAA 1FBQA 3IC7A 2G7UA 1RNLA 5F1RA 1O57A 3HRUA 2AXLA 1E2XA 2M1BA 4L18B 4EJVA 4OIOF 1BI0A 3DPLC 1U3EM 2NNYA 1O3TA 4XSZF 3RJPA 2A69F 4FHTA 3HSFA 1IUYA 5D8KB 3HRSA 1IN7A 3F8MA 3P9IA 4YG2F 2RN7A 2CO5A 4WK8F 4LLNA 2KJCA 4HBLA 3QU3A 2P7VB 2XKOA 4IJAA 1FBUA 1YS7A 1FPQA 2L01A 3RPQA 2EK5A 4UXNA 4BHBA 1D8KA 1IXRC 2PLYA 3HRMA 4P9FA 4LMYA 1YW8A 2ESNA 5EEHA 4PDKA 3VFZA 3MEXA 3KZYA 3ABUA 3WODF 3I54A 2OQGA 1TQIA 4CZZA 4AD9A 3E5XA 3MFKA 1ON2A 3BWGA 2RDPA 4HZFA 5E1WA 2XAHA 3CO7C 1MGTA 1W7PB 5FD5A 2O8XA 3PQJA 1FYLA 1ZG3A 5DDGA 5CVUA 1ZLKA 3C18A 3KP5A 4HX7A 5E20A 3FHZA 2UWMA 3KFWX 3I53A 2K02A 3WTZA 1FOKA 1SMYF 2A6EF 4B09A 5LBQA 4MEYF 2A07F 4WXHA 2F5DA 4U0VA 1B4AA 3NEUA 3E6CC 2LF7A 3BY6A 3BJ6A 1LDJA 2HGCA 2XAGA 5LHHA 1LB2A 1PUEE 2KRFA 4KIBA 4UUVA 1W4MA 2DO7A 1J75A 5EEGA 1F9NA 1HQCA 4PZJA 3KP7A 4G7OF 1MKMA 3F23A 5K5QA 1STZA 3M8FA 2DBBA 2FF4A 2JZYA 4CICA 3FMQA 4CGZA 2V9VA 2XROA 3GX4X 5LGTA 4L5IA 2O3FA 3F6VA 5FO5A 2YX7A 1IRFA 3L00A 1DUXC 3J7AO 3IRRA 2BGCA 2P5KA 1YTYA 4KIGA 3ERED 3DP7A 3GFMA 4EM1A 2STTA 3BDDA 3IL2A 3FM3A 2QQAA 4L5JA 5JR3A 1KYZA 3C1DA 1Z05A 4FX4A 4KYWA 4P5OA 2EFOA 1RZ4A 2Q2EA 3R60A 3HHHA 3EQLF 4UVCA 2HEOA 1U8RA 2HYGD 1ZRFA 4G94A 4Q48A 3SXYA 3U9GA 3WE2A 3ZPLA 5AIPA 3I64A 3KP2A 1BOAA 4OIRF 2W84A 4LK1F 5L3CA 5HLIA 4YIIA 1QPMA 2VONA 3FXRA 4I7HA 4RS8A 3MWMA 2XIGA 4A6EA 1S3JA 3ULQB 1TTYA 1XN7A 1U78A 1ZH5A 1TW2A 2IRFG 1Z6RA 1XMAA 3QRFF 3V8JA 5E8GA 4AVPA 4MNUA 2XUBA 3CO6C 1OMIA 2CGPA 2Z3YA 3U2RA 2ZBKA 2FBHA 2W24A 4WF2A 5D4SA 3TDUC 4WXDA 2ZNYA 2D45A 5KVRA 3JAMK 2QENA 3L09A 1YQAA 5A2QK 1ZG1A 3VEPA 3IKVA 1O3SA 4GGGA 2X4HA 1DP7P 4GYIA 4E70A 2OBPA 1R7JA 4PGGA 2GXBA 4YFKF 1YLFA 2IT0A 1CGPA 3RPUA 1P4WA 3MQ0A 1LVAA 3CUQA 3ECHA 3TGNA 4R1HA 4RGRA 3GF2A 1ULYA 2QQBA 2A61A 2EWNA 2L3DA 2Z5UA 4XLNF 2R3SA 1O3RA 3KLNA 3HTSB 4OMZA 1BI1A 1L0OC 3R0AA 1LEAA 4O5VA 2UXNA 1SFUA 2HTSA 5JHUA 3T8RA 2ELHA 4IXAA 3WTYC 1IRGA 4UNOA 3CLOA 2LF8A 3I59A 5K5RA 4G8XA 2L4AA 2XRNA 2KIMA 3BOQA 4ENJA 1P6RA 3C3WA 2DTRA 2J5PA 1J59A 4PGHA 2A6HF 3J80Z 3EUHA 2L54A 2EFPA 2QWWA 4H0EA 4OU0A 5D5WB 1ZAOA 4KUMA 4OIPF 2WTEA 3DF8A 3RKXA 1R1VA 4XRFA 2G7HA 4HQMA 2XHKA 1S7AA 4Y17A 2CW0F 4DQ2A 4ESJA 4DNCA 4QLCU 5L3FA 2QM3A 4CO8A 1JE8A 4XSXF 4HF0A 2PN6A 1WKMA 2VOPA 5ICEA 2H6BA 3KEQA 3WGGA 1TQMA 3O3KA 3HOTA 4HQEA 2ZJ2A 1TQPA 3GXOA 3H92A 4U0YA 2GA2A 5FB2A 1FY7A 4IRHA 5LLQA 4L9NA 5ILSA 3KP6A 1G3WA 1FNNA 3WTTC 4LFUA 1ZGAA 6PAXA 1FX7A 1ZREA 3QPHA 1ZN2A 3GFJA 1MZBA 4UV9A 5HS8A 2YPRA 1QNTA 4G6DA 3LQRA 3ZQ7A 3FX3A 3H3UA 4CYDA 2VC0A 5CVRA 2PEXA 3MZYA 3N97A 4U0WA 2OZ6A 1P2FA 1OYIA 4KMFA 4YFNF 2GQQA 3QPTA 2FA5A 3TDZC 1BI3A 2UZKA 4HA8A 1FYKA 1U2WA 1CF7B 1B9MA 2X0LA 1LQ1A 2EB7A 4L9JA 2V1DA 3TOAA 3WTSC 2DT5A 5D5UB 5BPIA 1RUNA 2M45A 2ESHA 3VODA 3DKWA 3O2PE 4N9IA 2ZKZA 1D8JA 3DXJF 3K69A 4ZYEA 3RKWA 4AIKA 5FLXZ 1HW1A 3B73A 2Q8KA 4CXFA 1FWZA 4A12A 4EGZA 5ILVA 2ZXJA 4M72A 2WWYA 1SFXA 4AIJA 1J5YA 2IA0A 2JSCA 2GWRA 1S29A 5D6FA 3W6KB 2Z9OA 4KIFA 4RGSA 1QQIA 2HQRA 3JTGA 3N4MA 1R22A 3J81Z 4BH9A 3GWZA 1R58A 4EGYA 4OMYA 3TQNA 3COAC 5HLGA 2P5VA 4KA4A 3L2CA 1JXSA 1ZHFA 2EV5A 2R7FA 3ZMDA 4TV7A 5HLHA 1KU9A 2DLLA 3KE2A 1FSEA 3ZN0A 3GZ6A 2OAZA 3LAJA 5CJ9A 3PQKA 1XDSA 4N0BA 2HWVA 3V8KA 2RGVA 3HYIA 2ZMEB 5LEJA 3O6BB 5IT9K 1W7PA 2P8TA 3Q9SA 1O7LA 1T6SA 4ESBA 1OYWA 3E5UA 2QLZA 4M9XA 3V7RA 3F8CA 1QGPA 1EH7A 4O6JA 4CDGA 2IVMA 4BYYA 2VODA 5LRRA 1SD5A 1F5TA 3WTUC 1G6NA 4ZZLA 3K9TA 1RI7A 2HKXA 1R36A 3RDIA 1LDKB 4ZYDA 5D4RA 2EV6A 2NRAC 3E6BA 1FP1D 3F72A 1S8NA 1DPRA 1MJ9A 3HIFA 1ZLJA 2HFHA 4EJTA 4HLYA 3ZP5A 4ZYHA 3K1NA 4M71A 2MLGA 4R8HA 2EFQA 1QZZA 4EQQA 2PJPA 1D5VA 1Q1HA 2JTVA 1PP7U 1B9NA 2QYOA 2MH9A 2VT3A 4YIFA 1OYYA 4LK0F 1A04A 1K78B 2KKOA 2FMLA 2DW4A 1Z9CA 1R1TA 1R1UA 4HDVA 2MBFA 1KU2A 2WV0A 2UXXA 1T2KA 2NS0A 3FWEA 2QVOA 1MD0A 4P96A 1J9IA 1FLIA 2A68F 2EJRA 2NAZA 2DPUA 5TRDA 4BNCA 3QOPA 2XGXA 1FYMA 1HXDA 4MTDA 1QZYA 2Z99A 5AONA 2DK5A 2MD5A 5DD4A 3S2WA 1PP8F 1JHFA 4LD5A 2A5YB 4EMSA 3P7NA 3U1DA 1TW3A 3BP8A 4GO1A 2OD5A 1G3YA 1UHMA 4I0BA 3ZMZA 5BPDA 2P7CB 5ICGA 4HV6A 4FT8A 4M73A 2FQ3A 2C6YA 5J8FA 3CDHA 3KZZA 2WC2A 4Y15A 3WE3A 1W5TA 4RB3C 3G73A 2JT1A 3AAFA 3FF5A 2FBIA 2VBXA 2K86A 2F5FA 4IVNA 3JAMZ 3HSEA 2MLKA 3KP4A 4WX9A 2FEZA 5FFZA 3LA7A 1IXSB 4EJOA 5BS6A 3M1EA 1ZG5A 5ICCA 2JPBA 2HS5A 4LLLA 2MH2A 1KYWA 3EDPA 2FSWA 3T0YA 3Q5FA 2DQRA 4KFCA 2LDUA 1KGSA 2D1HA 4A6DA 4KT5C 2PBIA 3KP3A 4MTEA 4RGUA 4ETSA 5FD6A 1L3LA 3P9CA 1ON1A 4IPAA 1BJAA 3QP6A 4HW0A 4EJUA 2EV0A 4ON0A 3DQVC 3GO5A 4GCVA 3HRTA 4L0YB 4XBFA 1TBXA 3L9FA 4OIQF 2PQ8A 3WG9A 2A3SA 1ZARA 3I0TA 4L0ZB 2VE9A 5E8IA 2F5CA 1P4XA 3I5UA 4I98B 1F4KA 2XAJA 1ZRDA 5ERIA 1BBYA 4P9UA 3ELKA 1J0RA 1IN5A 2BV6A 1K79A 3REOA 2O0YA 1U6GA 3JTHA 1ZRCA 2IPQX 1IF1A 4G7ZF 2HQNA 2HKOA 3LQQA 2FU4A 4WWCA 2W85A 4M9SA 3SFZA 2OZUA 1BIAA 1R00A 2QBYB 1ZGJA 2V79A 4L9VA 2KIFA 2HR3A 1S6LA 5BOXA 1WRJA 2E7XA 3LA3A 4Q47A 1KQ0A 3G3ZA 5DYMA 2D2WA 3R0JA 3WGIA 3HTUA 2VC1A 2K27A 4LB5A 3IHUA 1EV7A 5LGNA 4RB0A 2DFIA 4KICA 4LG0B 2PMHA 1XGOA 3E5QA 1QO0D 4EV0A 4EM0B 1HKSA 5DD8A 1IZ1A 1ONVA 2H09A 3GFIA 2JRTA 2E1NA 4MQ9F 2O61A 3K2ZA 4OOIA 3F21A 4BHCA 4KDPA 2VT2A 2M87A 1AOYA 3TOBA 2HOEA 3F22A 2Y48A 3WU1B 2VN2A 1I1SA 3K0LA 2HYFA 3KCCA 3F8FA 5BQTA 2DAOA 1RIOH 2FRHA 3OOPA 2R7DA 2ACJA 4EVIA 1REPC 2HTJA 4HF2A 1OKRA 3RI4A 3M9AA 3CTAA 1KQ8A 5BMZA 1OPCA 4M6XA 4YFXF 5CLSA 4G9YA 1NHAA 4UVBA 2L4MA 2V1UA 2DQLA 1U5TB 1SMTA 1I1GA 4MGRA 2B0LA 3WTVC 3GLXA 2EA2A 1R23A 3I71A 2GAUA 3RTRA 2VE8A 5L3DA 1XSVA 2YR2A 1CF7A 2HZTA 2CYYA 3RIRA 1U5TC 4RAYA 4HDUA 5D5VB 2QQ9A 2XAFA 5TJJA 3ZN1A 4L9TA 1OR7A 5HDGA 2K7LA 2RC4A 3RYRA 3ZMSA 3MZHA 1Z91A 2EA4A 3DFGA 4I01A 3DEUA 5LHIA 3QU6A 2FMYA 3WU0A 3V7CA 2Y0MA 4ZZDA 4IHTA 1ODDA 5L3EA 1MJBA 1O7FA 2DK8A 2W25A 1UHWA 4HOBA 1BM9A 3C7JA 1GXPA 1KQ9A 2KJBA 3CJNA 4HX4A 2XKPA 4M6YA 1IN8A 2F5EA 3E97A 1PDNC 2XAQA 4KMUX 1MDMB 3LSTA 1R5HA 1LDDA 2QUFA 3F6OA 2CWEA 4EM2A 1YW9A 5CVIA 1G3TA 5JI6A 2F2EA 1V3FA 3FM5A 5HOOA 3R6SA 5KK1A 3H3ZA 3ROUA 3GZ5A 3FZVA 4BXUA 1USSA 4G7HF 2ZMEA 1SD7A 1DDNA 3I58A 1YW7A 1EH6A 1EH8A 2E7WA 2IA2A 1O3QA 2FNAA 3HUGA 2J5OA 5F64A 1XB4A 3GFLA 3L7WA 1UFMA 3BROA 1H9GA 3E6DA 4N9HA 2YX4A 4RB2C 3BPXA 1WWXA 3ECOA 2O03A 2PI0A 4I09A 5DV5A 4O3MA 3SQNA 2M5WA 1SD4A 1XSXA 2MC3A 2VBWA 1BC7C 1G3SA 1BC8C 4A5NA 2Z33A 1XCBA 3ZMUA 3QAHA 5HS9A 2RV8A 3PFIA 2P6SA 2GXGA 2D1VA 1B1BA 1K78A 3KLOA 3ML6A 4CHUA 2YSRA 5H6RA 4ENNA 2RQPA 3E6MA 1ZYRF 1HW5A 4UHTA 3TKYA 4G6QA 3F8NA 5ED4A 2OA4A 2FE3A 5FLXK 3T5XA 1IXCA 5CVVA 1XD7A 4KN4X 1SAXA 2CSOA 1Z7UA 2GIVA 3VB2A 3ZMVA 2EFWA 1I5ZA 2LKPA 1I6XA 3HOSA 4GXOA 2IA1A 5DCMA 2RNJA 1IN6A 3GW2A 2ZCWA 2IW5A 1YYVA 1KA8A 2LSOA 1P4AA 3NQOA 3CUOA 3J81K 1H9TA 1RUOA 1S7OA 2IJLA
chains in the Genus database with same CATH superfamily
3M8JA 1YIOA 2V9PA 1HKTA 2GA1A 3ABMH 3L2WA 1IW7F 3FXLA 1QBJA 2RKHA 2HOAA 1E3OC 3VDXA 3L2UA 2K9NA 3OYAA 4LLGF 3B02A 3HHGA 4HV5A 1F1ZA 2ISYA 4QWQA 2CG4A 5FKNA 4MHGA 3SZTA 2KRCA 4LGWA 3RKYA 3QOEA 1C0WA 1FBSA 2M30A 3VYRB 5DCMB 2QEXI 1BA5A 4M3BA 3S2HJ 2BYVE 2WV1A 5L3GA 3S16J 1FSHA 2NYXA 5JVTA 1VTNC 3Q0VA 3BG7A 2HZDA 1QVUA 2DMQA 3RQIA 4XMYA 3GUDA 2BE5F 2DFEA 1YIJI 3GVAA 4LITA 1UCRA 4A0XA 2L7FP 4M6VA 3DTEA 1XX5A 2E1OA 3FK7A 5KHDA 1SVOA 2TDXA 1OCRH 1TNSA 4HEA2 5CYVA 5A2QZ 4C3IJ 4IRGA 5IP7J 2LY2A 3PSFA 2JUCA 2R7ZJ 1DPUA 4B8XA 2FOKA 4PCQA 2BEOA 1ORKA 4K2EA 2DA7A 1USTA 1FTTA 3J7ZI 4EJWA 2JA2A 1GHCA 5BNGA 2DU9A 1DQUA 2VIXA 1YX3A 2O7OA 2L7MP 3JSPA 2MG4A 1LNWA 3IP4B 3O8HA 3KETA 1NTCA 1V5GA 2ECCA 3R4KA 2PJRB 5IOYA 2M4GA 5IYCJ 3JSOA 5L3BA 2LNBA 2VBYA 5GPAA 3VYSB 3GLLA 4KNYA 2ZNZA 2LK2A 2BY0A 2P81A 2LBFB 4I99C 2X6XA 5LGUA 2BBYA 1HKQA 2PG4A 4LJZF 2V7FA 5M3FJ 1T95A 3R61A 1SFKA 4ESFA 3ONQA 4WCGA 1LFUP 2JVGA 4NUBA 2E1MB 5DM7F 1E17A 1H89C 3K1MA 4Y3OA 1XPXA 4MO7A 2X48A 2XASA 4A3MJ 1R6RA 2OU2A 1D1CA 5HDNA 2H8WA 1KU7A 2BOLA 5ICFA 5C4XJ 1IDZA 3CP2A 3VYUB 1D1AA 4ASNA 1B59A 1WCMJ 1T8IA 3EETA 3SZPA 4PSWA 2E1MC 2A05A 4M9ZA 4N4OB 2XV4S 2VXZA 1XGSA 4D0PA 3P9KA 3GTKJ 2K4JA 4S04A 5HS7A 3EYIA 4MEXF 1K6OA 5B5EC 4BACA 4XRMA 3GEZA 1UB9A 2RVCA 2HQ5A 3RPUD 2VPLA 5HVQC 2M7AA 4RGXA 5AIQA 1S9HA 2XSDC 4F7ZA 2ZO4A 4XIDA 2R7VA 3HPGA 1HLVA 1A31A 4U88A 1NG6A 1R49A 3JW4A 3E1SA 3I4NJ 2QKLB 2XAUA 4YELA 4BKXA 2LY9A 2WAQN 4FX0A 2GOMA 3OSGA 1IAWA 2QBYA 4Z2YA 1MMNA 2DJIA 1YO5C 4A3CJ 1Z3YA 2L5QA 4RDUA 4Q4ZF 1UELB 2E36A 3IWFA 5F6FA 2RQQA 2IS2A 4XL9A 1POGA 2VKDA 4HAMA 4B43A 3OWTA 2P6TA 2PMZA 4B47A 1T39A 4DBRA 4ENKA 3DPTA 4XKBA 4XK4A 2CFXA 1XDUA 4XONA 2Q0OA 4I2OA 4LG0A 1TWFJ 1PVEA 3MAJA 5IPAA 3OYNA 3VSKA 3S1NJ 1EF4A 2BVLA 2WAFA 2CFOA 4ZH4F 4MQVA 2W82A 3BZ6A 1K4TA 2VOOA 1ETWA 2KT0A 2FXAA 2P4WA 4RB1A 4AIHA 2AS5F 2PFBA 3U1KA 4CH7A 2GLOA 3PM1A 3K6GA 3Q9VA 2DMPA 4BHPA 1SD6A 3PL8A 3J7YJ 5D5XB 5ILUA 5JFRA 3OS0A 5H2FC 1QPIA 2Y0SN 3OIPA 1EJ9A 2OQRA 4UVAA 1T98A 1HA8A 3CCMI 5GAHJ 3OS1A 3FKIJ 5JHFA 3FXQA 1X2NA 3LSPA 5HDKA 2VJJA 1SEUA 5FFXA 3A2KA 3KEOA 3F8BA 4B44A 1V4RA 4I0AA 1TLHB 1EKEA 5E3OA 3RSNA 3S32A 2MGQA 5B1BH 5K5OA 2I10A 1FP2A 3K4CA 5EGOB 2FBKA 1XSDA 1LEBA 1FC3A 2EZIA 2ISZA 2V6CA 3PSIA 2G9WA 1ETQA 3M7GA 2ZJPF 1GUUA 5HNFA 1VZ0A 3BJOA 3TO7A 4PJJA 4YRVA 1D5YA 2YU3A 3K4LA 4XLPF 4JQFA 4ZDOA 1KZHA 1MNEA 3CDLA 4JX5A 2H27A 2XGDA 2ZXWH 2KDOA 4ENMA 5D8LB 4C2UA 2GZWA 3CD6I 2AXTC 2KIUA 3FMSA 3QWLA 3VOEA 2H6CA 4ABZA 2VJIA 3QP5A 2ZC2A 1FT9A 1I39A 4HLXA 1U5TA 1JKRC 2LMDA 3HXLA 4Y52J 3BPVA 3ABTA 3V7SA 1WJDA 2NS8A 3LA2A 4S05A 1YFHA 4HF1A 3D5SC 5KNLA 2COMA 3CUQB 2PMUA 2HOTA 2V6EA 2HDCA 3C2GA 4KN7X 1KU3A 1K83J 1XS9A 2VPRA 3F0CA 2GM4A 2L02A 1SFEA 1B8IB 1BN5A 1R5GA 1Y0NA 5TGTA 5EYRA 3CF2A 2FNPA 1Y1VJ 4UY8I 4HYEA 3K1PA 2JPCA 3V4GA 4NB5A 3MVPA 1J7KA 1GVJA 2CQKA 2ETHA 2NNNA 1GXQA 3H5RA 4IHSA 3ZMTA 3LFKA 3LSHA 3CC4I 2K3PA 3T1BA 2Y69H 4RM3A 3WTXC 5IYDJ 2ZSHB 5E18F 5B1AH 1K7AA 1MMSA 5H20A 3CC2I 2Y75A 5KCMA 1J2XA 1P9QC 2KPMA 2A6TA 4HPQA 3OYJA 3CUQC 1IV8A 1X1PA 2VQHA 1Z0XA 1W5SA 3BG6A 5FGMA 1Q1VA 3RYPA 4XRSG 4AWXB 2DPDA 1F43A 4FASD 4QPOA 3FMRA 1S72I 4BQAA 1Z67A 1VQLI 3OIQA 1I3AA 4E4HA 2EFNA 2WBMA 3L2QA 1Z7LA 1Z6TA 2XSJC 1HBXG 5E17F 2CQNA 4IHYA 3ERMA 2R5ZA 3IWZA 5LRSA 3IKTA 3I59B 1T38A 1HSTA 2VASA 3CMYA 5M5XJ 3NRVA 3DV8A 3OV8A 1YJWI 2YS9A 2QCOA 4JOMA 4HX8A 5J6XA 3ISPA 2XVCA 3SFIA 1XMKA 2H94A 3FIWA 4IOCF 2STWA 3K70C 1OFCX 1X3UA 2DFHA 4FTHA 3CCVI 3JRBA 3HSRA 3SEQA 3QQAA 1FMVA 5J8CA 5D6EA 4BE0A 4ZYGA 2VBZA 2DODA 5LHGA 5E1ZB 2IP2A 4I02A 3TW6A 1P92A 2WA0A 1WI9A 3D5LA 1JTXA 1HDDC 4M3EA 3V8LA 2KIQA 3S3OA 1YS6A 2HU9A 2WB1N 1AWCA 4U7DA 3DPUA 4OAZA 1D3YA 2BW3B 3PO3J 1WFXA 3G4SI 2Z2SB 4EEFG 5IT3A 1I27A 2DT7B 1G4DA 1FOXA 3BZKA 1X3WB 4DZJA 1MJAA 2M34A 2P5LC 4U7BA 2ID6A 1NG7A 1FEXA 1Y0UA 3GYHX 3HL2A 3EUHC 1MDMA 4PJ0C 1ZTRA 4Q5SF 4M3FA 2KZVA 3I4PA 4XLCA 3M1CA 3WTWC 2O6GE 4Y13A 1IN4A 4WXCA 4A2UA 5J1YA 5K1YA 3E0JB 2ADUA 1FZPB 5IT9Z 1T56A 1LJ9A 5CVJA 3LWFA 2QZ8A 1MBGA 4E7ZA 3D0SA 3W6JB 3CCLI 1BI2A 1HSJA 3ZCOA 5HODA 3CLQA 1VFCA 4FISA 3PNTA 4MFEA 2DI3A 5E1XA 1BR1A 1XGNA 1Y6IA 2MA3A 1XGMA 3E3VA 1T08B 1WQ2A 1Y8RB 2M8EA 4JBAA 4XKVA 2W57A 3LSKA 4RAZA 2NXNB 3F3XA 3TO9A 3EYYA 4BAYA 5DUIA 3M8EA 3TO6A 3J80K 3FXMA 1JGSA 3IRQA 3HBLA 2M3AA 4A0YA 4A5MA 4V2GA 5H6QA 4UB8C 3ZGKA 4RAGA 1H0MA 3WGHA 2E1CA 2KLOA 2V9KA 2OTJI 3T8TA 1WH7A 1JTYA 1Z1DA 4JK1X 3I55I 3A03A 5DCFA 1WJFA 1AKHA 1T0FA 1XCVA 1ETVA 3BCBA 2ELJA 4IF4A 3MCZA 3A01B 2LP0A 5DEQA 3OYKA 3W2VA 2K4BA 2TCTA 3FXUA 3SHFA 5LEKA 4B3AA 4P55A 1YG2A 3Q0UA 4OINF 3W6VA 3LAPA 2OC6A 4M74A 2V1XA 4A0ZA 1BIBA 2LR8A 4IRIA 3IAM2 1YI2I 1JKOC 1HW2A 4UUSA 1W7PD 3Q0WA 4LB6B 1PUFB 4NHJA 4XRSA 1WJBA 3KPHA 4XLHA 4GYGA 2R92J 4FQGA 2E2JJ 4NQWA 2ZFWA 4R79A 3DU5A 3DBRB 1TNTA 3EPZA 2KL4A 1Z77A 1MW7A 1WSUA 3VSLA 3OYGA 1OR7C 3UNGC 2F4OB 5DUKA 4PUSA 1B6AA 2F5VA 2JA8J 2OCCH 1JHHA 4UV8A 3BLYA 4RMNA 2CV1A 3BJAA 4AM3A 1FBQA 3IC7A 3ZQQA 2G7UA 1RKWA 1RNLA 5F1RA 2EIMH 2HDWA 2KQRA 4Z6YA 1O57A 3HRUA 2AXLA 1E2XA 2M1BA 4BU2A 5B3SH 3HOUJ 3SEZA 4L18B 2CH0A 2V4JC 2WAQA 4EJVA 4RA2A 1UJ8A 4OIOF 1BI0A 2E5NA 3DPLC 1U3EM 2JA7J 2NNYA 5E79C 2CUFA 2W00A 1NK2P 1O3TA 4XSZF 5IY5H 4BE1A 3BG9A 5FJ8J 2HDDA 2JVHA 3RJPA 2E34A 1V54H 2A69F 2HYJA 4BE2A 4FHTA 3HSFA 4BQOA 3PJRA 1BL0A 2JRMA 1IUYA 4AU7A 5D8KB 1ETYA 2NVUB 1I50J 3HRSA 1IN7A 3F8MA 1UMQA 3P9IA 4BS9A 4YG2F 2RN7A 2V26A 2LG4A 1SANA 2CO5A 4WK8F 1U9NA 4LLNA 2KJCA 4HBLA 3QU3A 2GIZA 1OCOH 2P7VB 3OYHA 2XKOA 4IJAA 1GDTA 1FBUA 3DBLB 2BXZA 1YS7A 1FPQA 2L01A 2R7OA 3BR5A 2BY2A 3RPQA 1WZ2A 2EK5A 2ZXHA 3D5RC 3IUOA 4UXNA 4QSHA 4BHBA 1D8KA 3TP3A 1N78A 4AC0A 1OQYA 2IGMA 3JRAA 1IXRC 2Y0SA 2PLYA 3HRMA 1FOYA 3HDDA 2R7RA 4P9FA 3PO2J 5EJCA 4LMYA 1YW8A 2ESNA 9ANTA 5EEHA 4PDKA 3VFZA 2XPVA 3MEXA 3KZYA 3ABUA 2P0WA 5HLTA 3M4OJ 4DYQA 1YX5A 2VL8A 3WODF 3I54A 2OQGA 2O8KA 1TQIA 4CZZA 4AD9A 3JRCA 2K85A 3E5XA 4G12A 3CC7I 3MFKA 1ON2A 3BWGA 2V1NA 2RDPA 4HZFA 3WU2C 5E1WA 2XAHA 2DMTA 3CO7C 1VQ8I 1MGTA 1W7PB 4J00A 3CZ6A 5DM6F 5FD5A 2O8XA 3PQJA 4QTRA 1FYLA 4E7KA 2DA3A 1ZG3A 3RZDJ 5DDGA 4PFOA 5CVUA 1LFBA 2MC4A 5E3MA 3CCSI 1LFPA 3FDYA 4PFPA 1ZLKA 2DTZA 1RR8C 4E7IA 5F0HA 3C18A 3KP5A 2NVXJ 4IKFA 1X4OA 4HX7A 5E20A 3FHZA 2UWMA 2GOXB 1DU6A 4HNUA 2CV0A 3KFWX 3I53A 2K02A 3A0BC 3IH2A 1VQ7I 3WTZA 1FOKA 2HPIA 1SMYF 2A6EF 4B09A 5LBQA 4MEYF 2A07F 4WXHA 2QF7A 2F5DA 4U0VA 1B4AA 3NEUA 3E6CC 3E7LA 4KJZA 4M3GA 2LF7A 3BY6A 3BJ6A 2EINH 2DXIA 5IP6A 1VQPI 1LDJA 2HGCA 2XAGA 2EZLA 2LY1A 2DT6A 5LHHA 4B48A 1Y39A 1LB2A 1PUEE 5JVGF 2H1KA 2IBDA 2KRFA 2DCEA 2ID3A 3HEFA 4KIBA 4UUVA 2R7TA 3G2BA 1W4MA 4PJMA 4AYBN 2B7EA 2DO7A 1J75A 2PJRA 5EEGA 1F9NA 1HQCA 3NARA 2BXYA 3KP7A 4PZJA 2HOSA 4G7OF 2K9LA 4HNVA 2LBFA 1MKMA 4KITB 2OJED 3F23A 5K5QA 3HOWJ 1IRZA 1QZEA 1STZA 3M8FA 2A5WA 4C3HJ 2DBBA 3HG9A 1JJ8C 2FF4A 5F27A 1MBKA 2FOWA 2JZYA 4CICA 3K7AJ 3CCEI 3FMQA 4CGZA 2V9VA 2XROA 3GX4X 4ZJZA 2JWTA 1WGXA 3A1YA 5LGTA 4L5IA 2O3FA 1E3PA 3F6VA 1RESA 5FO5A 2YX7A 1IRFA 3L00A 1DUXC 3J7AO 1ENHA 3IRRA 2BGCA 4NNJA 2LVSA 2P5KA 4IX7A 2DMUA 3I4MJ 1YTYA 1N77A 2PX9A 2CS3A 2NVYJ 3SZGA 2Z1DA 4KIGA 2FJ1A 4ZYAA 3OYFA 3ERED 2AHQA 1ZGWA 2ZSIB 2R7XA 3DP7A 3SDBA 3GFMA 4EM1A 1VQ4I 2DFFA 3MZ8A 2STTA 3BDDA 5FRNA 4A3DJ 1DGRM 3ZQIA 4F3QA 1VQMI 3IL2A 2DDBA 3FM3A 2QQAA 2IS6A 4L5JA 2H8RA 1PYVA 4H4KC 5JR3A 3OR1C 3OYLA 1KYZA 2JMWA 3C1DA 1Z05A 4FX4A 4KYWA 3CJQB 4P5OA 5J4VA 3UKGA 3DU6A 3G1LA 2EFOA 1RZ4A 2Q2EA 5F04A 3R60A 3HHHA 2EZHA 3EQLF 4UVCA 2K40A 3OYMA 3OR2C 3QYBA 3CCQI 2HEOA 3GMEA 1U8RA 5GTIC 5FKKA 5E3LA 2HYGD 1ZRFA 4G94A 4Q48A 3SXYA 2VB6A 3U9GA 3WE2A 3ZPLA 3BR0A 5GAEJ 5M5WJ 5AIPA 3I64A 3KP2A 1X1AA 3PNYA 1BOAA 4OIRF 4B1RA 1N25A 2F4IA 2W84A 4LK1F 5L3CA 5HLIA 4YIIA 5TISC 3ZQCA 3S3MA 3ABLH 4D5CA 1VQ9I 1QPMA 2VONA 3FXRA 3Q3SA 4FE4A 1V5FA 2O5RA 4I7HA 4AVZA 4RS8A 3K4NA 3MWMA 3ZRGA 2XIGA 2GBYA 4U87A 1OLTA 4A6EA 1S3JA 2MFZA 3ULQB 1TTYA 2Q2EB 3B6CA 4LG3A 4A3IJ 1XN7A 4F91B 1U78A 4KISA 1ZH5A 2F48A 2E19A 1TW2A 3CJRB 3P5JA 1ZKGA 2IRFG 3RQ4A 1QA6A 1WPKA 1Z6RA 3ABKH 3WG7H 1XMAA 4CSWA 4PJLA 3K70D 1JUPA 2IS4A 1XC5A 3QRFF 3V8JA 1A5JA 1SAUA 2M0MA 5E8GA 4AVPA 4MNUA 2XUBA 2UV1A 3CO6C 4JX6A 5EGOA 2EIJH 1OMIA 1QHHD 2CGPA 4HRIA 2Z3YA 3U2RA 2L2OA 4DW6A 2ZBKA 2FBHA 2W24A 4WF2A 5D4SA 3TDUC 5J47A 4WXDA 2ZNYA 2D45A 5KVRA 2QENA 3JAMK 3L09A 1X1DA 4QIWN 4D1QA 2KMUA 1YQAA 5A2QK 4HSTA 1ZG1A 3VEPA 1TT5B 3IKVA 5DS9A 1I6HJ 3AFHA 5IP9J 3A4CA 1O3SA 4GGGA 2X4HA 4D9JA 1DP7P 3UR3C 4GYIA 4E70A 2OBPA 1R7JA 5E3NA 3H0GJ 2ECBA 2KFDA 4PGGA 2GXBA 3OYBA 4YFKF 1YLFA 2IT0A 3WHBA 1CGPA 3HJEA 3RPUA 1N75A 2KHMA 1UHSA 1P4WA 3MQ0A 1VF9A 1LVAA 3CUQA 2BY3A 3ECHA 2RREA 3TGNA 2HI3A 1AU7A 5JLWA 1E3HA 4R1HA 4RGRA 1A6QA 3PNVA 3BT9A 3GF2A 1ULYA 1B8IA 1X1CA 1F36A 3BR6A 2QQBA 3DEWA 4NDLA 2A61A 2EWNA 3DWLE 2L3DA 2Z5UA 4XLNF 1W1WE 5CKTA 1YRNB 4CA0A 1TWCJ 4ZC3A 2ME6A 4I6ZA 1MH4A 1IJWC 4A3GJ 2R3SA 2CJJA 1O3RA 4BQNA 3KLNA 1LKXA 2NVTJ 3HTSB 5F1JA 4OMZA 1BI1A 4XOTA 2BVMA 3BR3A 1L0OC 3I3LA 3R0AA 4GDFA 1LEAA 4O5VA 2UXNA 1SFUA 2HTSA 5JHUA 5IOZA 4BDZA 3T8RA 2ME0A 2ELHA 1K6YA 4IXAA 3WTYC 1MMGA 4BY1J 1IRGA 4UNOA 1R4MB 3CLOA 2LF8A 1TP4A 1YHQI 3I59A 2EILH 1HF0A 5K5RA 4G8XA 2L4AA 3OMYA 1VNDA 2KIMA 2XRNA 5FKLA 3BOQA 4ENJA 1P6RA 4GFBA 1G8XA 3C3WA 2DTRA 2J5PA 2XGCA 4PGHA 1J59A 1JJ6C 2A6HF 3HC7A 2MD0A 3J80Z 2G0EA 3EUHA 2L54A 2EFPA 4CCKA 2QWWA 4H0EA 3FXOA 4OU0A 5D5WB 4GRIA 1ZAOA 4KUMA 2VJ4A 3B6AA 1TZLA 4OIPF 3MKYB 3CJTB 2XF6A 2BW3A 3QYFA 2WTEA 1MMDA 4XORA 3RZOJ 3DF8A 3RKXA 1R1VA 4XRFA 2XF5A 2G7HA 4HQMA 2XHKA 1S7AA 4Y17A 2XF7A 2CW0F 4DQ2A 4ESJA 4OWRB 4DNCA 3DEEA 1IV6A 2XGEA 2YUSA 4QLCU 5L3FA 2QM3A 4CYCB 4CO8A 1JE8A 2I5UA 2VXDA 3AG3H 4HF0A 4XSXF 3SYTA 2IXSA 1RPWA 2PN6A 1WKMA 2CQXA 2VQCA 2VOPA 5ICEA 2H6BA 3KEQA 3WGGA 1TQMA 3LL7A 1OCTC 5JLXA 1MNDA 3O3KA 3HOTA 2MSYA 4HQEA 2ZJ2A 1TQPA 4IQJA 3S8PA 3GXOA 1X1BA 4F52A 1NK3P 3BCAA 3H92A 4XNFA 4U0YA 2GA2A 5CQEA 5FB2A 3ZOBA 1FY7A 4IRHA 5LLQA 4A3JJ 4L9NA 1A6IA 5ILSA 5GPCA 3GBGA 3KP6A 1AA7A 2X1DA 1G3WA 3JRGA 1FNNA 3WTTC 4LFUA 1MBFA 1ZGAA 2CUEA 6PAXA 2CRGA 4AYBA 1X19A 5KAFC 3JRDA 1FX7A 1ZREA 3QPHA 1ZN2A 3GFJA 1MZBA 1DGWY 3KYLA 2ZFUA 4RLFA 3H35A 4L5EA 4UV9A 5HS8A 2YPRA 3HKZN 4A3KJ 2M8GX 4E6KG 3A01A 5J1UA 2JN6A 1QNTA 4LIUA 4G6DA 4A93J 2D5VA 3LQRA 2QQ8A 1ZELA 3ZQ7A 3FX3A 3H3UA 4CYDA 2VC0A 5CVRA 1GT0C 4A3BJ 2Q1ZB 2PEXA 3ZXSA 4PSXA 2IEKA 3MZYA 1VI0A 3N97A 4U0WA 3DLLF 1DU0A 2OZ6A 1P2FA 2HXOA 1OYIA 1PUFA 4KMFA 4YFNF 2FQ4A 2K5CA 2GQQA 3QPTA 2FA5A 3TDZC 4XLAA 1HCRA 1BI3A 2UZKA 4HA8A 1FYKA 2BY1A 4ZDLA 4AIDA 5IYBJ 1U2WA 1CF7B 1B9MA 4DYRA 2X0LA 3KZIC 2LFBA 1LQ1A 2EB7A 4L9JA 2V1DA 3TOAA 5HNHA 3WTSC 2DT5A 1S5LC 1VQNI 5D5UB 2KISA 5BPIA 4B4CA 3SDGA 1RUNA 2M45A 2RAEA 4ITVA 1Y1WJ 2ESHA 4HG2A 3VODA 3TEDA 3HOXJ 1JT0A 1JGGA 3DKWA 2EPFA 3O2PE 4N9IA 1PJRA 1ETXA 2X51A 1GV5A 2ZKZA 1D8JA 2KRHA 3DXJF 3K69A 4ZYEA 3RKWA 1JKQC 3DTIA 4AIKA 5FLXZ 3M3YJ 3DKYA 3D1NI 1HW1A 2JUGA 3B73A 2Q8KA 1ITYA 4CXFA 1WJEA 1BW5A 2KDZA 1FWZA 4A12A 5EF6A 3LNQA 2HNHA 5ILVA 4EGZA 3IV5A 2ZXJA 4M72A 4IZZA 2ICWG 2WWYA 3QPLA 1SFXA 4AIJA 1J5YA 4ZTJA 3OIOA 5FKOA 2IA0A 3S14J 3LFUA 2JSCA 2GWRA 1S29A 1M1EB 1TWGJ 1LVKA 4CCOA 4XOPA 5D6FA 3W6KB 1GVDA 2Y31A 3F9KA 5LD2C 4KIFA 2Z9OA 4RGSA 1QQIA 2HQRA 2LKSA 3JTGA 3N4MA 4A3EJ 1R22A 2R7SA 1TL8A 3J81Z 4BH9A 3L2VA 3GWZA 1R58A 1WI3A 4NC7A 4EGYA 3G1OA 4X6AJ 4CUGA 1UAAA 4OMYA 3TQNA 1OCPA 1JT6A 5EG0B 3COAC 5HLGA 2P5VA 4KT6A 1IUFA 4KA4A 3HB9A 3L2CA 4C2TA 2E2IJ 1JXSA 2DA5A 1ZHFA 3OYCA 2EV5A 1FIPA 2R7FA 2OPTA 3ZMDA 4TV7A 5HLHA 1UZCA 2LKXA 4C2MJ 3PUFA 1KU9A 2DLLA 3KE2A 1FSEA 3ZN0A 3GZ6A 1VQOI 2OAZA 3GTMJ 1YOVB 2COBA 3LAJA 3AG4H 5CJ9A 1OISA 3PQKA 5LFAA 1XDSA 4N0BA 2HWVA 3V8KA 1TWAJ 2RGVA 1MNMC 3JRHA 2JQ7A 3HYIA 2ZMEB 3N05A 3O6BB 5LEJA 5IT9K 1W7PA 2P8TA 3Q9SA 1O7LA 4ANJA 3H0DA 1T6SA 1SC7A 4ESBA 3S1RJ 1OYWA 2F6CA 3KYDB 3E5UA 5K7ZA 3LMMA 4A3LJ 2QLZA 1WJCA 1VQ5I 4M9XA 3NWSA 3V7RA 3HUGB 3FXKA 3F8CA 1QGPA 1EH7A 4O6JA 4CDGA 2R0QC 2DA2A 1WHUA 2IVMA 4BYYA 2DJNA 2EQRA 2NS7A 2VODA 5LRRA 1SD5A 1F5TA 2CUZA 3WTUC 3CF5F 1G6NA 4ZZLA 3K9TA 2X6OA 1JUSA 1RI7A 2HKXA 1R36A 2ZMEC 3H36A 2LOOA 3RDIA 4F93B 1R71A 1LDKB 2HVSA 3OOUA 3H5NA 5D4RA 2EV6A 4ZYDA 2NRAC 1W36C 1WJ5A 3E6BA 1FP1D 2CU7A 3F72A 1S8NA 1DPRA 1MJ9A 3HIFA 1ZLJA 3BG3A 2HFHA 2WAEA 4PJNA 4EJTA 2K9QA 4HLYA 3ZP5A 4ZYHA 3K1NA 4M71A 2MLGA 2NOJB 4R8HA 2VJ5A 1X58A 1ACIA 2VQGA 2EFQA 1QZZA 4EQQA 1T33A 2ZJQF 1G2HA 2PJPA 5J3LA 3PFYA 3I9V2 2BHYA 3ZR8X 1D5VA 1Q1HA 2JTVA 2H1LA 1PP7U 1B9NA 2QYOA 2MH9A 2VT3A 4YIFA 3HOZJ 1OYYA 4LK0F 1A04A 4DJAA 3OYEA 1K78B 2KKOA 2FMLA 2DW4A 2NVQJ 2RNGA 3W3CA 1IDYA 2HVRA 4I76A 3TP0A 1Z9CA 1R1TA 2L9NA 4JX4A 2HPMA 1R1UA 4D7MA 4HDVA 4BEHB 2MBFA 2QA4I 1KU2A 2WV0A 2UXXA 4J01A 1T2KA 4BY7J 2NS0A 3FWEA 3L1PA 2LLKA 2FD5A 2QVOA 3CQZJ 3AKZA 4BBRJ 1MD0A 3PIPF 4XICA 1MSEC 1D0YA 4P96A 1J9IA 1FLIA 2A68F 2EJRA 2NAZA 1D0XA 2DPUA 5TRDA 4BNCA 3QOPA 2XGXA 1FYMA 1HXDA 4MTDA 2YU9J 1BW6A 3CMMA 1QZYA 3OYDA 2Z99A 3NWTA 2W1OA 5AONA 5FLVA 4X0GA 2DK5A 2MD5A 5DD4A 3S2WA 1PP8F 1JHFA 4LD5A 2A5YB 4EMSA 2VLAA 2KP6A 4CCNA 2R5YB 2Y30A 3P7NA 3RKQA 1JUMA 3U1DA 2CQ7A 1TW3A 1IGNA 3BP8A 3JREA 1GV2A 1MMAA 1IO2A 2OD5A 4GO1A 4BUPA 4CCMA 1D0ZA 1RRJA 3LSMA 1G3YA 1UHMA 1Y56A 2OTLI 4I0BA 1OCCH 3ZMZA 5BPDA 2P7CB 4B3XA 2QSGX 5ICGA 4HV6A 4IHVA 4FT8A 4M73A 2FQ3A 2C6YA 3AG2H 4DIQA 3CDHA 5J8FA 3KZZA 3JRIA 3TL4X 2WC2A 4Y15A 4XQFA 3WE3A 3S15J 4X1EA 1W5TA 1X2MA 4N4NB 4RB3C 3G73A 2VKHA 1NH3A 2K9SA 2JT1A 3AAFA 3FF5A 2FBIA 2VBXA 2K86A 2E35A 2WY8Q 4D7NA 3GCMA 2CW7A 2F5FA 2AO9A 4IVNA 2WB1A 2WADA 3JAMZ 3HSEA 1MIJA 2MLKA 3KP4A 3VYTB 3OY9A 4WX9A 1ZK8A 2FEZA 5FFZA 3LA7A 2CMPA 1IXSB 4EJOA 1MSFC 2I8DA 5BS6A 3M1EA 1ZG5A 5ICCA 2JPBA 3GTOJ 2HS5A 4LLLA 2ZB9A 2MH2A 2F4MB 1KYWA 4Y4RA 3K10A 3EDPA 1P7IA 2FSWA 3T0YA 3HKZA 2DQRA 3LSRA 2TRTA 2XDVA 2CQQA 3Q5FA 5CQGA 4KFCA 1VQ6I 4II2A 2LDUA 1KGSA 2D1HA 3H3VK 4A6DA 4KT5C 1WVRA 4JYKA 4F92B 3ASNH 3LSIA 2PBIA 1UG0A 3KP3A 2HXIA 2KZGA 4A3FJ 3MN2A 5C4JJ 3I56I 4MTEA 1W0UA 4RGUA 2VKVA 4ETSA 5M5YJ 5FD6A 3CESA 1L3LA 3KYCB 3MMYB 3P9CA 2IGNA 1ON1A 4IPAA 1BJAA 3EUKL 3QP6A 4HW0A 2LH9A 4EJUA 2EBIA 2QGUA 2EV0A 5DTDA 3L2RA 1APLC 1P7JA 1BR4A 4ON0A 5GAGJ 3DQVC 4J19A 3HOVJ 3S2DJ 2DOFA 4MLOA 3GO5A 4BGDA 3BZCA 1JI8A 4GCVA 3K4KA 2K9MA 3DKXA 4FCYA 1LE8A 3HRTA 2E2HJ 2OV7A 4W97A 1ETOA 4XBFA 4L0YB 2R7QA 1TBXA 4HSRA 3CMAI 2X85A 2GXAA 5C44J 1R9TJ 3L9FA 3BTJA 1ZQ3P 4OIQF 2PQ8A 3WG9A 2A3SA 1ZARA 3I0TA 3TMOA 4G6TB 1TWHJ 4DOZA 2IAIA 3CP8A 4JP0A 3LSJA 4L0ZB 1E0EA 2VE9A 2B9SA 5E8IA 2F5CA 1P4XA 3SJMA 3I5UA 4RAFA 4I98B 1F4KA 2XAJA 2LREA 3MKWB 1IC8A 4II3A 4DYCA 1ZRDA 4A69C 5ERIA 1BBYA 4P9UA 2QSFX 3ELKA 3U21A 3S1QJ 1J0RA 1IN5A 2BV6A 3FBNB 3GTJJ 1LE8B 4C9YA 2MABA 1K79A 1BR2A 1H8AC 1YRNA 2O9LA 3REOA 1ERDA 2O0YA 2BZTA 1U6GA 1V55H 1W5CC 3J7AY 1XTAA 3JTHA 1ZRCA 2VUMJ 2IGKA 2IPQX 1IF1A 4G7ZF 2HQNA 2HKOA 3LQQA 2DYSH 2FU4A 4WWCA 4BL0B 5F0FA 2W85A 4M9SA 1V5EA 3SFZA 4RBOA 2OZUA 2AQEA 3OSFA 2LC2A 3H9GA 1BIAA 3FK6A 1R00A 4UUTA 1ZGJA 2EH3A 5FROA 2QBYB 2V79A 4L9VA 2KIFA 2Y2ZA 1HC8A 2HR3A 1S6LA 5BOXA 1WRJA 4E7JA 4IOAF 2E7XA 3LA3A 5J1RA 4CCJA 4Q47A 1KQ0A 3FISA 2R7UA 3G3ZA 3MD2A 5DYMA 3K4JA 2FX0A 1DP3A 2JK3A 2D2WA 3R0JA 3WGIA 3HTUA 2VQLA 2R4GA 2VC1A 4ZDPA 2K27A 3CDIA 3IHUA 4DZPA 4LB5A 1EV7A 5LGNA 2DA6A 4RB0A 2DFIA 1RETA 4KICA 4LG0B 2PMHA 1XGOA 3E5QA 1QO0D 3NAUA 4EV0A 2AQFA 4EM0B 2DOAA 1Z21A 1HKSA 5DD8A 1IZ1A 4NBQA 1FJLA 1ONVA 2H09A 1VQKI 3GFIA 2JRTA 4CYCA 3JCUC 2E1NA 4MQ9F 3O8GA 2O61A 3K2ZA 1YJ9I 4OOIA 3F21A 2E5ZA 4BHCA 4KDPA 3CCYA 2VT2A 1MBHA 3IH3A 2M87A 2EZKA 3QPSA 5FRMA 1AOYA 3A02A 3TOBA 2HOEA 2LD5A 3F22A 3OYIA 2Y48A 3WU1B 2VN2A 2M2EA 1I1SA 3K0LA 1FMWA 2HYFA 1IG7A 3KCCA 4E7HA 2UUZA 3F8FA 2DAOA 1X4PA 5BQTA 1RIOH 3AL0B 2FRHA 3OOPA 4C3JJ 2R7DA 1GLNA 2ACJA 4RM2A 1J09A 3S17J 4EVIA 1QVTA 3ESWB 3DLAA 3H5AA 1ZR4A 4BXXJ 4IHXA 3WHCA 3X2QH 3K4MA 3LSGA 1REPC 1SVMA 2HTJA 1R4NB 2LYCA 4XR6A 3BTIA 4HF2A 1TC3C 1OKRA 3RI4A 3M9AA 2NOGA 3CTAA 1U8BA 3HGGA 1QU3A 4Y7NJ 5GTHC 3GZNB 1KQ8A 5BMZA 1OPCA 4UB6C 3ZQFA 4M6XA 3H9QA 3M07A 4YFXF 3BR1A 5CLSA 3AL0C 4IO9F 1JKPC 3BQZA 4G9YA 1NHAA 4IEJA 2W7NA 4UVBA 1TT0A 2L4MA 2V1UA 2DQLA 4XKWA 3GTLJ 1U5TB 1K4SA 1SMTA 1I1GA 4MGRA 2B0LA 5F0CA 3WTVC 3PIOF 4PK4A 3GLXA 2DOEA 3HPHA 2EA2A 1R23A 3I71A 1FTZA 2GAUA 2W48A 3V42A 2QSHX 3RTRA 5GP9A 2EIKH 2VE8A 5L3DA 2XB0X 3BG5A 1XSVA 2X6YA 5EDNA 2YR2A 2N8GA 3RCOA 3FHNA 1ZR2A 1CF7A 2HZTA 2CYYA 3GTGJ 1A35A 3RIRA 3ZQGA 3BTLA 1MH3A 5M3MJ 1U5TC 2DYRH 4BDYA 2ELKA 2L0KA 4RAYA 4HDUA 2DMNA 2L9RA 2ZXIA 1XG1A 5D5VB 5EZGA 1KONA 3ASOH 1A36A 2QQ9A 3OL3A 2XAFA 3QODA 5TJJA 3HM5A 3ZN1A 1LPQA 4L9TA 1OR7A 3EUAA 5HDGA 3CCJI 1BOBA 2K7LA 3BTCA 4DBQA 3OS2A 2RC4A 3W2WA 1SVLA 3RYRA 3ZQLA 1YITI 2E71A 1UG2A 2DN0A 2B63J 2R5ZB 3ZMSA 3MZHA 1Z91A 4MFDA 3C2HA 2EA4A 3DFGA 4I01A 2X1CA 4MIMA 1OCZH 1W36D 3DEUA 3HZJA 2CW8A 5LHIA 3G71I 3HOYJ 3QU6A 4IL6C 3CCUI 1Y8QB 2FMYA 3IAS2 3WU0A 3V7CA 2Y0MA 4EATA 1HOMA 4ZZDA 2XB5A 4F55A 2M9HA 4IHTA 4ZTFA 1ODDA 5L3EA 1MJBA 5CPRB 1O7FA 4V19K 5J4YA 2JA5J 1H88C 2E60A 2DK8A 2W25A 3G1MA 3TBIA 1QRYA 4NC6A 1UHWA 4HOBA 3DBHB 1Z3XA 4Y33A 1R5ID 1BM9A 2Y9ZA 3C7JA 2CUJA 1W0TA 1GXPA 1KQ9A 2KJBA 3CJNA 4HX4A 2XKPA 4M6YA 2CV2A 1YE9A 1IN8A 1XMXA 2F5EA 3E97A 1PDNC 4XLEA 2XAQA 2JSPA 4KMUX 2HQAA 4LIVA 4BXFA 1MDMB 2L7ZA 4XKCA 3LSTA 1R5HA 5EG0A 1LDDA 2QUFA 4QPQA 1ETKA 3F6OA 2CWEA 4EM2A 1YW9A 5CVIA 1EA3A 3MKZA 3OL4A 2VI6A 1U0JA 1G3TA 5JI6A 4C30A 2F2EA 4BJTA 1V3FA 3FM5A 1K61A 1RC9A 5HOOA 3R6SA 5KK1A 2HVQA 3H3ZA 3W2AA 3ROUA 1WH5A 1U9OA 4IQ4A 3QYEA 5B66C 3CMEI 2PMZN 3GZ5A 3LOCA 2MYSA 4AUXA 3FZVA 4BXUA 2OF7A 1USSA 4G7HF 2ZMEA 4E7LA 3A0HC 1SD7A 2Y9YA 1DDNA 3I58A 1YW7A 3FBIB 3JRFA 3KX2A 1EH6A 1EH8A 2XPUA 1S7EA 2E7WA 5K7HA 2IA2A 1O3QA 2R93J 2FNAA 3HUGA 4D5FA 2J5OA 5F64A 1XB4A 3IH4A 3GFLA 5F08A 3GTPJ 3BC8A 1RR7A 3L7WA 1AKHB 1UFMA 3CCRI 3BQYA 2XC7A 4XM3A 3BROA 1H9GA 3FXJA 3E6DA 4M3DA 1AHDP 3S3NA 4NC8A 4N9HA 2YX4A 4FETA 4RB2C 3BPXA 3FKJA 4W1UA 4S0HB 2ZJRF 1CQTA 2IS1A 1WWXA 3ECOA 4FE7A 2O03A 2PI0A 4RLQA 4I09A 5DV5A 4O3MA 4UUSB 1I3QJ 4DGWB 3SQNA 5C3EJ 2M5WA 5EZHA 1SD4A 1HDPA 2L7KA 2X9DA 1RKTA 1XSXA 2L9VA 1T0FC 4NQWB 3DTKA 5GADJ 2LRDA 2MC3A 2JA6J 1X3ZB 2VBWA 3PUBA 1BC7C 4LOCA 1G3SA 1O4XA 3K2AA 1BC8C 4A5NA 2M7BA 2XPWA 2Z33A 1XCBA 1SFOJ 3ZMUA 3QAHA 3TW7A 2WY7Q 5HS9A 2RV8A 5EEAA 3PFIA 2P6SA 2GXGA 2D1VA 1B1BA 3DCFA 3ZQHA 5FLMJ 1K78A 1MBEA 3VWBA 3S1MJ 3KLOA 3GTQJ 3ML6A 1YJNI 2BHZA 4CHUA 2YSRA 2FUG2 5H6RA 3HGYA 4HNTA 1BJZA 4ENNA 2RQPA 4BEHA 2M4KA 4XLFA 2MW8A 3E6MA 1B72A 4BJ5C 1MBJA 1ZYRF 1HW5A 4UHTA 5J40A 3TKYA 4YIRX 1IRXA 4G6QA 2X6WA 4XN3A 3F8NA 5ED4A 2OA4A 2DDAA 4BBSJ 5FKMA 1QHGA 3BR2A 2FE3A 2OUMA 2L9SA 3H1CA 5FLXK 3H9JA 4IHWA 2R7WA 3S93A 2OCEA 4YEJA 5K7FA 4CCLA 2W4SA 2R5YA 3T5XA 1FIAA 3JR9A 4CZCA 1IXCA 5CVVA 1XD7A 4KN4X 4E7SA 2X1EA 3G6EI 3AG1H 2LTPA 4P1WA 3VPRA 1SAXA 2CSOA 1Z7UA 2GIVA 3VB2A 3ZMVA 2VKEA 3MKLA 1G59A 2EFWA 1I5ZA 2LKPA 3KEYA 1I6XA 1B72B 3HOSA 1FOWA 2DA1A 2K3FA 2M0CA 4GXOA 1LUJB 1D1BA 2IA1A 2QKMB 5DCMA 2IGOA 2RNJA 4BQQA 2JJ7A 5KAIC 1IN6A 2Z16A 3C2BA 3GW2A 3K4BA 4OAYA 4BJ6C 1WJAA 2ZCWA 1OJLA 2IW5A 1YYVA 1KA8A 2LSOA 1P4AA 2DA4A 3NQOA 4V2FA 3CUOA 4XN0A 3J81K 1H9TA 1RUOA 1S7OA 2XRLA 2IJLA 3KIOA
chains in the Genus database with same CATH topology
1YIOA 1HKTA 2GA1A 1IW7F 1QBJA 2RKHA 4LLGF 3B02A 3HHGA 4HV5A 1F1ZA 2ISYA 4QWQA 2CG4A 4MHGA 3SZTA 4LGWA 3RKYA 1C0WA 1FBSA 2M30A 5DCMB 2BYVE 5L3GA 1FSHA 2NYXA 5JVTA 1VTNC 3GUDA 2BE5F 3GVAA 1UCRA 4A0XA 2TDXA 1TNSA 5CYVA 5A2QZ 4IRGA 1DPUA 4B8XA 2FOKA 4PCQA 2BEOA 4K2EA 1USTA 4EJWA 1GHCA 2DU9A 3JSPA 1LNWA 3KETA 3R4KA 3JSOA 5L3BA 2LNBA 2VBYA 4KNYA 2ZNZA 5LGUA 2BBYA 1HKQA 2PG4A 4LJZF 3R61A 4ESFA 4WCGA 1E17A 3K1MA 2XASA 2OU2A 5HDNA 1KU7A 5ICFA 4ASNA 1B59A 3EETA 3SZPA 4M9ZA 2XV4S 2VXZA 1XGSA 4D0PA 3P9KA 2K4JA 4S04A 5HS7A 3EYIA 4MEXF 1K6OA 3GEZA 1UB9A 2RVCA 5HVQC 4RGXA 5AIQA 4F7ZA 2ZO4A 4U88A 3JW4A 4FX0A 1IAWA 2QBYA 4Z2YA 1YO5C 4Q4ZF 3IWFA 5F6FA 4HAMA 2P6TA 1T39A 4ENKA 3DPTA 2CFXA 1XDUA 2Q0OA 4I2OA 4LG0A 3MAJA 4ZH4F 4MQVA 3BZ6A 2VOOA 2FXAA 2P4WA 4RB1A 4AIHA 2AS5F 2PFBA 3Q9VA 4BHPA 1SD6A 5D5XB 5ILUA 5JFRA 2OQRA 4UVAA 1T98A 3FXQA 5HDKA 5FFXA 3KEOA 3F8BA 1V4RA 4I0AA 1TLHB 5K5OA 1FP2A 2FBKA 1XSDA 1LEBA 1FC3A 2ISZA 2V6CA 2G9WA 3M7GA 3BJOA 3TO7A 2YU3A 4XLPF 4JQFA 2H27A 4ENMA 5D8LB 2GZWA 2KIUA 3FMSA 3VOEA 2H6CA 3QP5A 1FT9A 4HLXA 1U5TA 3BPVA 3ABTA 3V7SA 4S05A 3LA2A 1YFHA 4HF1A 2COMA 3CUQB 2PMUA 2HDCA 4KN7X 1KU3A 2L02A 1SFEA 1BN5A 1R5GA 2FNPA 4HYEA 3K1PA 2JPCA 3V4GA 4NB5A 1J7KA 1GVJA 2CQKA 2ETHA 2NNNA 1GXQA 4IHSA 3ZMTA 3LFKA 3T1BA 3WTXC 5E18F 1K7AA 5H20A 2Y75A 1J2XA 3CUQC 1W5SA 5FGMA 4AWXB 3RYPA 2DPDA 3FMRA 4BQAA 2EFNA 1Z6TA 1HBXG 5E17F 3IWZA 5LRSA 3IKTA 3I59B 1T38A 1HSTA 3NRVA 3DV8A 3OV8A 4HX8A 5J6XA 3ISPA 2XVCA 1XMKA 2H94A 2STWA 1X3UA 3HSRA 5J8CA 5D6EA 4ZYGA 2VBZA 5LHGA 5E1ZB 2IP2A 4I02A 1P92A 1WI9A 3D5LA 3V8LA 1YS6A 1AWCA 4U7DA 1D3YA 5IT3A 1I27A 1G4DA 1MJAA 2P5LC 4U7BA 1Y0UA 3GYHX 1MDMA 4Q5SF 3I4PA 3WTWC 2O6GE 4Y13A 1IN4A 4WXCA 4A2UA 5K1YA 2ADUA 1FZPB 5IT9Z 1LJ9A 5CVJA 3LWFA 2QZ8A 3D0SA 3W6JB 1BI2A 1HSJA 2DI3A 5E1XA 1XGNA 2MA3A 1XGMA 3E3VA 1WQ2A 2M8EA 4JBAA 2W57A 4RAZA 3F3XA 3TO9A 4BAYA 3EYYA 5DUIA 3M8EA 3TO6A 3J80K 1JGSA 3IRQA 4A0YA 4A5MA 5H6QA 1H0MA 3WGHA 2E1CA 3T8TA 1Z1DA 4JK1X 5DCFA 1T0FA 1XCVA 4IF4A 3MCZA 5DEQA 2K4BA 3FXUA 3SHFA 5LEKA 4P55A 1YG2A 4OINF 3LAPA 4M74A 2V1XA 4A0ZA 1BIBA 4IRIA 1HW2A 1W7PD 4LB6B 4NHJA 4GYGA 4NQWA 2ZFWA 4R79A 1TNTA 1WSUA 5DUKA 1B6AA 1JHHA 4UV8A 3BJAA 1FBQA 3IC7A 2G7UA 1RNLA 5F1RA 1O57A 3HRUA 2AXLA 1E2XA 2M1BA 4L18B 4EJVA 4OIOF 1BI0A 3DPLC 1U3EM 2NNYA 1O3TA 4XSZF 3RJPA 2A69F 4FHTA 3HSFA 1IUYA 5D8KB 3HRSA 1IN7A 3F8MA 3P9IA 4YG2F 2RN7A 2CO5A 4WK8F 4LLNA 2KJCA 4HBLA 3QU3A 2P7VB 2XKOA 4IJAA 1FBUA 1YS7A 1FPQA 2L01A 3RPQA 2EK5A 4UXNA 4BHBA 1D8KA 1IXRC 2PLYA 3HRMA 4P9FA 4LMYA 1YW8A 2ESNA 5EEHA 4PDKA 3VFZA 3MEXA 3KZYA 3ABUA 3WODF 3I54A 2OQGA 1TQIA 4CZZA 4AD9A 3E5XA 3MFKA 1ON2A 3BWGA 2RDPA 4HZFA 5E1WA 2XAHA 3CO7C 1MGTA 1W7PB 5FD5A 2O8XA 3PQJA 1FYLA 1ZG3A 5DDGA 5CVUA 1ZLKA 3C18A 3KP5A 4HX7A 5E20A 3FHZA 2UWMA 3KFWX 3I53A 2K02A 3WTZA 1FOKA 1SMYF 2A6EF 4B09A 5LBQA 4MEYF 2A07F 4WXHA 2F5DA 4U0VA 1B4AA 3NEUA 3E6CC 2LF7A 3BY6A 3BJ6A 1LDJA 2HGCA 2XAGA 5LHHA 1LB2A 1PUEE 2KRFA 4KIBA 4UUVA 1W4MA 2DO7A 1J75A 5EEGA 1F9NA 1HQCA 4PZJA 3KP7A 4G7OF 1MKMA 3F23A 5K5QA 1STZA 3M8FA 2DBBA 2FF4A 2JZYA 4CICA 3FMQA 4CGZA 2V9VA 2XROA 3GX4X 5LGTA 4L5IA 2O3FA 3F6VA 5FO5A 2YX7A 1IRFA 3L00A 1DUXC 3J7AO 3IRRA 2BGCA 2P5KA 1YTYA 4KIGA 3ERED 3DP7A 3GFMA 4EM1A 2STTA 3BDDA 3IL2A 3FM3A 2QQAA 4L5JA 5JR3A 1KYZA 3C1DA 1Z05A 4FX4A 4KYWA 4P5OA 2EFOA 1RZ4A 2Q2EA 3R60A 3HHHA 3EQLF 4UVCA 2HEOA 1U8RA 2HYGD 1ZRFA 4G94A 4Q48A 3SXYA 3U9GA 3WE2A 3ZPLA 5AIPA 3I64A 3KP2A 1BOAA 4OIRF 2W84A 4LK1F 5L3CA 5HLIA 4YIIA 1QPMA 2VONA 3FXRA 4I7HA 4RS8A 3MWMA 2XIGA 4A6EA 1S3JA 3ULQB 1TTYA 1XN7A 1U78A 1ZH5A 1TW2A 2IRFG 1Z6RA 1XMAA 3QRFF 3V8JA 5E8GA 4AVPA 4MNUA 2XUBA 3CO6C 1OMIA 2CGPA 2Z3YA 3U2RA 2ZBKA 2FBHA 2W24A 4WF2A 5D4SA 3TDUC 4WXDA 2ZNYA 2D45A 5KVRA 3JAMK 2QENA 3L09A 1YQAA 5A2QK 1ZG1A 3VEPA 3IKVA 1O3SA 4GGGA 2X4HA 1DP7P 4GYIA 4E70A 2OBPA 1R7JA 4PGGA 2GXBA 4YFKF 1YLFA 2IT0A 1CGPA 3RPUA 1P4WA 3MQ0A 1LVAA 3CUQA 3ECHA 3TGNA 4R1HA 4RGRA 3GF2A 1ULYA 2QQBA 2A61A 2EWNA 2L3DA 2Z5UA 4XLNF 2R3SA 1O3RA 3KLNA 3HTSB 4OMZA 1BI1A 1L0OC 3R0AA 1LEAA 4O5VA 2UXNA 1SFUA 2HTSA 5JHUA 3T8RA 2ELHA 4IXAA 3WTYC 1IRGA 4UNOA 3CLOA 2LF8A 3I59A 5K5RA 4G8XA 2L4AA 2XRNA 2KIMA 3BOQA 4ENJA 1P6RA 3C3WA 2DTRA 2J5PA 1J59A 4PGHA 2A6HF 3J80Z 3EUHA 2L54A 2EFPA 2QWWA 4H0EA 4OU0A 5D5WB 1ZAOA 4KUMA 4OIPF 2WTEA 3DF8A 3RKXA 1R1VA 4XRFA 2G7HA 4HQMA 2XHKA 1S7AA 4Y17A 2CW0F 4DQ2A 4ESJA 4DNCA 4QLCU 5L3FA 2QM3A 4CO8A 1JE8A 4XSXF 4HF0A 2PN6A 1WKMA 2VOPA 5ICEA 2H6BA 3KEQA 3WGGA 1TQMA 3O3KA 3HOTA 4HQEA 2ZJ2A 1TQPA 3GXOA 3H92A 4U0YA 2GA2A 5FB2A 1FY7A 4IRHA 5LLQA 4L9NA 5ILSA 3KP6A 1G3WA 1FNNA 3WTTC 4LFUA 1ZGAA 6PAXA 1FX7A 1ZREA 3QPHA 1ZN2A 3GFJA 1MZBA 4UV9A 5HS8A 2YPRA 1QNTA 4G6DA 3LQRA 3ZQ7A 3FX3A 3H3UA 4CYDA 2VC0A 5CVRA 2PEXA 3MZYA 3N97A 4U0WA 2OZ6A 1P2FA 1OYIA 4KMFA 4YFNF 2GQQA 3QPTA 2FA5A 3TDZC 1BI3A 2UZKA 4HA8A 1FYKA 1U2WA 1CF7B 1B9MA 2X0LA 1LQ1A 2EB7A 4L9JA 2V1DA 3TOAA 3WTSC 2DT5A 5D5UB 5BPIA 1RUNA 2M45A 2ESHA 3VODA 3DKWA 3O2PE 4N9IA 2ZKZA 1D8JA 3DXJF 3K69A 4ZYEA 3RKWA 4AIKA 5FLXZ 1HW1A 3B73A 2Q8KA 4CXFA 1FWZA 4A12A 4EGZA 5ILVA 2ZXJA 4M72A 2WWYA 1SFXA 4AIJA 1J5YA 2IA0A 2JSCA 2GWRA 1S29A 5D6FA 3W6KB 2Z9OA 4KIFA 4RGSA 1QQIA 2HQRA 3JTGA 3N4MA 1R22A 3J81Z 4BH9A 3GWZA 1R58A 4EGYA 4OMYA 3TQNA 3COAC 5HLGA 2P5VA 4KA4A 3L2CA 1JXSA 1ZHFA 2EV5A 2R7FA 3ZMDA 4TV7A 5HLHA 1KU9A 2DLLA 3KE2A 1FSEA 3ZN0A 3GZ6A 2OAZA 3LAJA 5CJ9A 3PQKA 1XDSA 4N0BA 2HWVA 3V8KA 2RGVA 3HYIA 2ZMEB 5LEJA 3O6BB 5IT9K 1W7PA 2P8TA 3Q9SA 1O7LA 1T6SA 4ESBA 1OYWA 3E5UA 2QLZA 4M9XA 3V7RA 3F8CA 1QGPA 1EH7A 4O6JA 4CDGA 2IVMA 4BYYA 2VODA 5LRRA 1SD5A 1F5TA 3WTUC 1G6NA 4ZZLA 3K9TA 1RI7A 2HKXA 1R36A 3RDIA 1LDKB 4ZYDA 5D4RA 2EV6A 2NRAC 3E6BA 1FP1D 3F72A 1S8NA 1DPRA 1MJ9A 3HIFA 1ZLJA 2HFHA 4EJTA 4HLYA 3ZP5A 4ZYHA 3K1NA 4M71A 2MLGA 4R8HA 2EFQA 1QZZA 4EQQA 2PJPA 1D5VA 1Q1HA 2JTVA 1PP7U 1B9NA 2QYOA 2MH9A 2VT3A 4YIFA 1OYYA 4LK0F 1A04A 1K78B 2KKOA 2FMLA 2DW4A 1Z9CA 1R1TA 1R1UA 4HDVA 2MBFA 1KU2A 2WV0A 2UXXA 1T2KA 2NS0A 3FWEA 2QVOA 1MD0A 4P96A 1J9IA 1FLIA 2A68F 2EJRA 2NAZA 2DPUA 5TRDA 4BNCA 3QOPA 2XGXA 1FYMA 1HXDA 4MTDA 1QZYA 2Z99A 5AONA 2DK5A 2MD5A 5DD4A 3S2WA 1PP8F 1JHFA 4LD5A 2A5YB 4EMSA 3P7NA 3U1DA 1TW3A 3BP8A 4GO1A 2OD5A 1G3YA 1UHMA 4I0BA 3ZMZA 5BPDA 2P7CB 5ICGA 4HV6A 4FT8A 4M73A 2FQ3A 2C6YA 5J8FA 3CDHA 3KZZA 2WC2A 4Y15A 3WE3A 1W5TA 4RB3C 3G73A 2JT1A 3AAFA 3FF5A 2FBIA 2VBXA 2K86A 2F5FA 4IVNA 3JAMZ 3HSEA 2MLKA 3KP4A 4WX9A 2FEZA 5FFZA 3LA7A 1IXSB 4EJOA 5BS6A 3M1EA 1ZG5A 5ICCA 2JPBA 2HS5A 4LLLA 2MH2A 1KYWA 3EDPA 2FSWA 3T0YA 3Q5FA 2DQRA 4KFCA 2LDUA 1KGSA 2D1HA 4A6DA 4KT5C 2PBIA 3KP3A 4MTEA 4RGUA 4ETSA 5FD6A 1L3LA 3P9CA 1ON1A 4IPAA 1BJAA 3QP6A 4HW0A 4EJUA 2EV0A 4ON0A 3DQVC 3GO5A 4GCVA 3HRTA 4L0YB 4XBFA 1TBXA 3L9FA 4OIQF 2PQ8A 3WG9A 2A3SA 1ZARA 3I0TA 4L0ZB 2VE9A 5E8IA 2F5CA 1P4XA 3I5UA 4I98B 1F4KA 2XAJA 1ZRDA 5ERIA 1BBYA 4P9UA 3ELKA 1J0RA 1IN5A 2BV6A 1K79A 3REOA 2O0YA 1U6GA 3JTHA 1ZRCA 2IPQX 1IF1A 4G7ZF 2HQNA 2HKOA 3LQQA 2FU4A 4WWCA 2W85A 4M9SA 3SFZA 2OZUA 1BIAA 1R00A 2QBYB 1ZGJA 2V79A 4L9VA 2KIFA 2HR3A 1S6LA 5BOXA 1WRJA 2E7XA 3LA3A 4Q47A 1KQ0A 3G3ZA 5DYMA 2D2WA 3R0JA 3WGIA 3HTUA 2VC1A 2K27A 4LB5A 3IHUA 1EV7A 5LGNA 4RB0A 2DFIA 4KICA 4LG0B 2PMHA 1XGOA 3E5QA 1QO0D 4EV0A 4EM0B 1HKSA 5DD8A 1IZ1A 1ONVA 2H09A 3GFIA 2JRTA 2E1NA 4MQ9F 2O61A 3K2ZA 4OOIA 3F21A 4BHCA 4KDPA 2VT2A 2M87A 1AOYA 3TOBA 2HOEA 3F22A 2Y48A 3WU1B 2VN2A 1I1SA 3K0LA 2HYFA 3KCCA 3F8FA 5BQTA 2DAOA 1RIOH 2FRHA 3OOPA 2R7DA 2ACJA 4EVIA 1REPC 2HTJA 4HF2A 1OKRA 3RI4A 3M9AA 3CTAA 1KQ8A 5BMZA 1OPCA 4M6XA 4YFXF 5CLSA 4G9YA 1NHAA 4UVBA 2L4MA 2V1UA 2DQLA 1U5TB 1SMTA 1I1GA 4MGRA 2B0LA 3WTVC 3GLXA 2EA2A 1R23A 3I71A 2GAUA 3RTRA 2VE8A 5L3DA 1XSVA 2YR2A 1CF7A 2HZTA 2CYYA 3RIRA 1U5TC 4RAYA 4HDUA 5D5VB 2QQ9A 2XAFA 5TJJA 3ZN1A 4L9TA 1OR7A 5HDGA 2K7LA 2RC4A 3RYRA 3ZMSA 3MZHA 1Z91A 2EA4A 3DFGA 4I01A 3DEUA 5LHIA 3QU6A 2FMYA 3WU0A 3V7CA 2Y0MA 4ZZDA 4IHTA 1ODDA 5L3EA 1MJBA 1O7FA 2DK8A 2W25A 1UHWA 4HOBA 1BM9A 3C7JA 1GXPA 1KQ9A 2KJBA 3CJNA 4HX4A 2XKPA 4M6YA 1IN8A 2F5EA 3E97A 1PDNC 2XAQA 4KMUX 1MDMB 3LSTA 1R5HA 1LDDA 2QUFA 3F6OA 2CWEA 4EM2A 1YW9A 5CVIA 1G3TA 5JI6A 2F2EA 1V3FA 3FM5A 5HOOA 3R6SA 5KK1A 3H3ZA 3ROUA 3GZ5A 3FZVA 4BXUA 1USSA 4G7HF 2ZMEA 1SD7A 1DDNA 3I58A 1YW7A 1EH6A 1EH8A 2E7WA 2IA2A 1O3QA 2FNAA 3HUGA 2J5OA 5F64A 1XB4A 3GFLA 3L7WA 1UFMA 3BROA 1H9GA 3E6DA 4N9HA 2YX4A 4RB2C 3BPXA 1WWXA 3ECOA 2O03A 2PI0A 4I09A 5DV5A 4O3MA 3SQNA 2M5WA 1SD4A 1XSXA 2MC3A 2VBWA 1BC7C 1G3SA 1BC8C 4A5NA 2Z33A 1XCBA 3ZMUA 3QAHA 5HS9A 2RV8A 3PFIA 2P6SA 2GXGA 2D1VA 1B1BA 1K78A 3KLOA 3ML6A 4CHUA 2YSRA 5H6RA 4ENNA 2RQPA 3E6MA 1ZYRF 1HW5A 4UHTA 3TKYA 4G6QA 3F8NA 5ED4A 2OA4A 2FE3A 5FLXK 3T5XA 1IXCA 5CVVA 1XD7A 4KN4X 1SAXA 2CSOA 1Z7UA 2GIVA 3VB2A 3ZMVA 2EFWA 1I5ZA 2LKPA 1I6XA 3HOSA 4GXOA 2IA1A 5DCMA 2RNJA 1IN6A 3GW2A 2ZCWA 2IW5A 1YYVA 1KA8A 2LSOA 1P4AA 3NQOA 3CUOA 3J81K 1H9TA 1RUOA 1S7OA 2IJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIO A;  1HKT A;  2GA1 A;  1IW7 F;  1QBJ A;  2RKH A;  4LLG F;  3B02 A;  3HHG A;  4HV5 A;  1F1Z A;  2ISY A;  4QWQ A;  2CG4 A;  4MHG A;  3SZT A;  4LGW A;  3RKY A;  1C0W A;  1FBS A;  2M30 A;  5DCM B;  2BYV E;  5L3G A;  1FSH A;  2NYX A;  5JVT A;  1VTN C;  3GUD A;  2BE5 F;  3GVA A;  1UCR A;  4A0X A;  2TDX A;  1TNS A;  5CYV A;  5A2Q Z;  4IRG A;  1DPU A;  4B8X A;  2FOK A;  4PCQ A;  2BEO A;  4K2E A;  1UST A;  4EJW A;  1GHC A;  2DU9 A;  3JSP A;  1LNW A;  3KET A;  3R4K A;  3JSO A;  5L3B A;  2LNB A;  2VBY A;  4KNY A;  2ZNZ A;  5LGU A;  2BBY A;  1HKQ A;  2PG4 A;  4LJZ F;  3R61 A;  4ESF A;  4WCG A;  1E17 A;  3K1M A;  2XAS A;  2OU2 A;  5HDN A;  1KU7 A;  5ICF A;  4ASN A;  1B59 A;  3EET A;  3SZP A;  4M9Z A;  2XV4 S;  2VXZ A;  1XGS A;  4D0P A;  3P9K A;  2K4J A;  4S04 A;  5HS7 A;  3EYI A;  4MEX F;  1K6O A;  3GEZ A;  1UB9 A;  2RVC A;  5HVQ C;  4RGX A;  5AIQ A;  4F7Z A;  2ZO4 A;  4U88 A;  3JW4 A;  4FX0 A;  1IAW A;  2QBY A;  4Z2Y A;  1YO5 C;  4Q4Z F;  3IWF A;  5F6F A;  4HAM A;  2P6T A;  1T39 A;  4ENK A;  3DPT A;  2CFX A;  1XDU A;  2Q0O A;  4I2O A;  4LG0 A;  3MAJ A;  4ZH4 F;  4MQV A;  3BZ6 A;  2VOO A;  2FXA A;  2P4W A;  4RB1 A;  4AIH A;  2AS5 F;  2PFB A;  3Q9V A;  4BHP A;  1SD6 A;  5D5X B;  5ILU A;  5JFR A;  2OQR A;  4UVA A;  1T98 A;  3FXQ A;  5HDK A;  5FFX A;  3KEO A;  3F8B A;  1V4R A;  4I0A A;  1TLH B;  5K5O A;  1FP2 A;  2FBK A;  1XSD A;  1LEB A;  1FC3 A;  2ISZ A;  2V6C A;  2G9W A;  3M7G A;  3BJO A;  3TO7 A;  2YU3 A;  4XLP F;  4JQF A;  2H27 A;  4ENM A;  5D8L B;  2GZW A;  2KIU A;  3FMS A;  3VOE A;  2H6C A;  3QP5 A;  1FT9 A;  4HLX A;  1U5T A;  3BPV A;  3ABT A;  3V7S A;  4S05 A;  3LA2 A;  1YFH A;  4HF1 A;  2COM A;  3CUQ B;  2PMU A;  2HDC A;  4KN7 X;  1KU3 A;  2L02 A;  1SFE A;  1BN5 A;  1R5G A;  2FNP A;  4HYE A;  3K1P A;  2JPC A;  3V4G A;  4NB5 A;  1J7K A;  1GVJ A;  2CQK A;  2ETH A;  2NNN A;  1GXQ A;  4IHS A;  3ZMT A;  3LFK A;  3T1B A;  3WTX C;  5E18 F;  1K7A A;  5H20 A;  2Y75 A;  1J2X A;  3CUQ C;  1W5S A;  5FGM A;  4AWX B;  3RYP A;  2DPD A;  3FMR A;  4BQA A;  2EFN A;  1Z6T A;  1HBX G;  5E17 F;  3IWZ A;  5LRS A;  3IKT A;  3I59 B;  1T38 A;  1HST A;  3NRV A;  3DV8 A;  3OV8 A;  4HX8 A;  5J6X A;  3ISP A;  2XVC A;  1XMK A;  2H94 A;  2STW A;  1X3U A;  3HSR A;  5J8C A;  5D6E A;  4ZYG A;  2VBZ A;  5LHG A;  5E1Z B;  2IP2 A;  4I02 A;  1P92 A;  1WI9 A;  3D5L A;  3V8L A;  1YS6 A;  1AWC A;  4U7D A;  1D3Y A;  5IT3 A;  1I27 A;  1G4D A;  1MJA A;  2P5L C;  4U7B A;  1Y0U A;  3GYH X;  1MDM A;  4Q5S F;  3I4P A;  3WTW C;  2O6G E;  4Y13 A;  1IN4 A;  4WXC A;  4A2U A;  5K1Y A;  2ADU A;  1FZP B;  5IT9 Z;  1LJ9 A;  5CVJ A;  3LWF A;  2QZ8 A;  3D0S A;  3W6J B;  1BI2 A;  1HSJ A;  2DI3 A;  5E1X A;  1XGN A;  2MA3 A;  1XGM A;  3E3V A;  1WQ2 A;  2M8E A;  4JBA A;  2W57 A;  4RAZ A;  3F3X A;  3TO9 A;  4BAY A;  3EYY A;  5DUI A;  3M8E A;  3TO6 A;  3J80 K;  1JGS A;  3IRQ A;  4A0Y A;  4A5M A;  5H6Q A;  1H0M A;  3WGH A;  2E1C A;  3T8T A;  1Z1D A;  4JK1 X;  5DCF A;  1T0F A;  1XCV A;  4IF4 A;  3MCZ A;  5DEQ A;  2K4B A;  3FXU A;  3SHF A;  5LEK A;  4P55 A;  1YG2 A;  4OIN F;  3LAP A;  4M74 A;  2V1X A;  4A0Z A;  1BIB A;  4IRI A;  1HW2 A;  1W7P D;  4LB6 B;  4NHJ A;  4GYG A;  4NQW A;  2ZFW A;  4R79 A;  1TNT A;  1WSU A;  5DUK A;  1B6A A;  1JHH A;  4UV8 A;  3BJA A;  1FBQ A;  3IC7 A;  2G7U A;  1RNL A;  5F1R A;  1O57 A;  3HRU A;  2AXL A;  1E2X A;  2M1B A;  4L18 B;  4EJV A;  4OIO F;  1BI0 A;  3DPL C;  1U3E M;  2NNY A;  1O3T A;  4XSZ F;  3RJP A;  2A69 F;  4FHT A;  3HSF A;  1IUY A;  5D8K B;  3HRS A;  1IN7 A;  3F8M A;  3P9I A;  4YG2 F;  2RN7 A;  2CO5 A;  4WK8 F;  4LLN A;  2KJC A;  4HBL A;  3QU3 A;  2P7V B;  2XKO A;  4IJA A;  1FBU A;  1YS7 A;  1FPQ A;  2L01 A;  3RPQ A;  2EK5 A;  4UXN A;  4BHB A;  1D8K A;  1IXR C;  2PLY A;  3HRM A;  4P9F A;  4LMY A;  1YW8 A;  2ESN A;  5EEH A;  4PDK A;  3VFZ A;  3MEX A;  3KZY A;  3ABU A;  3WOD F;  3I54 A;  2OQG A;  1TQI A;  4CZZ A;  4AD9 A;  3E5X A;  3MFK A;  1ON2 A;  3BWG A;  2RDP A;  4HZF A;  5E1W A;  2XAH A;  3CO7 C;  1MGT A;  1W7P B;  5FD5 A;  2O8X A;  3PQJ A;  1FYL A;  1ZG3 A;  5DDG A;  5CVU A;  1ZLK A;  3C18 A;  3KP5 A;  4HX7 A;  5E20 A;  3FHZ A;  2UWM A;  3KFW X;  3I53 A;  2K02 A;  3WTZ A;  1FOK A;  1SMY F;  2A6E F;  4B09 A;  5LBQ A;  4MEY F;  2A07 F;  4WXH A;  2F5D A;  4U0V A;  1B4A A;  3NEU A;  3E6C C;  2LF7 A;  3BY6 A;  3BJ6 A;  1LDJ A;  2HGC A;  2XAG A;  5LHH A;  1LB2 A;  1PUE E;  2KRF A;  4KIB A;  4UUV A;  1W4M A;  2DO7 A;  1J75 A;  5EEG A;  1F9N A;  1HQC A;  4PZJ A;  3KP7 A;  4G7O F;  1MKM A;  3F23 A;  5K5Q A;  1STZ A;  3M8F A;  2DBB A;  2FF4 A;  2JZY A;  4CIC A;  3FMQ A;  4CGZ A;  2V9V A;  2XRO A;  3GX4 X;  5LGT A;  4L5I A;  2O3F A;  3F6V A;  5FO5 A;  2YX7 A;  1IRF A;  3L00 A;  1DUX C;  3J7A O;  3IRR A;  2BGC A;  2P5K A;  1YTY A;  4KIG A;  3ERE D;  3DP7 A;  3GFM A;  4EM1 A;  2STT A;  3BDD A;  3IL2 A;  3FM3 A;  2QQA A;  4L5J A;  5JR3 A;  1KYZ A;  3C1D A;  1Z05 A;  4FX4 A;  4KYW A;  4P5O A;  2EFO A;  1RZ4 A;  2Q2E A;  3R60 A;  3HHH A;  3EQL F;  4UVC A;  2HEO A;  1U8R A;  2HYG D;  1ZRF A;  4G94 A;  4Q48 A;  3SXY A;  3U9G A;  3WE2 A;  3ZPL A;  5AIP A;  3I64 A;  3KP2 A;  1BOA A;  4OIR F;  2W84 A;  4LK1 F;  5L3C A;  5HLI A;  4YII A;  1QPM A;  2VON A;  3FXR A;  4I7H A;  4RS8 A;  3MWM A;  2XIG A;  4A6E A;  1S3J A;  3ULQ B;  1TTY A;  1XN7 A;  1U78 A;  1ZH5 A;  1TW2 A;  2IRF G;  1Z6R A;  1XMA A;  3QRF F;  3V8J A;  5E8G A;  4AVP A;  4MNU A;  2XUB A;  3CO6 C;  1OMI A;  2CGP A;  2Z3Y A;  3U2R A;  2ZBK A;  2FBH A;  2W24 A;  4WF2 A;  5D4S A;  3TDU C;  4WXD A;  2ZNY A;  2D45 A;  5KVR A;  3JAM K;  2QEN A;  3L09 A;  1YQA A;  5A2Q K;  1ZG1 A;  3VEP A;  3IKV A;  1O3S A;  4GGG A;  2X4H A;  1DP7 P;  4GYI A;  4E70 A;  2OBP A;  1R7J A;  4PGG A;  2GXB A;  4YFK F;  1YLF A;  2IT0 A;  1CGP A;  3RPU A;  1P4W A;  3MQ0 A;  1LVA A;  3CUQ A;  3ECH A;  3TGN A;  4R1H A;  4RGR A;  3GF2 A;  1ULY A;  2QQB A;  2A61 A;  2EWN A;  2L3D A;  2Z5U A;  4XLN F;  2R3S A;  1O3R A;  3KLN A;  3HTS B;  4OMZ A;  1BI1 A;  1L0O C;  3R0A A;  1LEA A;  4O5V A;  2UXN A;  1SFU A;  2HTS A;  5JHU A;  3T8R A;  2ELH A;  4IXA A;  3WTY C;  1IRG A;  4UNO A;  3CLO A;  2LF8 A;  3I59 A;  5K5R A;  4G8X A;  2L4A A;  2XRN A;  2KIM A;  3BOQ A;  4ENJ A;  1P6R A;  3C3W A;  2DTR A;  2J5P A;  1J59 A;  4PGH A;  2A6H F;  3J80 Z;  3EUH A;  2L54 A;  2EFP A;  2QWW A;  4H0E A;  4OU0 A;  5D5W B;  1ZAO A;  4KUM A;  4OIP F;  2WTE A;  3DF8 A;  3RKX A;  1R1V A;  4XRF A;  2G7H A;  4HQM A;  2XHK A;  1S7A A;  4Y17 A;  2CW0 F;  4DQ2 A;  4ESJ A;  4DNC A;  4QLC U;  5L3F A;  2QM3 A;  4CO8 A;  1JE8 A;  4XSX F;  4HF0 A;  2PN6 A;  1WKM A;  2VOP A;  5ICE A;  2H6B A;  3KEQ A;  3WGG A;  1TQM A;  3O3K A;  3HOT A;  4HQE A;  2ZJ2 A;  1TQP A;  3GXO A;  3H92 A;  4U0Y A;  2GA2 A;  5FB2 A;  1FY7 A;  4IRH A;  5LLQ A;  4L9N A;  5ILS A;  3KP6 A;  1G3W A;  1FNN A;  3WTT C;  4LFU A;  1ZGA A;  6PAX A;  1FX7 A;  1ZRE A;  3QPH A;  1ZN2 A;  3GFJ A;  1MZB A;  4UV9 A;  5HS8 A;  2YPR A;  1QNT A;  4G6D A;  3LQR A;  3ZQ7 A;  3FX3 A;  3H3U A;  4CYD A;  2VC0 A;  5CVR A;  2PEX A;  3MZY A;  3N97 A;  4U0W A;  2OZ6 A;  1P2F A;  1OYI A;  4KMF A;  4YFN F;  2GQQ A;  3QPT A;  2FA5 A;  3TDZ C;  1BI3 A;  2UZK A;  4HA8 A;  1FYK A;  1U2W A;  1CF7 B;  1B9M A;  2X0L A;  1LQ1 A;  2EB7 A;  4L9J A;  2V1D A;  3TOA A;  3WTS C;  2DT5 A;  5D5U B;  5BPI A;  1RUN A;  2M45 A;  2ESH A;  3VOD A;  3DKW A;  3O2P E;  4N9I A;  2ZKZ A;  1D8J A;  3DXJ F;  3K69 A;  4ZYE A;  3RKW A;  4AIK A;  5FLX Z;  1HW1 A;  3B73 A;  2Q8K A;  4CXF A;  1FWZ A;  4A12 A;  4EGZ A;  5ILV A;  2ZXJ A;  4M72 A;  2WWY A;  1SFX A;  4AIJ A;  1J5Y A;  2IA0 A;  2JSC A;  2GWR A;  1S29 A;  5D6F A;  3W6K B;  2Z9O A;  4KIF A;  4RGS A;  1QQI A;  2HQR A;  3JTG A;  3N4M A;  1R22 A;  3J81 Z;  4BH9 A;  3GWZ A;  1R58 A;  4EGY A;  4OMY A;  3TQN A;  3COA C;  5HLG A;  2P5V A;  4KA4 A;  3L2C A;  1JXS A;  1ZHF A;  2EV5 A;  2R7F A;  3ZMD A;  4TV7 A;  5HLH A;  1KU9 A;  2DLL A;  3KE2 A;  1FSE A;  3ZN0 A;  3GZ6 A;  2OAZ A;  3LAJ A;  5CJ9 A;  3PQK A;  1XDS A;  4N0B A;  2HWV A;  3V8K A;  2RGV A;  3HYI A;  2ZME B;  5LEJ A;  3O6B B;  5IT9 K;  1W7P A;  2P8T A;  3Q9S A;  1O7L A;  1T6S A;  4ESB A;  1OYW A;  3E5U A;  2QLZ A;  4M9X A;  3V7R A;  3F8C A;  1QGP A;  1EH7 A;  4O6J A;  4CDG A;  2IVM A;  4BYY A;  2VOD A;  5LRR A;  1SD5 A;  1F5T A;  3WTU C;  1G6N A;  4ZZL A;  3K9T A;  1RI7 A;  2HKX A;  1R36 A;  3RDI A;  1LDK B;  4ZYD A;  5D4R A;  2EV6 A;  2NRA C;  3E6B A;  1FP1 D;  3F72 A;  1S8N A;  1DPR A;  1MJ9 A;  3HIF A;  1ZLJ A;  2HFH A;  4EJT A;  4HLY A;  3ZP5 A;  4ZYH A;  3K1N A;  4M71 A;  2MLG A;  4R8H A;  2EFQ A;  1QZZ A;  4EQQ A;  2PJP A;  1D5V A;  1Q1H A;  2JTV A;  1PP7 U;  1B9N A;  2QYO A;  2MH9 A;  2VT3 A;  4YIF A;  1OYY A;  4LK0 F;  1A04 A;  1K78 B;  2KKO A;  2FML A;  2DW4 A;  1Z9C A;  1R1T A;  1R1U A;  4HDV A;  2MBF A;  1KU2 A;  2WV0 A;  2UXX A;  1T2K A;  2NS0 A;  3FWE A;  2QVO A;  1MD0 A;  4P96 A;  1J9I A;  1FLI A;  2A68 F;  2EJR A;  2NAZ A;  2DPU A;  5TRD A;  4BNC A;  3QOP A;  2XGX A;  1FYM A;  1HXD A;  4MTD A;  1QZY A;  2Z99 A;  5AON A;  2DK5 A;  2MD5 A;  5DD4 A;  3S2W A;  1PP8 F;  1JHF A;  4LD5 A;  2A5Y B;  4EMS A;  3P7N A;  3U1D A;  1TW3 A;  3BP8 A;  4GO1 A;  2OD5 A;  1G3Y A;  1UHM A;  4I0B A;  3ZMZ A;  5BPD A;  2P7C B;  5ICG A;  4HV6 A;  4FT8 A;  4M73 A;  2FQ3 A;  2C6Y A;  5J8F A;  3CDH A;  3KZZ A;  2WC2 A;  4Y15 A;  3WE3 A;  1W5T A;  4RB3 C;  3G73 A;  2JT1 A;  3AAF A;  3FF5 A;  2FBI A;  2VBX A;  2K86 A;  2F5F A;  4IVN A;  3JAM Z;  3HSE A;  2MLK A;  3KP4 A;  4WX9 A;  2FEZ A;  5FFZ A;  3LA7 A;  1IXS B;  4EJO A;  5BS6 A;  3M1E A;  1ZG5 A;  5ICC A;  2JPB A;  2HS5 A;  4LLL A;  2MH2 A;  1KYW A;  3EDP A;  2FSW A;  3T0Y A;  3Q5F A;  2DQR A;  4KFC A;  2LDU A;  1KGS A;  2D1H A;  4A6D A;  4KT5 C;  2PBI A;  3KP3 A;  4MTE A;  4RGU A;  4ETS A;  5FD6 A;  1L3L A;  3P9C A;  1ON1 A;  4IPA A;  1BJA A;  3QP6 A;  4HW0 A;  4EJU A;  2EV0 A;  4ON0 A;  3DQV C;  3GO5 A;  4GCV A;  3HRT A;  4L0Y B;  4XBF A;  1TBX A;  3L9F A;  4OIQ F;  2PQ8 A;  3WG9 A;  2A3S A;  1ZAR A;  3I0T A;  4L0Z B;  2VE9 A;  5E8I A;  2F5C A;  1P4X A;  3I5U A;  4I98 B;  1F4K A;  2XAJ A;  1ZRD A;  5ERI A;  1BBY A;  4P9U A;  3ELK A;  1J0R A;  1IN5 A;  2BV6 A;  1K79 A;  3REO A;  2O0Y A;  1U6G A;  3JTH A;  1ZRC A;  2IPQ X;  1IF1 A;  4G7Z F;  2HQN A;  2HKO A;  3LQQ A;  2FU4 A;  4WWC A;  2W85 A;  4M9S A;  3SFZ A;  2OZU A;  1BIA A;  1R00 A;  2QBY B;  1ZGJ A;  2V79 A;  4L9V A;  2KIF A;  2HR3 A;  1S6L A;  5BOX A;  1WRJ A;  2E7X A;  3LA3 A;  4Q47 A;  1KQ0 A;  3G3Z A;  5DYM A;  2D2W A;  3R0J A;  3WGI A;  3HTU A;  2VC1 A;  2K27 A;  4LB5 A;  3IHU A;  1EV7 A;  5LGN A;  4RB0 A;  2DFI A;  4KIC A;  4LG0 B;  2PMH A;  1XGO A;  3E5Q A;  1QO0 D;  4EV0 A;  4EM0 B;  1HKS A;  5DD8 A;  1IZ1 A;  1ONV A;  2H09 A;  3GFI A;  2JRT A;  2E1N A;  4MQ9 F;  2O61 A;  3K2Z A;  4OOI A;  3F21 A;  4BHC A;  4KDP A;  2VT2 A;  2M87 A;  1AOY A;  3TOB A;  2HOE A;  3F22 A;  2Y48 A;  3WU1 B;  2VN2 A;  1I1S A;  3K0L A;  2HYF A;  3KCC A;  3F8F A;  5BQT A;  2DAO A;  1RIO H;  2FRH A;  3OOP A;  2R7D A;  2ACJ A;  4EVI A;  1REP C;  2HTJ A;  4HF2 A;  1OKR A;  3RI4 A;  3M9A A;  3CTA A;  1KQ8 A;  5BMZ A;  1OPC A;  4M6X A;  4YFX F;  5CLS A;  4G9Y A;  1NHA A;  4UVB A;  2L4M A;  2V1U A;  2DQL A;  1U5T B;  1SMT A;  1I1G A;  4MGR A;  2B0L A;  3WTV C;  3GLX A;  2EA2 A;  1R23 A;  3I71 A;  2GAU A;  3RTR A;  2VE8 A;  5L3D A;  1XSV A;  2YR2 A;  1CF7 A;  2HZT A;  2CYY A;  3RIR A;  1U5T C;  4RAY A;  4HDU A;  5D5V B;  2QQ9 A;  2XAF A;  5TJJ A;  3ZN1 A;  4L9T A;  1OR7 A;  5HDG A;  2K7L A;  2RC4 A;  3RYR A;  3ZMS A;  3MZH A;  1Z91 A;  2EA4 A;  3DFG A;  4I01 A;  3DEU A;  5LHI A;  3QU6 A;  2FMY A;  3WU0 A;  3V7C A;  2Y0M A;  4ZZD A;  4IHT A;  1ODD A;  5L3E A;  1MJB A;  1O7F A;  2DK8 A;  2W25 A;  1UHW A;  4HOB A;  1BM9 A;  3C7J A;  1GXP A;  1KQ9 A;  2KJB A;  3CJN A;  4HX4 A;  2XKP A;  4M6Y A;  1IN8 A;  2F5E A;  3E97 A;  1PDN C;  2XAQ A;  4KMU X;  1MDM B;  3LST A;  1R5H A;  1LDD A;  2QUF A;  3F6O A;  2CWE A;  4EM2 A;  1YW9 A;  5CVI A;  1G3T A;  5JI6 A;  2F2E A;  1V3F A;  3FM5 A;  5HOO A;  3R6S A;  5KK1 A;  3H3Z A;  3ROU A;  3GZ5 A;  3FZV A;  4BXU A;  1USS A;  4G7H F;  2ZME A;  1SD7 A;  1DDN A;  3I58 A;  1YW7 A;  1EH6 A;  1EH8 A;  2E7W A;  2IA2 A;  1O3Q A;  2FNA A;  3HUG A;  2J5O A;  5F64 A;  1XB4 A;  3GFL A;  3L7W A;  1UFM A;  3BRO A;  1H9G A;  3E6D A;  4N9H A;  2YX4 A;  4RB2 C;  3BPX A;  1WWX A;  3ECO A;  2O03 A;  2PI0 A;  4I09 A;  5DV5 A;  4O3M A;  3SQN A;  2M5W A;  1SD4 A;  1XSX A;  2MC3 A;  2VBW A;  1BC7 C;  1G3S A;  1BC8 C;  4A5N A;  2Z33 A;  1XCB A;  3ZMU A;  3QAH A;  5HS9 A;  2RV8 A;  3PFI A;  2P6S A;  2GXG A;  2D1V A;  1B1B A;  1K78 A;  3KLO A;  3ML6 A;  4CHU A;  2YSR A;  5H6R A;  4ENN A;  2RQP A;  3E6M A;  1ZYR F;  1HW5 A;  4UHT A;  3TKY A;  4G6Q A;  3F8N A;  5ED4 A;  2OA4 A;  2FE3 A;  5FLX K;  3T5X A;  1IXC A;  5CVV A;  1XD7 A;  4KN4 X;  1SAX A;  2CSO A;  1Z7U A;  2GIV A;  3VB2 A;  3ZMV A;  2EFW A;  1I5Z A;  2LKP A;  1I6X A;  3HOS A;  4GXO A;  2IA1 A;  5DCM A;  2RNJ A;  1IN6 A;  3GW2 A;  2ZCW A;  2IW5 A;  1YYV A;  1KA8 A;  2LSO A;  1P4A A;  3NQO A;  3CUO A;  3J81 K;  1H9T A;  1RUO A;  1S7O A;  2IJL A; 
#chains in the Genus database with same CATH topology
 3M8J A;  1YIO A;  2V9P A;  1HKT A;  2GA1 A;  3ABM H;  3L2W A;  1IW7 F;  3FXL A;  1QBJ A;  2RKH A;  2HOA A;  1E3O C;  3VDX A;  3L2U A;  2K9N A;  3OYA A;  4LLG F;  3B02 A;  3HHG A;  4HV5 A;  1F1Z A;  2ISY A;  4QWQ A;  2CG4 A;  5FKN A;  4MHG A;  3SZT A;  2KRC A;  4LGW A;  3RKY A;  3QOE A;  1C0W A;  1FBS A;  2M30 A;  3VYR B;  5DCM B;  2QEX I;  1BA5 A;  4M3B A;  3S2H J;  2BYV E;  2WV1 A;  5L3G A;  3S16 J;  1FSH A;  2NYX A;  5JVT A;  1VTN C;  3Q0V A;  3BG7 A;  2HZD A;  1QVU A;  2DMQ A;  3RQI A;  4XMY A;  3GUD A;  2BE5 F;  2DFE A;  1YIJ I;  3GVA A;  4LIT A;  1UCR A;  4A0X A;  2L7F P;  4M6V A;  3DTE A;  1XX5 A;  2E1O A;  3FK7 A;  5KHD A;  1SVO A;  2TDX A;  1OCR H;  1TNS A;  4HEA 2;  5CYV A;  5A2Q Z;  4C3I J;  4IRG A;  5IP7 J;  2LY2 A;  3PSF A;  2JUC A;  2R7Z J;  1DPU A;  4B8X A;  2FOK A;  4PCQ A;  2BEO A;  1ORK A;  4K2E A;  2DA7 A;  1UST A;  1FTT A;  3J7Z I;  4EJW A;  2JA2 A;  1GHC A;  5BNG A;  2DU9 A;  1DQU A;  2VIX A;  1YX3 A;  2O7O A;  2L7M P;  3JSP A;  2MG4 A;  1LNW A;  3IP4 B;  3O8H A;  3KET A;  1NTC A;  1V5G A;  2ECC A;  3R4K A;  2PJR B;  5IOY A;  2M4G A;  5IYC J;  3JSO A;  5L3B A;  2LNB A;  2VBY A;  5GPA A;  3VYS B;  3GLL A;  4KNY A;  2ZNZ A;  2LK2 A;  2BY0 A;  2P81 A;  2LBF B;  4I99 C;  2X6X A;  5LGU A;  2BBY A;  1HKQ A;  2PG4 A;  4LJZ F;  2V7F A;  5M3F J;  1T95 A;  3R61 A;  1SFK A;  4ESF A;  3ONQ A;  4WCG A;  1LFU P;  2JVG A;  4NUB A;  2E1M B;  5DM7 F;  1E17 A;  1H89 C;  3K1M A;  4Y3O A;  1XPX A;  4MO7 A;  2X48 A;  2XAS A;  4A3M J;  1R6R A;  2OU2 A;  1D1C A;  5HDN A;  2H8W A;  1KU7 A;  2BOL A;  5ICF A;  5C4X J;  1IDZ A;  3CP2 A;  3VYU B;  1D1A A;  4ASN A;  1B59 A;  1WCM J;  1T8I A;  3EET A;  3SZP A;  4PSW A;  2E1M C;  2A05 A;  4M9Z A;  4N4O B;  2XV4 S;  2VXZ A;  1XGS A;  4D0P A;  3P9K A;  3GTK J;  2K4J A;  4S04 A;  5HS7 A;  3EYI A;  4MEX F;  1K6O A;  5B5E C;  4BAC A;  4XRM A;  3GEZ A;  1UB9 A;  2RVC A;  2HQ5 A;  3RPU D;  2VPL A;  5HVQ C;  2M7A A;  4RGX A;  5AIQ A;  1S9H A;  2XSD C;  4F7Z A;  2ZO4 A;  4XID A;  2R7V A;  3HPG A;  1HLV A;  1A31 A;  4U88 A;  1NG6 A;  1R49 A;  3JW4 A;  3E1S A;  3I4N J;  2QKL B;  2XAU A;  4YEL A;  4BKX A;  2LY9 A;  2WAQ N;  4FX0 A;  2GOM A;  3OSG A;  1IAW A;  2QBY A;  4Z2Y A;  1MMN A;  2DJI A;  1YO5 C;  4A3C J;  1Z3Y A;  2L5Q A;  4RDU A;  4Q4Z F;  1UEL B;  2E36 A;  3IWF A;  5F6F A;  2RQQ A;  2IS2 A;  4XL9 A;  1POG A;  2VKD A;  4HAM A;  4B43 A;  3OWT A;  2P6T A;  2PMZ A;  4B47 A;  1T39 A;  4DBR A;  4ENK A;  3DPT A;  4XKB A;  4XK4 A;  2CFX A;  1XDU A;  4XON A;  2Q0O A;  4I2O A;  4LG0 A;  1TWF J;  1PVE A;  3MAJ A;  5IPA A;  3OYN A;  3VSK A;  3S1N J;  1EF4 A;  2BVL A;  2WAF A;  2CFO A;  4ZH4 F;  4MQV A;  2W82 A;  3BZ6 A;  1K4T A;  2VOO A;  1ETW A;  2KT0 A;  2FXA A;  2P4W A;  4RB1 A;  4AIH A;  2AS5 F;  2PFB A;  3U1K A;  4CH7 A;  2GLO A;  3PM1 A;  3K6G A;  3Q9V A;  2DMP A;  4BHP A;  1SD6 A;  3PL8 A;  3J7Y J;  5D5X B;  5ILU A;  5JFR A;  3OS0 A;  5H2F C;  1QPI A;  2Y0S N;  3OIP A;  1EJ9 A;  2OQR A;  4UVA A;  1T98 A;  1HA8 A;  3CCM I;  5GAH J;  3OS1 A;  3FKI J;  5JHF A;  3FXQ A;  1X2N A;  3LSP A;  5HDK A;  2VJJ A;  1SEU A;  5FFX A;  3A2K A;  3KEO A;  3F8B A;  4B44 A;  1V4R A;  4I0A A;  1TLH B;  1EKE A;  5E3O A;  3RSN A;  3S32 A;  2MGQ A;  5B1B H;  5K5O A;  2I10 A;  1FP2 A;  3K4C A;  5EGO B;  2FBK A;  1XSD A;  1LEB A;  1FC3 A;  2EZI A;  2ISZ A;  2V6C A;  3PSI A;  2G9W A;  1ETQ A;  3M7G A;  2ZJP F;  1GUU A;  5HNF A;  1VZ0 A;  3BJO A;  3TO7 A;  4PJJ A;  4YRV A;  1D5Y A;  2YU3 A;  3K4L A;  4XLP F;  4JQF A;  4ZDO A;  1KZH A;  1MNE A;  3CDL A;  4JX5 A;  2H27 A;  2XGD A;  2ZXW H;  2KDO A;  4ENM A;  5D8L B;  4C2U A;  2GZW A;  3CD6 I;  2AXT C;  2KIU A;  3FMS A;  3QWL A;  3VOE A;  2H6C A;  4ABZ A;  2VJI A;  3QP5 A;  2ZC2 A;  1FT9 A;  1I39 A;  4HLX A;  1U5T A;  1JKR C;  2LMD A;  3HXL A;  4Y52 J;  3BPV A;  3ABT A;  3V7S A;  1WJD A;  2NS8 A;  3LA2 A;  4S05 A;  1YFH A;  4HF1 A;  3D5S C;  5KNL A;  2COM A;  3CUQ B;  2PMU A;  2HOT A;  2V6E A;  2HDC A;  3C2G A;  4KN7 X;  1KU3 A;  1K83 J;  1XS9 A;  2VPR A;  3F0C A;  2GM4 A;  2L02 A;  1SFE A;  1B8I B;  1BN5 A;  1R5G A;  1Y0N A;  5TGT A;  5EYR A;  3CF2 A;  2FNP A;  1Y1V J;  4UY8 I;  4HYE A;  3K1P A;  2JPC A;  3V4G A;  4NB5 A;  3MVP A;  1J7K A;  1GVJ A;  2CQK A;  2ETH A;  2NNN A;  1GXQ A;  3H5R A;  4IHS A;  3ZMT A;  3LFK A;  3LSH A;  3CC4 I;  2K3P A;  3T1B A;  2Y69 H;  4RM3 A;  3WTX C;  5IYD J;  2ZSH B;  5E18 F;  5B1A H;  1K7A A;  1MMS A;  5H20 A;  3CC2 I;  2Y75 A;  5KCM A;  1J2X A;  1P9Q C;  2KPM A;  2A6T A;  4HPQ A;  3OYJ A;  3CUQ C;  1IV8 A;  1X1P A;  2VQH A;  1Z0X A;  1W5S A;  3BG6 A;  5FGM A;  1Q1V A;  3RYP A;  4XRS G;  4AWX B;  2DPD A;  1F43 A;  4FAS D;  4QPO A;  3FMR A;  1S72 I;  4BQA A;  1Z67 A;  1VQL I;  3OIQ A;  1I3A A;  4E4H A;  2EFN A;  2WBM A;  3L2Q A;  1Z7L A;  1Z6T A;  2XSJ C;  1HBX G;  5E17 F;  2CQN A;  4IHY A;  3ERM A;  2R5Z A;  3IWZ A;  5LRS A;  3IKT A;  3I59 B;  1T38 A;  1HST A;  2VAS A;  3CMY A;  5M5X J;  3NRV A;  3DV8 A;  3OV8 A;  1YJW I;  2YS9 A;  2QCO A;  4JOM A;  4HX8 A;  5J6X A;  3ISP A;  2XVC A;  3SFI A;  1XMK A;  2H94 A;  3FIW A;  4IOC F;  2STW A;  3K70 C;  1OFC X;  1X3U A;  2DFH A;  4FTH A;  3CCV I;  3JRB A;  3HSR A;  3SEQ A;  3QQA A;  1FMV A;  5J8C A;  5D6E A;  4BE0 A;  4ZYG A;  2VBZ A;  2DOD A;  5LHG A;  5E1Z B;  2IP2 A;  4I02 A;  3TW6 A;  1P92 A;  2WA0 A;  1WI9 A;  3D5L A;  1JTX A;  1HDD C;  4M3E A;  3V8L A;  2KIQ A;  3S3O A;  1YS6 A;  2HU9 A;  2WB1 N;  1AWC A;  4U7D A;  3DPU A;  4OAZ A;  1D3Y A;  2BW3 B;  3PO3 J;  1WFX A;  3G4S I;  2Z2S B;  4EEF G;  5IT3 A;  1I27 A;  2DT7 B;  1G4D A;  1FOX A;  3BZK A;  1X3W B;  4DZJ A;  1MJA A;  2M34 A;  2P5L C;  4U7B A;  2ID6 A;  1NG7 A;  1FEX A;  1Y0U A;  3GYH X;  3HL2 A;  3EUH C;  1MDM A;  4PJ0 C;  1ZTR A;  4Q5S F;  4M3F A;  2KZV A;  3I4P A;  4XLC A;  3M1C A;  3WTW C;  2O6G E;  4Y13 A;  1IN4 A;  4WXC A;  4A2U A;  5J1Y A;  5K1Y A;  3E0J B;  2ADU A;  1FZP B;  5IT9 Z;  1T56 A;  1LJ9 A;  5CVJ A;  3LWF A;  2QZ8 A;  1MBG A;  4E7Z A;  3D0S A;  3W6J B;  3CCL I;  1BI2 A;  1HSJ A;  3ZCO A;  5HOD A;  3CLQ A;  1VFC A;  4FIS A;  3PNT A;  4MFE A;  2DI3 A;  5E1X A;  1BR1 A;  1XGN A;  1Y6I A;  2MA3 A;  1XGM A;  3E3V A;  1T08 B;  1WQ2 A;  1Y8R B;  2M8E A;  4JBA A;  4XKV A;  2W57 A;  3LSK A;  4RAZ A;  2NXN B;  3F3X A;  3TO9 A;  3EYY A;  4BAY A;  5DUI A;  3M8E A;  3TO6 A;  3J80 K;  3FXM A;  1JGS A;  3IRQ A;  3HBL A;  2M3A A;  4A0Y A;  4A5M A;  4V2G A;  5H6Q A;  4UB8 C;  3ZGK A;  4RAG A;  1H0M A;  3WGH A;  2E1C A;  2KLO A;  2V9K A;  2OTJ I;  3T8T A;  1WH7 A;  1JTY A;  1Z1D A;  4JK1 X;  3I55 I;  3A03 A;  5DCF A;  1WJF A;  1AKH A;  1T0F A;  1XCV A;  1ETV A;  3BCB A;  2ELJ A;  4IF4 A;  3MCZ A;  3A01 B;  2LP0 A;  5DEQ A;  3OYK A;  3W2V A;  2K4B A;  2TCT A;  3FXU A;  3SHF A;  5LEK A;  4B3A A;  4P55 A;  1YG2 A;  3Q0U A;  4OIN F;  3W6V A;  3LAP A;  2OC6 A;  4M74 A;  2V1X A;  4A0Z A;  1BIB A;  2LR8 A;  4IRI A;  3IAM 2;  1YI2 I;  1JKO C;  1HW2 A;  4UUS A;  1W7P D;  3Q0W A;  4LB6 B;  1PUF B;  4NHJ A;  4XRS A;  1WJB A;  3KPH A;  4XLH A;  4GYG A;  2R92 J;  4FQG A;  2E2J J;  4NQW A;  2ZFW A;  4R79 A;  3DU5 A;  3DBR B;  1TNT A;  3EPZ A;  2KL4 A;  1Z77 A;  1MW7 A;  1WSU A;  3VSL A;  3OYG A;  1OR7 C;  3UNG C;  2F4O B;  5DUK A;  4PUS A;  1B6A A;  2F5V A;  2JA8 J;  2OCC H;  1JHH A;  4UV8 A;  3BLY A;  4RMN A;  2CV1 A;  3BJA A;  4AM3 A;  1FBQ A;  3IC7 A;  3ZQQ A;  2G7U A;  1RKW A;  1RNL A;  5F1R A;  2EIM H;  2HDW A;  2KQR A;  4Z6Y A;  1O57 A;  3HRU A;  2AXL A;  1E2X A;  2M1B A;  4BU2 A;  5B3S H;  3HOU J;  3SEZ A;  4L18 B;  2CH0 A;  2V4J C;  2WAQ A;  4EJV A;  4RA2 A;  1UJ8 A;  4OIO F;  1BI0 A;  2E5N A;  3DPL C;  1U3E M;  2JA7 J;  2NNY A;  5E79 C;  2CUF A;  2W00 A;  1NK2 P;  1O3T A;  4XSZ F;  5IY5 H;  4BE1 A;  3BG9 A;  5FJ8 J;  2HDD A;  2JVH A;  3RJP A;  2E34 A;  1V54 H;  2A69 F;  2HYJ A;  4BE2 A;  4FHT A;  3HSF A;  4BQO A;  3PJR A;  1BL0 A;  2JRM A;  1IUY A;  4AU7 A;  5D8K B;  1ETY A;  2NVU B;  1I50 J;  3HRS A;  1IN7 A;  3F8M A;  1UMQ A;  3P9I A;  4BS9 A;  4YG2 F;  2RN7 A;  2V26 A;  2LG4 A;  1SAN A;  2CO5 A;  4WK8 F;  1U9N A;  4LLN A;  2KJC A;  4HBL A;  3QU3 A;  2GIZ A;  1OCO H;  2P7V B;  3OYH A;  2XKO A;  4IJA A;  1GDT A;  1FBU A;  3DBL B;  2BXZ A;  1YS7 A;  1FPQ A;  2L01 A;  2R7O A;  3BR5 A;  2BY2 A;  3RPQ A;  1WZ2 A;  2EK5 A;  2ZXH A;  3D5R C;  3IUO A;  4UXN A;  4QSH A;  4BHB A;  1D8K A;  3TP3 A;  1N78 A;  4AC0 A;  1OQY A;  2IGM A;  3JRA A;  1IXR C;  2Y0S A;  2PLY A;  3HRM A;  1FOY A;  3HDD A;  2R7R A;  4P9F A;  3PO2 J;  5EJC A;  4LMY A;  1YW8 A;  2ESN A;  9ANT A;  5EEH A;  4PDK A;  3VFZ A;  2XPV A;  3MEX A;  3KZY A;  3ABU A;  2P0W A;  5HLT A;  3M4O J;  4DYQ A;  1YX5 A;  2VL8 A;  3WOD F;  3I54 A;  2OQG A;  2O8K A;  1TQI A;  4CZZ A;  4AD9 A;  3JRC A;  2K85 A;  3E5X A;  4G12 A;  3CC7 I;  3MFK A;  1ON2 A;  3BWG A;  2V1N A;  2RDP A;  4HZF A;  3WU2 C;  5E1W A;  2XAH A;  2DMT A;  3CO7 C;  1VQ8 I;  1MGT A;  1W7P B;  4J00 A;  3CZ6 A;  5DM6 F;  5FD5 A;  2O8X A;  3PQJ A;  4QTR A;  1FYL A;  4E7K A;  2DA3 A;  1ZG3 A;  3RZD J;  5DDG A;  4PFO A;  5CVU A;  1LFB A;  2MC4 A;  5E3M A;  3CCS I;  1LFP A;  3FDY A;  4PFP A;  1ZLK A;  2DTZ A;  1RR8 C;  4E7I A;  5F0H A;  3C18 A;  3KP5 A;  2NVX J;  4IKF A;  1X4O A;  4HX7 A;  5E20 A;  3FHZ A;  2UWM A;  2GOX B;  1DU6 A;  4HNU A;  2CV0 A;  3KFW X;  3I53 A;  2K02 A;  3A0B C;  3IH2 A;  1VQ7 I;  3WTZ A;  1FOK A;  2HPI A;  1SMY F;  2A6E F;  4B09 A;  5LBQ A;  4MEY F;  2A07 F;  4WXH A;  2QF7 A;  2F5D A;  4U0V A;  1B4A A;  3NEU A;  3E6C C;  3E7L A;  4KJZ A;  4M3G A;  2LF7 A;  3BY6 A;  3BJ6 A;  2EIN H;  2DXI A;  5IP6 A;  1VQP I;  1LDJ A;  2HGC A;  2XAG A;  2EZL A;  2LY1 A;  2DT6 A;  5LHH A;  4B48 A;  1Y39 A;  1LB2 A;  1PUE E;  5JVG F;  2H1K A;  2IBD A;  2KRF A;  2DCE A;  2ID3 A;  3HEF A;  4KIB A;  4UUV A;  2R7T A;  3G2B A;  1W4M A;  4PJM A;  4AYB N;  2B7E A;  2DO7 A;  1J75 A;  2PJR A;  5EEG A;  1F9N A;  1HQC A;  3NAR A;  2BXY A;  3KP7 A;  4PZJ A;  2HOS A;  4G7O F;  2K9L A;  4HNV A;  2LBF A;  1MKM A;  4KIT B;  2OJE D;  3F23 A;  5K5Q A;  3HOW J;  1IRZ A;  1QZE A;  1STZ A;  3M8F A;  2A5W A;  4C3H J;  2DBB A;  3HG9 A;  1JJ8 C;  2FF4 A;  5F27 A;  1MBK A;  2FOW A;  2JZY A;  4CIC A;  3K7A J;  3CCE I;  3FMQ A;  4CGZ A;  2V9V A;  2XRO A;  3GX4 X;  4ZJZ A;  2JWT A;  1WGX A;  3A1Y A;  5LGT A;  4L5I A;  2O3F A;  1E3P A;  3F6V A;  1RES A;  5FO5 A;  2YX7 A;  1IRF A;  3L00 A;  1DUX C;  3J7A O;  1ENH A;  3IRR A;  2BGC A;  4NNJ A;  2LVS A;  2P5K A;  4IX7 A;  2DMU A;  3I4M J;  1YTY A;  1N77 A;  2PX9 A;  2CS3 A;  2NVY J;  3SZG A;  2Z1D A;  4KIG A;  2FJ1 A;  4ZYA A;  3OYF A;  3ERE D;  2AHQ A;  1ZGW A;  2ZSI B;  2R7X A;  3DP7 A;  3SDB A;  3GFM A;  4EM1 A;  1VQ4 I;  2DFF A;  3MZ8 A;  2STT A;  3BDD A;  5FRN A;  4A3D J;  1DGR M;  3ZQI A;  4F3Q A;  1VQM I;  3IL2 A;  2DDB A;  3FM3 A;  2QQA A;  2IS6 A;  4L5J A;  2H8R A;  1PYV A;  4H4K C;  5JR3 A;  3OR1 C;  3OYL A;  1KYZ A;  2JMW A;  3C1D A;  1Z05 A;  4FX4 A;  4KYW A;  3CJQ B;  4P5O A;  5J4V A;  3UKG A;  3DU6 A;  3G1L A;  2EFO A;  1RZ4 A;  2Q2E A;  5F04 A;  3R60 A;  3HHH A;  2EZH A;  3EQL F;  4UVC A;  2K40 A;  3OYM A;  3OR2 C;  3QYB A;  3CCQ I;  2HEO A;  3GME A;  1U8R A;  5GTI C;  5FKK A;  5E3L A;  2HYG D;  1ZRF A;  4G94 A;  4Q48 A;  3SXY A;  2VB6 A;  3U9G A;  3WE2 A;  3ZPL A;  3BR0 A;  5GAE J;  5M5W J;  5AIP A;  3I64 A;  3KP2 A;  1X1A A;  3PNY A;  1BOA A;  4OIR F;  4B1R A;  1N25 A;  2F4I A;  2W84 A;  4LK1 F;  5L3C A;  5HLI A;  4YII A;  5TIS C;  3ZQC A;  3S3M A;  3ABL H;  4D5C A;  1VQ9 I;  1QPM A;  2VON A;  3FXR A;  3Q3S A;  4FE4 A;  1V5F A;  2O5R A;  4I7H A;  4AVZ A;  4RS8 A;  3K4N A;  3MWM A;  3ZRG A;  2XIG A;  2GBY A;  4U87 A;  1OLT A;  4A6E A;  1S3J A;  2MFZ A;  3ULQ B;  1TTY A;  2Q2E B;  3B6C A;  4LG3 A;  4A3I J;  1XN7 A;  4F91 B;  1U78 A;  4KIS A;  1ZH5 A;  2F48 A;  2E19 A;  1TW2 A;  3CJR B;  3P5J A;  1ZKG A;  2IRF G;  3RQ4 A;  1QA6 A;  1WPK A;  1Z6R A;  3ABK H;  3WG7 H;  1XMA A;  4CSW A;  4PJL A;  3K70 D;  1JUP A;  2IS4 A;  1XC5 A;  3QRF F;  3V8J A;  1A5J A;  1SAU A;  2M0M A;  5E8G A;  4AVP A;  4MNU A;  2XUB A;  2UV1 A;  3CO6 C;  4JX6 A;  5EGO A;  2EIJ H;  1OMI A;  1QHH D;  2CGP A;  4HRI A;  2Z3Y A;  3U2R A;  2L2O A;  4DW6 A;  2ZBK A;  2FBH A;  2W24 A;  4WF2 A;  5D4S A;  3TDU C;  5J47 A;  4WXD A;  2ZNY A;  2D45 A;  5KVR A;  2QEN A;  3JAM K;  3L09 A;  1X1D A;  4QIW N;  4D1Q A;  2KMU A;  1YQA A;  5A2Q K;  4HST A;  1ZG1 A;  3VEP A;  1TT5 B;  3IKV A;  5DS9 A;  1I6H J;  3AFH A;  5IP9 J;  3A4C A;  1O3S A;  4GGG A;  2X4H A;  4D9J A;  1DP7 P;  3UR3 C;  4GYI A;  4E70 A;  2OBP A;  1R7J A;  5E3N A;  3H0G J;  2ECB A;  2KFD A;  4PGG A;  2GXB A;  3OYB A;  4YFK F;  1YLF A;  2IT0 A;  3WHB A;  1CGP A;  3HJE A;  3RPU A;  1N75 A;  2KHM A;  1UHS A;  1P4W A;  3MQ0 A;  1VF9 A;  1LVA A;  3CUQ A;  2BY3 A;  3ECH A;  2RRE A;  3TGN A;  2HI3 A;  1AU7 A;  5JLW A;  1E3H A;  4R1H A;  4RGR A;  1A6Q A;  3PNV A;  3BT9 A;  3GF2 A;  1ULY A;  1B8I A;  1X1C A;  1F36 A;  3BR6 A;  2QQB A;  3DEW A;  4NDL A;  2A61 A;  2EWN A;  3DWL E;  2L3D A;  2Z5U A;  4XLN F;  1W1W E;  5CKT A;  1YRN B;  4CA0 A;  1TWC J;  4ZC3 A;  2ME6 A;  4I6Z A;  1MH4 A;  1IJW C;  4A3G J;  2R3S A;  2CJJ A;  1O3R A;  4BQN A;  3KLN A;  1LKX A;  2NVT J;  3HTS B;  5F1J A;  4OMZ A;  1BI1 A;  4XOT A;  2BVM A;  3BR3 A;  1L0O C;  3I3L A;  3R0A A;  4GDF A;  1LEA A;  4O5V A;  2UXN A;  1SFU A;  2HTS A;  5JHU A;  5IOZ A;  4BDZ A;  3T8R A;  2ME0 A;  2ELH A;  1K6Y A;  4IXA A;  3WTY C;  1MMG A;  4BY1 J;  1IRG A;  4UNO A;  1R4M B;  3CLO A;  2LF8 A;  1TP4 A;  1YHQ I;  3I59 A;  2EIL H;  1HF0 A;  5K5R A;  4G8X A;  2L4A A;  3OMY A;  1VND A;  2KIM A;  2XRN A;  5FKL A;  3BOQ A;  4ENJ A;  1P6R A;  4GFB A;  1G8X A;  3C3W A;  2DTR A;  2J5P A;  2XGC A;  4PGH A;  1J59 A;  1JJ6 C;  2A6H F;  3HC7 A;  2MD0 A;  3J80 Z;  2G0E A;  3EUH A;  2L54 A;  2EFP A;  4CCK A;  2QWW A;  4H0E A;  3FXO A;  4OU0 A;  5D5W B;  4GRI A;  1ZAO A;  4KUM A;  2VJ4 A;  3B6A A;  1TZL A;  4OIP F;  3MKY B;  3CJT B;  2XF6 A;  2BW3 A;  3QYF A;  2WTE A;  1MMD A;  4XOR A;  3RZO J;  3DF8 A;  3RKX A;  1R1V A;  4XRF A;  2XF5 A;  2G7H A;  4HQM A;  2XHK A;  1S7A A;  4Y17 A;  2XF7 A;  2CW0 F;  4DQ2 A;  4ESJ A;  4OWR B;  4DNC A;  3DEE A;  1IV6 A;  2XGE A;  2YUS A;  4QLC U;  5L3F A;  2QM3 A;  4CYC B;  4CO8 A;  1JE8 A;  2I5U A;  2VXD A;  3AG3 H;  4HF0 A;  4XSX F;  3SYT A;  2IXS A;  1RPW A;  2PN6 A;  1WKM A;  2CQX A;  2VQC A;  2VOP A;  5ICE A;  2H6B A;  3KEQ A;  3WGG A;  1TQM A;  3LL7 A;  1OCT C;  5JLX A;  1MND A;  3O3K A;  3HOT A;  2MSY A;  4HQE A;  2ZJ2 A;  1TQP A;  4IQJ A;  3S8P A;  3GXO A;  1X1B A;  4F52 A;  1NK3 P;  3BCA A;  3H92 A;  4XNF A;  4U0Y A;  2GA2 A;  5CQE A;  5FB2 A;  3ZOB A;  1FY7 A;  4IRH A;  5LLQ A;  4A3J J;  4L9N A;  1A6I A;  5ILS A;  5GPC A;  3GBG A;  3KP6 A;  1AA7 A;  2X1D A;  1G3W A;  3JRG A;  1FNN A;  3WTT C;  4LFU A;  1MBF A;  1ZGA A;  2CUE A;  6PAX A;  2CRG A;  4AYB A;  1X19 A;  5KAF C;  3JRD A;  1FX7 A;  1ZRE A;  3QPH A;  1ZN2 A;  3GFJ A;  1MZB A;  1DGW Y;  3KYL A;  2ZFU A;  4RLF A;  3H35 A;  4L5E A;  4UV9 A;  5HS8 A;  2YPR A;  3HKZ N;  4A3K J;  2M8G X;  4E6K G;  3A01 A;  5J1U A;  2JN6 A;  1QNT A;  4LIU A;  4G6D A;  4A93 J;  2D5V A;  3LQR A;  2QQ8 A;  1ZEL A;  3ZQ7 A;  3FX3 A;  3H3U A;  4CYD A;  2VC0 A;  5CVR A;  1GT0 C;  4A3B J;  2Q1Z B;  2PEX A;  3ZXS A;  4PSX A;  2IEK A;  3MZY A;  1VI0 A;  3N97 A;  4U0W A;  3DLL F;  1DU0 A;  2OZ6 A;  1P2F A;  2HXO A;  1OYI A;  1PUF A;  4KMF A;  4YFN F;  2FQ4 A;  2K5C A;  2GQQ A;  3QPT A;  2FA5 A;  3TDZ C;  4XLA A;  1HCR A;  1BI3 A;  2UZK A;  4HA8 A;  1FYK A;  2BY1 A;  4ZDL A;  4AID A;  5IYB J;  1U2W A;  1CF7 B;  1B9M A;  4DYR A;  2X0L A;  3KZI C;  2LFB A;  1LQ1 A;  2EB7 A;  4L9J A;  2V1D A;  3TOA A;  5HNH A;  3WTS C;  2DT5 A;  1S5L C;  1VQN I;  5D5U B;  2KIS A;  5BPI A;  4B4C A;  3SDG A;  1RUN A;  2M45 A;  2RAE A;  4ITV A;  1Y1W J;  2ESH A;  4HG2 A;  3VOD A;  3TED A;  3HOX J;  1JT0 A;  1JGG A;  3DKW A;  2EPF A;  3O2P E;  4N9I A;  1PJR A;  1ETX A;  2X51 A;  1GV5 A;  2ZKZ A;  1D8J A;  2KRH A;  3DXJ F;  3K69 A;  4ZYE A;  3RKW A;  1JKQ C;  3DTI A;  4AIK A;  5FLX Z;  3M3Y J;  3DKY A;  3D1N I;  1HW1 A;  2JUG A;  3B73 A;  2Q8K A;  1ITY A;  4CXF A;  1WJE A;  1BW5 A;  2KDZ A;  1FWZ A;  4A12 A;  5EF6 A;  3LNQ A;  2HNH A;  5ILV A;  4EGZ A;  3IV5 A;  2ZXJ A;  4M72 A;  4IZZ A;  2ICW G;  2WWY A;  3QPL A;  1SFX A;  4AIJ A;  1J5Y A;  4ZTJ A;  3OIO A;  5FKO A;  2IA0 A;  3S14 J;  3LFU A;  2JSC A;  2GWR A;  1S29 A;  1M1E B;  1TWG J;  1LVK A;  4CCO A;  4XOP A;  5D6F A;  3W6K B;  1GVD A;  2Y31 A;  3F9K A;  5LD2 C;  4KIF A;  2Z9O A;  4RGS A;  1QQI A;  2HQR A;  2LKS A;  3JTG A;  3N4M A;  4A3E J;  1R22 A;  2R7S A;  1TL8 A;  3J81 Z;  4BH9 A;  3L2V A;  3GWZ A;  1R58 A;  1WI3 A;  4NC7 A;  4EGY A;  3G1O A;  4X6A J;  4CUG A;  1UAA A;  4OMY A;  3TQN A;  1OCP A;  1JT6 A;  5EG0 B;  3COA C;  5HLG A;  2P5V A;  4KT6 A;  1IUF A;  4KA4 A;  3HB9 A;  3L2C A;  4C2T A;  2E2I J;  1JXS A;  2DA5 A;  1ZHF A;  3OYC A;  2EV5 A;  1FIP A;  2R7F A;  2OPT A;  3ZMD A;  4TV7 A;  5HLH A;  1UZC A;  2LKX A;  4C2M J;  3PUF A;  1KU9 A;  2DLL A;  3KE2 A;  1FSE A;  3ZN0 A;  3GZ6 A;  1VQO I;  2OAZ A;  3GTM J;  1YOV B;  2COB A;  3LAJ A;  3AG4 H;  5CJ9 A;  1OIS A;  3PQK A;  5LFA A;  1XDS A;  4N0B A;  2HWV A;  3V8K A;  1TWA J;  2RGV A;  1MNM C;  3JRH A;  2JQ7 A;  3HYI A;  2ZME B;  3N05 A;  3O6B B;  5LEJ A;  5IT9 K;  1W7P A;  2P8T A;  3Q9S A;  1O7L A;  4ANJ A;  3H0D A;  1T6S A;  1SC7 A;  4ESB A;  3S1R J;  1OYW A;  2F6C A;  3KYD B;  3E5U A;  5K7Z A;  3LMM A;  4A3L J;  2QLZ A;  1WJC A;  1VQ5 I;  4M9X A;  3NWS A;  3V7R A;  3HUG B;  3FXK A;  3F8C A;  1QGP A;  1EH7 A;  4O6J A;  4CDG A;  2R0Q C;  2DA2 A;  1WHU A;  2IVM A;  4BYY A;  2DJN A;  2EQR A;  2NS7 A;  2VOD A;  5LRR A;  1SD5 A;  1F5T A;  2CUZ A;  3WTU C;  3CF5 F;  1G6N A;  4ZZL A;  3K9T A;  2X6O A;  1JUS A;  1RI7 A;  2HKX A;  1R36 A;  2ZME C;  3H36 A;  2LOO A;  3RDI A;  4F93 B;  1R71 A;  1LDK B;  2HVS A;  3OOU A;  3H5N A;  5D4R A;  2EV6 A;  4ZYD A;  2NRA C;  1W36 C;  1WJ5 A;  3E6B A;  1FP1 D;  2CU7 A;  3F72 A;  1S8N A;  1DPR A;  1MJ9 A;  3HIF A;  1ZLJ A;  3BG3 A;  2HFH A;  2WAE A;  4PJN A;  4EJT A;  2K9Q A;  4HLY A;  3ZP5 A;  4ZYH A;  3K1N A;  4M71 A;  2MLG A;  2NOJ B;  4R8H A;  2VJ5 A;  1X58 A;  1ACI A;  2VQG A;  2EFQ A;  1QZZ A;  4EQQ A;  1T33 A;  2ZJQ F;  1G2H A;  2PJP A;  5J3L A;  3PFY A;  3I9V 2;  2BHY A;  3ZR8 X;  1D5V A;  1Q1H A;  2JTV A;  2H1L A;  1PP7 U;  1B9N A;  2QYO A;  2MH9 A;  2VT3 A;  4YIF A;  3HOZ J;  1OYY A;  4LK0 F;  1A04 A;  4DJA A;  3OYE A;  1K78 B;  2KKO A;  2FML A;  2DW4 A;  2NVQ J;  2RNG A;  3W3C A;  1IDY A;  2HVR A;  4I76 A;  3TP0 A;  1Z9C A;  1R1T A;  2L9N A;  4JX4 A;  2HPM A;  1R1U A;  4D7M A;  4HDV A;  4BEH B;  2MBF A;  2QA4 I;  1KU2 A;  2WV0 A;  2UXX A;  4J01 A;  1T2K A;  4BY7 J;  2NS0 A;  3FWE A;  3L1P A;  2LLK A;  2FD5 A;  2QVO A;  3CQZ J;  3AKZ A;  4BBR J;  1MD0 A;  3PIP F;  4XIC A;  1MSE C;  1D0Y A;  4P96 A;  1J9I A;  1FLI A;  2A68 F;  2EJR A;  2NAZ A;  1D0X A;  2DPU A;  5TRD A;  4BNC A;  3QOP A;  2XGX A;  1FYM A;  1HXD A;  4MTD A;  2YU9 J;  1BW6 A;  3CMM A;  1QZY A;  3OYD A;  2Z99 A;  3NWT A;  2W1O A;  5AON A;  5FLV A;  4X0G A;  2DK5 A;  2MD5 A;  5DD4 A;  3S2W A;  1PP8 F;  1JHF A;  4LD5 A;  2A5Y B;  4EMS A;  2VLA A;  2KP6 A;  4CCN A;  2R5Y B;  2Y30 A;  3P7N A;  3RKQ A;  1JUM A;  3U1D A;  2CQ7 A;  1TW3 A;  1IGN A;  3BP8 A;  3JRE A;  1GV2 A;  1MMA A;  1IO2 A;  2OD5 A;  4GO1 A;  4BUP A;  4CCM A;  1D0Z A;  1RRJ A;  3LSM A;  1G3Y A;  1UHM A;  1Y56 A;  2OTL I;  4I0B A;  1OCC H;  3ZMZ A;  5BPD A;  2P7C B;  4B3X A;  2QSG X;  5ICG A;  4HV6 A;  4IHV A;  4FT8 A;  4M73 A;  2FQ3 A;  2C6Y A;  3AG2 H;  4DIQ A;  3CDH A;  5J8F A;  3KZZ A;  3JRI A;  3TL4 X;  2WC2 A;  4Y15 A;  4XQF A;  3WE3 A;  3S15 J;  4X1E A;  1W5T A;  1X2M A;  4N4N B;  4RB3 C;  3G73 A;  2VKH A;  1NH3 A;  2K9S A;  2JT1 A;  3AAF A;  3FF5 A;  2FBI A;  2VBX A;  2K86 A;  2E35 A;  2WY8 Q;  4D7N A;  3GCM A;  2CW7 A;  2F5F A;  2AO9 A;  4IVN A;  2WB1 A;  2WAD A;  3JAM Z;  3HSE A;  1MIJ A;  2MLK A;  3KP4 A;  3VYT B;  3OY9 A;  4WX9 A;  1ZK8 A;  2FEZ A;  5FFZ A;  3LA7 A;  2CMP A;  1IXS B;  4EJO A;  1MSF C;  2I8D A;  5BS6 A;  3M1E A;  1ZG5 A;  5ICC A;  2JPB A;  3GTO J;  2HS5 A;  4LLL A;  2ZB9 A;  2MH2 A;  2F4M B;  1KYW A;  4Y4R A;  3K10 A;  3EDP A;  1P7I A;  2FSW A;  3T0Y A;  3HKZ A;  2DQR A;  3LSR A;  2TRT A;  2XDV A;  2CQQ A;  3Q5F A;  5CQG A;  4KFC A;  1VQ6 I;  4II2 A;  2LDU A;  1KGS A;  2D1H A;  3H3V K;  4A6D A;  4KT5 C;  1WVR A;  4JYK A;  4F92 B;  3ASN H;  3LSI A;  2PBI A;  1UG0 A;  3KP3 A;  2HXI A;  2KZG A;  4A3F J;  3MN2 A;  5C4J J;  3I56 I;  4MTE A;  1W0U A;  4RGU A;  2VKV A;  4ETS A;  5M5Y J;  5FD6 A;  3CES A;  1L3L A;  3KYC B;  3MMY B;  3P9C A;  2IGN A;  1ON1 A;  4IPA A;  1BJA A;  3EUK L;  3QP6 A;  4HW0 A;  2LH9 A;  4EJU A;  2EBI A;  2QGU A;  2EV0 A;  5DTD A;  3L2R A;  1APL C;  1P7J A;  1BR4 A;  4ON0 A;  5GAG J;  3DQV C;  4J19 A;  3HOV J;  3S2D J;  2DOF A;  4MLO A;  3GO5 A;  4BGD A;  3BZC A;  1JI8 A;  4GCV A;  3K4K A;  2K9M A;  3DKX A;  4FCY A;  1LE8 A;  3HRT A;  2E2H J;  2OV7 A;  4W97 A;  1ETO A;  4XBF A;  4L0Y B;  2R7Q A;  1TBX A;  4HSR A;  3CMA I;  2X85 A;  2GXA A;  5C44 J;  1R9T J;  3L9F A;  3BTJ A;  1ZQ3 P;  4OIQ F;  2PQ8 A;  3WG9 A;  2A3S A;  1ZAR A;  3I0T A;  3TMO A;  4G6T B;  1TWH J;  4DOZ A;  2IAI A;  3CP8 A;  4JP0 A;  3LSJ A;  4L0Z B;  1E0E A;  2VE9 A;  2B9S A;  5E8I A;  2F5C A;  1P4X A;  3SJM A;  3I5U A;  4RAF A;  4I98 B;  1F4K A;  2XAJ A;  2LRE A;  3MKW B;  1IC8 A;  4II3 A;  4DYC A;  1ZRD A;  4A69 C;  5ERI A;  1BBY A;  4P9U A;  2QSF X;  3ELK A;  3U21 A;  3S1Q J;  1J0R A;  1IN5 A;  2BV6 A;  3FBN B;  3GTJ J;  1LE8 B;  4C9Y A;  2MAB A;  1K79 A;  1BR2 A;  1H8A C;  1YRN A;  2O9L A;  3REO A;  1ERD A;  2O0Y A;  2BZT A;  1U6G A;  1V55 H;  1W5C C;  3J7A Y;  1XTA A;  3JTH A;  1ZRC A;  2VUM J;  2IGK A;  2IPQ X;  1IF1 A;  4G7Z F;  2HQN A;  2HKO A;  3LQQ A;  2DYS H;  2FU4 A;  4WWC A;  4BL0 B;  5F0F A;  2W85 A;  4M9S A;  1V5E A;  3SFZ A;  4RBO A;  2OZU A;  2AQE A;  3OSF A;  2LC2 A;  3H9G A;  1BIA A;  3FK6 A;  1R00 A;  4UUT A;  1ZGJ A;  2EH3 A;  5FRO A;  2QBY B;  2V79 A;  4L9V A;  2KIF A;  2Y2Z A;  1HC8 A;  2HR3 A;  1S6L A;  5BOX A;  1WRJ A;  4E7J A;  4IOA F;  2E7X A;  3LA3 A;  5J1R A;  4CCJ A;  4Q47 A;  1KQ0 A;  3FIS A;  2R7U A;  3G3Z A;  3MD2 A;  5DYM A;  3K4J A;  2FX0 A;  1DP3 A;  2JK3 A;  2D2W A;  3R0J A;  3WGI A;  3HTU A;  2VQL A;  2R4G A;  2VC1 A;  4ZDP A;  2K27 A;  3CDI A;  3IHU A;  4DZP A;  4LB5 A;  1EV7 A;  5LGN A;  2DA6 A;  4RB0 A;  2DFI A;  1RET A;  4KIC A;  4LG0 B;  2PMH A;  1XGO A;  3E5Q A;  1QO0 D;  3NAU A;  4EV0 A;  2AQF A;  4EM0 B;  2DOA A;  1Z21 A;  1HKS A;  5DD8 A;  1IZ1 A;  4NBQ A;  1FJL A;  1ONV A;  2H09 A;  1VQK I;  3GFI A;  2JRT A;  4CYC A;  3JCU C;  2E1N A;  4MQ9 F;  3O8G A;  2O61 A;  3K2Z A;  1YJ9 I;  4OOI A;  3F21 A;  2E5Z A;  4BHC A;  4KDP A;  3CCY A;  2VT2 A;  1MBH A;  3IH3 A;  2M87 A;  2EZK A;  3QPS A;  5FRM A;  1AOY A;  3A02 A;  3TOB A;  2HOE A;  2LD5 A;  3F22 A;  3OYI A;  2Y48 A;  3WU1 B;  2VN2 A;  2M2E A;  1I1S A;  3K0L A;  1FMW A;  2HYF A;  1IG7 A;  3KCC A;  4E7H A;  2UUZ A;  3F8F A;  2DAO A;  1X4P A;  5BQT A;  1RIO H;  3AL0 B;  2FRH A;  3OOP A;  4C3J J;  2R7D A;  1GLN A;  2ACJ A;  4RM2 A;  1J09 A;  3S17 J;  4EVI A;  1QVT A;  3ESW B;  3DLA A;  3H5A A;  1ZR4 A;  4BXX J;  4IHX A;  3WHC A;  3X2Q H;  3K4M A;  3LSG A;  1REP C;  1SVM A;  2HTJ A;  1R4N B;  2LYC A;  4XR6 A;  3BTI A;  4HF2 A;  1TC3 C;  1OKR A;  3RI4 A;  3M9A A;  2NOG A;  3CTA A;  1U8B A;  3HGG A;  1QU3 A;  4Y7N J;  5GTH C;  3GZN B;  1KQ8 A;  5BMZ A;  1OPC A;  4UB6 C;  3ZQF A;  4M6X A;  3H9Q A;  3M07 A;  4YFX F;  3BR1 A;  5CLS A;  3AL0 C;  4IO9 F;  1JKP C;  3BQZ A;  4G9Y A;  1NHA A;  4IEJ A;  2W7N A;  4UVB A;  1TT0 A;  2L4M A;  2V1U A;  2DQL A;  4XKW A;  3GTL J;  1U5T B;  1K4S A;  1SMT A;  1I1G A;  4MGR A;  2B0L A;  5F0C A;  3WTV C;  3PIO F;  4PK4 A;  3GLX A;  2DOE A;  3HPH A;  2EA2 A;  1R23 A;  3I71 A;  1FTZ A;  2GAU A;  2W48 A;  3V42 A;  2QSH X;  3RTR A;  5GP9 A;  2EIK H;  2VE8 A;  5L3D A;  2XB0 X;  3BG5 A;  1XSV A;  2X6Y A;  5EDN A;  2YR2 A;  2N8G A;  3RCO A;  3FHN A;  1ZR2 A;  1CF7 A;  2HZT A;  2CYY A;  3GTG J;  1A35 A;  3RIR A;  3ZQG A;  3BTL A;  1MH3 A;  5M3M J;  1U5T C;  2DYR H;  4BDY A;  2ELK A;  2L0K A;  4RAY A;  4HDU A;  2DMN A;  2L9R A;  2ZXI A;  1XG1 A;  5D5V B;  5EZG A;  1KON A;  3ASO H;  1A36 A;  2QQ9 A;  3OL3 A;  2XAF A;  3QOD A;  5TJJ A;  3HM5 A;  3ZN1 A;  1LPQ A;  4L9T A;  1OR7 A;  3EUA A;  5HDG A;  3CCJ I;  1BOB A;  2K7L A;  3BTC A;  4DBQ A;  3OS2 A;  2RC4 A;  3W2W A;  1SVL A;  3RYR A;  3ZQL A;  1YIT I;  2E71 A;  1UG2 A;  2DN0 A;  2B63 J;  2R5Z B;  3ZMS A;  3MZH A;  1Z91 A;  4MFD A;  3C2H A;  2EA4 A;  3DFG A;  4I01 A;  2X1C A;  4MIM A;  1OCZ H;  1W36 D;  3DEU A;  3HZJ A;  2CW8 A;  5LHI A;  3G71 I;  3HOY J;  3QU6 A;  4IL6 C;  3CCU I;  1Y8Q B;  2FMY A;  3IAS 2;  3WU0 A;  3V7C A;  2Y0M A;  4EAT A;  1HOM A;  4ZZD A;  2XB5 A;  4F55 A;  2M9H A;  4IHT A;  4ZTF A;  1ODD A;  5L3E A;  1MJB A;  5CPR B;  1O7F A;  4V19 K;  5J4Y A;  2JA5 J;  1H88 C;  2E60 A;  2DK8 A;  2W25 A;  3G1M A;  3TBI A;  1QRY A;  4NC6 A;  1UHW A;  4HOB A;  3DBH B;  1Z3X A;  4Y33 A;  1R5I D;  1BM9 A;  2Y9Z A;  3C7J A;  2CUJ A;  1W0T A;  1GXP A;  1KQ9 A;  2KJB A;  3CJN A;  4HX4 A;  2XKP A;  4M6Y A;  2CV2 A;  1YE9 A;  1IN8 A;  1XMX A;  2F5E A;  3E97 A;  1PDN C;  4XLE A;  2XAQ A;  2JSP A;  4KMU X;  2HQA A;  4LIV A;  4BXF A;  1MDM B;  2L7Z A;  4XKC A;  3LST A;  1R5H A;  5EG0 A;  1LDD A;  2QUF A;  4QPQ A;  1ETK A;  3F6O A;  2CWE A;  4EM2 A;  1YW9 A;  5CVI A;  1EA3 A;  3MKZ A;  3OL4 A;  2VI6 A;  1U0J A;  1G3T A;  5JI6 A;  4C30 A;  2F2E A;  4BJT A;  1V3F A;  3FM5 A;  1K61 A;  1RC9 A;  5HOO A;  3R6S A;  5KK1 A;  2HVQ A;  3H3Z A;  3W2A A;  3ROU A;  1WH5 A;  1U9O A;  4IQ4 A;  3QYE A;  5B66 C;  3CME I;  2PMZ N;  3GZ5 A;  3LOC A;  2MYS A;  4AUX A;  3FZV A;  4BXU A;  2OF7 A;  1USS A;  4G7H F;  2ZME A;  4E7L A;  3A0H C;  1SD7 A;  2Y9Y A;  1DDN A;  3I58 A;  1YW7 A;  3FBI B;  3JRF A;  3KX2 A;  1EH6 A;  1EH8 A;  2XPU A;  1S7E A;  2E7W A;  5K7H A;  2IA2 A;  1O3Q A;  2R93 J;  2FNA A;  3HUG A;  4D5F A;  2J5O A;  5F64 A;  1XB4 A;  3IH4 A;  3GFL A;  5F08 A;  3GTP J;  3BC8 A;  1RR7 A;  3L7W A;  1AKH B;  1UFM A;  3CCR I;  3BQY A;  2XC7 A;  4XM3 A;  3BRO A;  1H9G A;  3FXJ A;  3E6D A;  4M3D A;  1AHD P;  3S3N A;  4NC8 A;  4N9H A;  2YX4 A;  4FET A;  4RB2 C;  3BPX A;  3FKJ A;  4W1U A;  4S0H B;  2ZJR F;  1CQT A;  2IS1 A;  1WWX A;  3ECO A;  4FE7 A;  2O03 A;  2PI0 A;  4RLQ A;  4I09 A;  5DV5 A;  4O3M A;  4UUS B;  1I3Q J;  4DGW B;  3SQN A;  5C3E J;  2M5W A;  5EZH A;  1SD4 A;  1HDP A;  2L7K A;  2X9D A;  1RKT A;  1XSX A;  2L9V A;  1T0F C;  4NQW B;  3DTK A;  5GAD J;  2LRD A;  2MC3 A;  2JA6 J;  1X3Z B;  2VBW A;  3PUB A;  1BC7 C;  4LOC A;  1G3S A;  1O4X A;  3K2A A;  1BC8 C;  4A5N A;  2M7B A;  2XPW A;  2Z33 A;  1XCB A;  1SFO J;  3ZMU A;  3QAH A;  3TW7 A;  2WY7 Q;  5HS9 A;  2RV8 A;  5EEA A;  3PFI A;  2P6S A;  2GXG A;  2D1V A;  1B1B A;  3DCF A;  3ZQH A;  5FLM J;  1K78 A;  1MBE A;  3VWB A;  3S1M J;  3KLO A;  3GTQ J;  3ML6 A;  1YJN I;  2BHZ A;  4CHU A;  2YSR A;  2FUG 2;  5H6R A;  3HGY A;  4HNT A;  1BJZ A;  4ENN A;  2RQP A;  4BEH A;  2M4K A;  4XLF A;  2MW8 A;  3E6M A;  1B72 A;  4BJ5 C;  1MBJ A;  1ZYR F;  1HW5 A;  4UHT A;  5J40 A;  3TKY A;  4YIR X;  1IRX A;  4G6Q A;  2X6W A;  4XN3 A;  3F8N A;  5ED4 A;  2OA4 A;  2DDA A;  4BBS J;  5FKM A;  1QHG A;  3BR2 A;  2FE3 A;  2OUM A;  2L9S A;  3H1C A;  5FLX K;  3H9J A;  4IHW A;  2R7W A;  3S93 A;  2OCE A;  4YEJ A;  5K7F A;  4CCL A;  2W4S A;  2R5Y A;  3T5X A;  1FIA A;  3JR9 A;  4CZC A;  1IXC A;  5CVV A;  1XD7 A;  4KN4 X;  4E7S A;  2X1E A;  3G6E I;  3AG1 H;  2LTP A;  4P1W A;  3VPR A;  1SAX A;  2CSO A;  1Z7U A;  2GIV A;  3VB2 A;  3ZMV A;  2VKE A;  3MKL A;  1G59 A;  2EFW A;  1I5Z A;  2LKP A;  3KEY A;  1I6X A;  1B72 B;  3HOS A;  1FOW A;  2DA1 A;  2K3F A;  2M0C A;  4GXO A;  1LUJ B;  1D1B A;  2IA1 A;  2QKM B;  5DCM A;  2IGO A;  2RNJ A;  4BQQ A;  2JJ7 A;  5KAI C;  1IN6 A;  2Z16 A;  3C2B A;  3GW2 A;  3K4B A;  4OAY A;  4BJ6 C;  1WJA A;  2ZCW A;  1OJL A;  2IW5 A;  1YYV A;  1KA8 A;  2LSO A;  1P4A A;  2DA4 A;  3NQO A;  4V2F A;  3CUO A;  4XN0 A;  3J81 K;  1H9T A;  1RUO A;  1S7O A;  2XRL A;  2IJL A;  3KIO A; 
#chains in the Genus database with same CATH homology
 1YIO A;  1HKT A;  2GA1 A;  1IW7 F;  1QBJ A;  2RKH A;  4LLG F;  3B02 A;  3HHG A;  4HV5 A;  1F1Z A;  2ISY A;  4QWQ A;  2CG4 A;  4MHG A;  3SZT A;  4LGW A;  3RKY A;  1C0W A;  1FBS A;  2M30 A;  5DCM B;  2BYV E;  5L3G A;  1FSH A;  2NYX A;  5JVT A;  1VTN C;  3GUD A;  2BE5 F;  3GVA A;  1UCR A;  4A0X A;  2TDX A;  1TNS A;  5CYV A;  5A2Q Z;  4IRG A;  1DPU A;  4B8X A;  2FOK A;  4PCQ A;  2BEO A;  4K2E A;  1UST A;  4EJW A;  1GHC A;  2DU9 A;  3JSP A;  1LNW A;  3KET A;  3R4K A;  3JSO A;  5L3B A;  2LNB A;  2VBY A;  4KNY A;  2ZNZ A;  5LGU A;  2BBY A;  1HKQ A;  2PG4 A;  4LJZ F;  3R61 A;  4ESF A;  4WCG A;  1E17 A;  3K1M A;  2XAS A;  2OU2 A;  5HDN A;  1KU7 A;  5ICF A;  4ASN A;  1B59 A;  3EET A;  3SZP A;  4M9Z A;  2XV4 S;  2VXZ A;  1XGS A;  4D0P A;  3P9K A;  2K4J A;  4S04 A;  5HS7 A;  3EYI A;  4MEX F;  1K6O A;  3GEZ A;  1UB9 A;  2RVC A;  5HVQ C;  4RGX A;  5AIQ A;  4F7Z A;  2ZO4 A;  4U88 A;  3JW4 A;  4FX0 A;  1IAW A;  2QBY A;  4Z2Y A;  1YO5 C;  4Q4Z F;  3IWF A;  5F6F A;  4HAM A;  2P6T A;  1T39 A;  4ENK A;  3DPT A;  2CFX A;  1XDU A;  2Q0O A;  4I2O A;  4LG0 A;  3MAJ A;  4ZH4 F;  4MQV A;  3BZ6 A;  2VOO A;  2FXA A;  2P4W A;  4RB1 A;  4AIH A;  2AS5 F;  2PFB A;  3Q9V A;  4BHP A;  1SD6 A;  5D5X B;  5ILU A;  5JFR A;  2OQR A;  4UVA A;  1T98 A;  3FXQ A;  5HDK A;  5FFX A;  3KEO A;  3F8B A;  1V4R A;  4I0A A;  1TLH B;  5K5O A;  1FP2 A;  2FBK A;  1XSD A;  1LEB A;  1FC3 A;  2ISZ A;  2V6C A;  2G9W A;  3M7G A;  3BJO A;  3TO7 A;  2YU3 A;  4XLP F;  4JQF A;  2H27 A;  4ENM A;  5D8L B;  2GZW A;  2KIU A;  3FMS A;  3VOE A;  2H6C A;  3QP5 A;  1FT9 A;  4HLX A;  1U5T A;  3BPV A;  3ABT A;  3V7S A;  4S05 A;  3LA2 A;  1YFH A;  4HF1 A;  2COM A;  3CUQ B;  2PMU A;  2HDC A;  4KN7 X;  1KU3 A;  2L02 A;  1SFE A;  1BN5 A;  1R5G A;  2FNP A;  4HYE A;  3K1P A;  2JPC A;  3V4G A;  4NB5 A;  1J7K A;  1GVJ A;  2CQK A;  2ETH A;  2NNN A;  1GXQ A;  4IHS A;  3ZMT A;  3LFK A;  3T1B A;  3WTX C;  5E18 F;  1K7A A;  5H20 A;  2Y75 A;  1J2X A;  3CUQ C;  1W5S A;  5FGM A;  4AWX B;  3RYP A;  2DPD A;  3FMR A;  4BQA A;  2EFN A;  1Z6T A;  1HBX G;  5E17 F;  3IWZ A;  5LRS A;  3IKT A;  3I59 B;  1T38 A;  1HST A;  3NRV A;  3DV8 A;  3OV8 A;  4HX8 A;  5J6X A;  3ISP A;  2XVC A;  1XMK A;  2H94 A;  2STW A;  1X3U A;  3HSR A;  5J8C A;  5D6E A;  4ZYG A;  2VBZ A;  5LHG A;  5E1Z B;  2IP2 A;  4I02 A;  1P92 A;  1WI9 A;  3D5L A;  3V8L A;  1YS6 A;  1AWC A;  4U7D A;  1D3Y A;  5IT3 A;  1I27 A;  1G4D A;  1MJA A;  2P5L C;  4U7B A;  1Y0U A;  3GYH X;  1MDM A;  4Q5S F;  3I4P A;  3WTW C;  2O6G E;  4Y13 A;  1IN4 A;  4WXC A;  4A2U A;  5K1Y A;  2ADU A;  1FZP B;  5IT9 Z;  1LJ9 A;  5CVJ A;  3LWF A;  2QZ8 A;  3D0S A;  3W6J B;  1BI2 A;  1HSJ A;  2DI3 A;  5E1X A;  1XGN A;  2MA3 A;  1XGM A;  3E3V A;  1WQ2 A;  2M8E A;  4JBA A;  2W57 A;  4RAZ A;  3F3X A;  3TO9 A;  4BAY A;  3EYY A;  5DUI A;  3M8E A;  3TO6 A;  3J80 K;  1JGS A;  3IRQ A;  4A0Y A;  4A5M A;  5H6Q A;  1H0M A;  3WGH A;  2E1C A;  3T8T A;  1Z1D A;  4JK1 X;  5DCF A;  1T0F A;  1XCV A;  4IF4 A;  3MCZ A;  5DEQ A;  2K4B A;  3FXU A;  3SHF A;  5LEK A;  4P55 A;  1YG2 A;  4OIN F;  3LAP A;  4M74 A;  2V1X A;  4A0Z A;  1BIB A;  4IRI A;  1HW2 A;  1W7P D;  4LB6 B;  4NHJ A;  4GYG A;  4NQW A;  2ZFW A;  4R79 A;  1TNT A;  1WSU A;  5DUK A;  1B6A A;  1JHH A;  4UV8 A;  3BJA A;  1FBQ A;  3IC7 A;  2G7U A;  1RNL A;  5F1R A;  1O57 A;  3HRU A;  2AXL A;  1E2X A;  2M1B A;  4L18 B;  4EJV A;  4OIO F;  1BI0 A;  3DPL C;  1U3E M;  2NNY A;  1O3T A;  4XSZ F;  3RJP A;  2A69 F;  4FHT A;  3HSF A;  1IUY A;  5D8K B;  3HRS A;  1IN7 A;  3F8M A;  3P9I A;  4YG2 F;  2RN7 A;  2CO5 A;  4WK8 F;  4LLN A;  2KJC A;  4HBL A;  3QU3 A;  2P7V B;  2XKO A;  4IJA A;  1FBU A;  1YS7 A;  1FPQ A;  2L01 A;  3RPQ A;  2EK5 A;  4UXN A;  4BHB A;  1D8K A;  1IXR C;  2PLY A;  3HRM A;  4P9F A;  4LMY A;  1YW8 A;  2ESN A;  5EEH A;  4PDK A;  3VFZ A;  3MEX A;  3KZY A;  3ABU A;  3WOD F;  3I54 A;  2OQG A;  1TQI A;  4CZZ A;  4AD9 A;  3E5X A;  3MFK A;  1ON2 A;  3BWG A;  2RDP A;  4HZF A;  5E1W A;  2XAH A;  3CO7 C;  1MGT A;  1W7P B;  5FD5 A;  2O8X A;  3PQJ A;  1FYL A;  1ZG3 A;  5DDG A;  5CVU A;  1ZLK A;  3C18 A;  3KP5 A;  4HX7 A;  5E20 A;  3FHZ A;  2UWM A;  3KFW X;  3I53 A;  2K02 A;  3WTZ A;  1FOK A;  1SMY F;  2A6E F;  4B09 A;  5LBQ A;  4MEY F;  2A07 F;  4WXH A;  2F5D A;  4U0V A;  1B4A A;  3NEU A;  3E6C C;  2LF7 A;  3BY6 A;  3BJ6 A;  1LDJ A;  2HGC A;  2XAG A;  5LHH A;  1LB2 A;  1PUE E;  2KRF A;  4KIB A;  4UUV A;  1W4M A;  2DO7 A;  1J75 A;  5EEG A;  1F9N A;  1HQC A;  4PZJ A;  3KP7 A;  4G7O F;  1MKM A;  3F23 A;  5K5Q A;  1STZ A;  3M8F A;  2DBB A;  2FF4 A;  2JZY A;  4CIC A;  3FMQ A;  4CGZ A;  2V9V A;  2XRO A;  3GX4 X;  5LGT A;  4L5I A;  2O3F A;  3F6V A;  5FO5 A;  2YX7 A;  1IRF A;  3L00 A;  1DUX C;  3J7A O;  3IRR A;  2BGC A;  2P5K A;  1YTY A;  4KIG A;  3ERE D;  3DP7 A;  3GFM A;  4EM1 A;  2STT A;  3BDD A;  3IL2 A;  3FM3 A;  2QQA A;  4L5J A;  5JR3 A;  1KYZ A;  3C1D A;  1Z05 A;  4FX4 A;  4KYW A;  4P5O A;  2EFO A;  1RZ4 A;  2Q2E A;  3R60 A;  3HHH A;  3EQL F;  4UVC A;  2HEO A;  1U8R A;  2HYG D;  1ZRF A;  4G94 A;  4Q48 A;  3SXY A;  3U9G A;  3WE2 A;  3ZPL A;  5AIP A;  3I64 A;  3KP2 A;  1BOA A;  4OIR F;  2W84 A;  4LK1 F;  5L3C A;  5HLI A;  4YII A;  1QPM A;  2VON A;  3FXR A;  4I7H A;  4RS8 A;  3MWM A;  2XIG A;  4A6E A;  1S3J A;  3ULQ B;  1TTY A;  1XN7 A;  1U78 A;  1ZH5 A;  1TW2 A;  2IRF G;  1Z6R A;  1XMA A;  3QRF F;  3V8J A;  5E8G A;  4AVP A;  4MNU A;  2XUB A;  3CO6 C;  1OMI A;  2CGP A;  2Z3Y A;  3U2R A;  2ZBK A;  2FBH A;  2W24 A;  4WF2 A;  5D4S A;  3TDU C;  4WXD A;  2ZNY A;  2D45 A;  5KVR A;  3JAM K;  2QEN A;  3L09 A;  1YQA A;  5A2Q K;  1ZG1 A;  3VEP A;  3IKV A;  1O3S A;  4GGG A;  2X4H A;  1DP7 P;  4GYI A;  4E70 A;  2OBP A;  1R7J A;  4PGG A;  2GXB A;  4YFK F;  1YLF A;  2IT0 A;  1CGP A;  3RPU A;  1P4W A;  3MQ0 A;  1LVA A;  3CUQ A;  3ECH A;  3TGN A;  4R1H A;  4RGR A;  3GF2 A;  1ULY A;  2QQB A;  2A61 A;  2EWN A;  2L3D A;  2Z5U A;  4XLN F;  2R3S A;  1O3R A;  3KLN A;  3HTS B;  4OMZ A;  1BI1 A;  1L0O C;  3R0A A;  1LEA A;  4O5V A;  2UXN A;  1SFU A;  2HTS A;  5JHU A;  3T8R A;  2ELH A;  4IXA A;  3WTY C;  1IRG A;  4UNO A;  3CLO A;  2LF8 A;  3I59 A;  5K5R A;  4G8X A;  2L4A A;  2XRN A;  2KIM A;  3BOQ A;  4ENJ A;  1P6R A;  3C3W A;  2DTR A;  2J5P A;  1J59 A;  4PGH A;  2A6H F;  3J80 Z;  3EUH A;  2L54 A;  2EFP A;  2QWW A;  4H0E A;  4OU0 A;  5D5W B;  1ZAO A;  4KUM A;  4OIP F;  2WTE A;  3DF8 A;  3RKX A;  1R1V A;  4XRF A;  2G7H A;  4HQM A;  2XHK A;  1S7A A;  4Y17 A;  2CW0 F;  4DQ2 A;  4ESJ A;  4DNC A;  4QLC U;  5L3F A;  2QM3 A;  4CO8 A;  1JE8 A;  4XSX F;  4HF0 A;  2PN6 A;  1WKM A;  2VOP A;  5ICE A;  2H6B A;  3KEQ A;  3WGG A;  1TQM A;  3O3K A;  3HOT A;  4HQE A;  2ZJ2 A;  1TQP A;  3GXO A;  3H92 A;  4U0Y A;  2GA2 A;  5FB2 A;  1FY7 A;  4IRH A;  5LLQ A;  4L9N A;  5ILS A;  3KP6 A;  1G3W A;  1FNN A;  3WTT C;  4LFU A;  1ZGA A;  6PAX A;  1FX7 A;  1ZRE A;  3QPH A;  1ZN2 A;  3GFJ A;  1MZB A;  4UV9 A;  5HS8 A;  2YPR A;  1QNT A;  4G6D A;  3LQR A;  3ZQ7 A;  3FX3 A;  3H3U A;  4CYD A;  2VC0 A;  5CVR A;  2PEX A;  3MZY A;  3N97 A;  4U0W A;  2OZ6 A;  1P2F A;  1OYI A;  4KMF A;  4YFN F;  2GQQ A;  3QPT A;  2FA5 A;  3TDZ C;  1BI3 A;  2UZK A;  4HA8 A;  1FYK A;  1U2W A;  1CF7 B;  1B9M A;  2X0L A;  1LQ1 A;  2EB7 A;  4L9J A;  2V1D A;  3TOA A;  3WTS C;  2DT5 A;  5D5U B;  5BPI A;  1RUN A;  2M45 A;  2ESH A;  3VOD A;  3DKW A;  3O2P E;  4N9I A;  2ZKZ A;  1D8J A;  3DXJ F;  3K69 A;  4ZYE A;  3RKW A;  4AIK A;  5FLX Z;  1HW1 A;  3B73 A;  2Q8K A;  4CXF A;  1FWZ A;  4A12 A;  4EGZ A;  5ILV A;  2ZXJ A;  4M72 A;  2WWY A;  1SFX A;  4AIJ A;  1J5Y A;  2IA0 A;  2JSC A;  2GWR A;  1S29 A;  5D6F A;  3W6K B;  2Z9O A;  4KIF A;  4RGS A;  1QQI A;  2HQR A;  3JTG A;  3N4M A;  1R22 A;  3J81 Z;  4BH9 A;  3GWZ A;  1R58 A;  4EGY A;  4OMY A;  3TQN A;  3COA C;  5HLG A;  2P5V A;  4KA4 A;  3L2C A;  1JXS A;  1ZHF A;  2EV5 A;  2R7F A;  3ZMD A;  4TV7 A;  5HLH A;  1KU9 A;  2DLL A;  3KE2 A;  1FSE A;  3ZN0 A;  3GZ6 A;  2OAZ A;  3LAJ A;  5CJ9 A;  3PQK A;  1XDS A;  4N0B A;  2HWV A;  3V8K A;  2RGV A;  3HYI A;  2ZME B;  5LEJ A;  3O6B B;  5IT9 K;  1W7P A;  2P8T A;  3Q9S A;  1O7L A;  1T6S A;  4ESB A;  1OYW A;  3E5U A;  2QLZ A;  4M9X A;  3V7R A;  3F8C A;  1QGP A;  1EH7 A;  4O6J A;  4CDG A;  2IVM A;  4BYY A;  2VOD A;  5LRR A;  1SD5 A;  1F5T A;  3WTU C;  1G6N A;  4ZZL A;  3K9T A;  1RI7 A;  2HKX A;  1R36 A;  3RDI A;  1LDK B;  4ZYD A;  5D4R A;  2EV6 A;  2NRA C;  3E6B A;  1FP1 D;  3F72 A;  1S8N A;  1DPR A;  1MJ9 A;  3HIF A;  1ZLJ A;  2HFH A;  4EJT A;  4HLY A;  3ZP5 A;  4ZYH A;  3K1N A;  4M71 A;  2MLG A;  4R8H A;  2EFQ A;  1QZZ A;  4EQQ A;  2PJP A;  1D5V A;  1Q1H A;  2JTV A;  1PP7 U;  1B9N A;  2QYO A;  2MH9 A;  2VT3 A;  4YIF A;  1OYY A;  4LK0 F;  1A04 A;  1K78 B;  2KKO A;  2FML A;  2DW4 A;  1Z9C A;  1R1T A;  1R1U A;  4HDV A;  2MBF A;  1KU2 A;  2WV0 A;  2UXX A;  1T2K A;  2NS0 A;  3FWE A;  2QVO A;  1MD0 A;  4P96 A;  1J9I A;  1FLI A;  2A68 F;  2EJR A;  2NAZ A;  2DPU A;  5TRD A;  4BNC A;  3QOP A;  2XGX A;  1FYM A;  1HXD A;  4MTD A;  1QZY A;  2Z99 A;  5AON A;  2DK5 A;  2MD5 A;  5DD4 A;  3S2W A;  1PP8 F;  1JHF A;  4LD5 A;  2A5Y B;  4EMS A;  3P7N A;  3U1D A;  1TW3 A;  3BP8 A;  4GO1 A;  2OD5 A;  1G3Y A;  1UHM A;  4I0B A;  3ZMZ A;  5BPD A;  2P7C B;  5ICG A;  4HV6 A;  4FT8 A;  4M73 A;  2FQ3 A;  2C6Y A;  5J8F A;  3CDH A;  3KZZ A;  2WC2 A;  4Y15 A;  3WE3 A;  1W5T A;  4RB3 C;  3G73 A;  2JT1 A;  3AAF A;  3FF5 A;  2FBI A;  2VBX A;  2K86 A;  2F5F A;  4IVN A;  3JAM Z;  3HSE A;  2MLK A;  3KP4 A;  4WX9 A;  2FEZ A;  5FFZ A;  3LA7 A;  1IXS B;  4EJO A;  5BS6 A;  3M1E A;  1ZG5 A;  5ICC A;  2JPB A;  2HS5 A;  4LLL A;  2MH2 A;  1KYW A;  3EDP A;  2FSW A;  3T0Y A;  3Q5F A;  2DQR A;  4KFC A;  2LDU A;  1KGS A;  2D1H A;  4A6D A;  4KT5 C;  2PBI A;  3KP3 A;  4MTE A;  4RGU A;  4ETS A;  5FD6 A;  1L3L A;  3P9C A;  1ON1 A;  4IPA A;  1BJA A;  3QP6 A;  4HW0 A;  4EJU A;  2EV0 A;  4ON0 A;  3DQV C;  3GO5 A;  4GCV A;  3HRT A;  4L0Y B;  4XBF A;  1TBX A;  3L9F A;  4OIQ F;  2PQ8 A;  3WG9 A;  2A3S A;  1ZAR A;  3I0T A;  4L0Z B;  2VE9 A;  5E8I A;  2F5C A;  1P4X A;  3I5U A;  4I98 B;  1F4K A;  2XAJ A;  1ZRD A;  5ERI A;  1BBY A;  4P9U A;  3ELK A;  1J0R A;  1IN5 A;  2BV6 A;  1K79 A;  3REO A;  2O0Y A;  1U6G A;  3JTH A;  1ZRC A;  2IPQ X;  1IF1 A;  4G7Z F;  2HQN A;  2HKO A;  3LQQ A;  2FU4 A;  4WWC A;  2W85 A;  4M9S A;  3SFZ A;  2OZU A;  1BIA A;  1R00 A;  2QBY B;  1ZGJ A;  2V79 A;  4L9V A;  2KIF A;  2HR3 A;  1S6L A;  5BOX A;  1WRJ A;  2E7X A;  3LA3 A;  4Q47 A;  1KQ0 A;  3G3Z A;  5DYM A;  2D2W A;  3R0J A;  3WGI A;  3HTU A;  2VC1 A;  2K27 A;  4LB5 A;  3IHU A;  1EV7 A;  5LGN A;  4RB0 A;  2DFI A;  4KIC A;  4LG0 B;  2PMH A;  1XGO A;  3E5Q A;  1QO0 D;  4EV0 A;  4EM0 B;  1HKS A;  5DD8 A;  1IZ1 A;  1ONV A;  2H09 A;  3GFI A;  2JRT A;  2E1N A;  4MQ9 F;  2O61 A;  3K2Z A;  4OOI A;  3F21 A;  4BHC A;  4KDP A;  2VT2 A;  2M87 A;  1AOY A;  3TOB A;  2HOE A;  3F22 A;  2Y48 A;  3WU1 B;  2VN2 A;  1I1S A;  3K0L A;  2HYF A;  3KCC A;  3F8F A;  5BQT A;  2DAO A;  1RIO H;  2FRH A;  3OOP A;  2R7D A;  2ACJ A;  4EVI A;  1REP C;  2HTJ A;  4HF2 A;  1OKR A;  3RI4 A;  3M9A A;  3CTA A;  1KQ8 A;  5BMZ A;  1OPC A;  4M6X A;  4YFX F;  5CLS A;  4G9Y A;  1NHA A;  4UVB A;  2L4M A;  2V1U A;  2DQL A;  1U5T B;  1SMT A;  1I1G A;  4MGR A;  2B0L A;  3WTV C;  3GLX A;  2EA2 A;  1R23 A;  3I71 A;  2GAU A;  3RTR A;  2VE8 A;  5L3D A;  1XSV A;  2YR2 A;  1CF7 A;  2HZT A;  2CYY A;  3RIR A;  1U5T C;  4RAY A;  4HDU A;  5D5V B;  2QQ9 A;  2XAF A;  5TJJ A;  3ZN1 A;  4L9T A;  1OR7 A;  5HDG A;  2K7L A;  2RC4 A;  3RYR A;  3ZMS A;  3MZH A;  1Z91 A;  2EA4 A;  3DFG A;  4I01 A;  3DEU A;  5LHI A;  3QU6 A;  2FMY A;  3WU0 A;  3V7C A;  2Y0M A;  4ZZD A;  4IHT A;  1ODD A;  5L3E A;  1MJB A;  1O7F A;  2DK8 A;  2W25 A;  1UHW A;  4HOB A;  1BM9 A;  3C7J A;  1GXP A;  1KQ9 A;  2KJB A;  3CJN A;  4HX4 A;  2XKP A;  4M6Y A;  1IN8 A;  2F5E A;  3E97 A;  1PDN C;  2XAQ A;  4KMU X;  1MDM B;  3LST A;  1R5H A;  1LDD A;  2QUF A;  3F6O A;  2CWE A;  4EM2 A;  1YW9 A;  5CVI A;  1G3T A;  5JI6 A;  2F2E A;  1V3F A;  3FM5 A;  5HOO A;  3R6S A;  5KK1 A;  3H3Z A;  3ROU A;  3GZ5 A;  3FZV A;  4BXU A;  1USS A;  4G7H F;  2ZME A;  1SD7 A;  1DDN A;  3I58 A;  1YW7 A;  1EH6 A;  1EH8 A;  2E7W A;  2IA2 A;  1O3Q A;  2FNA A;  3HUG A;  2J5O A;  5F64 A;  1XB4 A;  3GFL A;  3L7W A;  1UFM A;  3BRO A;  1H9G A;  3E6D A;  4N9H A;  2YX4 A;  4RB2 C;  3BPX A;  1WWX A;  3ECO A;  2O03 A;  2PI0 A;  4I09 A;  5DV5 A;  4O3M A;  3SQN A;  2M5W A;  1SD4 A;  1XSX A;  2MC3 A;  2VBW A;  1BC7 C;  1G3S A;  1BC8 C;  4A5N A;  2Z33 A;  1XCB A;  3ZMU A;  3QAH A;  5HS9 A;  2RV8 A;  3PFI A;  2P6S A;  2GXG A;  2D1V A;  1B1B A;  1K78 A;  3KLO A;  3ML6 A;  4CHU A;  2YSR A;  5H6R A;  4ENN A;  2RQP A;  3E6M A;  1ZYR F;  1HW5 A;  4UHT A;  3TKY A;  4G6Q A;  3F8N A;  5ED4 A;  2OA4 A;  2FE3 A;  5FLX K;  3T5X A;  1IXC A;  5CVV A;  1XD7 A;  4KN4 X;  1SAX A;  2CSO A;  1Z7U A;  2GIV A;  3VB2 A;  3ZMV A;  2EFW A;  1I5Z A;  2LKP A;  1I6X A;  3HOS A;  4GXO A;  2IA1 A;  5DCM A;  2RNJ A;  1IN6 A;  3GW2 A;  2ZCW A;  2IW5 A;  1YYV A;  1KA8 A;  2LSO A;  1P4A A;  3NQO A;  3CUO A;  3J81 K;  1H9T A;  1RUO A;  1S7O A;  2IJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...