2EK5A

Crystal strucutre of the transcriptional factor from c.glutamicum at 2.2 angstrom resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
VPLYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGMFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of transcription factor CGL2947 from Corynebacterium glutamicum in two crystal forms: A novel homodimer assembling and the implication for effector-binding mode
pubmed doi rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Transcription
molecule keywords Predicted transcriptional regulators
total genus 37
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ek5A00
2FE3A 3V8JA 1PUEE 1Z9CA 3F21A 4I0BA 3I59B 2YPRA 2PG4A 3C18A 1FLIA 5D8LB 3M9AA 4KN7X 3ELKA 3PFIA 1LQ1A 4ENKA 2EFPA 3WTXC 3ROUA 4L0ZB 1FBSA 2OQGA 2XGXA 3RI4A 3JW4A 1JE8A 1LDKB 3DQVC 5DD4A 3KZYA 1XGSA 3DV8A 4PGHA 2FU4A 5IT3A 1TLHB 1BN5A 1T98A 1LNWA 1HBXG 4KFCA 2R3SA 5LGTA 4XRFA 4HQEA 3SQNA 5D5UB 5LHIA 3BZ6A 1YW7A 2DK8A 1IRFA 1IZ1A 3ABTA 4U0VA 1Z1DA 2F5DA 2VT2A 1B1BA 2F5CA 2FMYA 1F4KA 3TDUC 1TBXA 2FBIA 1F9NA 2JSCA 3FHZA 1BJAA 4YFKF 4CZZA 1AOYA 4OU0A 4FX0A 1IN4A 3VEPA 2JPCA 2CO5A 2GXBA 1W4MA 3TO9A 5L3DA 2L54A 4KMUX 2V1XA 1FWZA 3U2RA 4CDGA 2DU9A 2ZMEA 2ZKZA 4A6EA 1YW8A 1YO5C 5BOXA 2HDCA 3R6SA 3ZQ7A 3CUOA 3JSOA 1U5TA 4CICA 3R0JA 1YTYA 2VBWA 3H3ZA 3JTGA 4U88A 2ESNA 2DAOA 1S6LA 3WTZA 5BPDA 5HDGA 2M8EA 4ENJA 1GXQA 3DF8A 1U5TC 5BQTA 3KP3A 5BPIA 1FSHA 1ZAOA 1P4WA 5ILUA 3K0LA 2OD5A 2JRTA 1HW5A 3GF2A 5E20A 2QQBA 3HSRA 3MFKA 2Y0MA 1EH6A 3E3VA 5ICGA 2K86A 3P9KA 1A04A 1RZ4A 5ILSA 3GUDA 3F8BA 1ZGAA 2ZBKA 2QBYA 2LF7A 3HRMA 3HTUA 2GAUA 3L9FA 1QZZA 1P4AA 4TV7A 2O6GE 3CUQC 1RUNA 2ZMEB 4U0WA 1NHAA 1J75A 3KE2A 4B8XA 1D3YA 3FMSA 1WKMA 3J80K 3CUQB 1ZG5A 3JSPA 5KK1A 4RB1A 3V8KA 3WU0A 3ZMUA 1U3EM 4O3MA 3BPXA 3EDPA 2L4AA 2Q0OA 4G6QA 4ZH4F 2HR3A 1U8RA 1HKTA 1W7PA 2EV0A 1OYWA 4OMYA 1V4RA 1YIOA 3J80Z 4P96A 3JTHA 2IP2A 1MDMA 3RKXA 4M74A 1ON2A 4RGUA 1BI2A 4HDUA 2D1VA 1ON1A 1OMIA 2A5YB 1XMAA 2ADUA 2P7VB 1O3QA 5H6RA 5AIQA 2XV4S 3GFJA 4IHTA 2VODA 1D8KA 3B02A 3I59A 4HX4A 5F6FA 2FSWA 2ISZA 3IKVA 4KT5C 3GFIA 3GW2A 1T39A 3CO6C 1GHCA 5CVUA 4RAZA 3I0TA 2JT1A 2EB7A 2ZO4A 2V1DA 1CF7A 4UVBA 4NQWA 2G9WA 3K1NA 2MLKA 4UNOA 4L5JA 1ULYA 3QRFF 2P4WA 5E1WA 3WGHA 4A0YA 2FBKA 1XB4A 4IJAA 4EJTA 3GEZA 4RAYA 1OKRA 1G3TA 5K5OA 4G9YA 4BNCA 3CJNA 3J81K 4MEXF 4XBFA 4N9HA 4LK0F 2OA4A 4O5VA 2VOOA 3C7JA 3N4MA 3FMRA 3MZYA 1FBUA 2H6CA 2XAQA 2H09A 4HV6A 2OQRA 2EWNA 1GXPA 1EH7A 2EFWA 3E6MA 2HQNA 3DXJF 3OV8A 3RTRA 2BE5F 4ZYGA 4OIOF 1JGSA 3HRUA 5IT9Z 3LQQA 4Q48A 3RKWA 4LLNA 1R23A 2A6EF 3LA7A 1I1GA 4HV5A 3GFMA 4S05A 4WCGA 3LFKA 5KVRA 3MQ0A 1Z6RA 3HOTA 1IN7A 1JHHA 2O61A 2DBBA 2BBYA 3I53A 3HHHA 3BP8A 4L9NA 2CFXA 4CXFA 2LSOA 5E1ZB 1O7LA 3E97A 5L3FA 5HS7A 1PP8F 3WTVC 3FXRA 2GXGA 1SMTA 2FOKA 5HOOA 4PDKA 2CW0F 3W6KB 3LA2A 2A07F 1FY7A 2TDXA 2PN6A 1MD0A 2J5PA 1STZA 3Q5FA 5DUKA 1SD7A 1OYYA 2W84A 4GGGA 3GVAA 4KIGA 5DYMA 4BHBA 1XSXA 2IA2A 1FPQA 2QLZA 1BIAA 3GZ5A 3IWZA 1SMYF 5BS6A 2AXLA 2GA2A 2OBPA 1FNNA 2WC2A 5K5QA 5LHHA 5ILVA 3TDZC 1O7FA 1LDJA 5JR3A 3BWGA 2PMUA 4GO1A 4UHTA 5HS9A 4CHUA 3C1DA 4R79A 5D6EA 4A5NA 2W57A 3KCCA 4KUMA 3WU1B 5DCMB 4HQMA 4NB5A 4KDPA 3JAMZ 2ETHA 4Q4ZF 3G73A 3M8EA 1EH8A 2IVMA 3Q9SA 1K79A 2NNYA 2YU3A 2A61A 3T1BA 2P5LC 3R0AA 1G4DA 4JBAA 3EETA 4LLGF 4U7DA 3H92A 3WTYC 1YS6A 2HQRA 4NHJA 1Q1HA 2RNJA 2MH9A 2L02A 5AIPA 1B59A 3U9GA 1ZREA 4HA8A 4UXNA 3L00A 3HSEA 2K4BA 4CGZA 3RIRA 1Z7UA 2V79A 5FFXA 3MZHA 3FF5A 3H3UA 1R36A 4JQFA 4Q47A 1MJAA 1S29A 3L7WA 1QGPA 1W7PD 3BJOA 4IXAA 1J9IA 2Y75A 3E6CC 1BIBA 2M30A 1IAWA 3DPLC 3ECHA 1FSEA 1XMKA 5LGNA 2M45A 1R1UA 3KP5A 1FOKA 4LG0A 4AWXB 1K6OA 2EFNA 4XLNF 4AD9A 5JFRA 2ZJ2A 4FT8A 1KU7A 2M1BA 3E5UA 2VXZA 4RB0A 5L3GA 4L5IA 3ABUA 1R5HA 1HQCA 3PQJA 3SHFA 1TW3A 4ENMA 4LJZF 2X0LA 2XROA 1C0WA 1F1ZA 3F8FA 2Q8KA 5BMZA 2HKXA 3BY6A 3O2PE 4MQVA 3FWEA 5HLGA 2FXAA 5DDGA 4LB5A 1LJ9A 1F5TA 2X4HA 5A2QZ 4YIIA 3RDIA 1S7AA 2HYFA 2DPUA 2LNBA 3IC7A 1PP7U 1I1SA 2HZTA 4EVIA 3RJPA 2XHKA 2F5EA 1R58A 1IN5A 4GYGA 3T8RA 1O57A 2VN2A 4HLYA 3BJAA 1IN8A 4M72A 4LK1F 3TGNA 1RI7A 1FYMA 3O3KA 5ICFA 4OMZA 2RDPA 1SFXA 2FEZA 2OZUA 3NRVA 4BYYA 5J8CA 1BI1A 3SFZA 3CUQA 1OR7A 3IRRA 4KA4A 1RUOA 5FD6A 4A6DA 1J5YA 3KEOA 4M73A 3DPTA 1P6RA 4KN4X 3OOPA 4BHPA 3K1MA 2BV6A 2K02A 1D5VA 2GQQA 1XSDA 3KP4A 2XASA 1YYVA 2OU2A 4MEYF 3K1PA 4Q5SF 2STWA 4G7HF 3BPVA 1KGSA 2D1HA 5CVVA 3F6VA 5JVTA 4OIPF 2E1NA 1SAXA 4HF0A 4WXCA 5CVIA 3KETA 3HOSA 5H6QA 4OOIA 1FBQA 2MA3A 3L2CA 2XAGA 3TQNA 1FC3A 5K5RA 5IT9K 3E5QA 4ZYDA 4BH9A 1VTNC 4UV8A 2ZNYA 2L01A 3MAJA 2P7CB 4G8XA 1QZYA 3KFWX 1IXRC 1MJ9A 4HW0A 3WGIA 2GZWA 2VBXA 4P9FA 3ZMTA 4FHTA 2E1CA 3WODF 4M71A 1ZYRF 1T0FA 2KKOA 1H9TA 1ZRFA 2P6TA 1G6NA 2V9VA 2RGVA 1MJBA 2G7HA 4I7HA 3HHGA 5D4SA 4WX9A 3TOAA 1IRGA 1OYIA 2DI3A 2A3SA 4I98B 1ODDA 4L18B 4BQAA 1I27A 1MKMA 4HX7A 3C3WA 1QPMA 1TQIA 5J8FA 5FO5A 1B9NA 3VB2A 3DP7A 3IWFA 2DO7A 3GX4X 3DFGA 4IRIA 3F22A 1JHFA 1BM9A 4MHGA 1HKQA 1BC7C 4RGSA 2PEXA 3FMQA 5DEQA 4ZZDA 4H0EA 4HF2A 5K1YA 3M1EA 4LLLA 2EK5A 3IRQA 1ONVA 5LLQA 3R4KA 2VE9A 3FM3A 4HDVA 1E17A 1XSVA 5HLHA 2R7DA 3RYRA 3F23A 1AWCA 4WK8F 2IW5A 4A12A 3RYPA 3ZPLA 1IN6A 2QVOA 1I6XA 4XLPF 2JPBA 1KQ9A 4N0BA 3M8FA 2BGCA 1ZLKA 1YFHA 4YG2F 4RGRA 1J0RA 2IRFG 4I02A 3IL2A 3QU6A 3QAHA 4A5MA 2H94A 4EJOA 3W6JB 1Z91A 2IPQX 2V1UA 1G3YA 2VBZA 3EQLF 4D0PA 4ETSA 4KIBA 4LB6B 1P4XA 4L0YB 2NRAC 1FZPB 1XGNA 3Q9VA 3D0SA 1V3FA 2DFIA 3WE2A 4Z2YA 1BBYA 4UUVA 3ZMZA 3T0YA 2VT3A 4HZFA 1SFEA 1ZHFA 3P9IA 4G7OF 1ZG3A 2EFOA 1I5ZA 2D45A 3ISPA 1LDDA 1O3TA 1HSTA 1K78A 2XKOA 3WTSC 2HTSA 4P5OA 1YS7A 1W5SA 1WQ2A 3F8MA 5L3CA 2P5VA 1QQIA 4L9TA 4IRHA 4ZZLA 3F6OA 5JI6A 3ECOA 2IA1A 3I54A 1K78B 2VC0A 1FYLA 3P9CA 5E1XA 2P6SA 3GZ6A 2COMA 3S2WA 1B4AA 4L9JA 1R1TA 3KP2A 4EQQA 3F8CA 2PBIA 4LD5A 3EUHA 3CDHA 2DQRA 5E8IA 4EGYA 2GA1A 2UXXA 3CLOA 3WGGA 1KYZA 2HFHA 1S8NA 2YR2A 4HOBA 4M9ZA 2GIVA 2AS5F 3GFLA 5FLXK 4KNYA 2WV0A 3IHUA 3VOEA 3RPQA 2WTEA 4MQ9F 5ICCA 1UCRA 1USSA 3LSTA 2NS0A 4N9IA 3V4GA 1B6AA 5CLSA 2E7XA 3BROA 4DNCA 4EJVA 2VONA 3ERED 2BYVE 2KRFA 2HEOA 2YX4A 2Z99A 3MCZA 2MLGA 2IT0A 5JHUA 3HTSB 3K9TA 2RV8A 4EJWA 1KU9A 2VOPA 1J2XA 4AIJA 2UZKA 1G3WA 1JXSA 4M6XA 1KU2A 3ZMDA 5FFZA 1CF7B 2XKPA 5EEGA 1E2XA 1UFMA 3QU3A 4Y15A 3SZPA 4HLXA 1TNTA 3TO6A 1OPCA 1Z6TA 2EFQA 1P92A 2Y48A 3TO7A 2W24A 2KJBA 3ML6A 1R22A 5J6XA 1MZBA 2EV5A 1UHWA 4YFXF 2QQAA 4EMSA 2A68F 1UB9A 2V6CA 1SFUA 3SZTA 2CSOA 3MEXA 1LEAA 1TW2A 4U0YA 2XIGA 5CJ9A 4UVCA 1H9GA 5D5VB 3JAMK 1HW1A 3LAJA 3P7NA 3KP6A 3L09A 2BEOA 2HKOA 1ZN2A 1ZG1A 1HW2A 4BHCA 4BXUA 2STTA 4MTDA 3ZMSA 1J7KA 3GWZA 3NEUA 1WI9A 2K4JA 1TQPA 4HF1A 2B0LA 5CYVA 5DD8A 4BAYA 5L3BA 4HAMA 4IF4A 3R61A 2ZXJA 1IXSB 2KIUA 4GCVA 1YQAA 3IKTA 2M87A 3ZN1A 4ESFA 4FX4A 4AIHA 1KU3A 3NQOA 5TRDA 3GYHX 5LEKA 5HDNA 2O3FA 1XCVA 3E5XA 3V7CA 1PDNC 1HSJA 4G7ZF 3DEUA 1KYWA 1SD4A 4KICA 2H27A 1FP1D 3FXQA 5F1RA 5CVRA 2M5WA 1U2WA 1WWXA 4XSXF 1USTA 1BI3A 1KA8A 2DQLA 4ON0A 5D5WB 5E8GA 4RB2C 2L4MA 5HLIA 2PQ8A 4LFUA 4L9VA 2QM3A 2MBFA 4ESBA 2DTRA 5E18F 3V8LA 1ZRCA 1MDMB 4I09A 4M6YA 4ESJA 3WG9A 4KIFA 5A2QK 3V7RA 2KIFA 1S7OA 4HX8A 1XD7A 4A2UA 3CTAA 1YG2A 1TTYA 2EV6A 4G94A 4ASNA 4B09A 2QUFA 4RB3C 2ESHA 2L3DA 1IW7F 1K7AA 4RGXA 2CWEA 4ZYEA 1IUYA 2A69F 2F2EA 2CGPA 6PAXA 2FNAA 2XAFA 2WWYA 5ERIA 5LRSA 4EJUA 3LA3A 3BOQA 4EM2A 2O0YA 3BDDA 3HSFA 3EYYA 3I4PA 2VBYA 2NNNA 3TKYA 3VFZA 3M7GA 1ZRDA 4PGGA 2R7FA 1SD5A 4MNUA 4P55A 2W25A 3T8TA 3GLXA 5FB2A 1EV7A 3HYIA 4HBLA 1BC8C 1U78A 1FYKA 2O03A 2A6HF 2HWVA 3GXOA 2LF8A 4LMYA 1P2FA 2XVCA 1YW9A 1G3SA 4WXDA 1DPUA 2P5KA 3DKWA 4GYIA 1X3UA 1Y0UA 1XGMA 5ICEA 1DPRA 3J7AO 4R1HA 5HS8A 2PI0A 4M9XA 4OIRF 3J81Z 3MWMA 2DW4A 2NYXA 2HOEA 4G6DA 5D5XB 4EM1A 2QENA 4ENNA 2Z3YA 1LVAA 4LGWA 1RIOH 5E17F 2C6YA 4MTEA 3B73A 1T6SA 4EV0A 3FZVA 3I71A 4O6JA 5D6FA 3ZP5A 4IHSA 2E7WA 3LQRA 4KYWA 1ZGJA 3T5XA 3EYIA 2O8XA 4OINF 4I01A 2MH2A 2YSRA 4QWQA 4Y13A 3LWFA 1T38A 3K69A 3QOPA 1XGOA 1R00A 1REPC 3KLOA 1TQMA 4KMFA 3LAPA 5D8KB 3K2ZA 3F8NA 2GWRA 1XDUA 3QPHA 1QNTA 5LGUA 2FMLA 1W7PB 3FX3A 2MC3A 2CQKA 2XAHA 4Y17A 2VC1A 4EM0B 4UVAA 2PMHA 4QLCU 2HGCA 1CGPA 3QP5A 2KJCA 3KP7A 1YLFA 1U5TB 2QQ9A 5DCFA 2CG4A 1O3RA 2JZYA 1H0MA 2DK5A 1T2KA 3I58A 1LEBA 2YX7A 4OIQF 3WTUC 1ZH5A 3ZN0A 2KIMA 2EJRA 2ZNZA 2PFBA 2FBHA 5LEJA 5DCMA 2UXNA 2RKHA 5ED4A 4PZJA 2FF4A 4GXOA 5FLXZ 1FX7A 4LG0B 3V7SA 1D8JA 2VE8A 2QBYB 3ULQB 2FRHA 3CO7C 2J5OA 4U7BA 3KLNA 5AONA 2QZ8A 3D5LA 5LBQA 1XCBA 4WWCA 2RC4A 2EA4A 2ZFWA 1S3JA 2IJLA 4K2EA 1LB2A 1O3SA 4I0AA 2EA2A 2Q2EA 2Z5UA 3R60A 1J59A 3WTTC 2NAZA 2RQPA 1WSUA 2W85A 3I64A 3COAC 2F5FA 4S04A 1MGTA 5H20A 5LRRA 2JTVA 4A0ZA 1W5TA 2DPDA 4XSZF 2D2WA 2ZCWA 1XDSA 1UHMA 3HRTA 1U6GA 2FQ3A 2Z9OA 2OZ6A 2QWWA 3QP6A 1XN7A 2RVCA 3F72A 5FGMA 4CYDA 3E6BA 4YIFA 1KQ8A 3TOBA 3VODA 3ZMVA 2DLLA 2XRNA 2FNPA 3SXYA 2HS5A 2ACJA 2PJPA 2OAZA 1ZARA 3GO5A 2Z33A 2HYGD 4JK1X 1WRJA 3N97A 1BOAA 5TJJA 5CVJA 3F3XA 3WTWC 3RPUA 2ISYA 2IA0A 4AIKA 5HDKA 4IPAA 1R5GA 4IVNA 3BJ6A 2H6BA 5DUIA 1DUXC 2UWMA 3KZZA 1IXCA 1QBJA 5D4RA 3AAFA 2CYYA 2G7UA 1L0OC 5HVQC 1L3LA 4UV9A 4PCQA 1Z05A 1ZLJA 3I5UA 4A0XA 3G3ZA 3HUGA 3O6BB 4R8HA 4F7ZA 2P8TA 1RNLA 5EEHA 2DT5A 5L3EA 1SD6A 1KQ0A 4ZYHA 3WE3A 2QYOA 1IF1A 1GVJA 4WXHA 3U1DA 4DQ2A 4WF2A 3RKYA 4YFNF 4IRGA 4E70A 2XAJA 5LHGA 1FT9A 3E6DA 1R7JA 4M9SA 3FXUA 1HKSA 1QO0D 4CO8A 4MGRA 3HRSA 1BI0A 2K7LA 4P9UA 2PLYA 3HIFA 4AVPA 3QPTA 4HYEA 1HXDA 2HTJA 2FA5A 3PQKA 2RN7A 2ELHA 1DDNA 4EGZA 1TNSA 2LDUA 5DV5A 2LKPA 1R1VA 1DP7P 4RS8A 3REOA 1FP2A 2MD5A 5F64A 1B9MA 4I2OA 3KEQA 3FM5A 5FD5A 2K27A 2XUBA
chains in the Genus database with same CATH superfamily
4KJZA 2FE3A 3V8JA 1PUEE 1Z9CA 3F21A 4I0BA 2O8KA 3I59B 4DGWB 2YPRA 2PG4A 3C18A 4IHVA 3F0CA 5J4VA 2R7RA 1FLIA 3G1LA 5D8LB 2F4IA 3M9AA 4KN7X 1S72I 1E3OC 2DDAA 2K9MA 3ELKA 3PFIA 1LQ1A 2EZHA 2XPUA 1IUFA 4ENKA 3E7LA 4XRMA 2EFPA 3WTXC 1ZGWA 3ROUA 4L0ZB 2KP6A 1FBSA 5GADJ 2OQGA 1BOBA 4PJJA 2XGXA 3FK6A 3RI4A 1IG7A 3JW4A 3DTEA 2ECCA 1JE8A 3UR3C 4J01A 1LDKB 3DQVC 2BZTA 1WJ5A 5DD4A 3KZYA 3AG1H 1XGSA 3DV8A 3HBLA 3Q0VA 2HI3A 3FKIJ 4NDLA 4PGHA 5IOYA 3HOZJ 2R7TA 4A3GJ 1VQMI 2FU4A 5IT3A 4IOAF 1TLHB 1BN5A 1T98A 3ZQCA 1LNWA 3BZKA 3CP2A 4AYBA 1HBXG 4KFCA 5J1RA 2R3SA 1GVDA 5LGTA 3DBLB 2DT7B 4XRFA 5FKLA 3MN2A 2KIQA 2OJED 1P7IA 2FJ1A 1R4NB 4HQEA 3SQNA 3CMYA 5KAIC 2OCCH 2WB1A 5J4YA 3OR2C 5D5UB 3S8PA 1LFBA 3OYHA 1KONA 3HB9A 5LHIA 1UJ8A 3BZ6A 1RPWA 1YW7A 1ITYA 2DK8A 1IRFA 3F9KA 3HOVJ 1IZ1A 4D9JA 3ABTA 4U0VA 1Z1DA 2F5DA 3Q0WA 1FJLA 2VT2A 2LH9A 1JKOC 1B1BA 2F5CA 2RREA 2FMYA 1F4KA 3EUKL 3TDUC 1MNDA 1UAAA 1Y1VJ 3LSKA 1TBXA 2FBIA 1ZKGA 5C4XJ 3DBRB 1F9NA 2JSCA 3FHZA 1BJAA 4B3AA 1MMNA 4YFKF 2DA6A 4CZZA 1AOYA 4OU0A 3PFYA 4UUSA 4FX0A 1IN4A 4UY8I 1WI3A 2DT6A 3LSRA 3VEPA 2JPCA 2CO5A 2VJ4A 1W4MA 3K6GA 3TO9A 3LOCA 5L3DA 3RKQA 2I10A 3SEQA 1JJ6C 3HOYJ 3S1RJ 2L54A 1IRXA 3SEZA 3FXLA 4KMUX 2WV1A 1DQUA 3H35A 2VJ5A 2V1XA 3ZCOA 1R4MB 2NVXJ 3QOEA 1FWZA 5E3MA 3NWSA 4V2GA 5HNFA 3N05A 3U2RA 3VYRB 2WA0A 4CDGA 2KRCA 5IYCJ 2DU9A 2HQ5A 2ZMEA 2OTJI 2ZKZA 4A6EA 3IV5A 4QIWN 1V5GA 2VJIA 1YW8A 2WY8Q 2Y69H 1YO5C 5BOXA 4ITVA 2HDCA 3S2HJ 3R6SA 3ZQ7A 4IOCF 3S1NJ 4FCYA 3CUOA 3JSOA 2MABA 1U5TA 4CICA 3DU5A 4RM3A 3K4NA 2EBIA 3R0JA 1YTYA 2VBWA 4G6TB 1GDTA 2V4JC 3H3ZA 2F4OB 3PIPF 4AUXA 3JTGA 4U88A 2ESNA 2E2HJ 2R7XA 2DAOA 4LG3A 3H36A 2X6YA 4RDUA 1S6LA 2W00A 3WTZA 5BPDA 5HDGA 2M8EA 4ENJA 2M7AA 4E7HA 2ECBA 1GXQA 3CDLA 3DF8A 1MW7A 1U5TC 4UB6C 3PIOF 5BQTA 3KP3A 5BPIA 2NS8A 2W7NA 1FSHA 4IHWA 1ZAOA 1P4WA 2DA5A 5TISC 5ILUA 2JUGA 3K0LA 2OD5A 2JRTA 1M1EB 1VF9A 1P7JA 2JSPA 1HW5A 3JREA 1MNMC 5C3EJ 3GF2A 5E20A 2QQBA 2ZB9A 4DIQA 2E36A 3HSRA 2OCEA 3MFKA 1XS9A 1VQKI 1BW5A 1X2MA 2Y0MA 3K10A 2R5ZB 2DA4A 1EH6A 2DA7A 3E3VA 3SYTA 5ICGA 5EEAA 2K86A 3P9KA 1WHUA 1ETVA 1A04A 1RZ4A 2K3FA 1APLC 1VQPI 2JA2A 5ILSA 3GUDA 3F8BA 1ZGAA 3CD6I 2M4GA 2ZBKA 2QBYA 2AO9A 2LF7A 3HRMA 3HTUA 2GAUA 3OL3A 2Q2EB 3FHNA 3L9FA 1QZZA 1P4AA 1WH5A 4TV7A 1YJWI 1E3PA 2O6GE 4S0HB 2BHZA 3E0JB 3CUQC 3JRCA 1RUNA 2P0WA 2ZMEB 4U0WA 1NHAA 3RZOJ 4D5CA 1J75A 1IDZA 3KE2A 1I3QJ 3I56I 1MMSA 4B8XA 2KRHA 1JJ8C 4N4OB 1D3YA 3FMSA 1WKMA 2E35A 3OYMA 3J80K 2DMUA 5JLWA 3OWTA 3CUQB 1XX5A 1ZG5A 3JSPA 1YHQI 4NC6A 3CMAI 1OCZH 3BQZA 1FEXA 5KK1A 1A36A 2DYSH 2EIMH 4RB1A 4B48A 3V8KA 3WG7H 4GRIA 3WU0A 3ZMUA 1WJEA 3MZ8A 1U3EM 4O3MA 3BPXA 3EDPA 2E1OA 3HDDA 2L4AA 2Q0OA 4G6QA 5CKTA 1B72A 1S9HA 4ZH4F 2HR3A 1U8RA 1MBEA 1HKTA 1N25A 2A5WA 2LBFB 1W7PA 2EV0A 1OYWA 1LVKA 4Y4RA 1ZR4A 4OMYA 1SFOJ 2VB6A 2XF6A 1MBGA 1V4RA 3VYTB 1YIOA 3H3VK 3J80Z 4PSWA 4P96A 3JTHA 4KT6A 1RRJA 2ID6A 2IP2A 1MDMA 3H0DA 2ME6A 3RKXA 4M74A 2DMPA 1IV8A 1QA6A 1ETQA 1ON2A 4RGUA 1BI2A 4HDUA 2D1VA 2VIXA 3K4BA 1ON1A 1Y56A 1Z0XA 1OMIA 2A5YB 1XMAA 2ADUA 2H8WA 2P7VB 2R7OA 5H6RA 4DBQA 1O3QA 5AIQA 2V7FA 5C4JJ 2BW3B 2XV4S 1VQ4I 2LBFA 3GFJA 3W3CA 4IHTA 4QSHA 2JA5J 2VODA 1D8KA 3B02A 3I59A 3A01A 4HX4A 4X6AJ 5F04A 5F6FA 2XB5A 4BY7J 2FSWA 2ISZA 2HZDA 3IKVA 4KT5C 2H1KA 1UELB 2CV0A 1TWAJ 2GOXB 4II2A 4C30A 3GFIA 2IS4A 1V5EA 1X3ZB 1BR2A 4RLQA 3GW2A 1T39A 3CO6C 1GHCA 5CVUA 3JRHA 4RAZA 2MFZA 4HSRA 1PJRA 3I0TA 3PL8A 4XLHA 1I39A 2JT1A 2EB7A 2ZO4A 1N78A 3IUOA 3UKGA 3OSGA 2V1DA 3JRGA 1CF7A 4UVBA 2JN6A 4NQWA 2GM4A 2G9WA 3K1NA 1WJFA 5B3SH 2ZJPF 1ETOA 4CCNA 4DYRA 4DYQA 2MLKA 3SZGA 4A3FJ 4UNOA 4L5JA 1ULYA 5FROA 5HLTA 3L2UA 4J19A 3QRFF 1H8AC 2P4WA 3FBNB 5E1WA 3WGHA 3OYCA 3U1KA 3CESA 3OYAA 1FMVA 4A0YA 2FBKA 2GLOA 1XB4A 2QSFX 4IJAA 4EJTA 2EZIA 3CCJI 5E3OA 3GEZA 9ANTA 3RQ4A 4RAYA 1OKRA 2CUJA 3GZNB 1OCOH 1YX3A 1TWGJ 3OMYA 3PO3J 1G3TA 4B3XA 5K5OA 4G9YA 2CFOA 5M5YJ 4BNCA 3CJNA 1MH3A 3J81K 3TP0A 4MEXF 3A0BC 3GLLA 2BOLA 2EQRA 4N9HA 4XBFA 5GAEJ 1HA8A 2LP0A 3BR2A 4LK0F 2OA4A 1X1CA 4O5VA 2VOOA 2Y9YA 1I50J 3C7JA 3N4MA 2R92J 3FMRA 3MZYA 1FBUA 5B1AH 2H6CA 3OL4A 2QGUA 4A3CJ 2XAQA 2H09A 4HV6A 2VKVA 2OQRA 2EWNA 2IEKA 1GXPA 1EH7A 2EFWA 3E6MA 2HQNA 3DXJF 3OV8A 3RTRA 2BE5F 4XK4A 4M3BA 3D5RC 4ZYGA 4OIOF 1JGSA 5GTHC 4YELA 3HRUA 4LITA 5IT9Z 3LQQA 4Q48A 3RKWA 3LFUA 4XICA 1FTTA 1D0XA 4LLNA 1R23A 2A6EF 3LA7A 1I1GA 4HV5A 4CCJA 1AHDP 4C2TA 3GFMA 3BR5A 4S05A 2QF7A 4OAZA 4HNVA 3D5SC 3ABMH 5F1JA 3M8JA 1QPIA 4WCGA 3LFKA 4LIVA 3BT9A 4PUSA 5KVRA 3HEFA 3MQ0A 1Z6RA 3HOTA 2P81A 1IN7A 1JHHA 2O61A 2DBBA 2BBYA 2EIKH 4MIMA 3I53A 3HHHA 4BJ5C 3BP8A 3HGYA 1MBFA 4L9NA 2CFXA 4CXFA 4XKBA 1J09A 4A3DJ 2LSOA 5E1ZB 4CYCA 2PJRB 4IO9F 3L2RA 3DCFA 4I6ZA 1BR1A 1O7LA 1LUJB 4ZDOA 5E3LA 3E97A 3ABKH 3H5RA 2ZMEC 4C3JJ 1HC8A 3JRIA 5L3FA 5HS7A 1PP8F 2V1NA 2LY2A 5KHDA 3WTVC 3FXRA 1FIAA 2CJJA 2KHMA 3KYDB 4NBQA 2GXGA 2Y31A 4CCMA 1SMTA 3C2GA 2VPRA 1WJDA 2FOKA 4D1QA 5HOOA 2IGKA 1X1BA 4PDKA 4BL0B 2HPMA 2CW0F 3W6KB 4IHYA 2B63J 3LA2A 1B8IB 2X6OA 2VXDA 2A07F 3A0HC 1FY7A 2VKEA 2VASA 2TDXA 2PN6A 4C2MJ 2HVSA 1MD0A 2J5PA 5BNGA 1STZA 2DA2A 2XB0X 1WZ2A 4MFEA 3Q5FA 1UHSA 2O7OA 2M4KA 4BQNA 4BUPA 5IP9J 3S3MA 5DUKA 1SD7A 4CSWA 1OYYA 1P9QC 2W84A 3GVAA 2LFBA 4GGGA 4KIGA 1YJ9I 4ABZA 2VKHA 3B6AA 4I76A 5DYMA 3FDYA 1WGXA 3FIWA 4BHBA 4XQFA 1XSXA 3PNTA 1JUSA 2IA2A 3PSIA 2LKSA 1FPQA 1Y8RB 1HDPA 1BW6A 2QLZA 3BQYA 1GV2A 4B44A 1BIAA 3GZ5A 3IWZA 3BCAA 1VQLI 2QSGX 2E34A 4XNFA 1SMYF 5BS6A 2DMTA 1YRNA 2AXLA 3LSGA 1NG6A 2R7SA 2GA2A 1MMDA 1QU3A 2OBPA 4HG2A 3GTJJ 1FNNA 2WC2A 5K5QA 5LHHA 5ILVA 2XF5A 4IZZA 4JX5A 2COBA 3TDZC 1O7FA 1LDJA 1OR7C 5JR3A 3BWGA 2PMUA 4GO1A 4UHTA 5HS9A 2XSDC 2HXOA 1UG0A 3CJTB 4CHUA 1RR8C 4D7NA 4CH7A 3TMOA 4D5FA 1LKXA 3CZ6A 3C1DA 4R79A 2CQNA 2L7FP 5D6EA 4A5NA 3HC7A 4BBRJ 3S1QJ 2LTPA 2W57A 3KCCA 3M1CA 4KUMA 4RA2A 3WU1B 3CF2A 5DCMB 3S93A 2OUMA 4HQMA 2E1MB 3ASOH 4NB5A 4KDPA 3JAMZ 2CQXA 3PUFA 2ETHA 4UUTA 4Q4ZF 3G73A 3M8EA 3J7YJ 2RNGA 1JI8A 2VQHA 1EH8A 2IVMA 3Q9SA 1K79A 2TRTA 2L9NA 4XL9A 2NNYA 2YU3A 2A61A 3T1BA 2QKMB 2P5LC 3R0AA 1G4DA 4B43A 4JBAA 3EETA 2BXZA 2JJ7A 3H92A 4LLGF 4U7DA 3WTYC 1EJ9A 4DBRA 4UUSB 2DFFA 3AKZA 2XGCA 1YS6A 3CCEI 2HQRA 4XONA 4NHJA 1Q1HA 2L9VA 2RNJA 2MH9A 2L02A 5AIPA 1B59A 3G1MA 3K70C 4BE2A 3U9GA 1ZREA 2VUMJ 4HA8A 4UXNA 3L00A 2HPIA 3BR6A 3CCVI 3HSEA 4Z6YA 5CQGA 3W6VA 2JWTA 2K4BA 1ACIA 1PVEA 4CGZA 3RIRA 2M9HA 4OAYA 4L5EA 1XC5A 1Z7UA 2V79A 2OPTA 1NK3P 1UMQA 5FFXA 3BLYA 4ZDLA 3FF5A 3H3UA 3MZHA 3CC4I 1R36A 4JQFA 1ERDA 4Q47A 2LD5A 1MJAA 1S29A 3L7WA 3I4NJ 1QGPA 5FLVA 1W7PD 3BJOA 1IO2A 4ZC3A 4M6VA 2QEXI 4IXAA 5EZGA 4PJNA 1J9IA 3MMYB 1BR4A 2Y75A 2IGMA 3E6CC 3CCYA 1BIBA 1GT0C 4B1RA 1BJZA 2M30A 1IAWA 3DPLC 3ECHA 2BY1A 1FSEA 1XMKA 3VSKA 5LGNA 2M45A 3KIOA 1R1UA 2OC6A 3OYJA 2B7EA 2KLOA 3KP5A 1FOKA 2FOWA 4LG0A 3H9JA 4AWXB 1K6OA 5EJCA 4DW6A 3VYUB 2EFNA 4XLNF 4AD9A 5JFRA 2ZJ2A 1JKPC 1RKTA 2OV7A 4FT8A 1KU7A 3CC2I 2M1BA 2GIZA 3E5UA 4BXFA 1Y39A 2DYRH 2VXZA 1R6RA 4RB0A 5L3GA 4L5IA 1Q1VA 1SFKA 3ABUA 1R5HA 1HQCA 2GXAA 4KITB 3PQJA 1JKQC 3SHFA 1TW3A 4RMNA 4ENMA 4LJZF 4M3GA 2X0LA 2XROA 1C0WA 2R0QC 1YOVB 1F1ZA 3F8FA 3H9QA 2Q8KA 5BMZA 5FKMA 4ZDPA 2R7WA 2HKXA 4HPQA 3BY6A 3O2PE 5K7FA 4MQVA 4XN3A 3FWEA 2HYJA 5HLGA 2FXAA 5DDGA 4C9YA 5F0HA 1UG2A 4LB5A 2ZXHA 2XGEA 3FXMA 2XPVA 5FRNA 1MBHA 3LMMA 3FXJA 1LJ9A 4W1UA 2KDZA 1F5TA 2X4HA 5A2QZ 2HOTA 1SC7A 4YIIA 3JRAA 3RDIA 5M5WJ 3S1MJ 5K7HA 1H89C 1F43A 1S7AA 2HYFA 2DPUA 2LNBA 1Z77A 3BTJA 3IC7A 1X3WB 1PP7U 1I1SA 2HZTA 4EVIA 3RPUD 3RJPA 1OCTC 2XHKA 2F5VA 2IGNA 2F5EA 2JVGA 1R58A 3PNVA 1IN5A 4GYGA 3T8RA 4X0GA 1O57A 1WPKA 4V19K 2VN2A 4HLYA 3BJAA 1IN8A 4M72A 3DEWA 4LK1F 3TGNA 4KISA 1RI7A 3CF5F 1FYMA 3O3KA 1MSFC 5ICFA 4OMZA 2RDPA 4BXXJ 3B6CA 1SFXA 2FEZA 2LR8A 2OZUA 3NRVA 4BYYA 2VJJA 3SDGA 3IP4B 3OIPA 4ZJZA 5J8CA 5FLMJ 1BI1A 3SFZA 3CUQA 1OR7A 3IRRA 4KA4A 4BJTA 2K40A 1RUOA 5GP9A 5FD6A 4A6DA 1J5YA 3KEOA 4ZYAA 1AKHB 4M73A 3DPTA 3S15J 1P6RA 4KN4X 3CCLI 3OOPA 3BG3A 3VSLA 4BHPA 4MLOA 3K1MA 2BV6A 2K02A 1D5VA 3AFHA 2CUFA 4CA0A 3BR0A 2GQQA 1RESA 2MYSA 1PYVA 1ZTRA 1TWCJ 2HDWA 3BTLA 1XSDA 2DODA 3KP4A 2OTLI 2R7UA 2XASA 1YYVA 2OU2A 4XOTA 3K4MA 3TEDA 4I99C 4MEYF 3K1PA 1AU7A 4Q5SF 2STWA 1GUUA 4G7HF 2LOOA 3BPVA 3PUBA 5JHFA 1KGSA 2D1HA 5CVVA 2CUEA 4RM2A 3L2WA 3F6VA 1AKHA 5JVTA 4OIPF 3WHCA 2VQLA 2E1NA 1SAXA 2AQEA 1PUFA 1R49A 4HF0A 4WXCA 5CVIA 4C3IJ 3TW6A 2N8GA 3KETA 5H6QA 4OOIA 1FBQA 3HOSA 2MA3A 3L2CA 2XAGA 3TQNA 1FC3A 5K5RA 4JYKA 2HVRA 5IT9K 3E5QA 3LL7A 2L9SA 4ZYDA 3A01B 1X4PA 2DOEA 4BH9A 2LG4A 4UV8A 1VTNC 2ZNYA 1WFXA 2V26A 3OS1A 2G0EA 2L01A 3MAJA 5KAFC 2HOAA 2P7CB 4G8XA 1QZYA 3K2AA 3KFWX 1X1DA 2JA8J 1VQ7I 1IXRC 2CW8A 3QYFA 1MJ9A 3G1OA 3CCQI 4X1EA 4HW0A 3WGIA 5IP7J 2Y2ZA 2VQGA 3U21A 4CZCA 2GZWA 2VBXA 2LKXA 4P9FA 1JT6A 5EG0A 3ZMTA 4FHTA 1G8XA 2KL4A 2QSHX 2AXTC 2R93J 2E1CA 3BR1A 3WODF 2M7BA 4M71A 1ZYRF 2HXIA 1FMWA 2VI6A 3EPZA 2DJNA 2HVQA 1YITI 1T0FA 2O9LA 2KKOA 4BACA 1H9TA 1ZRFA 2P6TA 5EGOB 1IC8A 1G6NA 2BXYA 2RGVA 2V9VA 1MJBA 2G7HA 4IHXA 3PO2J 4I7HA 3HHGA 5D4SA 4WX9A 3TOAA 1IRGA 2DJIA 1OYIA 2DI3A 4IL6C 3DBHB 2A3SA 4I98B 1ODDA 4FE4A 1V55H 5IY5H 4L18B 4BQAA 1VZ0A 1I27A 1VQOI 1MKMA 2X6XA 4HX7A 1D5YA 3C3WA 1QPMA 5DM6F 2E2IJ 2M0CA 1TQIA 5J8FA 1ZK8A 1JUMA 5FO5A 1B9NA 1POGA 3VB2A 3DP7A 3IWFA 5EDNA 2DO7A 2AHQA 2VKDA 3GX4X 3DFGA 4BJ6C 4H4KC 3F22A 4IRIA 1JHFA 1BM9A 2CMPA 1HKQA 4MHGA 1N75A 4PJMA 1X58A 1ETXA 1BC7C 4RGSA 2PEXA 3I55I 2E5ZA 1S5LC 3FMQA 5DEQA 4ZZDA 2DCEA 4H0EA 2KMUA 2MSYA 5HODA 4HF2A 3GTOJ 5K1YA 3M1EA 4LLLA 2EK5A 3IRQA 1ONVA 3AL0B 4AM3A 5F27A 4OWRB 5GPAA 5LLQA 1U9NA 1HF0A 3R4KA 3CMMA 1T8IA 1D0ZA 2VE9A 3FM3A 4IQ4A 4HDVA 1E17A 2XRLA 4FISA 1VFCA 1XSVA 5HLHA 5TGTA 1DGWY 3PM1A 2JQ7A 3HGGA 4E4HA 2R7DA 3RYRA 2DFEA 3TP3A 3F23A 1VQNI 2OF7A 2NVYJ 1AWCA 3HXLA 2HDDA 2PJRA 4WK8F 1YIJI 3DKXA 2IW5A 3QQAA 1R5ID 4A12A 4NUBA 3RYPA 3ZPLA 3GTMJ 2Z16A 1IN6A 3A02A 2QVOA 1SANA 2QA4I 3S3NA 3I4MJ 1I6XA 4XLPF 3L2QA 2JPBA 2LY9A 1KQ9A 4N0BA 3M8FA 2BGCA 3EUHC 1ZLKA 3TW7A 1Z7LA 4JX4A 1YFHA 4YG2F 4RGRA 3VPRA 5DM7F 1J0RA 1K6YA 2IRFG 4I02A 3IL2A 3QU6A 3ZXSA 2H8RA 1Y6IA 3QAHA 4A5MA 3OYEA 2H94A 2D5VA 4EJOA 3AG2H 3DTIA 1LE8A 2YU9J 3HOUJ 1NG7A 3W6JB 3OYBA 3KYLA 1Z91A 2IPQX 2XGDA 2V1UA 1G3YA 2VBZA 3BG7A 3EQLF 4D0PA 1MIJA 4QTRA 4ETSA 5J40A 4KIBA 4LB6B 1P4XA 1QHGA 2ICWG 3K4LA 4L0YB 2NRAC 2Q1ZB 1T08B 2F48A 1FZPB 1XGNA 3Q9VA 3D0SA 3HKZA 1V3FA 4BQOA 3LSHA 2DFIA 3JR9A 3A03A 1W36C 2DN0A 2CUZA 3WE2A 4HNUA 2KT0A 1YJNI 5LFAA 2K9LA 4Z2YA 1BBYA 3FKJA 4IEJA 4PFPA 1A31A 1X4OA 2ME0A 2I5UA 4UUVA 3ZMZA 3ZR8X 3T0YA 2VT3A 5GPCA 4IKFA 4HZFA 4XLFA 2RQQA 3DEEA 1SFEA 3HG9A 1NK2P 1MNEA 2K9QA 4Y7NJ 1ZHFA 3P9IA 4G7OF 1ZG3A 2EFOA 1I5ZA 2D45A 3ISPA 1LDDA 1O3TA 1HSTA 4E7JA 2L2OA 5IP6A 1QRYA 1EA3A 4HSTA 1FTZA 1XTAA 1K78A 2XKOA 3ZGKA 3WTSC 3HOWJ 2Y0SN 4PK4A 3RZDJ 3IAM2 2TCTA 1FIPA 3QPSA 3LNQA 4ZTFA 1W1WE 2R7QA 3A1YA 1O4XA 1OCRH 2FD5A 2HTSA 4P5OA 3J7ZI 1YS7A 2F4MB 1W5SA 2HOSA 1WQ2A 4BBSJ 3F8MA 5L3CA 2JVHA 4FTHA 4LIUA 4YIRX 2P5VA 3HM5A 5FKOA 3RCOA 1QQIA 3BG5A 2Y9ZA 3KZIC 4BEHB 3PJRA 4YEJA 4GFBA 3ERMA 3OR1C 4L9TA 4IRHA 4ZZLA 5F0FA 4CYCB 3F6OA 2E5NA 3O8HA 3IH4A 3RQIA 5JI6A 2XDVA 2IA1A 3ECOA 3I54A 3BZCA 1K78B 2VC0A 2ZJQF 1FYLA 1G59A 5IOZA 3P9CA 5E1XA 2L9RA 2P6SA 1HDDC 3GZ6A 2COMA 3S2WA 4F3QA 3ZQFA 2NOGA 1B4AA 5KCMA 4L9JA 1R1TA 1JGGA 3KP2A 4EQQA 3F8CA 2PBIA 4LD5A 1A6QA 3EUHA 1OQYA 3CDHA 2DQRA 3MD2A 5E8IA 4EGYA 2JA7J 2NVQJ 2GA1A 2UXXA 3CDIA 3CLOA 3LSPA 4PFOA 3WGGA 1KYZA 3I3LA 2HFHA 1S8NA 2YR2A 4HOBA 4M9ZA 4JOMA 1SVLA 4BE1A 2GIVA 3WHBA 2AS5F 3GFLA 1FOWA 3GCMA 3GMEA 4KNYA 2WV0A 5FLXK 3IHUA 3VOEA 3RPQA 3K4KA 5C44J 2W48A 5F0CA 2WTEA 2UUZA 4MQ9F 5ICCA 1UCRA 1USSA 2DA1A 2VLAA 4YRVA 3LSTA 2NS0A 4N9IA 4XN0A 4A3MJ 1VNDA 4AIDA 2XSJC 3TBIA 3V4GA 4RBOA 1B6AA 5CLSA 2E7XA 2KFDA 3BROA 4DNCA 1YRNB 4EJVA 3SJMA 2VONA 1X1PA 3PNYA 3ERED 1ETYA 2BYVE 5EG0B 2KRFA 2HEOA 2YX4A 3I9V2 3P5JA 1QHHD 2Z99A 3MCZA 2MLGA 2IT0A 2LMDA 5JHUA 4IQJA 2E19A 3HTSB 5FRMA 2WAEA 3ZQQA 3K9TA 2DFHA 2RV8A 3C2BA 1KU9A 4EJWA 3H0GJ 3NWTA 2VOPA 1J2XA 2L7KA 4II3A 4AIJA 2UZKA 3KPHA 1G3WA 1JXSA 4M6XA 1KU2A 3ZMDA 3KEYA 2L5QA 5B5EC 4BEHA 5FFZA 4V2FA 5B66C 4XIDA 1CF7B 2PX9A 2BY0A 2IS2A 4XOPA 1ZQ3P 1K4SA 2R5YA 2XKPA 5EEGA 1E2XA 1UFMA 3QU3A 4Y15A 3SZPA 1VQ6I 4HLXA 2E71A 4A3IJ 1TNTA 2IXSA 3TO6A 2YS9A 1JUPA 3VWBA 1OPCA 3L2VA 1Z6TA 2EFQA 1P92A 2Y48A 4XMYA 3TO7A 3DLLF 2W24A 2KJBA 1TL8A 2DTZA 2LYCA 3ML6A 1R22A 2ZXWH 5J6XA 2CRGA 1QZEA 1MZBA 2EV5A 5FJ8J 1UHWA 4YFXF 1FOYA 3FBIB 2QQAA 4EMSA 2A68F 3IH3A 1UB9A 2V6CA 1SFUA 3SZTA 5IPAA 1K61A 3AG4H 1I3AA 2CSOA 3C2HA 3MEXA 1LEAA 5M5XJ 1DU6A 1W5CC 1TW2A 2VQCA 2Y30A 4U0YA 1I6HJ 2BW3A 2XIGA 1T0FC 5CJ9A 4UVCA 3OYDA 2CV1A 3CJRB 4AVZA 3DPUA 1H9GA 2LY1A 5D5VB 3JAMK 1HW1A 3LAJA 1WJAA 3FXOA 2PMZN 1U9OA 3P7NA 5HNHA 2LLKA 3KP6A 1QVTA 3L09A 2BEOA 2HKOA 1YI2I 1ZN2A 3DTKA 2M0MA 1ZG1A 1HW2A 4BHCA 3S32A 2QKLB 4BXUA 2STTA 1DP3A 3ZMSA 4MTDA 4F55A 4DZPA 3G71I 2JUCA 1J7KA 3GWZA 3ZQIA 2CH0A 3NEUA 4F52A 1AA7A 4LOCA 2WADA 4Y33A 1WI9A 2K4JA 1TQPA 3LSIA 1H88C 3NARA 4HF1A 2B0LA 5CYVA 3OOUA 4M3DA 1TP4A 1E0EA 5DD8A 4BAYA 5L3BA 3CP8A 2K5CA 4HAMA 4FETA 4IF4A 3R61A 2ZXJA 2KISA 1IXSB 4XRSG 2KIUA 4GCVA 2F6CA 1WJCA 4B47A 1D1AA 1YQAA 4NC7A 2M87A 3W2VA 3IKTA 1Z67A 3BG9A 3ZN1A 3AL0C 4ESFA 1ETKA 3QYEA 4FX4A 1SEUA 4AIHA 3UNGC 3GTGJ 1KU3A 1TZLA 2KZVA 3HPHA 3NQOA 5TRDA 3GYHX 4EATA 5LEKA 3M3YJ 2O3FA 5HDNA 1XCVA 5EGOA 3E5XA 3V7CA 4E6KG 4AYBN 1PDNC 1HSJA 4G7ZF 1GLNA 2GOMA 3DEUA 4E7LA 4XM3A 1KYWA 2K9SA 1SD4A 4KICA 2H27A 2A05A 1FP1D 3CCMI 3S2DJ 2MGQA 3FXQA 5F1RA 2X1DA 3ABLH 5CVRA 4BGDA 1TWHJ 4NQWB 3ZQGA 2M5WA 1U2WA 1WWXA 1NTCA 4XSXF 1USTA 2M2EA 2ELJA 3W2AA 2JK3A 1BI3A 1KA8A 2DQLA 3K70D 2DOFA 4AU7A 4ON0A 5D5WB 4J00A 5E8GA 4RB2C 2L4MA 1MH4A 5HLIA 5CQEA 3Q3SA 3M4OJ 4D7MA 2PQ8A 3BCBA 1XPXA 4LFUA 4L9VA 3E1SA 2QM3A 2MBFA 3IH2A 4ESBA 2NS7A 3CQZJ 2DTRA 5E18F 3HKZN 3V8LA 3FISA 1D0YA 1ZRCA 1MDMB 2MG4A 4I09A 3GBGA 4M6YA 3WG9A 4ESJA 4KIFA 5A2QK 3V7RA 2KIFA 2BVLA 1YX5A 2FUG2 2JA6J 1E3HA 1S7OA 4Y52J 4HX8A 1XD7A 4F93B 1MSEC 4A2UA 2WB1N 3CTAA 1Y8QB 4XLEA 1YG2A 1WJBA 1TTYA 2EV6A 3KX2A 4G94A 4ASNA 4B09A 2QUFA 3BTIA 4RAGA 4HRIA 1V54H 2JRMA 1OCPA 4JX6A 4RB3C 2KZGA 4BS9A 2ESHA 1A6IA 2K85A 1HCRA 3HL2A 3CLQA 1B8IA 2L3DA 1IW7F 1K7AA 1VI0A 4RGXA 2CWEA 4ZYEA 3OYGA 1IUYA 4XKVA 4M3FA 2A69F 2F2EA 2CGPA 3H1CA 2H1LA 2X9DA 6PAXA 2FNAA 2XAFA 2WWYA 5ERIA 5LRSA 4EJUA 4ANJA 3LA3A 2UV1A 3BOQA 2HQAA 4EM2A 5M3MJ 5KNLA 2O0YA 3BDDA 2NVTJ 3HSFA 4XLCA 2QQ8A 3EYYA 3I4PA 2VBYA 3BTCA 5IYDJ 1GV5A 2NNNA 1XMXA 4XLAA 1TT5B 3TKYA 3VFZA 2ELKA 3HPGA 3M7GA 1ZRDA 5K7ZA 2CQQA 4PGGA 5EZHA 4A3BJ 4PSXA 2R7FA 3WU2C 1SD5A 5H2FC 1IV6A 4W97A 4MNUA 4NNJA 1LFUP 1WH7A 2GXBA 4P55A 1ENHA 2W25A 1V5FA 2AQFA 3OYLA 2EZLA 3T8TA 3GLXA 3PSFA 1EV7A 5FB2A 5F08A 4BY1J 3HYIA 3JRFA 4HBLA 1BC8C 3BC8A 1Y0NA 1U78A 3OIQA 3G6EI 3CCRI 2NVUB 4B4CA 1FYKA 3ONQA 2X1CA 2O03A 2A6HF 2HWVA 3GXOA 2LF8A 4LMYA 4F91B 3ZQHA 1P2FA 2XVCA 1Y1WJ 2O5RA 2WAQN 3H5AA 1Z21A 4MFDA 1YW9A 1G3SA 3IAS2 4WXDA 1DPUA 2P5KA 2WAFA 3DKWA 1X3UA 4GYIA 2LRDA 2B9SA 3CJQB 1Y0UA 4BQQA 3GTPJ 1XGMA 5ICEA 1DPRA 3J7AO 4R1HA 4FASD 2DMNA 4AC0A 5HS8A 1DGRM 2PI0A 3CC7I 4M9XA 4OIRF 3J81Z 3W2WA 4A3LJ 3MWMA 2DW4A 2NYXA 3L1PA 4U87A 2HOEA 2BY3A 3ZRGA 4G6DA 4BDZA 4GDFA 2RAEA 5D5XB 5GTIC 4EM1A 1K4TA 2DXIA 2QENA 4ENNA 2Z3YA 2EINH 1LVAA 2X48A 3FXKA 4LGWA 1RIOH 3S16J 4A3EJ 3VDXA 5E17F 1X19A 2C6YA 4MTEA 1G2HA 2VL8A 5B1BH 2X6WA 3B73A 2LVSA 1T6SA 4EV0A 2A6TA 3GTKJ 3FZVA 3I71A 2M8GX 4O6JA 1A5JA 5D6FA 3ZP5A 4IHSA 1BA5A 2E7WA 3LQRA 2BHYA 4KYWA 4JP0A 1ZGJA 5IYBJ 3T5XA 3EYIA 2O8XA 4OINF 4I01A 3V42A 2MH2A 1YE9A 4XRSA 3OSFA 1W0UA 2YSRA 3DWLE 1HLVA 4QWQA 1BL0A 4Y13A 1X1AA 3LWFA 3QODA 1SVOA 1T38A 3K69A 2MD0A 3QOPA 1XGOA 3RSNA 3OYFA 1R00A 1T95A 1ZR2A 2CU7A 1REPC 4E7IA 4XKWA 3JCUC 4BKXA 3JRDA 3KLOA 1TQMA 1JKRC 3LAPA 5FKNA 4KMFA 5D8KB 3K2ZA 3F8NA 3Q0UA 4UB8C 4QPOA 1ZELA 1T56A 2GWRA 1XDUA 3QPHA 1QNTA 4Y3OA 5J47A 5LGUA 2FMLA 3D1NI 1W7PB 3FX3A 3CMEI 2GBYA 2MC3A 2CQKA 3MVPA 1DU0A 2W1OA 2V9PA 2XAHA 4Y17A 3H5NA 1HOMA 2E60A 2V9KA 2VC1A 4HEA2 2LK2A 4EM0B 4NC8A 4UVAA 4A3KJ 5M3FJ 2PMHA 4QLCU 2BY2A 5JVGF 2HGCA 1CGPA 1VQ5I 3S17J 3QP5A 2KJCA 3KP7A 1VQ9I 1YLFA 4M3EA 2CW7A 1U5TB 2QQ9A 2YUSA 5DCFA 2CG4A 2EPFA 1O3RA 2JZYA 1WVRA 1F36A 1H0MA 2DK5A 4E7SA 2BVMA 1T2KA 3JRBA 3I58A 2DDBA 1U8BA 1MMGA 1LFPA 2DMQA 1LEBA 4FE7A 2YX7A 4OIQF 1K83J 2IAIA 2IBDA 3WTUC 1ZH5A 3CCUI 1SVMA 2ZSHB 3ZN0A 1LE8B 2KIMA 1RETA 2EJRA 1EKEA 2PFBA 2ZNZA 1CQTA 1IRZA 5GAHJ 3MKZA 2Z1DA 2FBHA 5LEJA 3OS2A 3ESWB 5DCMA 2UXNA 3K7AJ 2RKHA 3BG6A 4A3JJ 2VPLA 2DA3A 5GAGJ 5ED4A 4PZJA 2M3AA 4CCKA 2FF4A 1S7EA 3A2KA 1VQ8I 3MKWB 4GXOA 5FLXZ 1FX7A 3BR3A 4RAFA 1A35A 5JLXA 4LG0B 3V7SA 1D8JA 2VE8A 1MBJA 2QBYB 3ULQB 2FRHA 4F92B 3OYKA 3CO7C 2J5OA 4U7BA 3KLNA 3AG3H 2X1EA 4P1WA 5AONA 2QZ8A 4N4NB 4A69C 5FKKA 3D5LA 5LBQA 1XCBA 4WWCA 3OS0A 2RC4A 2EA4A 3CCSI 2ZFWA 1S3JA 4FQGA 2HNHA 1MMAA 1OFCX 2ID3A 2K9NA 2QCOA 2R5YB 2IJLA 2NXNB 4K2EA 4HNTA 1LB2A 1O3SA 3VYSB 4I0AA 1JTXA 2EA2A 1N77A 2EIJH 2Q2EA 2Z5UA 3R60A 1J59A 3WTTC 1Z3YA 2XPWA 4EEFG 2XC7A 3MKLA 2NAZA 1RKWA 2RQPA 1WSUA 4IX7A 2W85A 2WAQA 2MC4A 3I64A 4E7KA 3K4CA 3LSJA 2F5FA 3DU6A 4C3HJ 1MGTA 5H20A 4S04A 2JMWA 2L7ZA 3COAC 2W82A 1IJWC 5LRRA 2JTVA 2KPMA 4A0ZA 3KYCB 1W5TA 4CCOA 2DPDA 4XSZF 3S14J 2D2WA 2ZCWA 1XDSA 2I8DA 3FK7A 4QPQA 1UHMA 2IGOA 3HRTA 5DS9A 1U6GA 2FQ3A 2Z9OA 2OZ6A 2QWWA 3QP6A 4MO7A 5DTDA 1XN7A 2RVCA 3F72A 5FGMA 1RC9A 4CYDA 3E6BA 4YIFA 4DYCA 3OIOA 4RLFA 1KQ8A 1PUFB 2X51A 4BU2A 2NOJB 1JTYA 3TOBA 1R71A 2E2JJ 3VODA 3ZMVA 3DKYA 3G4SI 2DLLA 2XRNA 5J1YA 1OJLA 4DJAA 1B72B 2FNPA 1IDYA 1OLTA 2R7VA 3SXYA 2R4GA 2HS5A 2ACJA 2PJPA 1MBKA 2OAZA 3MKYB 1ZARA 2WBMA 3GO5A 2Z33A 2XAUA 5LD2C 2V6EA 2L7MP 2HYGD 2FQ4A 4JK1X 1WRJA 3N97A 1BOAA 5TJJA 5CVJA 3F3XA 3GTLJ 1D1BA 2DOAA 3O8GA 1XG1A 3WTWC 3HOXJ 2ZJRF 3RPUA 4E7ZA 2ISYA 2IA0A 4BE0A 3G2BA 4AIKA 5HDKA 4IPAA 1R5GA 1IGNA 4IVNA 3BJ6A 3GTQJ 2H6BA 3K4JA 3X2QH 5DUIA 3HZJA 2IS1A 1DUXC 1ETWA 1T33A 2UWMA 2Y0SA 3KZZA 1IXCA 3QWLA 5EF6A 1QBJA 5D4RA 1TC3C 3AAFA 2CYYA 3ZOBA 3DLAA 3TL4X 2CV2A 2G7UA 1L0OC 3A4CA 5HVQC 2FX0A 1L3LA 4UV9A 2ZSIB 1FOXA 3HJEA 4PCQA 2CS3A 2IS6A 1Z05A 2R5ZA 1EF4A 1ZLJA 1OCCH 3QPLA 2X85A 3H9GA 3I5UA 1U0JA 1UZCA 4A0XA 3G3ZA 2L0KA 2EZKA 3HUGA 3O6BB 2XF7A 4G12A 4R8HA 4F7ZA 2P8TA 1RNLA 5EEHA 2DT5A 5L3EA 1SD6A 2Z2SB 4A93J 1KQ0A 4XORA 3OY9A 3QYBA 4ZYHA 3WE3A 2QYOA 1IF1A 3OYNA 1D1CA 4ZTJA 5J3LA 2M34A 1GVJA 2MW8A 4WXHA 3LSMA 5CPRB 3U1DA 2HU9A 1RR7A 2WY7Q 4XR6A 4WF2A 4DQ2A 3RKYA 2E1MC 4YFNF 4IRGA 1JT0A 4BDYA 4E70A 2XAJA 5LHGA 1QVUA 1FT9A 3E6DA 3M07A 4DOZA 4DZJA 1TWFJ 1R7JA 4PJ0C 3HUGB 4M9SA 3FXUA 2ZXIA 5J1UA 3J7AY 4CCLA 3NAUA 1R9TJ 1HKSA 1QO0D 2KDOA 4CO8A 4XKCA 4MGRA 2R7ZJ 3HRSA 1BI0A 2K7LA 2PMZA 3ZQLA 5E79C 5EYRA 4P9UA 1TT0A 2PLYA 3HIFA 4AVPA 2EILH 3QPTA 3ASNH 1WCMJ 4HYEA 1KZHA 1HXDA 2HTJA 3S3OA 3EUAA 4C2UA 1ORKA 2ZFUA 2FA5A 3PQKA 3SDBA 1Z3XA 2RN7A 2LC2A 2ELHA 2LREA 1DDNA 2EH3A 1X2NA 1LPQA 4EGZA 1TNSA 3SFIA 3OYIA 1NH3A 2LDUA 5DV5A 2LKPA 1R1VA 1DP7P 5E3NA 1SAUA 2ZC2A 4RS8A 3REOA 1FP2A 2MD5A 2CQ7A 5F64A 1B9MA 4I2OA 1W36D 3KEQA 1OISA 2W4SA 4CUGA 3FM5A 4PJLA 2K27A 2K3PA 5FD5A 2XUBA 2KQRA 1W0TA
chains in the Genus database with same CATH topology
2FE3A 3V8JA 1PUEE 1Z9CA 3F21A 4I0BA 3I59B 2YPRA 2PG4A 3C18A 1FLIA 5D8LB 3M9AA 4KN7X 3ELKA 3PFIA 1LQ1A 4ENKA 2EFPA 3WTXC 3ROUA 4L0ZB 1FBSA 2OQGA 2XGXA 3RI4A 3JW4A 1JE8A 1LDKB 3DQVC 5DD4A 3KZYA 1XGSA 3DV8A 4PGHA 2FU4A 5IT3A 1TLHB 1BN5A 1T98A 1LNWA 1HBXG 4KFCA 2R3SA 5LGTA 4XRFA 4HQEA 3SQNA 5D5UB 5LHIA 3BZ6A 1YW7A 2DK8A 1IRFA 1IZ1A 3ABTA 4U0VA 1Z1DA 2F5DA 2VT2A 1B1BA 2F5CA 2FMYA 1F4KA 3TDUC 1TBXA 2FBIA 1F9NA 2JSCA 3FHZA 1BJAA 4YFKF 4CZZA 1AOYA 4OU0A 4FX0A 1IN4A 3VEPA 2JPCA 2CO5A 2GXBA 1W4MA 3TO9A 5L3DA 2L54A 4KMUX 2V1XA 1FWZA 3U2RA 4CDGA 2DU9A 2ZMEA 2ZKZA 4A6EA 1YW8A 1YO5C 5BOXA 2HDCA 3R6SA 3ZQ7A 3CUOA 3JSOA 1U5TA 4CICA 3R0JA 1YTYA 2VBWA 3H3ZA 3JTGA 4U88A 2ESNA 2DAOA 1S6LA 3WTZA 5BPDA 5HDGA 2M8EA 4ENJA 1GXQA 3DF8A 1U5TC 5BQTA 3KP3A 5BPIA 1FSHA 1ZAOA 1P4WA 5ILUA 3K0LA 2OD5A 2JRTA 1HW5A 3GF2A 5E20A 2QQBA 3HSRA 3MFKA 2Y0MA 1EH6A 3E3VA 5ICGA 2K86A 3P9KA 1A04A 1RZ4A 5ILSA 3GUDA 3F8BA 1ZGAA 2ZBKA 2QBYA 2LF7A 3HRMA 3HTUA 2GAUA 3L9FA 1QZZA 1P4AA 4TV7A 2O6GE 3CUQC 1RUNA 2ZMEB 4U0WA 1NHAA 1J75A 3KE2A 4B8XA 1D3YA 3FMSA 1WKMA 3J80K 3CUQB 1ZG5A 3JSPA 5KK1A 4RB1A 3V8KA 3WU0A 3ZMUA 1U3EM 4O3MA 3BPXA 3EDPA 2L4AA 2Q0OA 4G6QA 4ZH4F 2HR3A 1U8RA 1HKTA 1W7PA 2EV0A 1OYWA 4OMYA 1V4RA 1YIOA 3J80Z 4P96A 3JTHA 2IP2A 1MDMA 3RKXA 4M74A 1ON2A 4RGUA 1BI2A 4HDUA 2D1VA 1ON1A 1OMIA 2A5YB 1XMAA 2ADUA 2P7VB 1O3QA 5H6RA 5AIQA 2XV4S 3GFJA 4IHTA 2VODA 1D8KA 3B02A 3I59A 4HX4A 5F6FA 2FSWA 2ISZA 3IKVA 4KT5C 3GFIA 3GW2A 1T39A 3CO6C 1GHCA 5CVUA 4RAZA 3I0TA 2JT1A 2EB7A 2ZO4A 2V1DA 1CF7A 4UVBA 4NQWA 2G9WA 3K1NA 2MLKA 4UNOA 4L5JA 1ULYA 3QRFF 2P4WA 5E1WA 3WGHA 4A0YA 2FBKA 1XB4A 4IJAA 4EJTA 3GEZA 4RAYA 1OKRA 1G3TA 5K5OA 4G9YA 4BNCA 3CJNA 3J81K 4MEXF 4XBFA 4N9HA 4LK0F 2OA4A 4O5VA 2VOOA 3C7JA 3N4MA 3FMRA 3MZYA 1FBUA 2H6CA 2XAQA 2H09A 4HV6A 2OQRA 2EWNA 1GXPA 1EH7A 2EFWA 3E6MA 2HQNA 3DXJF 3OV8A 3RTRA 2BE5F 4ZYGA 4OIOF 1JGSA 3HRUA 5IT9Z 3LQQA 4Q48A 3RKWA 4LLNA 1R23A 2A6EF 3LA7A 1I1GA 4HV5A 3GFMA 4S05A 4WCGA 3LFKA 5KVRA 3MQ0A 1Z6RA 3HOTA 1IN7A 1JHHA 2O61A 2DBBA 2BBYA 3I53A 3HHHA 3BP8A 4L9NA 2CFXA 4CXFA 2LSOA 5E1ZB 1O7LA 3E97A 5L3FA 5HS7A 1PP8F 3WTVC 3FXRA 2GXGA 1SMTA 2FOKA 5HOOA 4PDKA 2CW0F 3W6KB 3LA2A 2A07F 1FY7A 2TDXA 2PN6A 1MD0A 2J5PA 1STZA 3Q5FA 5DUKA 1SD7A 1OYYA 2W84A 4GGGA 3GVAA 4KIGA 5DYMA 4BHBA 1XSXA 2IA2A 1FPQA 2QLZA 1BIAA 3GZ5A 3IWZA 1SMYF 5BS6A 2AXLA 2GA2A 2OBPA 1FNNA 2WC2A 5K5QA 5LHHA 5ILVA 3TDZC 1O7FA 1LDJA 5JR3A 3BWGA 2PMUA 4GO1A 4UHTA 5HS9A 4CHUA 3C1DA 4R79A 5D6EA 4A5NA 2W57A 3KCCA 4KUMA 3WU1B 5DCMB 4HQMA 4NB5A 4KDPA 3JAMZ 2ETHA 4Q4ZF 3G73A 3M8EA 1EH8A 2IVMA 3Q9SA 1K79A 2NNYA 2YU3A 2A61A 3T1BA 2P5LC 3R0AA 1G4DA 4JBAA 3EETA 4LLGF 4U7DA 3H92A 3WTYC 1YS6A 2HQRA 4NHJA 1Q1HA 2RNJA 2MH9A 2L02A 5AIPA 1B59A 3U9GA 1ZREA 4HA8A 4UXNA 3L00A 3HSEA 2K4BA 4CGZA 3RIRA 1Z7UA 2V79A 5FFXA 3MZHA 3FF5A 3H3UA 1R36A 4JQFA 4Q47A 1MJAA 1S29A 3L7WA 1QGPA 1W7PD 3BJOA 4IXAA 1J9IA 2Y75A 3E6CC 1BIBA 2M30A 1IAWA 3DPLC 3ECHA 1FSEA 1XMKA 5LGNA 2M45A 1R1UA 3KP5A 1FOKA 4LG0A 4AWXB 1K6OA 2EFNA 4XLNF 4AD9A 5JFRA 2ZJ2A 4FT8A 1KU7A 2M1BA 3E5UA 2VXZA 4RB0A 5L3GA 4L5IA 3ABUA 1R5HA 1HQCA 3PQJA 3SHFA 1TW3A 4ENMA 4LJZF 2X0LA 2XROA 1C0WA 1F1ZA 3F8FA 2Q8KA 5BMZA 2HKXA 3BY6A 3O2PE 4MQVA 3FWEA 5HLGA 2FXAA 5DDGA 4LB5A 1LJ9A 1F5TA 2X4HA 5A2QZ 4YIIA 3RDIA 1S7AA 2HYFA 2DPUA 2LNBA 3IC7A 1PP7U 1I1SA 2HZTA 4EVIA 3RJPA 2XHKA 2F5EA 1R58A 1IN5A 4GYGA 3T8RA 1O57A 2VN2A 4HLYA 3BJAA 1IN8A 4M72A 4LK1F 3TGNA 1RI7A 1FYMA 3O3KA 5ICFA 4OMZA 2RDPA 1SFXA 2FEZA 2OZUA 3NRVA 4BYYA 5J8CA 1BI1A 3SFZA 3CUQA 1OR7A 3IRRA 4KA4A 1RUOA 5FD6A 4A6DA 1J5YA 3KEOA 4M73A 3DPTA 1P6RA 4KN4X 3OOPA 4BHPA 3K1MA 2BV6A 2K02A 1D5VA 2GQQA 1XSDA 3KP4A 2XASA 1YYVA 2OU2A 4MEYF 3K1PA 4Q5SF 2STWA 4G7HF 3BPVA 1KGSA 2D1HA 5CVVA 3F6VA 5JVTA 4OIPF 2E1NA 1SAXA 4HF0A 4WXCA 5CVIA 3KETA 3HOSA 5H6QA 4OOIA 1FBQA 2MA3A 3L2CA 2XAGA 3TQNA 1FC3A 5K5RA 5IT9K 3E5QA 4ZYDA 4BH9A 1VTNC 4UV8A 2ZNYA 2L01A 3MAJA 2P7CB 4G8XA 1QZYA 3KFWX 1IXRC 1MJ9A 4HW0A 3WGIA 2GZWA 2VBXA 4P9FA 3ZMTA 4FHTA 2E1CA 3WODF 4M71A 1ZYRF 1T0FA 2KKOA 1H9TA 1ZRFA 2P6TA 1G6NA 2V9VA 2RGVA 1MJBA 2G7HA 4I7HA 3HHGA 5D4SA 4WX9A 3TOAA 1IRGA 1OYIA 2DI3A 2A3SA 4I98B 1ODDA 4L18B 4BQAA 1I27A 1MKMA 4HX7A 3C3WA 1QPMA 1TQIA 5J8FA 5FO5A 1B9NA 3VB2A 3DP7A 3IWFA 2DO7A 3GX4X 3DFGA 4IRIA 3F22A 1JHFA 1BM9A 4MHGA 1HKQA 1BC7C 4RGSA 2PEXA 3FMQA 5DEQA 4ZZDA 4H0EA 4HF2A 5K1YA 3M1EA 4LLLA 2EK5A 3IRQA 1ONVA 5LLQA 3R4KA 2VE9A 3FM3A 4HDVA 1E17A 1XSVA 5HLHA 2R7DA 3RYRA 3F23A 1AWCA 4WK8F 2IW5A 4A12A 3RYPA 3ZPLA 1IN6A 2QVOA 1I6XA 4XLPF 2JPBA 1KQ9A 4N0BA 3M8FA 2BGCA 1ZLKA 1YFHA 4YG2F 4RGRA 1J0RA 2IRFG 4I02A 3IL2A 3QU6A 3QAHA 4A5MA 2H94A 4EJOA 3W6JB 1Z91A 2IPQX 2V1UA 1G3YA 2VBZA 3EQLF 4D0PA 4ETSA 4KIBA 4LB6B 1P4XA 4L0YB 2NRAC 1FZPB 1XGNA 3Q9VA 3D0SA 1V3FA 2DFIA 3WE2A 4Z2YA 1BBYA 4UUVA 3ZMZA 3T0YA 2VT3A 4HZFA 1SFEA 1ZHFA 3P9IA 4G7OF 1ZG3A 2EFOA 1I5ZA 2D45A 3ISPA 1LDDA 1O3TA 1HSTA 1K78A 2XKOA 3WTSC 2HTSA 4P5OA 1YS7A 1W5SA 1WQ2A 3F8MA 5L3CA 2P5VA 1QQIA 4L9TA 4IRHA 4ZZLA 3F6OA 5JI6A 3ECOA 2IA1A 3I54A 1K78B 2VC0A 1FYLA 3P9CA 5E1XA 2P6SA 3GZ6A 2COMA 3S2WA 1B4AA 4L9JA 1R1TA 3KP2A 4EQQA 3F8CA 2PBIA 4LD5A 3EUHA 3CDHA 2DQRA 5E8IA 4EGYA 2GA1A 2UXXA 3CLOA 3WGGA 1KYZA 2HFHA 1S8NA 2YR2A 4HOBA 4M9ZA 2GIVA 2AS5F 3GFLA 5FLXK 4KNYA 2WV0A 3IHUA 3VOEA 3RPQA 2WTEA 4MQ9F 5ICCA 1UCRA 1USSA 3LSTA 2NS0A 4N9IA 3V4GA 1B6AA 5CLSA 2E7XA 3BROA 4DNCA 4EJVA 2VONA 3ERED 2BYVE 2KRFA 2HEOA 2YX4A 2Z99A 3MCZA 2MLGA 2IT0A 5JHUA 3HTSB 3K9TA 2RV8A 4EJWA 1KU9A 2VOPA 1J2XA 4AIJA 2UZKA 1G3WA 1JXSA 4M6XA 1KU2A 3ZMDA 5FFZA 1CF7B 2XKPA 5EEGA 1E2XA 1UFMA 3QU3A 4Y15A 3SZPA 4HLXA 1TNTA 3TO6A 1OPCA 1Z6TA 2EFQA 1P92A 2Y48A 3TO7A 2W24A 2KJBA 3ML6A 1R22A 5J6XA 1MZBA 2EV5A 1UHWA 4YFXF 2QQAA 4EMSA 2A68F 1UB9A 2V6CA 1SFUA 3SZTA 2CSOA 3MEXA 1LEAA 1TW2A 4U0YA 2XIGA 5CJ9A 4UVCA 1H9GA 5D5VB 3JAMK 1HW1A 3LAJA 3P7NA 3KP6A 3L09A 2BEOA 2HKOA 1ZN2A 1ZG1A 1HW2A 4BHCA 4BXUA 2STTA 4MTDA 3ZMSA 1J7KA 3GWZA 3NEUA 1WI9A 2K4JA 1TQPA 4HF1A 2B0LA 5CYVA 5DD8A 4BAYA 5L3BA 4HAMA 4IF4A 3R61A 2ZXJA 1IXSB 2KIUA 4GCVA 1YQAA 3IKTA 2M87A 3ZN1A 4ESFA 4FX4A 4AIHA 1KU3A 3NQOA 5TRDA 3GYHX 5LEKA 5HDNA 2O3FA 1XCVA 3E5XA 3V7CA 1PDNC 1HSJA 4G7ZF 3DEUA 1KYWA 1SD4A 4KICA 2H27A 1FP1D 3FXQA 5F1RA 5CVRA 2M5WA 1U2WA 1WWXA 4XSXF 1USTA 1BI3A 1KA8A 2DQLA 4ON0A 5D5WB 5E8GA 4RB2C 2L4MA 5HLIA 2PQ8A 4LFUA 4L9VA 2QM3A 2MBFA 4ESBA 2DTRA 5E18F 3V8LA 1ZRCA 1MDMB 4I09A 4M6YA 4ESJA 3WG9A 4KIFA 5A2QK 3V7RA 2KIFA 1S7OA 4HX8A 1XD7A 4A2UA 3CTAA 1YG2A 1TTYA 2EV6A 4G94A 4ASNA 4B09A 2QUFA 4RB3C 2ESHA 2L3DA 1IW7F 1K7AA 4RGXA 2CWEA 4ZYEA 1IUYA 2A69F 2F2EA 2CGPA 6PAXA 2FNAA 2XAFA 2WWYA 5ERIA 5LRSA 4EJUA 3LA3A 3BOQA 4EM2A 2O0YA 3BDDA 3HSFA 3EYYA 3I4PA 2VBYA 2NNNA 3TKYA 3VFZA 3M7GA 1ZRDA 4PGGA 2R7FA 1SD5A 4MNUA 4P55A 2W25A 3T8TA 3GLXA 5FB2A 1EV7A 3HYIA 4HBLA 1BC8C 1U78A 1FYKA 2O03A 2A6HF 2HWVA 3GXOA 2LF8A 4LMYA 1P2FA 2XVCA 1YW9A 1G3SA 4WXDA 1DPUA 2P5KA 3DKWA 4GYIA 1X3UA 1Y0UA 1XGMA 5ICEA 1DPRA 3J7AO 4R1HA 5HS8A 2PI0A 4M9XA 4OIRF 3J81Z 3MWMA 2DW4A 2NYXA 2HOEA 4G6DA 5D5XB 4EM1A 2QENA 4ENNA 2Z3YA 1LVAA 4LGWA 1RIOH 5E17F 2C6YA 4MTEA 3B73A 1T6SA 4EV0A 3FZVA 3I71A 4O6JA 5D6FA 3ZP5A 4IHSA 2E7WA 3LQRA 4KYWA 1ZGJA 3T5XA 3EYIA 2O8XA 4OINF 4I01A 2MH2A 2YSRA 4QWQA 4Y13A 3LWFA 1T38A 3K69A 3QOPA 1XGOA 1R00A 1REPC 3KLOA 1TQMA 4KMFA 3LAPA 5D8KB 3K2ZA 3F8NA 2GWRA 1XDUA 3QPHA 1QNTA 5LGUA 2FMLA 1W7PB 3FX3A 2MC3A 2CQKA 2XAHA 4Y17A 2VC1A 4EM0B 4UVAA 2PMHA 4QLCU 2HGCA 1CGPA 3QP5A 2KJCA 3KP7A 1YLFA 1U5TB 2QQ9A 5DCFA 2CG4A 1O3RA 2JZYA 1H0MA 2DK5A 1T2KA 3I58A 1LEBA 2YX7A 4OIQF 3WTUC 1ZH5A 3ZN0A 2KIMA 2EJRA 2ZNZA 2PFBA 2FBHA 5LEJA 5DCMA 2UXNA 2RKHA 5ED4A 4PZJA 2FF4A 4GXOA 5FLXZ 1FX7A 4LG0B 3V7SA 1D8JA 2VE8A 2QBYB 3ULQB 2FRHA 3CO7C 2J5OA 4U7BA 3KLNA 5AONA 2QZ8A 3D5LA 5LBQA 1XCBA 4WWCA 2RC4A 2EA4A 2ZFWA 1S3JA 2IJLA 4K2EA 1LB2A 1O3SA 4I0AA 2EA2A 2Q2EA 2Z5UA 3R60A 1J59A 3WTTC 2NAZA 2RQPA 1WSUA 2W85A 3I64A 3COAC 2F5FA 4S04A 1MGTA 5H20A 5LRRA 2JTVA 4A0ZA 1W5TA 2DPDA 4XSZF 2D2WA 2ZCWA 1XDSA 1UHMA 3HRTA 1U6GA 2FQ3A 2Z9OA 2OZ6A 2QWWA 3QP6A 1XN7A 2RVCA 3F72A 5FGMA 4CYDA 3E6BA 4YIFA 1KQ8A 3TOBA 3VODA 3ZMVA 2DLLA 2XRNA 2FNPA 3SXYA 2HS5A 2ACJA 2PJPA 2OAZA 1ZARA 3GO5A 2Z33A 2HYGD 4JK1X 1WRJA 3N97A 1BOAA 5TJJA 5CVJA 3F3XA 3WTWC 3RPUA 2ISYA 2IA0A 4AIKA 5HDKA 4IPAA 1R5GA 4IVNA 3BJ6A 2H6BA 5DUIA 1DUXC 2UWMA 3KZZA 1IXCA 1QBJA 5D4RA 3AAFA 2CYYA 2G7UA 1L0OC 5HVQC 1L3LA 4UV9A 4PCQA 1Z05A 1ZLJA 3I5UA 4A0XA 3G3ZA 3HUGA 3O6BB 4R8HA 4F7ZA 2P8TA 1RNLA 5EEHA 2DT5A 5L3EA 1SD6A 1KQ0A 4ZYHA 3WE3A 2QYOA 1IF1A 1GVJA 4WXHA 3U1DA 4DQ2A 4WF2A 3RKYA 4YFNF 4IRGA 4E70A 2XAJA 5LHGA 1FT9A 3E6DA 1R7JA 4M9SA 3FXUA 1HKSA 1QO0D 4CO8A 4MGRA 3HRSA 1BI0A 2K7LA 4P9UA 2PLYA 3HIFA 4AVPA 3QPTA 4HYEA 1HXDA 2HTJA 2FA5A 3PQKA 2RN7A 2ELHA 1DDNA 4EGZA 1TNSA 2LDUA 5DV5A 2LKPA 1R1VA 1DP7P 4RS8A 3REOA 1FP2A 2MD5A 5F64A 1B9MA 4I2OA 3KEQA 3FM5A 5FD5A 2K27A 2XUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FE3 A;  3V8J A;  1PUE E;  1Z9C A;  3F21 A;  4I0B A;  3I59 B;  2YPR A;  2PG4 A;  3C18 A;  1FLI A;  5D8L B;  3M9A A;  4KN7 X;  3ELK A;  3PFI A;  1LQ1 A;  4ENK A;  2EFP A;  3WTX C;  3ROU A;  4L0Z B;  1FBS A;  2OQG A;  2XGX A;  3RI4 A;  3JW4 A;  1JE8 A;  1LDK B;  3DQV C;  5DD4 A;  3KZY A;  1XGS A;  3DV8 A;  4PGH A;  2FU4 A;  5IT3 A;  1TLH B;  1BN5 A;  1T98 A;  1LNW A;  1HBX G;  4KFC A;  2R3S A;  5LGT A;  4XRF A;  4HQE A;  3SQN A;  5D5U B;  5LHI A;  3BZ6 A;  1YW7 A;  2DK8 A;  1IRF A;  1IZ1 A;  3ABT A;  4U0V A;  1Z1D A;  2F5D A;  2VT2 A;  1B1B A;  2F5C A;  2FMY A;  1F4K A;  3TDU C;  1TBX A;  2FBI A;  1F9N A;  2JSC A;  3FHZ A;  1BJA A;  4YFK F;  4CZZ A;  1AOY A;  4OU0 A;  4FX0 A;  1IN4 A;  3VEP A;  2JPC A;  2CO5 A;  2GXB A;  1W4M A;  3TO9 A;  5L3D A;  2L54 A;  4KMU X;  2V1X A;  1FWZ A;  3U2R A;  4CDG A;  2DU9 A;  2ZME A;  2ZKZ A;  4A6E A;  1YW8 A;  1YO5 C;  5BOX A;  2HDC A;  3R6S A;  3ZQ7 A;  3CUO A;  3JSO A;  1U5T A;  4CIC A;  3R0J A;  1YTY A;  2VBW A;  3H3Z A;  3JTG A;  4U88 A;  2ESN A;  2DAO A;  1S6L A;  3WTZ A;  5BPD A;  5HDG A;  2M8E A;  4ENJ A;  1GXQ A;  3DF8 A;  1U5T C;  5BQT A;  3KP3 A;  5BPI A;  1FSH A;  1ZAO A;  1P4W A;  5ILU A;  3K0L A;  2OD5 A;  2JRT A;  1HW5 A;  3GF2 A;  5E20 A;  2QQB A;  3HSR A;  3MFK A;  2Y0M A;  1EH6 A;  3E3V A;  5ICG A;  2K86 A;  3P9K A;  1A04 A;  1RZ4 A;  5ILS A;  3GUD A;  3F8B A;  1ZGA A;  2ZBK A;  2QBY A;  2LF7 A;  3HRM A;  3HTU A;  2GAU A;  3L9F A;  1QZZ A;  1P4A A;  4TV7 A;  2O6G E;  3CUQ C;  1RUN A;  2ZME B;  4U0W A;  1NHA A;  1J75 A;  3KE2 A;  4B8X A;  1D3Y A;  3FMS A;  1WKM A;  3J80 K;  3CUQ B;  1ZG5 A;  3JSP A;  5KK1 A;  4RB1 A;  3V8K A;  3WU0 A;  3ZMU A;  1U3E M;  4O3M A;  3BPX A;  3EDP A;  2L4A A;  2Q0O A;  4G6Q A;  4ZH4 F;  2HR3 A;  1U8R A;  1HKT A;  1W7P A;  2EV0 A;  1OYW A;  4OMY A;  1V4R A;  1YIO A;  3J80 Z;  4P96 A;  3JTH A;  2IP2 A;  1MDM A;  3RKX A;  4M74 A;  1ON2 A;  4RGU A;  1BI2 A;  4HDU A;  2D1V A;  1ON1 A;  1OMI A;  2A5Y B;  1XMA A;  2ADU A;  2P7V B;  1O3Q A;  5H6R A;  5AIQ A;  2XV4 S;  3GFJ A;  4IHT A;  2VOD A;  1D8K A;  3B02 A;  3I59 A;  4HX4 A;  5F6F A;  2FSW A;  2ISZ A;  3IKV A;  4KT5 C;  3GFI A;  3GW2 A;  1T39 A;  3CO6 C;  1GHC A;  5CVU A;  4RAZ A;  3I0T A;  2JT1 A;  2EB7 A;  2ZO4 A;  2V1D A;  1CF7 A;  4UVB A;  4NQW A;  2G9W A;  3K1N A;  2MLK A;  4UNO A;  4L5J A;  1ULY A;  3QRF F;  2P4W A;  5E1W A;  3WGH A;  4A0Y A;  2FBK A;  1XB4 A;  4IJA A;  4EJT A;  3GEZ A;  4RAY A;  1OKR A;  1G3T A;  5K5O A;  4G9Y A;  4BNC A;  3CJN A;  3J81 K;  4MEX F;  4XBF A;  4N9H A;  4LK0 F;  2OA4 A;  4O5V A;  2VOO A;  3C7J A;  3N4M A;  3FMR A;  3MZY A;  1FBU A;  2H6C A;  2XAQ A;  2H09 A;  4HV6 A;  2OQR A;  2EWN A;  1GXP A;  1EH7 A;  2EFW A;  3E6M A;  2HQN A;  3DXJ F;  3OV8 A;  3RTR A;  2BE5 F;  4ZYG A;  4OIO F;  1JGS A;  3HRU A;  5IT9 Z;  3LQQ A;  4Q48 A;  3RKW A;  4LLN A;  1R23 A;  2A6E F;  3LA7 A;  1I1G A;  4HV5 A;  3GFM A;  4S05 A;  4WCG A;  3LFK A;  5KVR A;  3MQ0 A;  1Z6R A;  3HOT A;  1IN7 A;  1JHH A;  2O61 A;  2DBB A;  2BBY A;  3I53 A;  3HHH A;  3BP8 A;  4L9N A;  2CFX A;  4CXF A;  2LSO A;  5E1Z B;  1O7L A;  3E97 A;  5L3F A;  5HS7 A;  1PP8 F;  3WTV C;  3FXR A;  2GXG A;  1SMT A;  2FOK A;  5HOO A;  4PDK A;  2CW0 F;  3W6K B;  3LA2 A;  2A07 F;  1FY7 A;  2TDX A;  2PN6 A;  1MD0 A;  2J5P A;  1STZ A;  3Q5F A;  5DUK A;  1SD7 A;  1OYY A;  2W84 A;  4GGG A;  3GVA A;  4KIG A;  5DYM A;  4BHB A;  1XSX A;  2IA2 A;  1FPQ A;  2QLZ A;  1BIA A;  3GZ5 A;  3IWZ A;  1SMY F;  5BS6 A;  2AXL A;  2GA2 A;  2OBP A;  1FNN A;  2WC2 A;  5K5Q A;  5LHH A;  5ILV A;  3TDZ C;  1O7F A;  1LDJ A;  5JR3 A;  3BWG A;  2PMU A;  4GO1 A;  4UHT A;  5HS9 A;  4CHU A;  3C1D A;  4R79 A;  5D6E A;  4A5N A;  2W57 A;  3KCC A;  4KUM A;  3WU1 B;  5DCM B;  4HQM A;  4NB5 A;  4KDP A;  3JAM Z;  2ETH A;  4Q4Z F;  3G73 A;  3M8E A;  1EH8 A;  2IVM A;  3Q9S A;  1K79 A;  2NNY A;  2YU3 A;  2A61 A;  3T1B A;  2P5L C;  3R0A A;  1G4D A;  4JBA A;  3EET A;  4LLG F;  4U7D A;  3H92 A;  3WTY C;  1YS6 A;  2HQR A;  4NHJ A;  1Q1H A;  2RNJ A;  2MH9 A;  2L02 A;  5AIP A;  1B59 A;  3U9G A;  1ZRE A;  4HA8 A;  4UXN A;  3L00 A;  3HSE A;  2K4B A;  4CGZ A;  3RIR A;  1Z7U A;  2V79 A;  5FFX A;  3MZH A;  3FF5 A;  3H3U A;  1R36 A;  4JQF A;  4Q47 A;  1MJA A;  1S29 A;  3L7W A;  1QGP A;  1W7P D;  3BJO A;  4IXA A;  1J9I A;  2Y75 A;  3E6C C;  1BIB A;  2M30 A;  1IAW A;  3DPL C;  3ECH A;  1FSE A;  1XMK A;  5LGN A;  2M45 A;  1R1U A;  3KP5 A;  1FOK A;  4LG0 A;  4AWX B;  1K6O A;  2EFN A;  4XLN F;  4AD9 A;  5JFR A;  2ZJ2 A;  4FT8 A;  1KU7 A;  2M1B A;  3E5U A;  2VXZ A;  4RB0 A;  5L3G A;  4L5I A;  3ABU A;  1R5H A;  1HQC A;  3PQJ A;  3SHF A;  1TW3 A;  4ENM A;  4LJZ F;  2X0L A;  2XRO A;  1C0W A;  1F1Z A;  3F8F A;  2Q8K A;  5BMZ A;  2HKX A;  3BY6 A;  3O2P E;  4MQV A;  3FWE A;  5HLG A;  2FXA A;  5DDG A;  4LB5 A;  1LJ9 A;  1F5T A;  2X4H A;  5A2Q Z;  4YII A;  3RDI A;  1S7A A;  2HYF A;  2DPU A;  2LNB A;  3IC7 A;  1PP7 U;  1I1S A;  2HZT A;  4EVI A;  3RJP A;  2XHK A;  2F5E A;  1R58 A;  1IN5 A;  4GYG A;  3T8R A;  1O57 A;  2VN2 A;  4HLY A;  3BJA A;  1IN8 A;  4M72 A;  4LK1 F;  3TGN A;  1RI7 A;  1FYM A;  3O3K A;  5ICF A;  4OMZ A;  2RDP A;  1SFX A;  2FEZ A;  2OZU A;  3NRV A;  4BYY A;  5J8C A;  1BI1 A;  3SFZ A;  3CUQ A;  1OR7 A;  3IRR A;  4KA4 A;  1RUO A;  5FD6 A;  4A6D A;  1J5Y A;  3KEO A;  4M73 A;  3DPT A;  1P6R A;  4KN4 X;  3OOP A;  4BHP A;  3K1M A;  2BV6 A;  2K02 A;  1D5V A;  2GQQ A;  1XSD A;  3KP4 A;  2XAS A;  1YYV A;  2OU2 A;  4MEY F;  3K1P A;  4Q5S F;  2STW A;  4G7H F;  3BPV A;  1KGS A;  2D1H A;  5CVV A;  3F6V A;  5JVT A;  4OIP F;  2E1N A;  1SAX A;  4HF0 A;  4WXC A;  5CVI A;  3KET A;  3HOS A;  5H6Q A;  4OOI A;  1FBQ A;  2MA3 A;  3L2C A;  2XAG A;  3TQN A;  1FC3 A;  5K5R A;  5IT9 K;  3E5Q A;  4ZYD A;  4BH9 A;  1VTN C;  4UV8 A;  2ZNY A;  2L01 A;  3MAJ A;  2P7C B;  4G8X A;  1QZY A;  3KFW X;  1IXR C;  1MJ9 A;  4HW0 A;  3WGI A;  2GZW A;  2VBX A;  4P9F A;  3ZMT A;  4FHT A;  2E1C A;  3WOD F;  4M71 A;  1ZYR F;  1T0F A;  2KKO A;  1H9T A;  1ZRF A;  2P6T A;  1G6N A;  2V9V A;  2RGV A;  1MJB A;  2G7H A;  4I7H A;  3HHG A;  5D4S A;  4WX9 A;  3TOA A;  1IRG A;  1OYI A;  2DI3 A;  2A3S A;  4I98 B;  1ODD A;  4L18 B;  4BQA A;  1I27 A;  1MKM A;  4HX7 A;  3C3W A;  1QPM A;  1TQI A;  5J8F A;  5FO5 A;  1B9N A;  3VB2 A;  3DP7 A;  3IWF A;  2DO7 A;  3GX4 X;  3DFG A;  4IRI A;  3F22 A;  1JHF A;  1BM9 A;  4MHG A;  1HKQ A;  1BC7 C;  4RGS A;  2PEX A;  3FMQ A;  5DEQ A;  4ZZD A;  4H0E A;  4HF2 A;  5K1Y A;  3M1E A;  4LLL A;  2EK5 A;  3IRQ A;  1ONV A;  5LLQ A;  3R4K A;  2VE9 A;  3FM3 A;  4HDV A;  1E17 A;  1XSV A;  5HLH A;  2R7D A;  3RYR A;  3F23 A;  1AWC A;  4WK8 F;  2IW5 A;  4A12 A;  3RYP A;  3ZPL A;  1IN6 A;  2QVO A;  1I6X A;  4XLP F;  2JPB A;  1KQ9 A;  4N0B A;  3M8F A;  2BGC A;  1ZLK A;  1YFH A;  4YG2 F;  4RGR A;  1J0R A;  2IRF G;  4I02 A;  3IL2 A;  3QU6 A;  3QAH A;  4A5M A;  2H94 A;  4EJO A;  3W6J B;  1Z91 A;  2IPQ X;  2V1U A;  1G3Y A;  2VBZ A;  3EQL F;  4D0P A;  4ETS A;  4KIB A;  4LB6 B;  1P4X A;  4L0Y B;  2NRA C;  1FZP B;  1XGN A;  3Q9V A;  3D0S A;  1V3F A;  2DFI A;  3WE2 A;  4Z2Y A;  1BBY A;  4UUV A;  3ZMZ A;  3T0Y A;  2VT3 A;  4HZF A;  1SFE A;  1ZHF A;  3P9I A;  4G7O F;  1ZG3 A;  2EFO A;  1I5Z A;  2D45 A;  3ISP A;  1LDD A;  1O3T A;  1HST A;  1K78 A;  2XKO A;  3WTS C;  2HTS A;  4P5O A;  1YS7 A;  1W5S A;  1WQ2 A;  3F8M A;  5L3C A;  2P5V A;  1QQI A;  4L9T A;  4IRH A;  4ZZL A;  3F6O A;  5JI6 A;  3ECO A;  2IA1 A;  3I54 A;  1K78 B;  2VC0 A;  1FYL A;  3P9C A;  5E1X A;  2P6S A;  3GZ6 A;  2COM A;  3S2W A;  1B4A A;  4L9J A;  1R1T A;  3KP2 A;  4EQQ A;  3F8C A;  2PBI A;  4LD5 A;  3EUH A;  3CDH A;  2DQR A;  5E8I A;  4EGY A;  2GA1 A;  2UXX A;  3CLO A;  3WGG A;  1KYZ A;  2HFH A;  1S8N A;  2YR2 A;  4HOB A;  4M9Z A;  2GIV A;  2AS5 F;  3GFL A;  5FLX K;  4KNY A;  2WV0 A;  3IHU A;  3VOE A;  3RPQ A;  2WTE A;  4MQ9 F;  5ICC A;  1UCR A;  1USS A;  3LST A;  2NS0 A;  4N9I A;  3V4G A;  1B6A A;  5CLS A;  2E7X A;  3BRO A;  4DNC A;  4EJV A;  2VON A;  3ERE D;  2BYV E;  2KRF A;  2HEO A;  2YX4 A;  2Z99 A;  3MCZ A;  2MLG A;  2IT0 A;  5JHU A;  3HTS B;  3K9T A;  2RV8 A;  4EJW A;  1KU9 A;  2VOP A;  1J2X A;  4AIJ A;  2UZK A;  1G3W A;  1JXS A;  4M6X A;  1KU2 A;  3ZMD A;  5FFZ A;  1CF7 B;  2XKP A;  5EEG A;  1E2X A;  1UFM A;  3QU3 A;  4Y15 A;  3SZP A;  4HLX A;  1TNT A;  3TO6 A;  1OPC A;  1Z6T A;  2EFQ A;  1P92 A;  2Y48 A;  3TO7 A;  2W24 A;  2KJB A;  3ML6 A;  1R22 A;  5J6X A;  1MZB A;  2EV5 A;  1UHW A;  4YFX F;  2QQA A;  4EMS A;  2A68 F;  1UB9 A;  2V6C A;  1SFU A;  3SZT A;  2CSO A;  3MEX A;  1LEA A;  1TW2 A;  4U0Y A;  2XIG A;  5CJ9 A;  4UVC A;  1H9G A;  5D5V B;  3JAM K;  1HW1 A;  3LAJ A;  3P7N A;  3KP6 A;  3L09 A;  2BEO A;  2HKO A;  1ZN2 A;  1ZG1 A;  1HW2 A;  4BHC A;  4BXU A;  2STT A;  4MTD A;  3ZMS A;  1J7K A;  3GWZ A;  3NEU A;  1WI9 A;  2K4J A;  1TQP A;  4HF1 A;  2B0L A;  5CYV A;  5DD8 A;  4BAY A;  5L3B A;  4HAM A;  4IF4 A;  3R61 A;  2ZXJ A;  1IXS B;  2KIU A;  4GCV A;  1YQA A;  3IKT A;  2M87 A;  3ZN1 A;  4ESF A;  4FX4 A;  4AIH A;  1KU3 A;  3NQO A;  5TRD A;  3GYH X;  5LEK A;  5HDN A;  2O3F A;  1XCV A;  3E5X A;  3V7C A;  1PDN C;  1HSJ A;  4G7Z F;  3DEU A;  1KYW A;  1SD4 A;  4KIC A;  2H27 A;  1FP1 D;  3FXQ A;  5F1R A;  5CVR A;  2M5W A;  1U2W A;  1WWX A;  4XSX F;  1UST A;  1BI3 A;  1KA8 A;  2DQL A;  4ON0 A;  5D5W B;  5E8G A;  4RB2 C;  2L4M A;  5HLI A;  2PQ8 A;  4LFU A;  4L9V A;  2QM3 A;  2MBF A;  4ESB A;  2DTR A;  5E18 F;  3V8L A;  1ZRC A;  1MDM B;  4I09 A;  4M6Y A;  4ESJ A;  3WG9 A;  4KIF A;  5A2Q K;  3V7R A;  2KIF A;  1S7O A;  4HX8 A;  1XD7 A;  4A2U A;  3CTA A;  1YG2 A;  1TTY A;  2EV6 A;  4G94 A;  4ASN A;  4B09 A;  2QUF A;  4RB3 C;  2ESH A;  2L3D A;  1IW7 F;  1K7A A;  4RGX A;  2CWE A;  4ZYE A;  1IUY A;  2A69 F;  2F2E A;  2CGP A;  6PAX A;  2FNA A;  2XAF A;  2WWY A;  5ERI A;  5LRS A;  4EJU A;  3LA3 A;  3BOQ A;  4EM2 A;  2O0Y A;  3BDD A;  3HSF A;  3EYY A;  3I4P A;  2VBY A;  2NNN A;  3TKY A;  3VFZ A;  3M7G A;  1ZRD A;  4PGG A;  2R7F A;  1SD5 A;  4MNU A;  4P55 A;  2W25 A;  3T8T A;  3GLX A;  5FB2 A;  1EV7 A;  3HYI A;  4HBL A;  1BC8 C;  1U78 A;  1FYK A;  2O03 A;  2A6H F;  2HWV A;  3GXO A;  2LF8 A;  4LMY A;  1P2F A;  2XVC A;  1YW9 A;  1G3S A;  4WXD A;  1DPU A;  2P5K A;  3DKW A;  4GYI A;  1X3U A;  1Y0U A;  1XGM A;  5ICE A;  1DPR A;  3J7A O;  4R1H A;  5HS8 A;  2PI0 A;  4M9X A;  4OIR F;  3J81 Z;  3MWM A;  2DW4 A;  2NYX A;  2HOE A;  4G6D A;  5D5X B;  4EM1 A;  2QEN A;  4ENN A;  2Z3Y A;  1LVA A;  4LGW A;  1RIO H;  5E17 F;  2C6Y A;  4MTE A;  3B73 A;  1T6S A;  4EV0 A;  3FZV A;  3I71 A;  4O6J A;  5D6F A;  3ZP5 A;  4IHS A;  2E7W A;  3LQR A;  4KYW A;  1ZGJ A;  3T5X A;  3EYI A;  2O8X A;  4OIN F;  4I01 A;  2MH2 A;  2YSR A;  4QWQ A;  4Y13 A;  3LWF A;  1T38 A;  3K69 A;  3QOP A;  1XGO A;  1R00 A;  1REP C;  3KLO A;  1TQM A;  4KMF A;  3LAP A;  5D8K B;  3K2Z A;  3F8N A;  2GWR A;  1XDU A;  3QPH A;  1QNT A;  5LGU A;  2FML A;  1W7P B;  3FX3 A;  2MC3 A;  2CQK A;  2XAH A;  4Y17 A;  2VC1 A;  4EM0 B;  4UVA A;  2PMH A;  4QLC U;  2HGC A;  1CGP A;  3QP5 A;  2KJC A;  3KP7 A;  1YLF A;  1U5T B;  2QQ9 A;  5DCF A;  2CG4 A;  1O3R A;  2JZY A;  1H0M A;  2DK5 A;  1T2K A;  3I58 A;  1LEB A;  2YX7 A;  4OIQ F;  3WTU C;  1ZH5 A;  3ZN0 A;  2KIM A;  2EJR A;  2ZNZ A;  2PFB A;  2FBH A;  5LEJ A;  5DCM A;  2UXN A;  2RKH A;  5ED4 A;  4PZJ A;  2FF4 A;  4GXO A;  5FLX Z;  1FX7 A;  4LG0 B;  3V7S A;  1D8J A;  2VE8 A;  2QBY B;  3ULQ B;  2FRH A;  3CO7 C;  2J5O A;  4U7B A;  3KLN A;  5AON A;  2QZ8 A;  3D5L A;  5LBQ A;  1XCB A;  4WWC A;  2RC4 A;  2EA4 A;  2ZFW A;  1S3J A;  2IJL A;  4K2E A;  1LB2 A;  1O3S A;  4I0A A;  2EA2 A;  2Q2E A;  2Z5U A;  3R60 A;  1J59 A;  3WTT C;  2NAZ A;  2RQP A;  1WSU A;  2W85 A;  3I64 A;  3COA C;  2F5F A;  4S04 A;  1MGT A;  5H20 A;  5LRR A;  2JTV A;  4A0Z A;  1W5T A;  2DPD A;  4XSZ F;  2D2W A;  2ZCW A;  1XDS A;  1UHM A;  3HRT A;  1U6G A;  2FQ3 A;  2Z9O A;  2OZ6 A;  2QWW A;  3QP6 A;  1XN7 A;  2RVC A;  3F72 A;  5FGM A;  4CYD A;  3E6B A;  4YIF A;  1KQ8 A;  3TOB A;  3VOD A;  3ZMV A;  2DLL A;  2XRN A;  2FNP A;  3SXY A;  2HS5 A;  2ACJ A;  2PJP A;  2OAZ A;  1ZAR A;  3GO5 A;  2Z33 A;  2HYG D;  4JK1 X;  1WRJ A;  3N97 A;  1BOA A;  5TJJ A;  5CVJ A;  3F3X A;  3WTW C;  3RPU A;  2ISY A;  2IA0 A;  4AIK A;  5HDK A;  4IPA A;  1R5G A;  4IVN A;  3BJ6 A;  2H6B A;  5DUI A;  1DUX C;  2UWM A;  3KZZ A;  1IXC A;  1QBJ A;  5D4R A;  3AAF A;  2CYY A;  2G7U A;  1L0O C;  5HVQ C;  1L3L A;  4UV9 A;  4PCQ A;  1Z05 A;  1ZLJ A;  3I5U A;  4A0X A;  3G3Z A;  3HUG A;  3O6B B;  4R8H A;  4F7Z A;  2P8T A;  1RNL A;  5EEH A;  2DT5 A;  5L3E A;  1SD6 A;  1KQ0 A;  4ZYH A;  3WE3 A;  2QYO A;  1IF1 A;  1GVJ A;  4WXH A;  3U1D A;  4DQ2 A;  4WF2 A;  3RKY A;  4YFN F;  4IRG A;  4E70 A;  2XAJ A;  5LHG A;  1FT9 A;  3E6D A;  1R7J A;  4M9S A;  3FXU A;  1HKS A;  1QO0 D;  4CO8 A;  4MGR A;  3HRS A;  1BI0 A;  2K7L A;  4P9U A;  2PLY A;  3HIF A;  4AVP A;  3QPT A;  4HYE A;  1HXD A;  2HTJ A;  2FA5 A;  3PQK A;  2RN7 A;  2ELH A;  1DDN A;  4EGZ A;  1TNS A;  2LDU A;  5DV5 A;  2LKP A;  1R1V A;  1DP7 P;  4RS8 A;  3REO A;  1FP2 A;  2MD5 A;  5F64 A;  1B9M A;  4I2O A;  3KEQ A;  3FM5 A;  5FD5 A;  2K27 A;  2XUB A; 
#chains in the Genus database with same CATH topology
 4KJZ A;  2FE3 A;  3V8J A;  1PUE E;  1Z9C A;  3F21 A;  4I0B A;  2O8K A;  3I59 B;  4DGW B;  2YPR A;  2PG4 A;  3C18 A;  4IHV A;  3F0C A;  5J4V A;  2R7R A;  1FLI A;  3G1L A;  5D8L B;  2F4I A;  3M9A A;  4KN7 X;  1S72 I;  1E3O C;  2DDA A;  2K9M A;  3ELK A;  3PFI A;  1LQ1 A;  2EZH A;  2XPU A;  1IUF A;  4ENK A;  3E7L A;  4XRM A;  2EFP A;  3WTX C;  1ZGW A;  3ROU A;  4L0Z B;  2KP6 A;  1FBS A;  5GAD J;  2OQG A;  1BOB A;  4PJJ A;  2XGX A;  3FK6 A;  3RI4 A;  1IG7 A;  3JW4 A;  3DTE A;  2ECC A;  1JE8 A;  3UR3 C;  4J01 A;  1LDK B;  3DQV C;  2BZT A;  1WJ5 A;  5DD4 A;  3KZY A;  3AG1 H;  1XGS A;  3DV8 A;  3HBL A;  3Q0V A;  2HI3 A;  3FKI J;  4NDL A;  4PGH A;  5IOY A;  3HOZ J;  2R7T A;  4A3G J;  1VQM I;  2FU4 A;  5IT3 A;  4IOA F;  1TLH B;  1BN5 A;  1T98 A;  3ZQC A;  1LNW A;  3BZK A;  3CP2 A;  4AYB A;  1HBX G;  4KFC A;  5J1R A;  2R3S A;  1GVD A;  5LGT A;  3DBL B;  2DT7 B;  4XRF A;  5FKL A;  3MN2 A;  2KIQ A;  2OJE D;  1P7I A;  2FJ1 A;  1R4N B;  4HQE A;  3SQN A;  3CMY A;  5KAI C;  2OCC H;  2WB1 A;  5J4Y A;  3OR2 C;  5D5U B;  3S8P A;  1LFB A;  3OYH A;  1KON A;  3HB9 A;  5LHI A;  1UJ8 A;  3BZ6 A;  1RPW A;  1YW7 A;  1ITY A;  2DK8 A;  1IRF A;  3F9K A;  3HOV J;  1IZ1 A;  4D9J A;  3ABT A;  4U0V A;  1Z1D A;  2F5D A;  3Q0W A;  1FJL A;  2VT2 A;  2LH9 A;  1JKO C;  1B1B A;  2F5C A;  2RRE A;  2FMY A;  1F4K A;  3EUK L;  3TDU C;  1MND A;  1UAA A;  1Y1V J;  3LSK A;  1TBX A;  2FBI A;  1ZKG A;  5C4X J;  3DBR B;  1F9N A;  2JSC A;  3FHZ A;  1BJA A;  4B3A A;  1MMN A;  4YFK F;  2DA6 A;  4CZZ A;  1AOY A;  4OU0 A;  3PFY A;  4UUS A;  4FX0 A;  1IN4 A;  4UY8 I;  1WI3 A;  2DT6 A;  3LSR A;  3VEP A;  2JPC A;  2CO5 A;  2VJ4 A;  1W4M A;  3K6G A;  3TO9 A;  3LOC A;  5L3D A;  3RKQ A;  2I10 A;  3SEQ A;  1JJ6 C;  3HOY J;  3S1R J;  2L54 A;  1IRX A;  3SEZ A;  3FXL A;  4KMU X;  2WV1 A;  1DQU A;  3H35 A;  2VJ5 A;  2V1X A;  3ZCO A;  1R4M B;  2NVX J;  3QOE A;  1FWZ A;  5E3M A;  3NWS A;  4V2G A;  5HNF A;  3N05 A;  3U2R A;  3VYR B;  2WA0 A;  4CDG A;  2KRC A;  5IYC J;  2DU9 A;  2HQ5 A;  2ZME A;  2OTJ I;  2ZKZ A;  4A6E A;  3IV5 A;  4QIW N;  1V5G A;  2VJI A;  1YW8 A;  2WY8 Q;  2Y69 H;  1YO5 C;  5BOX A;  4ITV A;  2HDC A;  3S2H J;  3R6S A;  3ZQ7 A;  4IOC F;  3S1N J;  4FCY A;  3CUO A;  3JSO A;  2MAB A;  1U5T A;  4CIC A;  3DU5 A;  4RM3 A;  3K4N A;  2EBI A;  3R0J A;  1YTY A;  2VBW A;  4G6T B;  1GDT A;  2V4J C;  3H3Z A;  2F4O B;  3PIP F;  4AUX A;  3JTG A;  4U88 A;  2ESN A;  2E2H J;  2R7X A;  2DAO A;  4LG3 A;  3H36 A;  2X6Y A;  4RDU A;  1S6L A;  2W00 A;  3WTZ A;  5BPD A;  5HDG A;  2M8E A;  4ENJ A;  2M7A A;  4E7H A;  2ECB A;  1GXQ A;  3CDL A;  3DF8 A;  1MW7 A;  1U5T C;  4UB6 C;  3PIO F;  5BQT A;  3KP3 A;  5BPI A;  2NS8 A;  2W7N A;  1FSH A;  4IHW A;  1ZAO A;  1P4W A;  2DA5 A;  5TIS C;  5ILU A;  2JUG A;  3K0L A;  2OD5 A;  2JRT A;  1M1E B;  1VF9 A;  1P7J A;  2JSP A;  1HW5 A;  3JRE A;  1MNM C;  5C3E J;  3GF2 A;  5E20 A;  2QQB A;  2ZB9 A;  4DIQ A;  2E36 A;  3HSR A;  2OCE A;  3MFK A;  1XS9 A;  1VQK I;  1BW5 A;  1X2M A;  2Y0M A;  3K10 A;  2R5Z B;  2DA4 A;  1EH6 A;  2DA7 A;  3E3V A;  3SYT A;  5ICG A;  5EEA A;  2K86 A;  3P9K A;  1WHU A;  1ETV A;  1A04 A;  1RZ4 A;  2K3F A;  1APL C;  1VQP I;  2JA2 A;  5ILS A;  3GUD A;  3F8B A;  1ZGA A;  3CD6 I;  2M4G A;  2ZBK A;  2QBY A;  2AO9 A;  2LF7 A;  3HRM A;  3HTU A;  2GAU A;  3OL3 A;  2Q2E B;  3FHN A;  3L9F A;  1QZZ A;  1P4A A;  1WH5 A;  4TV7 A;  1YJW I;  1E3P A;  2O6G E;  4S0H B;  2BHZ A;  3E0J B;  3CUQ C;  3JRC A;  1RUN A;  2P0W A;  2ZME B;  4U0W A;  1NHA A;  3RZO J;  4D5C A;  1J75 A;  1IDZ A;  3KE2 A;  1I3Q J;  3I56 I;  1MMS A;  4B8X A;  2KRH A;  1JJ8 C;  4N4O B;  1D3Y A;  3FMS A;  1WKM A;  2E35 A;  3OYM A;  3J80 K;  2DMU A;  5JLW A;  3OWT A;  3CUQ B;  1XX5 A;  1ZG5 A;  3JSP A;  1YHQ I;  4NC6 A;  3CMA I;  1OCZ H;  3BQZ A;  1FEX A;  5KK1 A;  1A36 A;  2DYS H;  2EIM H;  4RB1 A;  4B48 A;  3V8K A;  3WG7 H;  4GRI A;  3WU0 A;  3ZMU A;  1WJE A;  3MZ8 A;  1U3E M;  4O3M A;  3BPX A;  3EDP A;  2E1O A;  3HDD A;  2L4A A;  2Q0O A;  4G6Q A;  5CKT A;  1B72 A;  1S9H A;  4ZH4 F;  2HR3 A;  1U8R A;  1MBE A;  1HKT A;  1N25 A;  2A5W A;  2LBF B;  1W7P A;  2EV0 A;  1OYW A;  1LVK A;  4Y4R A;  1ZR4 A;  4OMY A;  1SFO J;  2VB6 A;  2XF6 A;  1MBG A;  1V4R A;  3VYT B;  1YIO A;  3H3V K;  3J80 Z;  4PSW A;  4P96 A;  3JTH A;  4KT6 A;  1RRJ A;  2ID6 A;  2IP2 A;  1MDM A;  3H0D A;  2ME6 A;  3RKX A;  4M74 A;  2DMP A;  1IV8 A;  1QA6 A;  1ETQ A;  1ON2 A;  4RGU A;  1BI2 A;  4HDU A;  2D1V A;  2VIX A;  3K4B A;  1ON1 A;  1Y56 A;  1Z0X A;  1OMI A;  2A5Y B;  1XMA A;  2ADU A;  2H8W A;  2P7V B;  2R7O A;  5H6R A;  4DBQ A;  1O3Q A;  5AIQ A;  2V7F A;  5C4J J;  2BW3 B;  2XV4 S;  1VQ4 I;  2LBF A;  3GFJ A;  3W3C A;  4IHT A;  4QSH A;  2JA5 J;  2VOD A;  1D8K A;  3B02 A;  3I59 A;  3A01 A;  4HX4 A;  4X6A J;  5F04 A;  5F6F A;  2XB5 A;  4BY7 J;  2FSW A;  2ISZ A;  2HZD A;  3IKV A;  4KT5 C;  2H1K A;  1UEL B;  2CV0 A;  1TWA J;  2GOX B;  4II2 A;  4C30 A;  3GFI A;  2IS4 A;  1V5E A;  1X3Z B;  1BR2 A;  4RLQ A;  3GW2 A;  1T39 A;  3CO6 C;  1GHC A;  5CVU A;  3JRH A;  4RAZ A;  2MFZ A;  4HSR A;  1PJR A;  3I0T A;  3PL8 A;  4XLH A;  1I39 A;  2JT1 A;  2EB7 A;  2ZO4 A;  1N78 A;  3IUO A;  3UKG A;  3OSG A;  2V1D A;  3JRG A;  1CF7 A;  4UVB A;  2JN6 A;  4NQW A;  2GM4 A;  2G9W A;  3K1N A;  1WJF A;  5B3S H;  2ZJP F;  1ETO A;  4CCN A;  4DYR A;  4DYQ A;  2MLK A;  3SZG A;  4A3F J;  4UNO A;  4L5J A;  1ULY A;  5FRO A;  5HLT A;  3L2U A;  4J19 A;  3QRF F;  1H8A C;  2P4W A;  3FBN B;  5E1W A;  3WGH A;  3OYC A;  3U1K A;  3CES A;  3OYA A;  1FMV A;  4A0Y A;  2FBK A;  2GLO A;  1XB4 A;  2QSF X;  4IJA A;  4EJT A;  2EZI A;  3CCJ I;  5E3O A;  3GEZ A;  9ANT A;  3RQ4 A;  4RAY A;  1OKR A;  2CUJ A;  3GZN B;  1OCO H;  1YX3 A;  1TWG J;  3OMY A;  3PO3 J;  1G3T A;  4B3X A;  5K5O A;  4G9Y A;  2CFO A;  5M5Y J;  4BNC A;  3CJN A;  1MH3 A;  3J81 K;  3TP0 A;  4MEX F;  3A0B C;  3GLL A;  2BOL A;  2EQR A;  4N9H A;  4XBF A;  5GAE J;  1HA8 A;  2LP0 A;  3BR2 A;  4LK0 F;  2OA4 A;  1X1C A;  4O5V A;  2VOO A;  2Y9Y A;  1I50 J;  3C7J A;  3N4M A;  2R92 J;  3FMR A;  3MZY A;  1FBU A;  5B1A H;  2H6C A;  3OL4 A;  2QGU A;  4A3C J;  2XAQ A;  2H09 A;  4HV6 A;  2VKV A;  2OQR A;  2EWN A;  2IEK A;  1GXP A;  1EH7 A;  2EFW A;  3E6M A;  2HQN A;  3DXJ F;  3OV8 A;  3RTR A;  2BE5 F;  4XK4 A;  4M3B A;  3D5R C;  4ZYG A;  4OIO F;  1JGS A;  5GTH C;  4YEL A;  3HRU A;  4LIT A;  5IT9 Z;  3LQQ A;  4Q48 A;  3RKW A;  3LFU A;  4XIC A;  1FTT A;  1D0X A;  4LLN A;  1R23 A;  2A6E F;  3LA7 A;  1I1G A;  4HV5 A;  4CCJ A;  1AHD P;  4C2T A;  3GFM A;  3BR5 A;  4S05 A;  2QF7 A;  4OAZ A;  4HNV A;  3D5S C;  3ABM H;  5F1J A;  3M8J A;  1QPI A;  4WCG A;  3LFK A;  4LIV A;  3BT9 A;  4PUS A;  5KVR A;  3HEF A;  3MQ0 A;  1Z6R A;  3HOT A;  2P81 A;  1IN7 A;  1JHH A;  2O61 A;  2DBB A;  2BBY A;  2EIK H;  4MIM A;  3I53 A;  3HHH A;  4BJ5 C;  3BP8 A;  3HGY A;  1MBF A;  4L9N A;  2CFX A;  4CXF A;  4XKB A;  1J09 A;  4A3D J;  2LSO A;  5E1Z B;  4CYC A;  2PJR B;  4IO9 F;  3L2R A;  3DCF A;  4I6Z A;  1BR1 A;  1O7L A;  1LUJ B;  4ZDO A;  5E3L A;  3E97 A;  3ABK H;  3H5R A;  2ZME C;  4C3J J;  1HC8 A;  3JRI A;  5L3F A;  5HS7 A;  1PP8 F;  2V1N A;  2LY2 A;  5KHD A;  3WTV C;  3FXR A;  1FIA A;  2CJJ A;  2KHM A;  3KYD B;  4NBQ A;  2GXG A;  2Y31 A;  4CCM A;  1SMT A;  3C2G A;  2VPR A;  1WJD A;  2FOK A;  4D1Q A;  5HOO A;  2IGK A;  1X1B A;  4PDK A;  4BL0 B;  2HPM A;  2CW0 F;  3W6K B;  4IHY A;  2B63 J;  3LA2 A;  1B8I B;  2X6O A;  2VXD A;  2A07 F;  3A0H C;  1FY7 A;  2VKE A;  2VAS A;  2TDX A;  2PN6 A;  4C2M J;  2HVS A;  1MD0 A;  2J5P A;  5BNG A;  1STZ A;  2DA2 A;  2XB0 X;  1WZ2 A;  4MFE A;  3Q5F A;  1UHS A;  2O7O A;  2M4K A;  4BQN A;  4BUP A;  5IP9 J;  3S3M A;  5DUK A;  1SD7 A;  4CSW A;  1OYY A;  1P9Q C;  2W84 A;  3GVA A;  2LFB A;  4GGG A;  4KIG A;  1YJ9 I;  4ABZ A;  2VKH A;  3B6A A;  4I76 A;  5DYM A;  3FDY A;  1WGX A;  3FIW A;  4BHB A;  4XQF A;  1XSX A;  3PNT A;  1JUS A;  2IA2 A;  3PSI A;  2LKS A;  1FPQ A;  1Y8R B;  1HDP A;  1BW6 A;  2QLZ A;  3BQY A;  1GV2 A;  4B44 A;  1BIA A;  3GZ5 A;  3IWZ A;  3BCA A;  1VQL I;  2QSG X;  2E34 A;  4XNF A;  1SMY F;  5BS6 A;  2DMT A;  1YRN A;  2AXL A;  3LSG A;  1NG6 A;  2R7S A;  2GA2 A;  1MMD A;  1QU3 A;  2OBP A;  4HG2 A;  3GTJ J;  1FNN A;  2WC2 A;  5K5Q A;  5LHH A;  5ILV A;  2XF5 A;  4IZZ A;  4JX5 A;  2COB A;  3TDZ C;  1O7F A;  1LDJ A;  1OR7 C;  5JR3 A;  3BWG A;  2PMU A;  4GO1 A;  4UHT A;  5HS9 A;  2XSD C;  2HXO A;  1UG0 A;  3CJT B;  4CHU A;  1RR8 C;  4D7N A;  4CH7 A;  3TMO A;  4D5F A;  1LKX A;  3CZ6 A;  3C1D A;  4R79 A;  2CQN A;  2L7F P;  5D6E A;  4A5N A;  3HC7 A;  4BBR J;  3S1Q J;  2LTP A;  2W57 A;  3KCC A;  3M1C A;  4KUM A;  4RA2 A;  3WU1 B;  3CF2 A;  5DCM B;  3S93 A;  2OUM A;  4HQM A;  2E1M B;  3ASO H;  4NB5 A;  4KDP A;  3JAM Z;  2CQX A;  3PUF A;  2ETH A;  4UUT A;  4Q4Z F;  3G73 A;  3M8E A;  3J7Y J;  2RNG A;  1JI8 A;  2VQH A;  1EH8 A;  2IVM A;  3Q9S A;  1K79 A;  2TRT A;  2L9N A;  4XL9 A;  2NNY A;  2YU3 A;  2A61 A;  3T1B A;  2QKM B;  2P5L C;  3R0A A;  1G4D A;  4B43 A;  4JBA A;  3EET A;  2BXZ A;  2JJ7 A;  3H92 A;  4LLG F;  4U7D A;  3WTY C;  1EJ9 A;  4DBR A;  4UUS B;  2DFF A;  3AKZ A;  2XGC A;  1YS6 A;  3CCE I;  2HQR A;  4XON A;  4NHJ A;  1Q1H A;  2L9V A;  2RNJ A;  2MH9 A;  2L02 A;  5AIP A;  1B59 A;  3G1M A;  3K70 C;  4BE2 A;  3U9G A;  1ZRE A;  2VUM J;  4HA8 A;  4UXN A;  3L00 A;  2HPI A;  3BR6 A;  3CCV I;  3HSE A;  4Z6Y A;  5CQG A;  3W6V A;  2JWT A;  2K4B A;  1ACI A;  1PVE A;  4CGZ A;  3RIR A;  2M9H A;  4OAY A;  4L5E A;  1XC5 A;  1Z7U A;  2V79 A;  2OPT A;  1NK3 P;  1UMQ A;  5FFX A;  3BLY A;  4ZDL A;  3FF5 A;  3H3U A;  3MZH A;  3CC4 I;  1R36 A;  4JQF A;  1ERD A;  4Q47 A;  2LD5 A;  1MJA A;  1S29 A;  3L7W A;  3I4N J;  1QGP A;  5FLV A;  1W7P D;  3BJO A;  1IO2 A;  4ZC3 A;  4M6V A;  2QEX I;  4IXA A;  5EZG A;  4PJN A;  1J9I A;  3MMY B;  1BR4 A;  2Y75 A;  2IGM A;  3E6C C;  3CCY A;  1BIB A;  1GT0 C;  4B1R A;  1BJZ A;  2M30 A;  1IAW A;  3DPL C;  3ECH A;  2BY1 A;  1FSE A;  1XMK A;  3VSK A;  5LGN A;  2M45 A;  3KIO A;  1R1U A;  2OC6 A;  3OYJ A;  2B7E A;  2KLO A;  3KP5 A;  1FOK A;  2FOW A;  4LG0 A;  3H9J A;  4AWX B;  1K6O A;  5EJC A;  4DW6 A;  3VYU B;  2EFN A;  4XLN F;  4AD9 A;  5JFR A;  2ZJ2 A;  1JKP C;  1RKT A;  2OV7 A;  4FT8 A;  1KU7 A;  3CC2 I;  2M1B A;  2GIZ A;  3E5U A;  4BXF A;  1Y39 A;  2DYR H;  2VXZ A;  1R6R A;  4RB0 A;  5L3G A;  4L5I A;  1Q1V A;  1SFK A;  3ABU A;  1R5H A;  1HQC A;  2GXA A;  4KIT B;  3PQJ A;  1JKQ C;  3SHF A;  1TW3 A;  4RMN A;  4ENM A;  4LJZ F;  4M3G A;  2X0L A;  2XRO A;  1C0W A;  2R0Q C;  1YOV B;  1F1Z A;  3F8F A;  3H9Q A;  2Q8K A;  5BMZ A;  5FKM A;  4ZDP A;  2R7W A;  2HKX A;  4HPQ A;  3BY6 A;  3O2P E;  5K7F A;  4MQV A;  4XN3 A;  3FWE A;  2HYJ A;  5HLG A;  2FXA A;  5DDG A;  4C9Y A;  5F0H A;  1UG2 A;  4LB5 A;  2ZXH A;  2XGE A;  3FXM A;  2XPV A;  5FRN A;  1MBH A;  3LMM A;  3FXJ A;  1LJ9 A;  4W1U A;  2KDZ A;  1F5T A;  2X4H A;  5A2Q Z;  2HOT A;  1SC7 A;  4YII A;  3JRA A;  3RDI A;  5M5W J;  3S1M J;  5K7H A;  1H89 C;  1F43 A;  1S7A A;  2HYF A;  2DPU A;  2LNB A;  1Z77 A;  3BTJ A;  3IC7 A;  1X3W B;  1PP7 U;  1I1S A;  2HZT A;  4EVI A;  3RPU D;  3RJP A;  1OCT C;  2XHK A;  2F5V A;  2IGN A;  2F5E A;  2JVG A;  1R58 A;  3PNV A;  1IN5 A;  4GYG A;  3T8R A;  4X0G A;  1O57 A;  1WPK A;  4V19 K;  2VN2 A;  4HLY A;  3BJA A;  1IN8 A;  4M72 A;  3DEW A;  4LK1 F;  3TGN A;  4KIS A;  1RI7 A;  3CF5 F;  1FYM A;  3O3K A;  1MSF C;  5ICF A;  4OMZ A;  2RDP A;  4BXX J;  3B6C A;  1SFX A;  2FEZ A;  2LR8 A;  2OZU A;  3NRV A;  4BYY A;  2VJJ A;  3SDG A;  3IP4 B;  3OIP A;  4ZJZ A;  5J8C A;  5FLM J;  1BI1 A;  3SFZ A;  3CUQ A;  1OR7 A;  3IRR A;  4KA4 A;  4BJT A;  2K40 A;  1RUO A;  5GP9 A;  5FD6 A;  4A6D A;  1J5Y A;  3KEO A;  4ZYA A;  1AKH B;  4M73 A;  3DPT A;  3S15 J;  1P6R A;  4KN4 X;  3CCL I;  3OOP A;  3BG3 A;  3VSL A;  4BHP A;  4MLO A;  3K1M A;  2BV6 A;  2K02 A;  1D5V A;  3AFH A;  2CUF A;  4CA0 A;  3BR0 A;  2GQQ A;  1RES A;  2MYS A;  1PYV A;  1ZTR A;  1TWC J;  2HDW A;  3BTL A;  1XSD A;  2DOD A;  3KP4 A;  2OTL I;  2R7U A;  2XAS A;  1YYV A;  2OU2 A;  4XOT A;  3K4M A;  3TED A;  4I99 C;  4MEY F;  3K1P A;  1AU7 A;  4Q5S F;  2STW A;  1GUU A;  4G7H F;  2LOO A;  3BPV A;  3PUB A;  5JHF A;  1KGS A;  2D1H A;  5CVV A;  2CUE A;  4RM2 A;  3L2W A;  3F6V A;  1AKH A;  5JVT A;  4OIP F;  3WHC A;  2VQL A;  2E1N A;  1SAX A;  2AQE A;  1PUF A;  1R49 A;  4HF0 A;  4WXC A;  5CVI A;  4C3I J;  3TW6 A;  2N8G A;  3KET A;  5H6Q A;  4OOI A;  1FBQ A;  3HOS A;  2MA3 A;  3L2C A;  2XAG A;  3TQN A;  1FC3 A;  5K5R A;  4JYK A;  2HVR A;  5IT9 K;  3E5Q A;  3LL7 A;  2L9S A;  4ZYD A;  3A01 B;  1X4P A;  2DOE A;  4BH9 A;  2LG4 A;  4UV8 A;  1VTN C;  2ZNY A;  1WFX A;  2V26 A;  3OS1 A;  2G0E A;  2L01 A;  3MAJ A;  5KAF C;  2HOA A;  2P7C B;  4G8X A;  1QZY A;  3K2A A;  3KFW X;  1X1D A;  2JA8 J;  1VQ7 I;  1IXR C;  2CW8 A;  3QYF A;  1MJ9 A;  3G1O A;  3CCQ I;  4X1E A;  4HW0 A;  3WGI A;  5IP7 J;  2Y2Z A;  2VQG A;  3U21 A;  4CZC A;  2GZW A;  2VBX A;  2LKX A;  4P9F A;  1JT6 A;  5EG0 A;  3ZMT A;  4FHT A;  1G8X A;  2KL4 A;  2QSH X;  2AXT C;  2R93 J;  2E1C A;  3BR1 A;  3WOD F;  2M7B A;  4M71 A;  1ZYR F;  2HXI A;  1FMW A;  2VI6 A;  3EPZ A;  2DJN A;  2HVQ A;  1YIT I;  1T0F A;  2O9L A;  2KKO A;  4BAC A;  1H9T A;  1ZRF A;  2P6T A;  5EGO B;  1IC8 A;  1G6N A;  2BXY A;  2RGV A;  2V9V A;  1MJB A;  2G7H A;  4IHX A;  3PO2 J;  4I7H A;  3HHG A;  5D4S A;  4WX9 A;  3TOA A;  1IRG A;  2DJI A;  1OYI A;  2DI3 A;  4IL6 C;  3DBH B;  2A3S A;  4I98 B;  1ODD A;  4FE4 A;  1V55 H;  5IY5 H;  4L18 B;  4BQA A;  1VZ0 A;  1I27 A;  1VQO I;  1MKM A;  2X6X A;  4HX7 A;  1D5Y A;  3C3W A;  1QPM A;  5DM6 F;  2E2I J;  2M0C A;  1TQI A;  5J8F A;  1ZK8 A;  1JUM A;  5FO5 A;  1B9N A;  1POG A;  3VB2 A;  3DP7 A;  3IWF A;  5EDN A;  2DO7 A;  2AHQ A;  2VKD A;  3GX4 X;  3DFG A;  4BJ6 C;  4H4K C;  3F22 A;  4IRI A;  1JHF A;  1BM9 A;  2CMP A;  1HKQ A;  4MHG A;  1N75 A;  4PJM A;  1X58 A;  1ETX A;  1BC7 C;  4RGS A;  2PEX A;  3I55 I;  2E5Z A;  1S5L C;  3FMQ A;  5DEQ A;  4ZZD A;  2DCE A;  4H0E A;  2KMU A;  2MSY A;  5HOD A;  4HF2 A;  3GTO J;  5K1Y A;  3M1E A;  4LLL A;  2EK5 A;  3IRQ A;  1ONV A;  3AL0 B;  4AM3 A;  5F27 A;  4OWR B;  5GPA A;  5LLQ A;  1U9N A;  1HF0 A;  3R4K A;  3CMM A;  1T8I A;  1D0Z A;  2VE9 A;  3FM3 A;  4IQ4 A;  4HDV A;  1E17 A;  2XRL A;  4FIS A;  1VFC A;  1XSV A;  5HLH A;  5TGT A;  1DGW Y;  3PM1 A;  2JQ7 A;  3HGG A;  4E4H A;  2R7D A;  3RYR A;  2DFE A;  3TP3 A;  3F23 A;  1VQN I;  2OF7 A;  2NVY J;  1AWC A;  3HXL A;  2HDD A;  2PJR A;  4WK8 F;  1YIJ I;  3DKX A;  2IW5 A;  3QQA A;  1R5I D;  4A12 A;  4NUB A;  3RYP A;  3ZPL A;  3GTM J;  2Z16 A;  1IN6 A;  3A02 A;  2QVO A;  1SAN A;  2QA4 I;  3S3N A;  3I4M J;  1I6X A;  4XLP F;  3L2Q A;  2JPB A;  2LY9 A;  1KQ9 A;  4N0B A;  3M8F A;  2BGC A;  3EUH C;  1ZLK A;  3TW7 A;  1Z7L A;  4JX4 A;  1YFH A;  4YG2 F;  4RGR A;  3VPR A;  5DM7 F;  1J0R A;  1K6Y A;  2IRF G;  4I02 A;  3IL2 A;  3QU6 A;  3ZXS A;  2H8R A;  1Y6I A;  3QAH A;  4A5M A;  3OYE A;  2H94 A;  2D5V A;  4EJO A;  3AG2 H;  3DTI A;  1LE8 A;  2YU9 J;  3HOU J;  1NG7 A;  3W6J B;  3OYB A;  3KYL A;  1Z91 A;  2IPQ X;  2XGD A;  2V1U A;  1G3Y A;  2VBZ A;  3BG7 A;  3EQL F;  4D0P A;  1MIJ A;  4QTR A;  4ETS A;  5J40 A;  4KIB A;  4LB6 B;  1P4X A;  1QHG A;  2ICW G;  3K4L A;  4L0Y B;  2NRA C;  2Q1Z B;  1T08 B;  2F48 A;  1FZP B;  1XGN A;  3Q9V A;  3D0S A;  3HKZ A;  1V3F A;  4BQO A;  3LSH A;  2DFI A;  3JR9 A;  3A03 A;  1W36 C;  2DN0 A;  2CUZ A;  3WE2 A;  4HNU A;  2KT0 A;  1YJN I;  5LFA A;  2K9L A;  4Z2Y A;  1BBY A;  3FKJ A;  4IEJ A;  4PFP A;  1A31 A;  1X4O A;  2ME0 A;  2I5U A;  4UUV A;  3ZMZ A;  3ZR8 X;  3T0Y A;  2VT3 A;  5GPC A;  4IKF A;  4HZF A;  4XLF A;  2RQQ A;  3DEE A;  1SFE A;  3HG9 A;  1NK2 P;  1MNE A;  2K9Q A;  4Y7N J;  1ZHF A;  3P9I A;  4G7O F;  1ZG3 A;  2EFO A;  1I5Z A;  2D45 A;  3ISP A;  1LDD A;  1O3T A;  1HST A;  4E7J A;  2L2O A;  5IP6 A;  1QRY A;  1EA3 A;  4HST A;  1FTZ A;  1XTA A;  1K78 A;  2XKO A;  3ZGK A;  3WTS C;  3HOW J;  2Y0S N;  4PK4 A;  3RZD J;  3IAM 2;  2TCT A;  1FIP A;  3QPS A;  3LNQ A;  4ZTF A;  1W1W E;  2R7Q A;  3A1Y A;  1O4X A;  1OCR H;  2FD5 A;  2HTS A;  4P5O A;  3J7Z I;  1YS7 A;  2F4M B;  1W5S A;  2HOS A;  1WQ2 A;  4BBS J;  3F8M A;  5L3C A;  2JVH A;  4FTH A;  4LIU A;  4YIR X;  2P5V A;  3HM5 A;  5FKO A;  3RCO A;  1QQI A;  3BG5 A;  2Y9Z A;  3KZI C;  4BEH B;  3PJR A;  4YEJ A;  4GFB A;  3ERM A;  3OR1 C;  4L9T A;  4IRH A;  4ZZL A;  5F0F A;  4CYC B;  3F6O A;  2E5N A;  3O8H A;  3IH4 A;  3RQI A;  5JI6 A;  2XDV A;  2IA1 A;  3ECO A;  3I54 A;  3BZC A;  1K78 B;  2VC0 A;  2ZJQ F;  1FYL A;  1G59 A;  5IOZ A;  3P9C A;  5E1X A;  2L9R A;  2P6S A;  1HDD C;  3GZ6 A;  2COM A;  3S2W A;  4F3Q A;  3ZQF A;  2NOG A;  1B4A A;  5KCM A;  4L9J A;  1R1T A;  1JGG A;  3KP2 A;  4EQQ A;  3F8C A;  2PBI A;  4LD5 A;  1A6Q A;  3EUH A;  1OQY A;  3CDH A;  2DQR A;  3MD2 A;  5E8I A;  4EGY A;  2JA7 J;  2NVQ J;  2GA1 A;  2UXX A;  3CDI A;  3CLO A;  3LSP A;  4PFO A;  3WGG A;  1KYZ A;  3I3L A;  2HFH A;  1S8N A;  2YR2 A;  4HOB A;  4M9Z A;  4JOM A;  1SVL A;  4BE1 A;  2GIV A;  3WHB A;  2AS5 F;  3GFL A;  1FOW A;  3GCM A;  3GME A;  4KNY A;  2WV0 A;  5FLX K;  3IHU A;  3VOE A;  3RPQ A;  3K4K A;  5C44 J;  2W48 A;  5F0C A;  2WTE A;  2UUZ A;  4MQ9 F;  5ICC A;  1UCR A;  1USS A;  2DA1 A;  2VLA A;  4YRV A;  3LST A;  2NS0 A;  4N9I A;  4XN0 A;  4A3M J;  1VND A;  4AID A;  2XSJ C;  3TBI A;  3V4G A;  4RBO A;  1B6A A;  5CLS A;  2E7X A;  2KFD A;  3BRO A;  4DNC A;  1YRN B;  4EJV A;  3SJM A;  2VON A;  1X1P A;  3PNY A;  3ERE D;  1ETY A;  2BYV E;  5EG0 B;  2KRF A;  2HEO A;  2YX4 A;  3I9V 2;  3P5J A;  1QHH D;  2Z99 A;  3MCZ A;  2MLG A;  2IT0 A;  2LMD A;  5JHU A;  4IQJ A;  2E19 A;  3HTS B;  5FRM A;  2WAE A;  3ZQQ A;  3K9T A;  2DFH A;  2RV8 A;  3C2B A;  1KU9 A;  4EJW A;  3H0G J;  3NWT A;  2VOP A;  1J2X A;  2L7K A;  4II3 A;  4AIJ A;  2UZK A;  3KPH A;  1G3W A;  1JXS A;  4M6X A;  1KU2 A;  3ZMD A;  3KEY A;  2L5Q A;  5B5E C;  4BEH A;  5FFZ A;  4V2F A;  5B66 C;  4XID A;  1CF7 B;  2PX9 A;  2BY0 A;  2IS2 A;  4XOP A;  1ZQ3 P;  1K4S A;  2R5Y A;  2XKP A;  5EEG A;  1E2X A;  1UFM A;  3QU3 A;  4Y15 A;  3SZP A;  1VQ6 I;  4HLX A;  2E71 A;  4A3I J;  1TNT A;  2IXS A;  3TO6 A;  2YS9 A;  1JUP A;  3VWB A;  1OPC A;  3L2V A;  1Z6T A;  2EFQ A;  1P92 A;  2Y48 A;  4XMY A;  3TO7 A;  3DLL F;  2W24 A;  2KJB A;  1TL8 A;  2DTZ A;  2LYC A;  3ML6 A;  1R22 A;  2ZXW H;  5J6X A;  2CRG A;  1QZE A;  1MZB A;  2EV5 A;  5FJ8 J;  1UHW A;  4YFX F;  1FOY A;  3FBI B;  2QQA A;  4EMS A;  2A68 F;  3IH3 A;  1UB9 A;  2V6C A;  1SFU A;  3SZT A;  5IPA A;  1K61 A;  3AG4 H;  1I3A A;  2CSO A;  3C2H A;  3MEX A;  1LEA A;  5M5X J;  1DU6 A;  1W5C C;  1TW2 A;  2VQC A;  2Y30 A;  4U0Y A;  1I6H J;  2BW3 A;  2XIG A;  1T0F C;  5CJ9 A;  4UVC A;  3OYD A;  2CV1 A;  3CJR B;  4AVZ A;  3DPU A;  1H9G A;  2LY1 A;  5D5V B;  3JAM K;  1HW1 A;  3LAJ A;  1WJA A;  3FXO A;  2PMZ N;  1U9O A;  3P7N A;  5HNH A;  2LLK A;  3KP6 A;  1QVT A;  3L09 A;  2BEO A;  2HKO A;  1YI2 I;  1ZN2 A;  3DTK A;  2M0M A;  1ZG1 A;  1HW2 A;  4BHC A;  3S32 A;  2QKL B;  4BXU A;  2STT A;  1DP3 A;  3ZMS A;  4MTD A;  4F55 A;  4DZP A;  3G71 I;  2JUC A;  1J7K A;  3GWZ A;  3ZQI A;  2CH0 A;  3NEU A;  4F52 A;  1AA7 A;  4LOC A;  2WAD A;  4Y33 A;  1WI9 A;  2K4J A;  1TQP A;  3LSI A;  1H88 C;  3NAR A;  4HF1 A;  2B0L A;  5CYV A;  3OOU A;  4M3D A;  1TP4 A;  1E0E A;  5DD8 A;  4BAY A;  5L3B A;  3CP8 A;  2K5C A;  4HAM A;  4FET A;  4IF4 A;  3R61 A;  2ZXJ A;  2KIS A;  1IXS B;  4XRS G;  2KIU A;  4GCV A;  2F6C A;  1WJC A;  4B47 A;  1D1A A;  1YQA A;  4NC7 A;  2M87 A;  3W2V A;  3IKT A;  1Z67 A;  3BG9 A;  3ZN1 A;  3AL0 C;  4ESF A;  1ETK A;  3QYE A;  4FX4 A;  1SEU A;  4AIH A;  3UNG C;  3GTG J;  1KU3 A;  1TZL A;  2KZV A;  3HPH A;  3NQO A;  5TRD A;  3GYH X;  4EAT A;  5LEK A;  3M3Y J;  2O3F A;  5HDN A;  1XCV A;  5EGO A;  3E5X A;  3V7C A;  4E6K G;  4AYB N;  1PDN C;  1HSJ A;  4G7Z F;  1GLN A;  2GOM A;  3DEU A;  4E7L A;  4XM3 A;  1KYW A;  2K9S A;  1SD4 A;  4KIC A;  2H27 A;  2A05 A;  1FP1 D;  3CCM I;  3S2D J;  2MGQ A;  3FXQ A;  5F1R A;  2X1D A;  3ABL H;  5CVR A;  4BGD A;  1TWH J;  4NQW B;  3ZQG A;  2M5W A;  1U2W A;  1WWX A;  1NTC A;  4XSX F;  1UST A;  2M2E A;  2ELJ A;  3W2A A;  2JK3 A;  1BI3 A;  1KA8 A;  2DQL A;  3K70 D;  2DOF A;  4AU7 A;  4ON0 A;  5D5W B;  4J00 A;  5E8G A;  4RB2 C;  2L4M A;  1MH4 A;  5HLI A;  5CQE A;  3Q3S A;  3M4O J;  4D7M A;  2PQ8 A;  3BCB A;  1XPX A;  4LFU A;  4L9V A;  3E1S A;  2QM3 A;  2MBF A;  3IH2 A;  4ESB A;  2NS7 A;  3CQZ J;  2DTR A;  5E18 F;  3HKZ N;  3V8L A;  3FIS A;  1D0Y A;  1ZRC A;  1MDM B;  2MG4 A;  4I09 A;  3GBG A;  4M6Y A;  3WG9 A;  4ESJ A;  4KIF A;  5A2Q K;  3V7R A;  2KIF A;  2BVL A;  1YX5 A;  2FUG 2;  2JA6 J;  1E3H A;  1S7O A;  4Y52 J;  4HX8 A;  1XD7 A;  4F93 B;  1MSE C;  4A2U A;  2WB1 N;  3CTA A;  1Y8Q B;  4XLE A;  1YG2 A;  1WJB A;  1TTY A;  2EV6 A;  3KX2 A;  4G94 A;  4ASN A;  4B09 A;  2QUF A;  3BTI A;  4RAG A;  4HRI A;  1V54 H;  2JRM A;  1OCP A;  4JX6 A;  4RB3 C;  2KZG A;  4BS9 A;  2ESH A;  1A6I A;  2K85 A;  1HCR A;  3HL2 A;  3CLQ A;  1B8I A;  2L3D A;  1IW7 F;  1K7A A;  1VI0 A;  4RGX A;  2CWE A;  4ZYE A;  3OYG A;  1IUY A;  4XKV A;  4M3F A;  2A69 F;  2F2E A;  2CGP A;  3H1C A;  2H1L A;  2X9D A;  6PAX A;  2FNA A;  2XAF A;  2WWY A;  5ERI A;  5LRS A;  4EJU A;  4ANJ A;  3LA3 A;  2UV1 A;  3BOQ A;  2HQA A;  4EM2 A;  5M3M J;  5KNL A;  2O0Y A;  3BDD A;  2NVT J;  3HSF A;  4XLC A;  2QQ8 A;  3EYY A;  3I4P A;  2VBY A;  3BTC A;  5IYD J;  1GV5 A;  2NNN A;  1XMX A;  4XLA A;  1TT5 B;  3TKY A;  3VFZ A;  2ELK A;  3HPG A;  3M7G A;  1ZRD A;  5K7Z A;  2CQQ A;  4PGG A;  5EZH A;  4A3B J;  4PSX A;  2R7F A;  3WU2 C;  1SD5 A;  5H2F C;  1IV6 A;  4W97 A;  4MNU A;  4NNJ A;  1LFU P;  1WH7 A;  2GXB A;  4P55 A;  1ENH A;  2W25 A;  1V5F A;  2AQF A;  3OYL A;  2EZL A;  3T8T A;  3GLX A;  3PSF A;  1EV7 A;  5FB2 A;  5F08 A;  4BY1 J;  3HYI A;  3JRF A;  4HBL A;  1BC8 C;  3BC8 A;  1Y0N A;  1U78 A;  3OIQ A;  3G6E I;  3CCR I;  2NVU B;  4B4C A;  1FYK A;  3ONQ A;  2X1C A;  2O03 A;  2A6H F;  2HWV A;  3GXO A;  2LF8 A;  4LMY A;  4F91 B;  3ZQH A;  1P2F A;  2XVC A;  1Y1W J;  2O5R A;  2WAQ N;  3H5A A;  1Z21 A;  4MFD A;  1YW9 A;  1G3S A;  3IAS 2;  4WXD A;  1DPU A;  2P5K A;  2WAF A;  3DKW A;  1X3U A;  4GYI A;  2LRD A;  2B9S A;  3CJQ B;  1Y0U A;  4BQQ A;  3GTP J;  1XGM A;  5ICE A;  1DPR A;  3J7A O;  4R1H A;  4FAS D;  2DMN A;  4AC0 A;  5HS8 A;  1DGR M;  2PI0 A;  3CC7 I;  4M9X A;  4OIR F;  3J81 Z;  3W2W A;  4A3L J;  3MWM A;  2DW4 A;  2NYX A;  3L1P A;  4U87 A;  2HOE A;  2BY3 A;  3ZRG A;  4G6D A;  4BDZ A;  4GDF A;  2RAE A;  5D5X B;  5GTI C;  4EM1 A;  1K4T A;  2DXI A;  2QEN A;  4ENN A;  2Z3Y A;  2EIN H;  1LVA A;  2X48 A;  3FXK A;  4LGW A;  1RIO H;  3S16 J;  4A3E J;  3VDX A;  5E17 F;  1X19 A;  2C6Y A;  4MTE A;  1G2H A;  2VL8 A;  5B1B H;  2X6W A;  3B73 A;  2LVS A;  1T6S A;  4EV0 A;  2A6T A;  3GTK J;  3FZV A;  3I71 A;  2M8G X;  4O6J A;  1A5J A;  5D6F A;  3ZP5 A;  4IHS A;  1BA5 A;  2E7W A;  3LQR A;  2BHY A;  4KYW A;  4JP0 A;  1ZGJ A;  5IYB J;  3T5X A;  3EYI A;  2O8X A;  4OIN F;  4I01 A;  3V42 A;  2MH2 A;  1YE9 A;  4XRS A;  3OSF A;  1W0U A;  2YSR A;  3DWL E;  1HLV A;  4QWQ A;  1BL0 A;  4Y13 A;  1X1A A;  3LWF A;  3QOD A;  1SVO A;  1T38 A;  3K69 A;  2MD0 A;  3QOP A;  1XGO A;  3RSN A;  3OYF A;  1R00 A;  1T95 A;  1ZR2 A;  2CU7 A;  1REP C;  4E7I A;  4XKW A;  3JCU C;  4BKX A;  3JRD A;  3KLO A;  1TQM A;  1JKR C;  3LAP A;  5FKN A;  4KMF A;  5D8K B;  3K2Z A;  3F8N A;  3Q0U A;  4UB8 C;  4QPO A;  1ZEL A;  1T56 A;  2GWR A;  1XDU A;  3QPH A;  1QNT A;  4Y3O A;  5J47 A;  5LGU A;  2FML A;  3D1N I;  1W7P B;  3FX3 A;  3CME I;  2GBY A;  2MC3 A;  2CQK A;  3MVP A;  1DU0 A;  2W1O A;  2V9P A;  2XAH A;  4Y17 A;  3H5N A;  1HOM A;  2E60 A;  2V9K A;  2VC1 A;  4HEA 2;  2LK2 A;  4EM0 B;  4NC8 A;  4UVA A;  4A3K J;  5M3F J;  2PMH A;  4QLC U;  2BY2 A;  5JVG F;  2HGC A;  1CGP A;  1VQ5 I;  3S17 J;  3QP5 A;  2KJC A;  3KP7 A;  1VQ9 I;  1YLF A;  4M3E A;  2CW7 A;  1U5T B;  2QQ9 A;  2YUS A;  5DCF A;  2CG4 A;  2EPF A;  1O3R A;  2JZY A;  1WVR A;  1F36 A;  1H0M A;  2DK5 A;  4E7S A;  2BVM A;  1T2K A;  3JRB A;  3I58 A;  2DDB A;  1U8B A;  1MMG A;  1LFP A;  2DMQ A;  1LEB A;  4FE7 A;  2YX7 A;  4OIQ F;  1K83 J;  2IAI A;  2IBD A;  3WTU C;  1ZH5 A;  3CCU I;  1SVM A;  2ZSH B;  3ZN0 A;  1LE8 B;  2KIM A;  1RET A;  2EJR A;  1EKE A;  2PFB A;  2ZNZ A;  1CQT A;  1IRZ A;  5GAH J;  3MKZ A;  2Z1D A;  2FBH A;  5LEJ A;  3OS2 A;  3ESW B;  5DCM A;  2UXN A;  3K7A J;  2RKH A;  3BG6 A;  4A3J J;  2VPL A;  2DA3 A;  5GAG J;  5ED4 A;  4PZJ A;  2M3A A;  4CCK A;  2FF4 A;  1S7E A;  3A2K A;  1VQ8 I;  3MKW B;  4GXO A;  5FLX Z;  1FX7 A;  3BR3 A;  4RAF A;  1A35 A;  5JLX A;  4LG0 B;  3V7S A;  1D8J A;  2VE8 A;  1MBJ A;  2QBY B;  3ULQ B;  2FRH A;  4F92 B;  3OYK A;  3CO7 C;  2J5O A;  4U7B A;  3KLN A;  3AG3 H;  2X1E A;  4P1W A;  5AON A;  2QZ8 A;  4N4N B;  4A69 C;  5FKK A;  3D5L A;  5LBQ A;  1XCB A;  4WWC A;  3OS0 A;  2RC4 A;  2EA4 A;  3CCS I;  2ZFW A;  1S3J A;  4FQG A;  2HNH A;  1MMA A;  1OFC X;  2ID3 A;  2K9N A;  2QCO A;  2R5Y B;  2IJL A;  2NXN B;  4K2E A;  4HNT A;  1LB2 A;  1O3S A;  3VYS B;  4I0A A;  1JTX A;  2EA2 A;  1N77 A;  2EIJ H;  2Q2E A;  2Z5U A;  3R60 A;  1J59 A;  3WTT C;  1Z3Y A;  2XPW A;  4EEF G;  2XC7 A;  3MKL A;  2NAZ A;  1RKW A;  2RQP A;  1WSU A;  4IX7 A;  2W85 A;  2WAQ A;  2MC4 A;  3I64 A;  4E7K A;  3K4C A;  3LSJ A;  2F5F A;  3DU6 A;  4C3H J;  1MGT A;  5H20 A;  4S04 A;  2JMW A;  2L7Z A;  3COA C;  2W82 A;  1IJW C;  5LRR A;  2JTV A;  2KPM A;  4A0Z A;  3KYC B;  1W5T A;  4CCO A;  2DPD A;  4XSZ F;  3S14 J;  2D2W A;  2ZCW A;  1XDS A;  2I8D A;  3FK7 A;  4QPQ A;  1UHM A;  2IGO A;  3HRT A;  5DS9 A;  1U6G A;  2FQ3 A;  2Z9O A;  2OZ6 A;  2QWW A;  3QP6 A;  4MO7 A;  5DTD A;  1XN7 A;  2RVC A;  3F72 A;  5FGM A;  1RC9 A;  4CYD A;  3E6B A;  4YIF A;  4DYC A;  3OIO A;  4RLF A;  1KQ8 A;  1PUF B;  2X51 A;  4BU2 A;  2NOJ B;  1JTY A;  3TOB A;  1R71 A;  2E2J J;  3VOD A;  3ZMV A;  3DKY A;  3G4S I;  2DLL A;  2XRN A;  5J1Y A;  1OJL A;  4DJA A;  1B72 B;  2FNP A;  1IDY A;  1OLT A;  2R7V A;  3SXY A;  2R4G A;  2HS5 A;  2ACJ A;  2PJP A;  1MBK A;  2OAZ A;  3MKY B;  1ZAR A;  2WBM A;  3GO5 A;  2Z33 A;  2XAU A;  5LD2 C;  2V6E A;  2L7M P;  2HYG D;  2FQ4 A;  4JK1 X;  1WRJ A;  3N97 A;  1BOA A;  5TJJ A;  5CVJ A;  3F3X A;  3GTL J;  1D1B A;  2DOA A;  3O8G A;  1XG1 A;  3WTW C;  3HOX J;  2ZJR F;  3RPU A;  4E7Z A;  2ISY A;  2IA0 A;  4BE0 A;  3G2B A;  4AIK A;  5HDK A;  4IPA A;  1R5G A;  1IGN A;  4IVN A;  3BJ6 A;  3GTQ J;  2H6B A;  3K4J A;  3X2Q H;  5DUI A;  3HZJ A;  2IS1 A;  1DUX C;  1ETW A;  1T33 A;  2UWM A;  2Y0S A;  3KZZ A;  1IXC A;  3QWL A;  5EF6 A;  1QBJ A;  5D4R A;  1TC3 C;  3AAF A;  2CYY A;  3ZOB A;  3DLA A;  3TL4 X;  2CV2 A;  2G7U A;  1L0O C;  3A4C A;  5HVQ C;  2FX0 A;  1L3L A;  4UV9 A;  2ZSI B;  1FOX A;  3HJE A;  4PCQ A;  2CS3 A;  2IS6 A;  1Z05 A;  2R5Z A;  1EF4 A;  1ZLJ A;  1OCC H;  3QPL A;  2X85 A;  3H9G A;  3I5U A;  1U0J A;  1UZC A;  4A0X A;  3G3Z A;  2L0K A;  2EZK A;  3HUG A;  3O6B B;  2XF7 A;  4G12 A;  4R8H A;  4F7Z A;  2P8T A;  1RNL A;  5EEH A;  2DT5 A;  5L3E A;  1SD6 A;  2Z2S B;  4A93 J;  1KQ0 A;  4XOR A;  3OY9 A;  3QYB A;  4ZYH A;  3WE3 A;  2QYO A;  1IF1 A;  3OYN A;  1D1C A;  4ZTJ A;  5J3L A;  2M34 A;  1GVJ A;  2MW8 A;  4WXH A;  3LSM A;  5CPR B;  3U1D A;  2HU9 A;  1RR7 A;  2WY7 Q;  4XR6 A;  4WF2 A;  4DQ2 A;  3RKY A;  2E1M C;  4YFN F;  4IRG A;  1JT0 A;  4BDY A;  4E70 A;  2XAJ A;  5LHG A;  1QVU A;  1FT9 A;  3E6D A;  3M07 A;  4DOZ A;  4DZJ A;  1TWF J;  1R7J A;  4PJ0 C;  3HUG B;  4M9S A;  3FXU A;  2ZXI A;  5J1U A;  3J7A Y;  4CCL A;  3NAU A;  1R9T J;  1HKS A;  1QO0 D;  2KDO A;  4CO8 A;  4XKC A;  4MGR A;  2R7Z J;  3HRS A;  1BI0 A;  2K7L A;  2PMZ A;  3ZQL A;  5E79 C;  5EYR A;  4P9U A;  1TT0 A;  2PLY A;  3HIF A;  4AVP A;  2EIL H;  3QPT A;  3ASN H;  1WCM J;  4HYE A;  1KZH A;  1HXD A;  2HTJ A;  3S3O A;  3EUA A;  4C2U A;  1ORK A;  2ZFU A;  2FA5 A;  3PQK A;  3SDB A;  1Z3X A;  2RN7 A;  2LC2 A;  2ELH A;  2LRE A;  1DDN A;  2EH3 A;  1X2N A;  1LPQ A;  4EGZ A;  1TNS A;  3SFI A;  3OYI A;  1NH3 A;  2LDU A;  5DV5 A;  2LKP A;  1R1V A;  1DP7 P;  5E3N A;  1SAU A;  2ZC2 A;  4RS8 A;  3REO A;  1FP2 A;  2MD5 A;  2CQ7 A;  5F64 A;  1B9M A;  4I2O A;  1W36 D;  3KEQ A;  1OIS A;  2W4S A;  4CUG A;  3FM5 A;  4PJL A;  2K27 A;  2K3P A;  5FD5 A;  2XUB A;  2KQR A;  1W0T A; 
#chains in the Genus database with same CATH homology
 2FE3 A;  3V8J A;  1PUE E;  1Z9C A;  3F21 A;  4I0B A;  3I59 B;  2YPR A;  2PG4 A;  3C18 A;  1FLI A;  5D8L B;  3M9A A;  4KN7 X;  3ELK A;  3PFI A;  1LQ1 A;  4ENK A;  2EFP A;  3WTX C;  3ROU A;  4L0Z B;  1FBS A;  2OQG A;  2XGX A;  3RI4 A;  3JW4 A;  1JE8 A;  1LDK B;  3DQV C;  5DD4 A;  3KZY A;  1XGS A;  3DV8 A;  4PGH A;  2FU4 A;  5IT3 A;  1TLH B;  1BN5 A;  1T98 A;  1LNW A;  1HBX G;  4KFC A;  2R3S A;  5LGT A;  4XRF A;  4HQE A;  3SQN A;  5D5U B;  5LHI A;  3BZ6 A;  1YW7 A;  2DK8 A;  1IRF A;  1IZ1 A;  3ABT A;  4U0V A;  1Z1D A;  2F5D A;  2VT2 A;  1B1B A;  2F5C A;  2FMY A;  1F4K A;  3TDU C;  1TBX A;  2FBI A;  1F9N A;  2JSC A;  3FHZ A;  1BJA A;  4YFK F;  4CZZ A;  1AOY A;  4OU0 A;  4FX0 A;  1IN4 A;  3VEP A;  2JPC A;  2CO5 A;  2GXB A;  1W4M A;  3TO9 A;  5L3D A;  2L54 A;  4KMU X;  2V1X A;  1FWZ A;  3U2R A;  4CDG A;  2DU9 A;  2ZME A;  2ZKZ A;  4A6E A;  1YW8 A;  1YO5 C;  5BOX A;  2HDC A;  3R6S A;  3ZQ7 A;  3CUO A;  3JSO A;  1U5T A;  4CIC A;  3R0J A;  1YTY A;  2VBW A;  3H3Z A;  3JTG A;  4U88 A;  2ESN A;  2DAO A;  1S6L A;  3WTZ A;  5BPD A;  5HDG A;  2M8E A;  4ENJ A;  1GXQ A;  3DF8 A;  1U5T C;  5BQT A;  3KP3 A;  5BPI A;  1FSH A;  1ZAO A;  1P4W A;  5ILU A;  3K0L A;  2OD5 A;  2JRT A;  1HW5 A;  3GF2 A;  5E20 A;  2QQB A;  3HSR A;  3MFK A;  2Y0M A;  1EH6 A;  3E3V A;  5ICG A;  2K86 A;  3P9K A;  1A04 A;  1RZ4 A;  5ILS A;  3GUD A;  3F8B A;  1ZGA A;  2ZBK A;  2QBY A;  2LF7 A;  3HRM A;  3HTU A;  2GAU A;  3L9F A;  1QZZ A;  1P4A A;  4TV7 A;  2O6G E;  3CUQ C;  1RUN A;  2ZME B;  4U0W A;  1NHA A;  1J75 A;  3KE2 A;  4B8X A;  1D3Y A;  3FMS A;  1WKM A;  3J80 K;  3CUQ B;  1ZG5 A;  3JSP A;  5KK1 A;  4RB1 A;  3V8K A;  3WU0 A;  3ZMU A;  1U3E M;  4O3M A;  3BPX A;  3EDP A;  2L4A A;  2Q0O A;  4G6Q A;  4ZH4 F;  2HR3 A;  1U8R A;  1HKT A;  1W7P A;  2EV0 A;  1OYW A;  4OMY A;  1V4R A;  1YIO A;  3J80 Z;  4P96 A;  3JTH A;  2IP2 A;  1MDM A;  3RKX A;  4M74 A;  1ON2 A;  4RGU A;  1BI2 A;  4HDU A;  2D1V A;  1ON1 A;  1OMI A;  2A5Y B;  1XMA A;  2ADU A;  2P7V B;  1O3Q A;  5H6R A;  5AIQ A;  2XV4 S;  3GFJ A;  4IHT A;  2VOD A;  1D8K A;  3B02 A;  3I59 A;  4HX4 A;  5F6F A;  2FSW A;  2ISZ A;  3IKV A;  4KT5 C;  3GFI A;  3GW2 A;  1T39 A;  3CO6 C;  1GHC A;  5CVU A;  4RAZ A;  3I0T A;  2JT1 A;  2EB7 A;  2ZO4 A;  2V1D A;  1CF7 A;  4UVB A;  4NQW A;  2G9W A;  3K1N A;  2MLK A;  4UNO A;  4L5J A;  1ULY A;  3QRF F;  2P4W A;  5E1W A;  3WGH A;  4A0Y A;  2FBK A;  1XB4 A;  4IJA A;  4EJT A;  3GEZ A;  4RAY A;  1OKR A;  1G3T A;  5K5O A;  4G9Y A;  4BNC A;  3CJN A;  3J81 K;  4MEX F;  4XBF A;  4N9H A;  4LK0 F;  2OA4 A;  4O5V A;  2VOO A;  3C7J A;  3N4M A;  3FMR A;  3MZY A;  1FBU A;  2H6C A;  2XAQ A;  2H09 A;  4HV6 A;  2OQR A;  2EWN A;  1GXP A;  1EH7 A;  2EFW A;  3E6M A;  2HQN A;  3DXJ F;  3OV8 A;  3RTR A;  2BE5 F;  4ZYG A;  4OIO F;  1JGS A;  3HRU A;  5IT9 Z;  3LQQ A;  4Q48 A;  3RKW A;  4LLN A;  1R23 A;  2A6E F;  3LA7 A;  1I1G A;  4HV5 A;  3GFM A;  4S05 A;  4WCG A;  3LFK A;  5KVR A;  3MQ0 A;  1Z6R A;  3HOT A;  1IN7 A;  1JHH A;  2O61 A;  2DBB A;  2BBY A;  3I53 A;  3HHH A;  3BP8 A;  4L9N A;  2CFX A;  4CXF A;  2LSO A;  5E1Z B;  1O7L A;  3E97 A;  5L3F A;  5HS7 A;  1PP8 F;  3WTV C;  3FXR A;  2GXG A;  1SMT A;  2FOK A;  5HOO A;  4PDK A;  2CW0 F;  3W6K B;  3LA2 A;  2A07 F;  1FY7 A;  2TDX A;  2PN6 A;  1MD0 A;  2J5P A;  1STZ A;  3Q5F A;  5DUK A;  1SD7 A;  1OYY A;  2W84 A;  4GGG A;  3GVA A;  4KIG A;  5DYM A;  4BHB A;  1XSX A;  2IA2 A;  1FPQ A;  2QLZ A;  1BIA A;  3GZ5 A;  3IWZ A;  1SMY F;  5BS6 A;  2AXL A;  2GA2 A;  2OBP A;  1FNN A;  2WC2 A;  5K5Q A;  5LHH A;  5ILV A;  3TDZ C;  1O7F A;  1LDJ A;  5JR3 A;  3BWG A;  2PMU A;  4GO1 A;  4UHT A;  5HS9 A;  4CHU A;  3C1D A;  4R79 A;  5D6E A;  4A5N A;  2W57 A;  3KCC A;  4KUM A;  3WU1 B;  5DCM B;  4HQM A;  4NB5 A;  4KDP A;  3JAM Z;  2ETH A;  4Q4Z F;  3G73 A;  3M8E A;  1EH8 A;  2IVM A;  3Q9S A;  1K79 A;  2NNY A;  2YU3 A;  2A61 A;  3T1B A;  2P5L C;  3R0A A;  1G4D A;  4JBA A;  3EET A;  4LLG F;  4U7D A;  3H92 A;  3WTY C;  1YS6 A;  2HQR A;  4NHJ A;  1Q1H A;  2RNJ A;  2MH9 A;  2L02 A;  5AIP A;  1B59 A;  3U9G A;  1ZRE A;  4HA8 A;  4UXN A;  3L00 A;  3HSE A;  2K4B A;  4CGZ A;  3RIR A;  1Z7U A;  2V79 A;  5FFX A;  3MZH A;  3FF5 A;  3H3U A;  1R36 A;  4JQF A;  4Q47 A;  1MJA A;  1S29 A;  3L7W A;  1QGP A;  1W7P D;  3BJO A;  4IXA A;  1J9I A;  2Y75 A;  3E6C C;  1BIB A;  2M30 A;  1IAW A;  3DPL C;  3ECH A;  1FSE A;  1XMK A;  5LGN A;  2M45 A;  1R1U A;  3KP5 A;  1FOK A;  4LG0 A;  4AWX B;  1K6O A;  2EFN A;  4XLN F;  4AD9 A;  5JFR A;  2ZJ2 A;  4FT8 A;  1KU7 A;  2M1B A;  3E5U A;  2VXZ A;  4RB0 A;  5L3G A;  4L5I A;  3ABU A;  1R5H A;  1HQC A;  3PQJ A;  3SHF A;  1TW3 A;  4ENM A;  4LJZ F;  2X0L A;  2XRO A;  1C0W A;  1F1Z A;  3F8F A;  2Q8K A;  5BMZ A;  2HKX A;  3BY6 A;  3O2P E;  4MQV A;  3FWE A;  5HLG A;  2FXA A;  5DDG A;  4LB5 A;  1LJ9 A;  1F5T A;  2X4H A;  5A2Q Z;  4YII A;  3RDI A;  1S7A A;  2HYF A;  2DPU A;  2LNB A;  3IC7 A;  1PP7 U;  1I1S A;  2HZT A;  4EVI A;  3RJP A;  2XHK A;  2F5E A;  1R58 A;  1IN5 A;  4GYG A;  3T8R A;  1O57 A;  2VN2 A;  4HLY A;  3BJA A;  1IN8 A;  4M72 A;  4LK1 F;  3TGN A;  1RI7 A;  1FYM A;  3O3K A;  5ICF A;  4OMZ A;  2RDP A;  1SFX A;  2FEZ A;  2OZU A;  3NRV A;  4BYY A;  5J8C A;  1BI1 A;  3SFZ A;  3CUQ A;  1OR7 A;  3IRR A;  4KA4 A;  1RUO A;  5FD6 A;  4A6D A;  1J5Y A;  3KEO A;  4M73 A;  3DPT A;  1P6R A;  4KN4 X;  3OOP A;  4BHP A;  3K1M A;  2BV6 A;  2K02 A;  1D5V A;  2GQQ A;  1XSD A;  3KP4 A;  2XAS A;  1YYV A;  2OU2 A;  4MEY F;  3K1P A;  4Q5S F;  2STW A;  4G7H F;  3BPV A;  1KGS A;  2D1H A;  5CVV A;  3F6V A;  5JVT A;  4OIP F;  2E1N A;  1SAX A;  4HF0 A;  4WXC A;  5CVI A;  3KET A;  3HOS A;  5H6Q A;  4OOI A;  1FBQ A;  2MA3 A;  3L2C A;  2XAG A;  3TQN A;  1FC3 A;  5K5R A;  5IT9 K;  3E5Q A;  4ZYD A;  4BH9 A;  1VTN C;  4UV8 A;  2ZNY A;  2L01 A;  3MAJ A;  2P7C B;  4G8X A;  1QZY A;  3KFW X;  1IXR C;  1MJ9 A;  4HW0 A;  3WGI A;  2GZW A;  2VBX A;  4P9F A;  3ZMT A;  4FHT A;  2E1C A;  3WOD F;  4M71 A;  1ZYR F;  1T0F A;  2KKO A;  1H9T A;  1ZRF A;  2P6T A;  1G6N A;  2V9V A;  2RGV A;  1MJB A;  2G7H A;  4I7H A;  3HHG A;  5D4S A;  4WX9 A;  3TOA A;  1IRG A;  1OYI A;  2DI3 A;  2A3S A;  4I98 B;  1ODD A;  4L18 B;  4BQA A;  1I27 A;  1MKM A;  4HX7 A;  3C3W A;  1QPM A;  1TQI A;  5J8F A;  5FO5 A;  1B9N A;  3VB2 A;  3DP7 A;  3IWF A;  2DO7 A;  3GX4 X;  3DFG A;  4IRI A;  3F22 A;  1JHF A;  1BM9 A;  4MHG A;  1HKQ A;  1BC7 C;  4RGS A;  2PEX A;  3FMQ A;  5DEQ A;  4ZZD A;  4H0E A;  4HF2 A;  5K1Y A;  3M1E A;  4LLL A;  2EK5 A;  3IRQ A;  1ONV A;  5LLQ A;  3R4K A;  2VE9 A;  3FM3 A;  4HDV A;  1E17 A;  1XSV A;  5HLH A;  2R7D A;  3RYR A;  3F23 A;  1AWC A;  4WK8 F;  2IW5 A;  4A12 A;  3RYP A;  3ZPL A;  1IN6 A;  2QVO A;  1I6X A;  4XLP F;  2JPB A;  1KQ9 A;  4N0B A;  3M8F A;  2BGC A;  1ZLK A;  1YFH A;  4YG2 F;  4RGR A;  1J0R A;  2IRF G;  4I02 A;  3IL2 A;  3QU6 A;  3QAH A;  4A5M A;  2H94 A;  4EJO A;  3W6J B;  1Z91 A;  2IPQ X;  2V1U A;  1G3Y A;  2VBZ A;  3EQL F;  4D0P A;  4ETS A;  4KIB A;  4LB6 B;  1P4X A;  4L0Y B;  2NRA C;  1FZP B;  1XGN A;  3Q9V A;  3D0S A;  1V3F A;  2DFI A;  3WE2 A;  4Z2Y A;  1BBY A;  4UUV A;  3ZMZ A;  3T0Y A;  2VT3 A;  4HZF A;  1SFE A;  1ZHF A;  3P9I A;  4G7O F;  1ZG3 A;  2EFO A;  1I5Z A;  2D45 A;  3ISP A;  1LDD A;  1O3T A;  1HST A;  1K78 A;  2XKO A;  3WTS C;  2HTS A;  4P5O A;  1YS7 A;  1W5S A;  1WQ2 A;  3F8M A;  5L3C A;  2P5V A;  1QQI A;  4L9T A;  4IRH A;  4ZZL A;  3F6O A;  5JI6 A;  3ECO A;  2IA1 A;  3I54 A;  1K78 B;  2VC0 A;  1FYL A;  3P9C A;  5E1X A;  2P6S A;  3GZ6 A;  2COM A;  3S2W A;  1B4A A;  4L9J A;  1R1T A;  3KP2 A;  4EQQ A;  3F8C A;  2PBI A;  4LD5 A;  3EUH A;  3CDH A;  2DQR A;  5E8I A;  4EGY A;  2GA1 A;  2UXX A;  3CLO A;  3WGG A;  1KYZ A;  2HFH A;  1S8N A;  2YR2 A;  4HOB A;  4M9Z A;  2GIV A;  2AS5 F;  3GFL A;  5FLX K;  4KNY A;  2WV0 A;  3IHU A;  3VOE A;  3RPQ A;  2WTE A;  4MQ9 F;  5ICC A;  1UCR A;  1USS A;  3LST A;  2NS0 A;  4N9I A;  3V4G A;  1B6A A;  5CLS A;  2E7X A;  3BRO A;  4DNC A;  4EJV A;  2VON A;  3ERE D;  2BYV E;  2KRF A;  2HEO A;  2YX4 A;  2Z99 A;  3MCZ A;  2MLG A;  2IT0 A;  5JHU A;  3HTS B;  3K9T A;  2RV8 A;  4EJW A;  1KU9 A;  2VOP A;  1J2X A;  4AIJ A;  2UZK A;  1G3W A;  1JXS A;  4M6X A;  1KU2 A;  3ZMD A;  5FFZ A;  1CF7 B;  2XKP A;  5EEG A;  1E2X A;  1UFM A;  3QU3 A;  4Y15 A;  3SZP A;  4HLX A;  1TNT A;  3TO6 A;  1OPC A;  1Z6T A;  2EFQ A;  1P92 A;  2Y48 A;  3TO7 A;  2W24 A;  2KJB A;  3ML6 A;  1R22 A;  5J6X A;  1MZB A;  2EV5 A;  1UHW A;  4YFX F;  2QQA A;  4EMS A;  2A68 F;  1UB9 A;  2V6C A;  1SFU A;  3SZT A;  2CSO A;  3MEX A;  1LEA A;  1TW2 A;  4U0Y A;  2XIG A;  5CJ9 A;  4UVC A;  1H9G A;  5D5V B;  3JAM K;  1HW1 A;  3LAJ A;  3P7N A;  3KP6 A;  3L09 A;  2BEO A;  2HKO A;  1ZN2 A;  1ZG1 A;  1HW2 A;  4BHC A;  4BXU A;  2STT A;  4MTD A;  3ZMS A;  1J7K A;  3GWZ A;  3NEU A;  1WI9 A;  2K4J A;  1TQP A;  4HF1 A;  2B0L A;  5CYV A;  5DD8 A;  4BAY A;  5L3B A;  4HAM A;  4IF4 A;  3R61 A;  2ZXJ A;  1IXS B;  2KIU A;  4GCV A;  1YQA A;  3IKT A;  2M87 A;  3ZN1 A;  4ESF A;  4FX4 A;  4AIH A;  1KU3 A;  3NQO A;  5TRD A;  3GYH X;  5LEK A;  5HDN A;  2O3F A;  1XCV A;  3E5X A;  3V7C A;  1PDN C;  1HSJ A;  4G7Z F;  3DEU A;  1KYW A;  1SD4 A;  4KIC A;  2H27 A;  1FP1 D;  3FXQ A;  5F1R A;  5CVR A;  2M5W A;  1U2W A;  1WWX A;  4XSX F;  1UST A;  1BI3 A;  1KA8 A;  2DQL A;  4ON0 A;  5D5W B;  5E8G A;  4RB2 C;  2L4M A;  5HLI A;  2PQ8 A;  4LFU A;  4L9V A;  2QM3 A;  2MBF A;  4ESB A;  2DTR A;  5E18 F;  3V8L A;  1ZRC A;  1MDM B;  4I09 A;  4M6Y A;  4ESJ A;  3WG9 A;  4KIF A;  5A2Q K;  3V7R A;  2KIF A;  1S7O A;  4HX8 A;  1XD7 A;  4A2U A;  3CTA A;  1YG2 A;  1TTY A;  2EV6 A;  4G94 A;  4ASN A;  4B09 A;  2QUF A;  4RB3 C;  2ESH A;  2L3D A;  1IW7 F;  1K7A A;  4RGX A;  2CWE A;  4ZYE A;  1IUY A;  2A69 F;  2F2E A;  2CGP A;  6PAX A;  2FNA A;  2XAF A;  2WWY A;  5ERI A;  5LRS A;  4EJU A;  3LA3 A;  3BOQ A;  4EM2 A;  2O0Y A;  3BDD A;  3HSF A;  3EYY A;  3I4P A;  2VBY A;  2NNN A;  3TKY A;  3VFZ A;  3M7G A;  1ZRD A;  4PGG A;  2R7F A;  1SD5 A;  4MNU A;  4P55 A;  2W25 A;  3T8T A;  3GLX A;  5FB2 A;  1EV7 A;  3HYI A;  4HBL A;  1BC8 C;  1U78 A;  1FYK A;  2O03 A;  2A6H F;  2HWV A;  3GXO A;  2LF8 A;  4LMY A;  1P2F A;  2XVC A;  1YW9 A;  1G3S A;  4WXD A;  1DPU A;  2P5K A;  3DKW A;  4GYI A;  1X3U A;  1Y0U A;  1XGM A;  5ICE A;  1DPR A;  3J7A O;  4R1H A;  5HS8 A;  2PI0 A;  4M9X A;  4OIR F;  3J81 Z;  3MWM A;  2DW4 A;  2NYX A;  2HOE A;  4G6D A;  5D5X B;  4EM1 A;  2QEN A;  4ENN A;  2Z3Y A;  1LVA A;  4LGW A;  1RIO H;  5E17 F;  2C6Y A;  4MTE A;  3B73 A;  1T6S A;  4EV0 A;  3FZV A;  3I71 A;  4O6J A;  5D6F A;  3ZP5 A;  4IHS A;  2E7W A;  3LQR A;  4KYW A;  1ZGJ A;  3T5X A;  3EYI A;  2O8X A;  4OIN F;  4I01 A;  2MH2 A;  2YSR A;  4QWQ A;  4Y13 A;  3LWF A;  1T38 A;  3K69 A;  3QOP A;  1XGO A;  1R00 A;  1REP C;  3KLO A;  1TQM A;  4KMF A;  3LAP A;  5D8K B;  3K2Z A;  3F8N A;  2GWR A;  1XDU A;  3QPH A;  1QNT A;  5LGU A;  2FML A;  1W7P B;  3FX3 A;  2MC3 A;  2CQK A;  2XAH A;  4Y17 A;  2VC1 A;  4EM0 B;  4UVA A;  2PMH A;  4QLC U;  2HGC A;  1CGP A;  3QP5 A;  2KJC A;  3KP7 A;  1YLF A;  1U5T B;  2QQ9 A;  5DCF A;  2CG4 A;  1O3R A;  2JZY A;  1H0M A;  2DK5 A;  1T2K A;  3I58 A;  1LEB A;  2YX7 A;  4OIQ F;  3WTU C;  1ZH5 A;  3ZN0 A;  2KIM A;  2EJR A;  2ZNZ A;  2PFB A;  2FBH A;  5LEJ A;  5DCM A;  2UXN A;  2RKH A;  5ED4 A;  4PZJ A;  2FF4 A;  4GXO A;  5FLX Z;  1FX7 A;  4LG0 B;  3V7S A;  1D8J A;  2VE8 A;  2QBY B;  3ULQ B;  2FRH A;  3CO7 C;  2J5O A;  4U7B A;  3KLN A;  5AON A;  2QZ8 A;  3D5L A;  5LBQ A;  1XCB A;  4WWC A;  2RC4 A;  2EA4 A;  2ZFW A;  1S3J A;  2IJL A;  4K2E A;  1LB2 A;  1O3S A;  4I0A A;  2EA2 A;  2Q2E A;  2Z5U A;  3R60 A;  1J59 A;  3WTT C;  2NAZ A;  2RQP A;  1WSU A;  2W85 A;  3I64 A;  3COA C;  2F5F A;  4S04 A;  1MGT A;  5H20 A;  5LRR A;  2JTV A;  4A0Z A;  1W5T A;  2DPD A;  4XSZ F;  2D2W A;  2ZCW A;  1XDS A;  1UHM A;  3HRT A;  1U6G A;  2FQ3 A;  2Z9O A;  2OZ6 A;  2QWW A;  3QP6 A;  1XN7 A;  2RVC A;  3F72 A;  5FGM A;  4CYD A;  3E6B A;  4YIF A;  1KQ8 A;  3TOB A;  3VOD A;  3ZMV A;  2DLL A;  2XRN A;  2FNP A;  3SXY A;  2HS5 A;  2ACJ A;  2PJP A;  2OAZ A;  1ZAR A;  3GO5 A;  2Z33 A;  2HYG D;  4JK1 X;  1WRJ A;  3N97 A;  1BOA A;  5TJJ A;  5CVJ A;  3F3X A;  3WTW C;  3RPU A;  2ISY A;  2IA0 A;  4AIK A;  5HDK A;  4IPA A;  1R5G A;  4IVN A;  3BJ6 A;  2H6B A;  5DUI A;  1DUX C;  2UWM A;  3KZZ A;  1IXC A;  1QBJ A;  5D4R A;  3AAF A;  2CYY A;  2G7U A;  1L0O C;  5HVQ C;  1L3L A;  4UV9 A;  4PCQ A;  1Z05 A;  1ZLJ A;  3I5U A;  4A0X A;  3G3Z A;  3HUG A;  3O6B B;  4R8H A;  4F7Z A;  2P8T A;  1RNL A;  5EEH A;  2DT5 A;  5L3E A;  1SD6 A;  1KQ0 A;  4ZYH A;  3WE3 A;  2QYO A;  1IF1 A;  1GVJ A;  4WXH A;  3U1D A;  4DQ2 A;  4WF2 A;  3RKY A;  4YFN F;  4IRG A;  4E70 A;  2XAJ A;  5LHG A;  1FT9 A;  3E6D A;  1R7J A;  4M9S A;  3FXU A;  1HKS A;  1QO0 D;  4CO8 A;  4MGR A;  3HRS A;  1BI0 A;  2K7L A;  4P9U A;  2PLY A;  3HIF A;  4AVP A;  3QPT A;  4HYE A;  1HXD A;  2HTJ A;  2FA5 A;  3PQK A;  2RN7 A;  2ELH A;  1DDN A;  4EGZ A;  1TNS A;  2LDU A;  5DV5 A;  2LKP A;  1R1V A;  1DP7 P;  4RS8 A;  3REO A;  1FP2 A;  2MD5 A;  5F64 A;  1B9M A;  4I2O A;  3KEQ A;  3FM5 A;  5FD5 A;  2K27 A;  2XUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...