2EK5A

Crystal strucutre of the transcriptional factor from c.glutamicum at 2.2 angstrom resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
b'VPLYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGMFVSAQAPALIRERRDAAFAATYVAPLIDESIHLGFTRARIHALLDQVAESR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted transcriptional regulators
publication title The structures of transcription factor CGL2947 from Corynebacterium glutamicum in two crystal forms: A novel homodimer assembling and the implication for effector-binding mode
pubmed doi rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Transcription
total genus 37
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ek5A00
2F5EA 5LEJA 4JBAA 3GFJA 3LFKA 4FHTA 3BJOA 4XLPF 3M7GA 4M74A 4LB6B 3GEZA 4Q48A 3FMQA 1R1VA 2KJBA 4EQQA 2CYYA 3O6BB 4HBLA 1LNWA 3RPQA 3ULQB 2MLGA 3L2CA 1RZ4A 4M73A 4R1HA 2QBYA 2P4WA 4KIGA 1ZRCA 1IXSB 1BI0A 2D45A 2EFOA 1TQMA 3ROUA 3W6KB 5BOXA 2Y75A 4OMYA 1G3YA 4WX9A 1XB4A 1R36A 2E7XA 1IN5A 4U0VA 5HS7A 5FD5A 2IW5A 1FSHA 1QNTA 1VTNC 1TNTA 3F23A 5HLHA 2JT1A 1SFUA 2DO7A 2OQGA 4YFNF 3JAMK 3V7RA 3O3KA 4I09A 4RGUA 3WTYC 3G3ZA 2XVCA 2IPQX 5E17F 4P5OA 4KMFA 1KU9A 4WXHA 4FT8A 1KGSA 4IRGA 2QQAA 5JFRA 3TDZC 3F8CA 1PUEE 4UV9A 2LDUA 3BDDA 3TO7A 4HDUA 1V3FA 4KNYA 2HS5A 2Y48A 3F8MA 2BYVE 3HSRA 3NRVA 4HAMA 1R22A 2FF4A 2ZMEA 3WGHA 5DCMA 2W57A 4MEYF 1D5VA 1XSDA 3ML6A 2HEOA 1HQCA 2UXNA 3M9AA 1OYYA 2M45A 3ZN0A 3WTSC 4NQWA 3ZQ7A 2DFIA 1IN8A 1KYZA 4UV8A 1K78A 3H92A 4PDKA 1J2XA 3LAJA 1UHMA 1F9NA 3K9TA 3V8LA 2HTJA 2RVCA 4A0YA 1QPMA 4MQ9F 4MQVA 3KZZA 1SD4A 3HTSB 3T5XA 1P4WA 1LEAA 4UVBA 1Z6RA 1QZZA 1Z05A 5D6EA 4I7HA 2A6EF 4R79A 2P5LC 2OU2A 5L3EA 5DD8A 4HYEA 1USTA 3HHHA 2M30A 1WQ2A 2L54A 3JW4A 1MD0A 2X0LA 1G3WA 2Q2EA 4HA8A 2DI3A 4GYIA 5K5QA 4XSZF 5L3GA 3GFIA 2P8TA 2V1XA 1GHCA 5D4RA 1RI7A 1XD7A 3IRRA 1KU2A 1XSVA 3ERED 2ZFWA 3I58A 3I5UA 2NNYA 3RIRA 1LDKB 2O3FA 5A2QZ 2CFXA 1J75A 3PQKA 2EA4A 2F5FA 2KKOA 1FP1D 3QP5A 2IP2A 3K0LA 3SFZA 3HIFA 5HLGA 1FP2A 4UHTA 2EFNA 4EVIA 2QBYB 1T0FA 3DPLC 1NHAA 4RB0A 5E1ZB 4WK8F 3KP3A 3EETA 4YIIA 2XGXA 2ZKZA 5L3DA 5E1XA 3MQ0A 3MEXA 2YSRA 3ELKA 3ZMDA 4RB3C 1FWZA 1ZHFA 1FYLA 5K5RA 4MEXF 4XSXF 3GWZA 1Z1DA 2P5KA 4I01A 3RKWA 3MFKA 2CWEA 4M6XA 5LHHA 3EQLF 3U1DA 5HVQC 1Z7UA 1EV7A 1BOAA 4CDGA 5ICGA 3F8NA 3I0TA 4IVNA 2QVOA 2W24A 3T0YA 3DP7A 1ZLJA 1TBXA 5BPDA 3JSPA 3WTVC 1IUYA 4LG0A 3GZ6A 1ZGAA 4ASNA 1ZG3A 4KMUX 2CO5A 1TW3A 1S3JA 4G7ZF 4B8XA 4I02A 3NEUA 1Q1HA 4AVPA 5FD6A 1U3EM 2ZMEB 1OMIA 1B6AA 5J8CA 3F22A 1YO5C 4H0EA 2ZNYA 1E17A 1TQPA 4ESJA 3VOEA 2VXZA 1HKTA 3DQVC 4RGSA 5F6FA 2XAJA 1IAWA 3W6JB 1XGOA 2J5OA 1MJBA 3IWZA 5LRSA 3VODA 1FLIA 2LNBA 2HQRA 1K78B 3J80K 3KP7A 2IVMA 1ZG5A 2G9WA 4KUMA 3HSFA 4OIRF 2HDCA 2KIUA 2DU9A 3JTHA 2VN2A 5CVJA 2MLKA 2ELHA 3CUQC 2GQQA 3J81Z 1PP7U 4LMYA 2G7HA 3BJAA 5HS8A 4MTDA 3KE2A 2ZO4A 4MTEA 3E6MA 4ENNA 5DV5A 2K27A 2DW4A 4I0AA 1GXQA 4GGGA 2JTVA 1XCBA 4FX0A 4L0YB 3FHZA 2NS0A 1DUXC 1SFXA 1O7LA 1T2KA 3JSOA 2ESHA 4N9HA 3OOPA 2FBKA 5JVTA 1FYMA 1BC7C 2HR3A 4LLGF 3ZMSA 3Q9SA 2HQNA 4A6DA 2RQPA 4HX4A 3V7SA 3CUOA 1OKRA 1O3RA 3DPTA 2TDXA 3GO5A 1SFEA 2PQ8A 4RGRA 4ZZDA 3VEPA 4CXFA 1WSUA 2HYGD 4GO1A 5FFZA 2QWWA 2QQBA 2X4HA 1CF7B 2XASA 4ETSA 5BS6A 2RNJA 2JRTA 4AIKA 1HSTA 1UCRA 5ILUA 4CO8A 1U5TB 1D3YA 2PJPA 3BP8A 1R58A 4RB2C 1KYWA 4KYWA 2ACJA 2VBWA 4HV5A 3JTGA 1TLHB 1XMAA 3GYHX 3WTTC 1LB2A 4A2UA 1LDJA 1I27A 4L9NA 3RKYA 1KA8A 1L3LA 1HW2A 1MKMA 3J81K 4KIFA 4PZJA 2R7FA 3GLXA 5D5XB 4DNCA 3IL2A 2JPCA 3CO6C 2MBFA 5E8IA 5CVRA 1XN7A 4TV7A 3WG9A 2OQRA 1QBJA 4RS8A 4M9XA 3OV8A 2W84A 5D8LB 3LA3A 1O57A 2FE3A 1IN7A 3P9IA 4O5VA 5JHUA 2Z99A 3C3WA 1Z6TA 4OIOF 3ZPLA 2RC4A 3M8FA 3K1MA 2KRFA 1UFMA 3E6BA 2IA0A 2PI0A 1R1TA 5JI6A 4U0YA 2L02A 2J5PA 4HF1A 2O8XA 4WF2A 2FNPA 5D8KB 3ZN1A 3K1PA 3U2RA 2VT2A 3FMSA 4ZYGA 2PG4A 2P5VA 2DK8A 3COAC 1FYKA 1KU7A 1TW2A 2XHKA 2QM3A 4MNUA 3HOTA 2QUFA 4UVCA 2FU4A 3MCZA 5IT9K 3R0AA 5H6RA 4G6QA 3R0JA 2O6GE 3QPHA 1LQ1A 4AWXB 3QOPA 4ENMA 4MHGA 1P4XA 3ABUA 4KDPA 1I5ZA 3V8KA 4HV6A 5FO5A 4U7DA 5DD4A 5D5UB 2ZJ2A 2RDPA 4ENKA 1HW1A 3TO6A 2E7WA 4KFCA 1QQIA 3H3ZA 2PFBA 4Q5SF 2ISZA 1G3SA 2ISYA 4OIPF 1IXRC 1OYWA 2DQLA 5HS9A 4N9IA 4NB5A 5LGTA 1EH8A 4YG2F 1S29A 4OU0A 3F6VA 4QLCU 1PP8F 4M72A 3B02A 5J6XA 2WTEA 2MA3A 2GA1A 1W7PD 3E5QA 3HRSA 3C7JA 2BBYA 2KIFA 3I54A 4GCVA 4P9UA 2A5YB 2PN6A 1YS6A 1J9IA 3LA2A 4E70A 5CLSA 2YX4A 1IRFA 3BROA 4EMSA 3FM3A 3HSEA 5D6FA 2Z33A 3ABTA 3GZ5A 3E97A 4RB1A 4O6JA 5KVRA 1X3UA 3M8EA 4L0ZB 5JR3A 2YU3A 3J7AO 3GUDA 1JHHA 5ICCA 3LAPA 2RN7A 2ETHA 2LKPA 3CUQA 4EM2A 5J8FA 2MC3A 1FY7A 3BPXA 4LLNA 1FBQA 5K5OA 2H94A 1YG2A 1FT9A 1W4MA 5HDKA 3CO7C 2W25A 3ZMZA 1OYIA 2P7VB 1UB9A 1ZRFA 2NAZA 1B9MA 2FXAA 3V8JA 4EJOA 4IJAA 2K02A 3R4KA 4M6YA 3BPVA 4G8XA 1R5HA 4Q4ZF 4LK0F 3V7CA 4LK1F 2GXGA 2EV0A 3D0SA 2VE9A 2ESNA 2VE8A 1YW7A 1J7KA 3RI4A 3SXYA 3V4GA 5DUKA 2VBZA 2GIVA 3E6DA 1XGSA 4IRIA 1ZLKA 2A68F 3RDIA 1S7OA 1USSA 1XDUA 3L7WA 5DCFA 2P6TA 3QRFF 2GXBA 1Z9CA 4BH9A 3EYYA 4EJWA 2CW0F 3FXRA 3TOBA 3LWFA 2A61A 4OOIA 2VODA 4P55A 5H20A 4YFXF 1D8KA 4CGZA 4YFKF 3KETA 1XSXA 2R7DA 4R8HA 3MWMA 5ICFA 2NRAC 1SAXA 4G7OF 1B59A 2E1NA 5FGMA 2EFWA 3I59A 4PCQA 1SD7A 1YW9A 3KLNA 2O0YA 4AIJA 1J0RA 3FMRA 4L5JA 5LHIA 1IXCA 4XLNF 4HF0A 3MZYA 3DV8A 1CGPA 1XGNA 1YTYA 2M87A 2A69F 2A07F 4HF2A 4LD5A 4BNCA 3D5LA 1WKMA 1LDDA 2XAHA 3BY6A 2PLYA 2CG4A 4JQFA 2DPDA 2XIGA 1XDSA 4WXDA 4BAYA 3N97A 3QU3A 3SQNA 3AAFA 4HQMA 3GX4X 2Z5UA 3F8BA 4RGXA 1RIOH 4BHBA 5DCMB 4HDVA 1FC3A 2O03A 3G73A 3WODF 1R1UA 4A0ZA 5L3BA 3WE3A 2VBYA 2XKPA 4DQ2A 1FSEA 4A0XA 3F3XA 4FX4A 1YQAA 4UVAA 5H6QA 4RAYA 3LA7A 3GFMA 3ISPA 3P7NA 1FZPB 4KICA 2HGCA 5A2QK 4CYDA 5AIPA 1G6NA 3REOA 4M71A 2OA4A 3RTRA 1H9TA 2B0LA 1EH6A 3CUQB 4M9ZA 2F2EA 2FMYA 1BN5A 1F1ZA 2DAOA 3SZPA 3S2WA 1SD5A 3K69A 5FB2A 1ZARA 5DEQA 1BI3A 1ZRDA 4IXAA 3TQNA 1ON1A 1FNNA 3DFGA 3DKWA 3IWFA 1ODDA 3N4MA 5K1YA 3KCCA 2EFPA 1B1BA 3WTXC 1RNLA 2STTA 1P92A 1RUOA 1STZA 2NYXA 2XV4S 1UHWA 4ZYEA 2DLLA 4U7BA 3T8RA 3KP4A 2XKOA 3RKXA 3NQOA 3E6CC 4L9VA 4KN7X 2H6BA 2OD5A 3SHFA 5EEGA 5ILSA 4HOBA 5HOOA 1O3QA 1U78A 4EGYA 2FQ3A 5BMZA 1SMTA 4JK1X 1S7AA 2BEOA 2PMHA 3IRQA 4HX8A 4S05A 2UZKA 4WCGA 2R3SA 5TJJA 4ZYHA 1WWXA 1HSJA 1FX7A 4U88A 2HOEA 2Q0OA 1ZYRF 4A12A 3Q5FA 3I59B 3PQJA 2G7UA 5FLXZ 3LQRA 2VONA 1TQIA 3WGGA 4M9SA 3QAHA 1W7PA 2ADUA 3F72A 3O2PE 1XCVA 1O3TA 1V4RA 1MJAA 2FBIA 4BHPA 2D2WA 2M5WA 1FBSA 4GYGA 3RYPA 4PGHA 1ZG1A 4HW0A 1U5TC 4ZH4F 3HHGA 4LG0B 3WE2A 3DXJF 2XUBA 3KEQA 2Z9OA 3L9FA 1TNSA 2H27A 2QLZA 1JE8A 5L3CA 3RYRA 3TO9A 3JAMZ 1G3TA 2OZUA 3TOAA 1OPCA 4BXUA 1DP7P 2HKXA 2PBIA 3KP5A 4ZZLA 4G7HF 1C0WA 1YFHA 3M1EA 1KQ0A 3KFWX 4K2EA 2H6CA 2IT0A 4L9TA 1FOKA 5LLQA 2PMUA 2O61A 3WU0A 1ZAOA 1AOYA 5CVUA 5ED4A 3BJ6A 4OIQF 2DQRA 1T39A 1ON2A 1P6RA 3P9KA 4G9YA 2MH2A 3I71A 5EEHA 1HBXG 2L01A 4BHCA 3BOQA 4Y15A 2GA2A 2HFHA 3KLOA 5FLXK 1MGTA 1PDNC 2Y0MA 4NHJA 2OBPA 3QPTA 4U0WA 5L3FA 3TDUC 3FM5A 3PFIA 2VC1A 4EV0A 1KQ9A 2K4BA 3R6SA 3IKTA 4AIHA 1O3SA 4Q47A 4LLLA 1K7AA 1HKQA 1DPRA 4S04A 2DPUA 2VBXA 5D5WB 2LF8A 3IHUA 1YS7A 2EJRA 3RJPA 4KN4X 2YX7A 1JGSA 2XAQA 1Z91A 1I6XA 2BV6A 5LGNA 2QQ9A 2V1DA 3WTUC 3ECHA 2YR2A 2OZ6A 2VT3A 1E2XA 1J5YA 3WTWC 2FOKA 4EM0B 3P9CA 2JSCA 1XMKA 2JZYA 2FNAA 3ZMUA 2W85A 1W7PB 3F21A 4Y13A 1BBYA 2ZBKA 1SMYF 1LJ9A 4O3MA 1ULYA 2BE5F 1WRJA 3L00A 1P4AA 2QYOA 1A04A 3GF2A 5BPIA 3R60A 2L4AA 4B09A 1ZGJA 5LBQA 5KK1A 3FZVA 2AXLA 5E20A 3WTZA 2L3DA 4L9JA 1BIAA 4ZYDA 1MDMA 2EWNA 3HRUA 4PGGA 4IF4A 3GXOA 3GFLA 3K1NA 3CTAA 1U8RA 4UUVA 4L5IA 4HZFA 2WWYA 3H3UA 3HRMA 1IN4A 4L18B 4HX7A 4KT5C 5LGUA 3KP6A 5AONA 4G94A 3HOSA 5D4SA 3E5XA 3FXUA 3DF8A 3FWEA 2EA2A 4IHTA 4RAZA 1YLFA 2WC2A 1KQ8A 3CLOA 1IN6A 2XAGA 4LGWA 1XGMA 4CICA 1IZ1A 4G6DA 2RGVA 2KIMA 2NNNA 2GAUA 1ZN2A 2P7CB 5DDGA 2EV5A 5IT3A 5DYMA 1DPUA 3SZTA 2K86A 4D0PA 1KU3A 4BYYA 3FXQA 3LQQA 1B4AA 2IA2A 2FSWA 3HRTA 3EUHA 1OR7A 3VB2A 2XAFA 3MZHA 2V1UA 2C6YA 2V79A 3J80Z 3I53A 4EGZA 4HQEA 3HYIA 2Q8KA 3DEUA 2FBHA 4A5MA 5CJ9A 3T8TA 3E3VA 4OINF 3GVAA 3C18A 2IRFG 1U6GA 1L0OC 1CF7A 2HKOA 1R23A 3Q9VA 2L4MA 1LEBA 3I4PA 1U5TA 3HUGA 2A6HF 5E1WA 4I2OA 4HLXA 2RKHA 3BWGA 2COMA 1ZH5A 1O7FA 1H0MA 1K79A 3ZMTA 4I0BA 3KEOA 4GXOA 2OAZA 4N0BA 2GZWA 2QENA 1P2FA 1HXDA 2ZXJA 1F4KA 4P9FA 2FRHA 3IKVA 3TKYA 2PEXA 1W5TA 1SD6A 5D5VB 1ONVA 3U9GA 3B73A 4YIFA 3CJNA 1I1GA 2DTRA 3E5UA 4EJTA 1T6SA 2EFQA 1I1SA 1B9NA 1BC8C 2STWA 1IW7F 2RV8A 1D8JA 1GVJA 5AIQA 3L09A 2D1HA 3GW2A 5HDGA 3C1DA 2DK5A 2XROA 4Z2YA 1S8NA 2V6CA 4LFUA 3I64A 4WXCA 1U2WA 5CVVA 4WWCA 4IHSA 2XRNA 4IRHA 2A3SA 1H9GA 1R7JA 5ILVA 1MDMB 1GXPA 1J59A 4LJZF 1MJ9A 2LSOA 3LSTA 3EYIA 1JHFA 2FA5A 4A5NA 2VOOA 2ZCWA 4P96A 3FF5A 5LHGA 2LF7A 1EH7A 2HYFA 4UXNA 2K4JA 1QZYA 1IF1A 2F5DA 2M1BA 5ERIA 2YPRA 1REPC 5HDNA 4BQAA 1K6OA 3ZMVA 2K7LA 2UWMA 3FX3A 3BZ6A 1Y0UA 4LB5A 4EJUA 3TGNA 4AD9A 3MAJA 2GWRA 2H09A 1TTYA 4ESFA 2HWVA 2MD5A 2MH9A 1HW5A 2FMLA 3KP2A 3WU1B 3QU6A 2IJLA 2E1CA 1BIBA 3ZP5A 3F6OA 2P6SA 4ESBA 1FPQA 4KA4A 4Y17A 4A6EA 2Z3YA 2BGCA 2M8EA 5E18F 1R00A 2VC0A 1BM9A 4F7ZA 3F8FA 1IRGA 4OMZA 1S6LA 1RUNA 1HKSA 3VFZA 4ON0A 3WGIA 3HTUA 2HZTA 4MGRA 1YIOA 2CQKA 1JXSA 3T1BA 5LEKA 5DUIA 2HTSA 3CDHA 5LRRA 4HLYA 2CGPA 1R5GA 1LVAA 1QO0D 2QZ8A 1BI1A 3K2ZA 2CSOA 2ZNZA 3KZYA 4I98B 5IT9Z 3R61A 3ECOA 2AS5F 2DBBA 1BI2A 5ICEA 1F5TA 1G4DA 5TRDA 1FBUA 4EM1A 1DDNA 1QGPA 1W5SA 2EK5A 1WI9A 4XBFA 5BQTA 1MZBA 2D1VA 3EDPA 3IC7A 2DT5A 3QP6A 1YW8A 5CYVA 2WV0A 5E8GA 4CHUA 4IPAA 2EV6A 4XRFA 2KJCA 4UNOA 2VOPA 2FEZA 4EJVA 5F64A 2V9VA 5F1RA 2EB7A 3RPUA 1YYVA 1ZREA 2IA1A 1BJAA 2F5CA 5HLIA 1T38A 1AWCA 5FFXA 5CVIA 2UXXA 4KIBA 4QWQA 1T98A 4CZZA 4ENJA 2JPBA 6PAXA
chains in the Genus database with same CATH superfamily
2W7NA 2JUCA 2F5EA 5FKMA 2QCOA 5LEJA 4JBAA 3FXJA 3GFJA 1F43A 2EZKA 3LFKA 4FHTA 3BJOA 2LVSA 4XLPF 2FUG2 3GCMA 3M7GA 4M74A 1VQLI 4LB6B 9ANTA 3GEZA 4Q48A 4IOAF 3FMQA 1R1VA 2COBA 2KJBA 2CYYA 3O6BB 3PSFA 3RCOA 4HBLA 4EQQA 1LNWA 3H9QA 3RPQA 3FK7A 3ULQB 2MLGA 3S1RJ 4EATA 3L2CA 1RZ4A 1OCOH 2DMQA 2X1CA 1YIJI 4M73A 4R1HA 4F93B 2QBYA 2P4WA 4CYCA 4KIGA 3H0DA 1ZRCA 1IXSB 4NC6A 1BI0A 2JRMA 4YEJA 4B3AA 2D45A 2EFOA 4Y7NJ 1TQMA 2N8GA 4XLAA 3LSIA 3ROUA 3CCQI 2NVXJ 1A31A 3W6KB 3IAS2 2XPWA 5BOXA 4PFPA 2Y75A 4OMYA 1G3YA 3OIOA 2JA8J 4WX9A 1BW5A 1XB4A 2ZJRF 1MMDA 1R36A 2E7XA 1ENHA 1Q1VA 1IN5A 4XMYA 4U0VA 3DLLF 3JRAA 5HS7A 5JLWA 5FD5A 2XSDC 4X0GA 2IW5A 5FLMJ 1FSHA 1QNTA 3DBRB 4MFDA 1TNTA 1VTNC 1H88C 3F23A 1FEXA 5HLHA 3ZQLA 2JT1A 1QHGA 1SFUA 1MNDA 2E2IJ 2BW3B 2DO7A 4IL6C 2OQGA 4YFNF 3JAMK 2NVTJ 3FK6A 1TZLA 2M4GA 3V7RA 1VQPI 2AQEA 5J1UA 3O3KA 4I09A 4RGUA 2DCEA 3TP0A 3WTYC 1SVOA 3G3ZA 2XVCA 2IPQX 3QPLA 5E17F 3SDBA 1G2HA 1VI0A 1WJDA 1RRJA 4P5OA 3K70C 2QSHX 3MZ8A 3OYAA 4KMFA 1LFPA 1KU9A 2KL4A 2MYSA 2LP0A 4WXHA 3NWTA 3KYCB 4FT8A 1VZ0A 1U8BA 4M3GA 3CESA 1KGSA 4IRGA 2BHYA 2QQAA 4PJMA 5JFRA 3TDZC 3F8CA 1PUEE 2AXTC 2XPUA 2LDUA 2A6TA 3NARA 4UV9A 1MH4A 3BDDA 3TO7A 1X2NA 4HDUA 1V3FA 4KNYA 2DFHA 3S1QJ 2F4OB 2HS5A 2Y48A 3TEDA 3F8MA 1T8IA 2BYVE 3HSRA 3NRVA 4HAMA 1R22A 3GTKJ 2FF4A 3OL4A 2BXZA 1Y8RB 2ZMEA 5EEAA 3G4SI 3WGHA 5DCMA 3HOXJ 2W57A 4M3FA 3W2AA 4MEYF 1IRXA 1D5VA 3FXMA 3CCUI 1XSDA 3CCJI 3ML6A 1ETXA 4RLFA 1HQCA 2HEOA 2UXNA 2DOEA 3CCYA 3M9AA 2CW7A 1OYYA 5B1AH 2M45A 2R7WA 3ZN0A 1MMAA 3FXOA 1K61A 3SEZA 3WTSC 4NQWA 4I99C 3ZQ7A 5LFAA 2DFIA 1IN8A 1XG1A 1KYZA 2ZXWH 4UV8A 1W0TA 1K78A 3H92A 1YJ9I 4PDKA 1J2XA 1UG2A 3LAJA 1UHMA 1F9NA 3K9TA 3V8LA 2HTJA 2RVCA 3A0BC 2R7ZJ 3RPUD 4A0YA 1JTYA 1QPMA 4MQ9F 1RR8C 1PYVA 1I6HJ 1R49A 4BEHA 4MQVA 1FTTA 2WY7Q 3HZJA 3KZZA 1SD4A 3HTSB 3H36A 4ZYAA 3T5XA 5HODA 1E3OC 3PFYA 3IP4B 1VQNI 1P4WA 1LEAA 1S9HA 4UVBA 2R7QA 4FQGA 1OCZH 1Z6RA 4PUSA 1QZZA 1UELB 2DT7B 1WFXA 1Z05A 2DA4A 5D6EA 3KYLA 4I7HA 2A6EF 4R79A 2P5LC 1TWCJ 2OU2A 3OIPA 1IGNA 3BR3A 3LSRA 1TWFJ 4BXXJ 1R5ID 5L3EA 3EPZA 3CF2A 4C2UA 2JVGA 2R93J 5DD8A 4HYEA 1USTA 4D5CA 3HHHA 2M30A 4E7HA 3CCSI 2EBIA 4LIVA 3D1NI 3IUOA 3HB9A 5KAFC 1WQ2A 3OS2A 2L54A 3JW4A 1MD0A 3RQIA 5M3FJ 2X0LA 3S1MJ 1G3WA 2Q2EA 2R4GA 2Y9YA 4HA8A 4QPQA 2DI3A 3GLLA 4GYIA 5K5QA 4XSZF 5L3GA 1IDYA 4IZZA 3HGGA 3TBIA 3GFIA 2ZC2A 2P8TA 3FKIJ 4MLOA 2V1XA 4RMNA 2DJNA 1GHCA 5D4RA 1RI7A 1XD7A 3IRRA 1KU2A 1XSVA 1HDDC 2CFOA 4OAZA 3ERED 2ZFWA 1ZR4A 1N25A 1QZEA 3I58A 3I5UA 4E7KA 3H3VK 1EF4A 2NNYA 3RIRA 5F04A 1LDKB 4XKCA 2O3FA 5A2QZ 2CFXA 2JA7J 3GZNB 2JWTA 1J75A 3S2HJ 3PQKA 2LFBA 2EA4A 2F5FA 2KKOA 4RLQA 1FP1D 2A5WA 3QP5A 2IP2A 3K0LA 3SFZA 3HIFA 5HLGA 1FP2A 4UHTA 2EFNA 4EVIA 2QBYB 1T0FA 3TW6A 3DPLC 1NHAA 4CYCB 4RB0A 5FJ8J 3CQZJ 3H9JA 3FKJA 5E1ZB 4WK8F 1FIPA 2DDAA 3KP3A 1W36C 3EETA 4YIIA 2XGXA 2ZKZA 5L3DA 5DTDA 5E1XA 1Y1VJ 3MQ0A 4UUSA 3MEXA 2YSRA 3ELKA 3ZMDA 4RB3C 1FWZA 4BBRJ 2OTLI 1ZHFA 1FYLA 5K5RA 4MEXF 4XSXF 1UJ8A 3GWZA 4XK4A 2GIZA 1BOBA 1ERDA 1LPQA 1Z1DA 2P5KA 4I01A 3TP3A 3RKWA 1WGXA 3MFKA 2CWEA 4M6XA 5LHHA 3HOWJ 3EQLF 4F55A 2JVHA 3U1DA 3S2DJ 3HDDA 2XGCA 4W1UA 5HVQC 3L2VA 4KT6A 1Z7UA 1EV7A 1BOAA 4CDGA 5ICGA 2XC7A 3BTIA 3F8NA 1ZGWA 3CP8A 3I0TA 2LOOA 3JRCA 4IVNA 1WI3A 2QVOA 2W24A 4D9JA 5BNGA 2EINH 3T0YA 3DP7A 1LFBA 5K7HA 1ZLJA 2XB5A 1TBXA 1Y39A 5GPCA 2DFFA 3K4LA 5BPDA 3JSPA 2L7KA 1QPIA 1DQUA 3WTVC 1IUYA 2L5QA 2UV1A 1V55H 4LG0A 3GZ6A 3HOYJ 1ZGAA 4ASNA 1X1AA 1JI8A 1ZG3A 4KMUX 2CO5A 2QGUA 4DW6A 4G6TB 1TW3A 1S3JA 5J4VA 1XTAA 4G7ZF 2DA3A 4B8XA 2RAEA 4RM3A 2CUJA 4I02A 3NEUA 1Q1HA 4AVPA 3IAM2 5FD6A 1U3EM 2IS1A 3Q3SA 2R5ZA 2Y30A 2ZMEB 1OMIA 3S3MA 4ZTFA 1B6AA 4XN3A 5J8CA 3F22A 1YO5C 3H35A 4H0EA 4XN0A 2ZNYA 3ABLH 1OCCH 2DMUA 1OLTA 1E17A 2WA0A 3DTEA 4E7LA 1TL8A 3C2GA 1TQPA 1N77A 2L7ZA 4ESJA 3VOEA 1Z21A 2VXZA 3IH2A 1HKTA 2RQQA 3DQVC 4RGSA 1X1DA 5F6FA 1ETVA 2XAJA 1IAWA 4IHYA 1MIJA 1GT0C 2FJ1A 3W6JB 1XGOA 2J5OA 3CJQB 1LKXA 1MJBA 1NG7A 1T08B 3IWZA 5LRSA 3VODA 2P81A 4B4CA 5EGOA 1FLIA 2LNBA 1S7EA 2NXNB 2HQRA 1K78B 3ZQIA 3J80K 3KP7A 3DCFA 3D5SC 2IVMA 1ZG5A 2G9WA 4KUMA 4CH7A 3HSFA 5GPAA 4OIRF 2HDCA 2KIUA 2QEXI 2DU9A 1JT0A 3JTHA 2VN2A 5CVJA 4BEHB 2WBMA 2MLKA 2ELHA 4BGDA 2DDBA 3CUQC 2GQQA 3J81Z 1PP7U 3S14J 4LMYA 2G7HA 1D5YA 3BJAA 3PUBA 5HS8A 4MTDA 1UZCA 2ZO4A 3KE2A 5IYCJ 4MTEA 3E6MA 4ENNA 5DV5A 5F0HA 1UG0A 2K27A 2DW4A 4I0AA 1GXQA 4GGGA 5HLTA 1Z7LA 2JTVA 1XCBA 4FX0A 4IOCF 4L0YB 3FHZA 2NS0A 1DUXC 1SFXA 1O7LA 5GP9A 3I55I 1T2KA 5GTHC 3OYLA 3JSOA 2ESHA 4YIRX 3A2KA 2EH3A 4N9HA 3OOPA 5E3OA 1Z3YA 2FBKA 5JVTA 1X3WB 1FYMA 5F1JA 1BC7C 3BC8A 2HR3A 3JRBA 3O8HA 3M4OJ 3GTQJ 4LLGF 3ZMSA 3Q9SA 5CQGA 4X1EA 2HQNA 1FTZA 5J3LA 2LC2A 4A6DA 2E1MC 2RQPA 4HX4A 3V7SA 1GDTA 3CUOA 2X48A 2DTZA 1OKRA 4B48A 1MMNA 2R7RA 1O3RA 4HG2A 2CMPA 2OTJI 4ZDPA 5GTIC 3DPTA 2TDXA 3GO5A 1SFEA 4RM2A 3OYNA 1JKPC 1CQTA 2PQ8A 4RGRA 4ZZDA 3VEPA 5DS9A 4CXFA 5KAIC 3HOVJ 1WSUA 2HYGD 4GO1A 4NDLA 5FFZA 2QWWA 2QQBA 1MBKA 1DGWY 2OF7A 4XKBA 2X4HA 1W0UA 2XASA 1YX5A 4ETSA 1CF7B 2X6WA 2D5VA 5BS6A 3RQ4A 4A3MJ 2RNJA 2JRTA 4AIKA 1OISA 2X9DA 1HSTA 2DN0A 1UCRA 2IGKA 5ILUA 4GDFA 4CO8A 2IS4A 1U5TB 3HUGB 2BZTA 1D3YA 3NAUA 2KZVA 2ID3A 5C4XJ 2BY1A 2PJPA 3BP8A 4ZTJA 1R58A 2G0EA 5F0FA 4RB2C 1KYWA 2LY1A 4KYWA 2B63J 2OJED 2ACJA 2VBWA 4HV5A 3JTGA 3BTJA 1MSEC 2FD5A 4RAFA 3TMOA 2L0KA 3KIOA 1TLHB 1XMAA 3GYHX 2BY0A 3S32A 1K6YA 2CQXA 3BLYA 5B1BH 3WTTC 1LB2A 2MG4A 4A2UA 1LDJA 1I27A 4L9NA 2IS2A 3RKQA 3Q0WA 3RKYA 1KA8A 3JRHA 1L3LA 4FETA 1TT0A 1HW2A 4B47A 2XRLA 1MKMA 5C3EJ 3L2QA 3OOUA 5GAEJ 4CCMA 3D5RC 3J81K 5M5WJ 4KIFA 4PZJA 2R7FA 1P7IA 2F48A 1SEUA 1S5LC 3VSKA 3GTJJ 4E7IA 3GLXA 3BTLA 5D5XB 4DNCA 1YHQI 3IL2A 1DU0A 4JX5A 4KITB 1ITYA 2JPCA 5FLVA 2VJJA 1D1CA 4XR6A 1WJBA 1IG7A 4XRMA 3CO6C 2MBFA 3LSGA 3IH3A 3JRIA 2CV0A 4A69C 3SZGA 2NVYJ 1R6RA 5E8IA 2CQ7A 1ZTRA 5CVRA 1XN7A 2HU9A 1SVMA 4TV7A 3BT9A 3WG9A 3BQZA 2K9LA 2OQRA 1QBJA 4NC8A 4C3IJ 4UB6C 2NVUB 4RS8A 4M9XA 3OV8A 4F91B 2W84A 5D8LB 3LA3A 1O57A 2FE3A 3OYIA 1IN7A 3CMYA 4GFBA 3P9IA 2ZB9A 4DZPA 4O5VA 5JHUA 2Z99A 3C3WA 3WHBA 1Z6TA 4OIOF 1WCMJ 2LKSA 2V9KA 3ZPLA 2RC4A 3M8FA 3ESWB 3K1MA 2KRFA 3FDYA 2ECCA 4XNFA 1UFMA 4FE4A 3J7AY 3ZGKA 3E6BA 2IA0A 2PI0A 1R1TA 2X6OA 5JI6A 2VPRA 1ZR2A 2KQRA 2A05A 4U0YA 2L02A 2J5PA 2K3FA 4IQJA 2VPLA 4HNVA 4HF1A 1X3ZB 2BVMA 2O8XA 3K2AA 4WF2A 2FNPA 1AKHA 5D8KB 3ZN1A 1V5GA 1FOYA 3BG7A 3K1PA 3GTOJ 3U2RA 2VT2A 3FMSA 2WADA 3DBLB 4ZYGA 2PG4A 4AYBN 1ZQ3P 4XQFA 2P5VA 3H5RA 1SVLA 2DK8A 4XKVA 4Y3OA 1MBEA 1PUFA 3COAC 1FYKA 1KU7A 1DGRM 1TW2A 2IAIA 2XHKA 2QM3A 1MSFC 2HVSA 3F9KA 1I39A 4MNUA 3K4JA 3HOTA 1X58A 2QUFA 4UVCA 3CDLA 3A0HC 5EDNA 1H89C 2FU4A 3MCZA 5IT9K 3R0AA 5FKOA 4XOTA 5H6RA 4G6QA 3R0JA 2O6GE 3QPHA 1LQ1A 4AWXB 3QOPA 4ENMA 4MHGA 1P4XA 1LE8A 3ABUA 3DEEA 3S16J 4KDPA 4BJTA 3DTKA 1I5ZA 3V8KA 3H5NA 4HV6A 4N4NB 3K70D 5FO5A 4XRSA 2BHZA 2VQLA 4W97A 5EJCA 1Z3XA 4U7DA 5DD4A 5D5UB 1VQMI 2ZJ2A 3B6CA 3TL4X 2IGOA 4AYBA 2RDPA 4ENKA 2GBYA 2LR8A 2VLAA 4JX6A 5E3LA 1HW1A 3TO6A 4LOCA 3ONQA 3ZCOA 1JT6A 2E7WA 1APLC 5TGTA 4KFCA 2L7FP 1QQIA 1SAUA 3H3ZA 2PFBA 4Q5SF 2ISZA 1G3SA 3KPHA 2EZHA 2ISYA 4OIPF 2QA4I 1IXRC 1OYWA 2DQLA 5HS9A 4HSTA 4N9IA 1YJWI 4XM3A 4NB5A 2H1LA 4BS9A 1IV8A 2LLKA 5LGTA 1EH8A 2TRTA 4YG2F 1OCPA 1LVKA 1S29A 4OU0A 3ZR8X 4IKFA 3F6VA 2F6CA 2K9NA 4QLCU 2LRDA 1PP8F 2EIJH 1U9OA 3LSJA 3B02A 4LIUA 4M72A 5J6XA 1R4MB 2WTEA 4BJ5C 4DGWB 2MA3A 2AQFA 4J00A 4BQQA 2GA1A 1W7PD 4XIDA 1LUJB 3E5QA 3J7YJ 2JUGA 3HRSA 2K9QA 3C7JA 1R71A 2BBYA 2KIFA 3I54A 4GCVA 3SDGA 2PJRA 2ICWG 4D1QA 4P9UA 2NS7A 2A5YB 3G1LA 3I4MJ 2PN6A 1YS6A 4NC7A 5FKKA 3LA2A 1J9IA 4E70A 2ECBA 5CLSA 2YX4A 1IRFA 3BROA 1X19A 4IQ4A 3GBGA 4EMSA 3Q0VA 3FM3A 3HSEA 2KT0A 5D6FA 2Z33A 3GTMJ 3ABTA 3S15J 3GZ5A 3E97A 2VKEA 4RB1A 4O6JA 5KVRA 2E60A 1X3UA 3M8EA 4N4OB 4L0ZB 5JR3A 1ZELA 3OYMA 3W6VA 3H5AA 4XLCA 2ZJQF 3HGYA 2YU3A 3J7AO 4CCNA 2JJ7A 3GUDA 2O8KA 1JHHA 5ICCA 3LAPA 2RN7A 3OL3A 1XX5A 2LTPA 1GV5A 2X51A 2HOTA 2ETHA 2LKPA 3CUQA 1Y6IA 3A03A 4EM2A 1ORKA 3ZOBA 5J8FA 2CUFA 2MC3A 1FY7A 2CRGA 2H8WA 2HOAA 1S72I 3BPXA 4LLNA 1FBQA 2QKLB 2DA2A 4BQNA 3ZQCA 5K5OA 2H94A 1A35A 1YG2A 1FT9A 1W4MA 5HDKA 3CO7C 2W25A 3ZMZA 1OJLA 2M0CA 2VI6A 3BCBA 1OYIA 3HM5A 2P7VB 1UB9A 1ZRFA 2NAZA 1B9MA 2FXAA 4A3IJ 3V8JA 1XPXA 4EJOA 2W48A 1JKOC 4IJAA 1JKRC 2K02A 5JLXA 3K4NA 1BR1A 3R4KA 4M6YA 1D0ZA 3BPVA 4QPOA 4G8XA 4FISA 1R5HA 1O4XA 4Q4ZF 1WJAA 4LK0F 2VKHA 3V7CA 4LK1F 2GXGA 1JJ8C 4C2MJ 2EV0A 3D0SA 1AU7A 2VE9A 2LREA 2ESNA 2VE8A 2GOXB 1YW7A 1J7KA 2LYCA 3G1MA 3S3NA 5J40A 3RI4A 3SXYA 4NUBA 1AKHB 2R7SA 4C30A 3PUFA 3V4GA 1VF9A 5DUKA 2VBZA 2GIVA 5IOYA 3VPRA 5DM6F 2Z1DA 2DOAA 1W36D 3I56I 2ZSHB 3E6DA 1XGSA 2MD0A 4IRIA 1ZLKA 1MW7A 2A68F 3RDIA 1S7OA 1USSA 4XL9A 4A93J 4UB8C 3IH4A 3AG2H 1XDUA 4ANJA 2CV2A 3L7WA 5DCFA 5JVGF 2V26A 2P6TA 3QRFF 2GXBA 1Z9CA 4BH9A 3PL8A 3EYYA 4EJWA 3OYKA 2CW0F 3FXRA 3TOBA 3CZ6A 4RAGA 3LWFA 2A61A 4OOIA 5M5YJ 2VODA 4P55A 5H20A 1FOWA 4YFXF 1D8KA 2Y0SA 1X1BA 4CGZA 4YFKF 3KETA 4BE1A 2EZLA 4JYKA 1XSXA 1LE8B 2R7DA 4R8HA 3MWMA 5ICFA 5FKLA 2NRAC 1JUMA 4NNJA 1SAXA 4G7OF 2LH9A 1B59A 3BZCA 2E1NA 5FGMA 2EFWA 3I59A 1MNEA 4PJNA 4PCQA 3QOEA 3CF5F 1SD7A 1YW9A 3LSMA 3S8PA 4C3JJ 2M7AA 1ZKGA 3KLNA 2M8GX 2O0YA 2VKVA 4AIJA 1J0RA 2JA6J 3FMRA 4L5JA 5LHIA 4JOMA 2V6EA 5B3SH 1IXCA 3CJRB 2HVQA 4AIDA 4XLNF 4HF0A 1VQ9I 3MZYA 1X2MA 3X2QH 1X4OA 3AL0C 3G1OA 3DV8A 1CGPA 1XGNA 2I10A 1MH3A 1YTYA 3FBNB 1D1BA 2M87A 3KX2A 2F4MB 1IRZA 2A69F 2A07F 4HF2A 3G6EI 1P7JA 4LD5A 4BNCA 3D5LA 1WKMA 5IYDJ 3A02A 4B3XA 2XAUA 1LDDA 2XAHA 3BY6A 2PLYA 2CG4A 4JQFA 2DPDA 4RA2A 2M4KA 2XIGA 1XDSA 1EJ9A 4WXDA 4BAYA 3N97A 3QU3A 5KCMA 3SQNA 3AAFA 3JRDA 4HQMA 3GX4X 4E4HA 2Z5UA 1B8IA 4BDZA 3F8BA 4RGXA 1RIOH 2HNHA 4BHBA 5DCMB 4HDVA 1VQ4I 1FC3A 2O03A 3LOCA 3G73A 3WODF 1R1UA 2PJRB 3FISA 4A0ZA 1NG6A 3DTIA 4M3BA 5L3BA 4OWRB 2VBYA 3WE3A 2XKPA 3HOUJ 2YS9A 1POGA 4DQ2A 1FSEA 4A0XA 2YU9J 3F3XA 1JKQC 4FX4A 1YQAA 4UVAA 5H6QA 4RAYA 2X6YA 3CJTB 2R7UA 4X6AJ 4BACA 3LA7A 3GFMA 3ISPA 3P7NA 4E6KG 1FZPB 4KICA 1X4PA 1WPKA 1FJLA 3OYJA 4DOZA 2HGCA 2UUZA 4NQWB 3CD6I 5A2QK 1MMSA 4CCKA 4CYDA 4OAYA 5AIPA 2HI3A 4D7NA 1G6NA 3P5JA 4KJZA 4NBQA 1VQKI 3REOA 4XICA 2EILH 2I8DA 4M71A 2OA4A 3RTRA 1H9TA 2B0LA 3DWLE 1EH6A 1BA5A 3MMYB 2M34A 2BXYA 2VJIA 3CUQB 4XORA 5EYRA 4M9ZA 2F2EA 2FMYA 3OMYA 1BN5A 1F1ZA 2DFEA 3CC2I 5EZGA 2DAOA 2R0QC 3SZPA 3S2WA 3L2UA 2K85A 5GADJ 1SD5A 3VSLA 3JRFA 1B72A 3K69A 5FB2A 1ZARA 2PX9A 5H2FC 5DEQA 4DJAA 2K5CA 2PMZN 5F0CA 1BI3A 2X1EA 3MKWB 1ZRDA 2FOWA 5HNHA 2HYJA 2Y2ZA 2X1DA 4IXAA 3TQNA 4MIMA 1ON1A 4ITVA 1Z0XA 5IP9J 3K6GA 2R7VA 1FNNA 3DFGA 3HJEA 3DKWA 4D7MA 1K83J 1QU3A 1TT5B 4ZDOA 3JRGA 3IWFA 1ODDA 2VJ4A 3N4MA 2R7OA 2OV7A 5K1YA 4I6ZA 3ABMH 3KCCA 3K7AJ 2KRHA 3DLAA 2EFPA 3MVPA 1B1BA 3TW7A 1EKEA 3WTXC 2R5YA 1RNLA 2STTA 1P92A 3G2BA 1RUOA 1STZA 3LFUA 5F08A 5HNFA 1VNDA 2Q2EB 2NYXA 2L9RA 1T95A 1IV6A 2XV4S 2CW8A 1UHWA 4XONA 1VQ7I 4DIQA 4ZYEA 1UMQA 5IP7J 3HOZJ 2DLLA 4U7BA 3T8RA 2HPMA 2R92J 3KP4A 2XKOA 5M5XJ 3RKXA 3NQOA 2PMZA 5EF6A 3E6CC 4L9VA 3FXKA 4LG3A 4KN7X 2H6BA 2OD5A 1Y8QB 1TWAJ 3SHFA 1MBHA 4U87A 3K4CA 5EEGA 3CLQA 5ILSA 4HOBA 1FMWA 5HOOA 1U78A 1O3QA 4EGYA 2FQ3A 5BMZA 4JX4A 1SMTA 3K4KA 4JK1X 1S7AA 2BEOA 2PMHA 3IRQA 3VWBA 4GRIA 3L2WA 4HX8A 2I5UA 2LD5A 3BR5A 4S05A 1HLVA 2UZKA 1ZK8A 3I4NJ 3FHNA 3H1CA 3QYBA 4WCGA 5IYBJ 2R3SA 4PSWA 3PJRA 2X85A 5TJJA 4ZYHA 1SANA 1WWXA 1HSJA 1FX7A 4U88A 4UUSB 1RETA 2HDWA 2WAQA 3EUHC 1OR7C 4XLHA 3ZQGA 2HOEA 3CCMI 2Q0OA 1NK2P 2CV1A 1ZYRF 4A12A 2ME0A 3Q5FA 3I59B 3PQJA 4CCJA 2HQAA 1GVDA 3FIWA 2G7UA 5FLXZ 2E5ZA 3LQRA 4V2FA 3M8JA 2VONA 1TQIA 3WGGA 3WHCA 4M9SA 2WY8Q 2Z2SB 3QAHA 1W7PA 4A3EJ 2ADUA 1Y0NA 3F72A 2KPMA 2NOJB 3O2PE 1XCVA 2AHQA 3ERMA 4AVZA 1O3TA 2H1KA 4BU2A 2DA7A 3MKYB 1V4RA 1MJAA 2FBIA 4PJJA 4PFOA 5IOZA 4BHPA 3ZQFA 4E7JA 2D2WA 2M3AA 2ZFUA 3CC7I 2M5WA 1FBSA 2LMDA 4GYGA 3RYPA 4CZCA 3UKGA 4PGHA 1ZG1A 2VKDA 4HW0A 4HNTA 1U5TC 3MN2A 2JQ7A 5EZHA 1YITI 3LSPA 1HC8A 4ZH4F 3HHGA 2KRCA 4LG0B 3WE2A 3DXJF 3VYSB 2HVRA 2XUBA 4LITA 3KEQA 2Z9OA 1XC5A 3L9FA 3NWSA 2XGEA 1TNSA 4V2GA 2H27A 2QLZA 3HL2A 1JE8A 2Y31A 3BR2A 5L3CA 4BJ6C 2R7TA 3DBHB 4C3HJ 4JP0A 2R5ZB 3RYRA 3TO9A 2BVLA 2XGDA 2XDVA 3JAMZ 4RDUA 1G3TA 1BJZA 2OZUA 3TOAA 1OPCA 4I76A 4BXUA 1DP7P 1YX3A 2HKXA 2PBIA 1Z67A 3EUAA 3KP5A 4ZZLA 3H0GJ 4G7HF 1C0WA 2EPFA 1YFHA 3BR6A 3M1EA 1KQ0A 3KFWX 4XRSG 2CU7A 2V1NA 1NH3A 2HQ5A 2Q1ZB 3BG3A 4K2EA 2E36A 1Y56A 2H6CA 2E34A 5EGOB 2IT0A 1AA7A 4L9TA 1FOKA 5LLQA 3S93A 2VXDA 4A3GJ 3KYDB 2PMUA 3I3LA 2O61A 2DYSH 1ZAOA 3WU0A 1AOYA 5LD2C 3PO2J 5CVUA 5ED4A 2QSGX 2E19A 3BJ6A 4Y52J 4OIQF 2NVQJ 4CCLA 3HG9A 2DQRA 1T39A 1HCRA 1ON2A 1P6RA 1FOXA 3P9KA 4G9YA 2E35A 2KISA 3ASOH 3CP2A 4XLFA 2MH2A 2MSYA 1UHSA 3DEWA 3I71A 5EEHA 1HBXG 1A6IA 2L01A 4BHCA 1P9QC 3BOQA 1NK3P 3QYEA 4BBSJ 3QODA 4Y15A 1U9NA 3O8GA 3W2WA 4BDYA 3PM1A 2GA2A 3SJMA 2FX0A 2WV1A 2HFHA 3KLOA 2KFDA 1MNMC 1JJ6C 4DYRA 5FLXK 2JSPA 1MGTA 2CQQA 3BR1A 1PDNC 2Y0MA 4NHJA 5E79C 3CMMA 4B44A 1E3PA 1V5FA 4HRIA 2OBPA 2FQ4A 4E7ZA 3QPTA 5TISC 2R5YB 4J19A 4U0WA 5L3FA 3TDUC 3FM5A 2CH0A 2VQHA 4ABZA 1D1AA 3PFIA 1T56A 2KZGA 2VC1A 4EV0A 1KQ9A 2K4BA 1LFUP 3QYFA 3R6SA 1N78A 2VQGA 1T33A 2K3PA 3GMEA 3IKTA 3HXLA 4AIHA 3EUKL 3UR3C 3KEYA 1O3SA 4Q47A 4LLLA 2HDDA 3BCAA 1FMVA 1K7AA 3KZIC 1HKQA 1MBGA 3LSKA 4Z6YA 3V42A 1DPRA 4S04A 2DPUA 3C2BA 5CPRB 3HEFA 2VBXA 3A1YA 3DU5A 4CCOA 5D5WB 2DMNA 2LF8A 3IHUA 1N75A 1QRYA 3MKLA 1YS7A 2EJRA 1WJ5A 1HOMA 4CA0A 4HNUA 3RJPA 1E3HA 1X1CA 4KN4X 2YX7A 2W82A 1JGSA 2MC4A 2XAQA 1MBFA 1Z91A 1I6XA 1JGGA 2BV6A 3M07A 3GTGJ 5LGNA 2VIXA 1YJNI 2KMUA 2OCEA 2QQ9A 2MW8A 2V1DA 1K4TA 3WTUC 3ECHA 2YR2A 2OZ6A 2NS8A 2VT3A 1AHDP 3OYCA 1E2XA 2QKMB 1J5YA 1MBJA 4DYCA 3WU2C 3WTWC 2QF7A 2FOKA 1D0XA 3A01A 3PNVA 4EM0B 3QPSA 3M1CA 3P9CA 2JSCA 1RKWA 2LY2A 3B6AA 1XMKA 1W5CC 2CUEA 3E1SA 2JZYA 2FNAA 3ZMUA 4BQOA 2DODA 3VYTB 4C9YA 2W1OA 2W85A 3BR0A 1TWGJ 4HSRA 1W7PB 3F21A 4Y13A 4ZJZA 1VFCA 4XLEA 1BBYA 3CCVI 2ZBKA 5F27A 1SMYF 1LJ9A 3UNGC 2O7OA 3VYUB 4FASD 3OIQA 5B66C 4O3MA 1ULYA 2BE5F 4BKXA 3CMEI 1WRJA 3L00A 1WJFA 4AUXA 1H8AC 4MO7A 3SYTA 1P4AA 4BE0A 2QYOA 2JN6A 1A04A 2L2OA 4PJ0C 2CUZA 2LBFA 3GF2A 3GTPJ 5BPIA 1EA3A 1IO2A 3E7LA 3F0CA 3R60A 2L4AA 3OY9A 4B09A 1ZGJA 5LBQA 2ID6A 5KK1A 3FZVA 2AXLA 5E20A 2MABA 2EZIA 1W1WE 3LSHA 3WTZA 2L3DA 4L9JA 1QVTA 1BIAA 1JUPA 2OUMA 1OCTC 3DKYA 4S0HB 4ZYDA 1MDMA 2RNGA 2EWNA 5K7FA 3HRUA 3Q0UA 3DPUA 4PGGA 4IF4A 4HPQA 2XPVA 3BG9A 3GXOA 4IX7A 2DT6A 3GFLA 1IUFA 4PK4A 4DYQA 3S17J 2BY3A 3K1NA 3CTAA 2KDZA 1U8RA 2ME6A 3C2HA 4L5IA 4UUVA 4HZFA 2WWYA 4YRVA 3H3UA 4MFEA 2RREA 2DMPA 3HRMA 1IN4A 4B43A 4L18B 5J1YA 3HC7A 2Y0SN 4HX7A 1JUSA 1OQYA 4KT5C 1RPWA 4M6VA 5LGUA 3KP6A 5AONA 2IEKA 4G94A 4HEA2 5D4SA 3E5XA 3FXUA 3HOSA 3DF8A 2K40A 3FWEA 2EA2A 4IHTA 4RAZA 1YLFA 2WC2A 5IY5H 4A3KJ 1KQ8A 1WH7A 1IN6A 3CLOA 2XAGA 4LGWA 1XGMA 4QIWN 2WAEA 4CICA 3ZRGA 1IZ1A 4G6DA 4UUTA 1BW6A 4Y33A 2RGVA 1VQ5I 2KIMA 2NNNA 3BTCA 4F92B 2GAUA 1ZN2A 2P7CB 3PNTA 5DDGA 1PUFB 1SC7A 2EV5A 3N05A 2GOMA 2K9SA 5IT3A 3S1NJ 5DYMA 1DPUA 3ABKH 3SZTA 2K86A 4AC0A 5C4JJ 4D0PA 1KU3A 4BYYA 1K4SA 3FXQA 3LQQA 1B4AA 5J4YA 2E5NA 2JA5J 2VUMJ 3U21A 4IEJA 2IA2A 4FE7A 4B1RA 1V5EA 2MFZA 4II2A 2E2JJ 2L9SA 3BZKA 2FSWA 3HRTA 3EUHA 1OR7A 5CQEA 1OFCX 4C2TA 5FKNA 1TP4A 2E1OA 3M3YJ 1DU6A 3HPHA 1UAAA 3AG4H 3VB2A 2XAFA 3MZHA 1WJEA 1ETKA 2V1UA 2OCCH 2DA5A 2C6YA 1V54H 2V79A 3J80Z 2HZDA 3I53A 4IO9F 4EGZA 4HQEA 2KHMA 3HYIA 2VB6A 2M7BA 1G8XA 3DEUA 2FBHA 2EQRA 2Q8KA 4A5MA 5CJ9A 3S3OA 3U1KA 3OS0A 3T8TA 3E3VA 4BY7J 2EIKH 2HOSA 2O5RA 1GV2A 2EIMH 3GVAA 3C18A 4OINF 2IRFG 1U6GA 1Z77A 4A3DJ 1L0OC 1CF7A 3AL0B 5FRNA 1YRNA 2HKOA 2Z16A 3W2VA 4PSXA 1VQ6I 2DYRH 3HKZN 1R23A 3Q9VA 2KP6A 2L4MA 1LEBA 3I4PA 1VQOI 5DM7F 1U5TA 3HUGA 2A6HF 5E1WA 4I2OA 4HLXA 2RKHA 3BWGA 1ETWA 2COMA 3JR9A 1ZH5A 4A3CJ 1O7FA 1YOVB 3FXLA 1H0MA 1K79A 3ZMTA 5M3MJ 4I0BA 2X6XA 3KEOA 4GXOA 2OAZA 2VJ5A 4N0BA 4XOPA 2GZWA 3PNYA 2QENA 1P2FA 1M1EB 2WB1N 2B7EA 4ZDLA 4DBQA 1HXDA 2IBDA 2ZXJA 2L9VA 1F4KA 4P9FA 4YELA 2FRHA 3MD2A 2E2HJ 3IKVA 2GXAA 3TKYA 1I3QJ 2PEXA 2IGNA 3K4MA 2QSFX 1W5TA 2ZXHA 2LG4A 4QSHA 3VYRB 1SD6A 5D5VB 4AU7A 4IHWA 1ONVA 1RESA 3A01B 2VQCA 3U9GA 2DJIA 3B73A 4FCYA 4V19K 1F36A 3CJNA 4YIFA 1I1GA 3OR2C 1HA8A 1ETYA 3HKZA 3OYFA 1KONA 2DTRA 4XKWA 1IJWC 3E5UA 2XB0X 4M3EA 5KHDA 1I50J 4A3BJ 1BR2A 4EJTA 1T6SA 5C44J 2XSJC 2EFQA 1I1SA 1B9NA 2W4SA 1BC8C 2STWA 2CS3A 2IXSA 1IW7F 1PJRA 2RV8A 1D8JA 3AKZA 3RZOJ 3QWLA 1WJCA 3K4BA 3PIOF 3SFIA 1GVJA 5AIQA 4G12A 1J09A 3L09A 2DXIA 3CCRI 5EG0A 2D1HA 2QQ8A 2F5VA 4CSWA 2WB1A 3BG6A 2ZMEC 3GTLJ 3GW2A 5HDGA 2XF7A 3C1DA 2DK5A 2LBFB 2XROA 4Z2YA 1S8NA 2V6CA 1RKTA 4LFUA 1QHHD 3E0JB 1FIAA 3I64A 3ZQHA 1RR7A 2VL8A 3CCEI 5IP6A 4WXCA 2WAFA 1U2WA 4P1WA 5CVVA 1YI2I 4WWCA 2B9SA 2HPIA 3CDIA 4IHSA 4IHVA 2XRNA 3DKXA 4IRHA 1E0EA 2A3SA 1MMGA 1H9GA 1R7JA 5ILVA 4AM3A 1MDMB 1GXPA 3OWTA 1J59A 3W3CA 2ZXIA 3HBLA 4LJZF 1BR4A 2IS6A 1MJ9A 4KISA 3OYHA 2LSOA 5KNLA 1HDPA 1XMXA 2BY2A 3LSTA 4F52A 3EYIA 2LK2A 1JHFA 5E3MA 2FA5A 4A5NA 3A4CA 2VOOA 1A5JA 2W00A 3IV5A 2ZCWA 2XF6A 4P96A 3AFHA 1WZ2A 3FF5A 4CUGA 3JREA 5LHGA 2LF7A 1HF0A 1EH7A 3WG7H 2HYFA 3OYBA 1DP3A 4UXNA 2K4JA 1QZYA 4BXFA 1IF1A 5GAGJ 2F5DA 2M1BA 1TC3C 2DA1A 3HPGA 5ERIA 2YPRA 4PJLA 1D0YA 2LY9A 3PIPF 2V7FA 1REPC 2E1MB 2WAQN 5E3NA 1TWHJ 5HDNA 1G59A 1ETQA 4BQAA 1K6OA 3ZMVA 2K7LA 3LL7A 2UWMA 3L1PA 3FX3A 2JK3A 3LNQA 2BOLA 2TCTA 2KLOA 2HXOA 3BZ6A 1Y0UA 4LB5A 4EJUA 1IDZA 3AG3H 3TGNA 2K9MA 4AD9A 1NTCA 2GWRA 2H09A 1TTYA 1X1PA 2L9NA 3MAJA 4ESFA 4H4KC 2HWVA 2MD5A 1RC9A 1ETOA 2MH9A 2P0WA 1HW5A 2FMLA 3KP2A 3WU1B 2O9LA 3QU6A 2IJLA 2YUSA 3OYEA 3OSFA 2E1CA 1BIBA 3ZP5A 2OC6A 4BE2A 3F6OA 2BW3A 2P6SA 3RZDJ 4DZJA 4ESBA 1XS9A 3MKZA 2AO9A 4A3JJ 1FPQA 2M0MA 2R7XA 4KA4A 1VQ8I 4Y17A 4A6EA 2Z3YA 1PVEA 2BGCA 2KIQA 3AG1H 3FBIB 2M8EA 5E18F 1R00A 2VC0A 1A6QA 1BM9A 3BG5A 4F7ZA 3F8FA 4BUPA 5GAHJ 4BY1J 2M9HA 1IRGA 4OMZA 1JTXA 1S6LA 3J7ZI 3ASNH 5J47A 1RUNA 1HKSA 3K10A 3VFZA 4ON0A 5FRMA 3WGIA 3HTUA 4UY8I 2HZTA 2HXIA 4MGRA 1YIOA 2CQKA 3JCUC 1JXSA 3T1BA 5LEKA 1ACIA 2DOFA 1GLNA 5DUIA 2LKXA 2HTSA 3CDHA 2OPTA 3CCLI 5LRRA 1R9TJ 4HLYA 1A36A 1YRNB 2CGPA 2GM4A 1R5GA 1LVAA 1QO0D 2QZ8A 1T0FC 2ZJPF 2H8RA 1BI1A 3K2ZA 4EEFG 2JA2A 2CSOA 2NOGA 1QA6A 2DA6A 2ZNZA 3KZYA 4I98B 3CC4I 5IT9Z 3R61A 3ECOA 5IPAA 2AS5F 2DBBA 1WHUA 4L5EA 1BI2A 2CJJA 3L2RA 3OYDA 1SFKA 5ICEA 3OYGA 1F5TA 2V9PA 3H9GA 1G4DA 4A3LJ 5TRDA 2MGQA 1FBUA 2ZSIB 2ELJA 3PSIA 4ZC3A 1R4NB 4RBOA 4EM1A 1DDNA 1QGPA 1SFOJ 1Y1WJ 2DMTA 1W5SA 2F4IA 3I9V2 2EK5A 4BL0B 1WI9A 2JMWA 4XBFA 2KDOA 5BQTA 1MZBA 2D1VA 4D5FA 3EDPA 3IC7A 4J01A 1BL0A 4A3FJ 2GLOA 1B8IB 2DT5A 2VASA 3QP6A 5JHFA 1YW8A 5CYVA 4QTRA 1QVUA 2WV0A 3ZQQA 5B5EC 1WH5A 5E8GA 4CHUA 3SEQA 3OSGA 4IPAA 2EV6A 1I3AA 1OCRH 2V4JC 1U0JA 4F3QA 4XRFA 2KJCA 4UNOA 2Y69H 4II3A 2VOPA 4DBRA 1YE9A 2FEZA 4EJVA 5F64A 2V9VA 5F1RA 2EB7A 3RSNA 3RPUA 1GUUA 5CKTA 5EG0B 1YYVA 1ZREA 3PO3J 4IHXA 2XF5A 2CQNA 2IA1A 2E71A 1WVRA 3DU6A 4Y4RA 3ZXSA 3LMMA 3G71I 1BJAA 2F5CA 2Y9ZA 1IC8A 2ELKA 3QQAA 5HLIA 5J1RA 1T38A 1AWCA 5K7ZA 5FFXA 2M2EA 3VDXA 5CVIA 2UXXA 3OS1A 4KIBA 1KZHA 4QWQA 1B72B 1T98A 4FTHA 3CMAI 2L7MP 4M3DA 4CZZA 3BQYA 4ENJA 2IGMA 4E7SA 2JPBA 3OR1C 5FROA 6PAXA
chains in the Genus database with same CATH topology
2F5EA 5LEJA 4JBAA 3GFJA 3LFKA 4FHTA 3BJOA 4XLPF 3M7GA 4M74A 4LB6B 3GEZA 4Q48A 3FMQA 1R1VA 2KJBA 4EQQA 2CYYA 3O6BB 4HBLA 1LNWA 3RPQA 3ULQB 2MLGA 3L2CA 1RZ4A 4M73A 4R1HA 2QBYA 2P4WA 4KIGA 1ZRCA 1IXSB 1BI0A 2D45A 2EFOA 1TQMA 3ROUA 3W6KB 5BOXA 2Y75A 4OMYA 1G3YA 4WX9A 1XB4A 1R36A 2E7XA 1IN5A 4U0VA 5HS7A 5FD5A 2IW5A 1FSHA 1QNTA 1VTNC 1TNTA 3F23A 5HLHA 2JT1A 1SFUA 2DO7A 2OQGA 4YFNF 3JAMK 3V7RA 3O3KA 4I09A 4RGUA 3WTYC 3G3ZA 2XVCA 2IPQX 5E17F 4P5OA 4KMFA 1KU9A 4WXHA 4FT8A 1KGSA 4IRGA 2QQAA 5JFRA 3TDZC 3F8CA 1PUEE 4UV9A 2LDUA 3BDDA 3TO7A 4HDUA 1V3FA 4KNYA 2HS5A 2Y48A 3F8MA 2BYVE 3HSRA 3NRVA 4HAMA 1R22A 2FF4A 2ZMEA 3WGHA 5DCMA 2W57A 4MEYF 1D5VA 1XSDA 3ML6A 2HEOA 1HQCA 2UXNA 3M9AA 1OYYA 2M45A 3ZN0A 3WTSC 4NQWA 3ZQ7A 2DFIA 1IN8A 1KYZA 4UV8A 1K78A 3H92A 4PDKA 1J2XA 3LAJA 1UHMA 1F9NA 3K9TA 3V8LA 2HTJA 2RVCA 4A0YA 1QPMA 4MQ9F 4MQVA 3KZZA 1SD4A 3HTSB 3T5XA 1P4WA 1LEAA 4UVBA 1Z6RA 1QZZA 1Z05A 5D6EA 4I7HA 2A6EF 4R79A 2P5LC 2OU2A 5L3EA 5DD8A 4HYEA 1USTA 3HHHA 2M30A 1WQ2A 2L54A 3JW4A 1MD0A 2X0LA 1G3WA 2Q2EA 4HA8A 2DI3A 4GYIA 5K5QA 4XSZF 5L3GA 3GFIA 2P8TA 2V1XA 1GHCA 5D4RA 1RI7A 1XD7A 3IRRA 1KU2A 1XSVA 3ERED 2ZFWA 3I58A 3I5UA 2NNYA 3RIRA 1LDKB 2O3FA 5A2QZ 2CFXA 1J75A 3PQKA 2EA4A 2F5FA 2KKOA 1FP1D 3QP5A 2IP2A 3K0LA 3SFZA 3HIFA 5HLGA 1FP2A 4UHTA 2EFNA 4EVIA 2QBYB 1T0FA 3DPLC 1NHAA 4RB0A 5E1ZB 4WK8F 3KP3A 3EETA 4YIIA 2XGXA 2ZKZA 5L3DA 5E1XA 3MQ0A 3MEXA 2YSRA 3ELKA 3ZMDA 4RB3C 1FWZA 1ZHFA 1FYLA 5K5RA 4MEXF 4XSXF 3GWZA 1Z1DA 2P5KA 4I01A 3RKWA 3MFKA 2CWEA 4M6XA 5LHHA 3EQLF 3U1DA 5HVQC 1Z7UA 1EV7A 1BOAA 4CDGA 5ICGA 3F8NA 3I0TA 4IVNA 2QVOA 2W24A 3T0YA 3DP7A 1ZLJA 1TBXA 5BPDA 3JSPA 3WTVC 1IUYA 4LG0A 3GZ6A 1ZGAA 4ASNA 1ZG3A 4KMUX 2CO5A 1TW3A 1S3JA 4G7ZF 4B8XA 4I02A 3NEUA 1Q1HA 4AVPA 5FD6A 1U3EM 2ZMEB 1OMIA 1B6AA 5J8CA 3F22A 1YO5C 4H0EA 2ZNYA 1E17A 1TQPA 4ESJA 3VOEA 2VXZA 1HKTA 3DQVC 4RGSA 5F6FA 2XAJA 1IAWA 3W6JB 1XGOA 2J5OA 1MJBA 3IWZA 5LRSA 3VODA 1FLIA 2LNBA 2HQRA 1K78B 3J80K 3KP7A 2IVMA 1ZG5A 2G9WA 4KUMA 3HSFA 4OIRF 2HDCA 2KIUA 2DU9A 3JTHA 2VN2A 5CVJA 2MLKA 2ELHA 3CUQC 2GQQA 3J81Z 1PP7U 4LMYA 2G7HA 3BJAA 5HS8A 4MTDA 3KE2A 2ZO4A 4MTEA 3E6MA 4ENNA 5DV5A 2K27A 2DW4A 4I0AA 1GXQA 4GGGA 2JTVA 1XCBA 4FX0A 4L0YB 3FHZA 2NS0A 1DUXC 1SFXA 1O7LA 1T2KA 3JSOA 2ESHA 4N9HA 3OOPA 2FBKA 5JVTA 1FYMA 1BC7C 2HR3A 4LLGF 3ZMSA 3Q9SA 2HQNA 4A6DA 2RQPA 4HX4A 3V7SA 3CUOA 1OKRA 1O3RA 3DPTA 2TDXA 3GO5A 1SFEA 2PQ8A 4RGRA 4ZZDA 3VEPA 4CXFA 1WSUA 2HYGD 4GO1A 5FFZA 2QWWA 2QQBA 2X4HA 1CF7B 2XASA 4ETSA 5BS6A 2RNJA 2JRTA 4AIKA 1HSTA 1UCRA 5ILUA 4CO8A 1U5TB 1D3YA 2PJPA 3BP8A 1R58A 4RB2C 1KYWA 4KYWA 2ACJA 2VBWA 4HV5A 3JTGA 1TLHB 1XMAA 3GYHX 3WTTC 1LB2A 4A2UA 1LDJA 1I27A 4L9NA 3RKYA 1KA8A 1L3LA 1HW2A 1MKMA 3J81K 4KIFA 4PZJA 2R7FA 3GLXA 5D5XB 4DNCA 3IL2A 2JPCA 3CO6C 2MBFA 5E8IA 5CVRA 1XN7A 4TV7A 3WG9A 2OQRA 1QBJA 4RS8A 4M9XA 3OV8A 2W84A 5D8LB 3LA3A 1O57A 2FE3A 1IN7A 3P9IA 4O5VA 5JHUA 2Z99A 3C3WA 1Z6TA 4OIOF 3ZPLA 2RC4A 3M8FA 3K1MA 2KRFA 1UFMA 3E6BA 2IA0A 2PI0A 1R1TA 5JI6A 4U0YA 2L02A 2J5PA 4HF1A 2O8XA 4WF2A 2FNPA 5D8KB 3ZN1A 3K1PA 3U2RA 2VT2A 3FMSA 4ZYGA 2PG4A 2P5VA 2DK8A 3COAC 1FYKA 1KU7A 1TW2A 2XHKA 2QM3A 4MNUA 3HOTA 2QUFA 4UVCA 2FU4A 3MCZA 5IT9K 3R0AA 5H6RA 4G6QA 3R0JA 2O6GE 3QPHA 1LQ1A 4AWXB 3QOPA 4ENMA 4MHGA 1P4XA 3ABUA 4KDPA 1I5ZA 3V8KA 4HV6A 5FO5A 4U7DA 5DD4A 5D5UB 2ZJ2A 2RDPA 4ENKA 1HW1A 3TO6A 2E7WA 4KFCA 1QQIA 3H3ZA 2PFBA 4Q5SF 2ISZA 1G3SA 2ISYA 4OIPF 1IXRC 1OYWA 2DQLA 5HS9A 4N9IA 4NB5A 5LGTA 1EH8A 4YG2F 1S29A 4OU0A 3F6VA 4QLCU 1PP8F 4M72A 3B02A 5J6XA 2WTEA 2MA3A 2GA1A 1W7PD 3E5QA 3HRSA 3C7JA 2BBYA 2KIFA 3I54A 4GCVA 4P9UA 2A5YB 2PN6A 1YS6A 1J9IA 3LA2A 4E70A 5CLSA 2YX4A 1IRFA 3BROA 4EMSA 3FM3A 3HSEA 5D6FA 2Z33A 3ABTA 3GZ5A 3E97A 4RB1A 4O6JA 5KVRA 1X3UA 3M8EA 4L0ZB 5JR3A 2YU3A 3J7AO 3GUDA 1JHHA 5ICCA 3LAPA 2RN7A 2ETHA 2LKPA 3CUQA 4EM2A 5J8FA 2MC3A 1FY7A 3BPXA 4LLNA 1FBQA 5K5OA 2H94A 1YG2A 1FT9A 1W4MA 5HDKA 3CO7C 2W25A 3ZMZA 1OYIA 2P7VB 1UB9A 1ZRFA 2NAZA 1B9MA 2FXAA 3V8JA 4EJOA 4IJAA 2K02A 3R4KA 4M6YA 3BPVA 4G8XA 1R5HA 4Q4ZF 4LK0F 3V7CA 4LK1F 2GXGA 2EV0A 3D0SA 2VE9A 2ESNA 2VE8A 1YW7A 1J7KA 3RI4A 3SXYA 3V4GA 5DUKA 2VBZA 2GIVA 3E6DA 1XGSA 4IRIA 1ZLKA 2A68F 3RDIA 1S7OA 1USSA 1XDUA 3L7WA 5DCFA 2P6TA 3QRFF 2GXBA 1Z9CA 4BH9A 3EYYA 4EJWA 2CW0F 3FXRA 3TOBA 3LWFA 2A61A 4OOIA 2VODA 4P55A 5H20A 4YFXF 1D8KA 4CGZA 4YFKF 3KETA 1XSXA 2R7DA 4R8HA 3MWMA 5ICFA 2NRAC 1SAXA 4G7OF 1B59A 2E1NA 5FGMA 2EFWA 3I59A 4PCQA 1SD7A 1YW9A 3KLNA 2O0YA 4AIJA 1J0RA 3FMRA 4L5JA 5LHIA 1IXCA 4XLNF 4HF0A 3MZYA 3DV8A 1CGPA 1XGNA 1YTYA 2M87A 2A69F 2A07F 4HF2A 4LD5A 4BNCA 3D5LA 1WKMA 1LDDA 2XAHA 3BY6A 2PLYA 2CG4A 4JQFA 2DPDA 2XIGA 1XDSA 4WXDA 4BAYA 3N97A 3QU3A 3SQNA 3AAFA 4HQMA 3GX4X 2Z5UA 3F8BA 4RGXA 1RIOH 4BHBA 5DCMB 4HDVA 1FC3A 2O03A 3G73A 3WODF 1R1UA 4A0ZA 5L3BA 3WE3A 2VBYA 2XKPA 4DQ2A 1FSEA 4A0XA 3F3XA 4FX4A 1YQAA 4UVAA 5H6QA 4RAYA 3LA7A 3GFMA 3ISPA 3P7NA 1FZPB 4KICA 2HGCA 5A2QK 4CYDA 5AIPA 1G6NA 3REOA 4M71A 2OA4A 3RTRA 1H9TA 2B0LA 1EH6A 3CUQB 4M9ZA 2F2EA 2FMYA 1BN5A 1F1ZA 2DAOA 3SZPA 3S2WA 1SD5A 3K69A 5FB2A 1ZARA 5DEQA 1BI3A 1ZRDA 4IXAA 3TQNA 1ON1A 1FNNA 3DFGA 3DKWA 3IWFA 1ODDA 3N4MA 5K1YA 3KCCA 2EFPA 1B1BA 3WTXC 1RNLA 2STTA 1P92A 1RUOA 1STZA 2NYXA 2XV4S 1UHWA 4ZYEA 2DLLA 4U7BA 3T8RA 3KP4A 2XKOA 3RKXA 3NQOA 3E6CC 4L9VA 4KN7X 2H6BA 2OD5A 3SHFA 5EEGA 5ILSA 4HOBA 5HOOA 1O3QA 1U78A 4EGYA 2FQ3A 5BMZA 1SMTA 4JK1X 1S7AA 2BEOA 2PMHA 3IRQA 4HX8A 4S05A 2UZKA 4WCGA 2R3SA 5TJJA 4ZYHA 1WWXA 1HSJA 1FX7A 4U88A 2HOEA 2Q0OA 1ZYRF 4A12A 3Q5FA 3I59B 3PQJA 2G7UA 5FLXZ 3LQRA 2VONA 1TQIA 3WGGA 4M9SA 3QAHA 1W7PA 2ADUA 3F72A 3O2PE 1XCVA 1O3TA 1V4RA 1MJAA 2FBIA 4BHPA 2D2WA 2M5WA 1FBSA 4GYGA 3RYPA 4PGHA 1ZG1A 4HW0A 1U5TC 4ZH4F 3HHGA 4LG0B 3WE2A 3DXJF 2XUBA 3KEQA 2Z9OA 3L9FA 1TNSA 2H27A 2QLZA 1JE8A 5L3CA 3RYRA 3TO9A 3JAMZ 1G3TA 2OZUA 3TOAA 1OPCA 4BXUA 1DP7P 2HKXA 2PBIA 3KP5A 4ZZLA 4G7HF 1C0WA 1YFHA 3M1EA 1KQ0A 3KFWX 4K2EA 2H6CA 2IT0A 4L9TA 1FOKA 5LLQA 2PMUA 2O61A 3WU0A 1ZAOA 1AOYA 5CVUA 5ED4A 3BJ6A 4OIQF 2DQRA 1T39A 1ON2A 1P6RA 3P9KA 4G9YA 2MH2A 3I71A 5EEHA 1HBXG 2L01A 4BHCA 3BOQA 4Y15A 2GA2A 2HFHA 3KLOA 5FLXK 1MGTA 1PDNC 2Y0MA 4NHJA 2OBPA 3QPTA 4U0WA 5L3FA 3TDUC 3FM5A 3PFIA 2VC1A 4EV0A 1KQ9A 2K4BA 3R6SA 3IKTA 4AIHA 1O3SA 4Q47A 4LLLA 1K7AA 1HKQA 1DPRA 4S04A 2DPUA 2VBXA 5D5WB 2LF8A 3IHUA 1YS7A 2EJRA 3RJPA 4KN4X 2YX7A 1JGSA 2XAQA 1Z91A 1I6XA 2BV6A 5LGNA 2QQ9A 2V1DA 3WTUC 3ECHA 2YR2A 2OZ6A 2VT3A 1E2XA 1J5YA 3WTWC 2FOKA 4EM0B 3P9CA 2JSCA 1XMKA 2JZYA 2FNAA 3ZMUA 2W85A 1W7PB 3F21A 4Y13A 1BBYA 2ZBKA 1SMYF 1LJ9A 4O3MA 1ULYA 2BE5F 1WRJA 3L00A 1P4AA 2QYOA 1A04A 3GF2A 5BPIA 3R60A 2L4AA 4B09A 1ZGJA 5LBQA 5KK1A 3FZVA 2AXLA 5E20A 3WTZA 2L3DA 4L9JA 1BIAA 4ZYDA 1MDMA 2EWNA 3HRUA 4PGGA 4IF4A 3GXOA 3GFLA 3K1NA 3CTAA 1U8RA 4UUVA 4L5IA 4HZFA 2WWYA 3H3UA 3HRMA 1IN4A 4L18B 4HX7A 4KT5C 5LGUA 3KP6A 5AONA 4G94A 3HOSA 5D4SA 3E5XA 3FXUA 3DF8A 3FWEA 2EA2A 4IHTA 4RAZA 1YLFA 2WC2A 1KQ8A 3CLOA 1IN6A 2XAGA 4LGWA 1XGMA 4CICA 1IZ1A 4G6DA 2RGVA 2KIMA 2NNNA 2GAUA 1ZN2A 2P7CB 5DDGA 2EV5A 5IT3A 5DYMA 1DPUA 3SZTA 2K86A 4D0PA 1KU3A 4BYYA 3FXQA 3LQQA 1B4AA 2IA2A 2FSWA 3HRTA 3EUHA 1OR7A 3VB2A 2XAFA 3MZHA 2V1UA 2C6YA 2V79A 3J80Z 3I53A 4EGZA 4HQEA 3HYIA 2Q8KA 3DEUA 2FBHA 4A5MA 5CJ9A 3T8TA 3E3VA 4OINF 3GVAA 3C18A 2IRFG 1U6GA 1L0OC 1CF7A 2HKOA 1R23A 3Q9VA 2L4MA 1LEBA 3I4PA 1U5TA 3HUGA 2A6HF 5E1WA 4I2OA 4HLXA 2RKHA 3BWGA 2COMA 1ZH5A 1O7FA 1H0MA 1K79A 3ZMTA 4I0BA 3KEOA 4GXOA 2OAZA 4N0BA 2GZWA 2QENA 1P2FA 1HXDA 2ZXJA 1F4KA 4P9FA 2FRHA 3IKVA 3TKYA 2PEXA 1W5TA 1SD6A 5D5VB 1ONVA 3U9GA 3B73A 4YIFA 3CJNA 1I1GA 2DTRA 3E5UA 4EJTA 1T6SA 2EFQA 1I1SA 1B9NA 1BC8C 2STWA 1IW7F 2RV8A 1D8JA 1GVJA 5AIQA 3L09A 2D1HA 3GW2A 5HDGA 3C1DA 2DK5A 2XROA 4Z2YA 1S8NA 2V6CA 4LFUA 3I64A 4WXCA 1U2WA 5CVVA 4WWCA 4IHSA 2XRNA 4IRHA 2A3SA 1H9GA 1R7JA 5ILVA 1MDMB 1GXPA 1J59A 4LJZF 1MJ9A 2LSOA 3LSTA 3EYIA 1JHFA 2FA5A 4A5NA 2VOOA 2ZCWA 4P96A 3FF5A 5LHGA 2LF7A 1EH7A 2HYFA 4UXNA 2K4JA 1QZYA 1IF1A 2F5DA 2M1BA 5ERIA 2YPRA 1REPC 5HDNA 4BQAA 1K6OA 3ZMVA 2K7LA 2UWMA 3FX3A 3BZ6A 1Y0UA 4LB5A 4EJUA 3TGNA 4AD9A 3MAJA 2GWRA 2H09A 1TTYA 4ESFA 2HWVA 2MD5A 2MH9A 1HW5A 2FMLA 3KP2A 3WU1B 3QU6A 2IJLA 2E1CA 1BIBA 3ZP5A 3F6OA 2P6SA 4ESBA 1FPQA 4KA4A 4Y17A 4A6EA 2Z3YA 2BGCA 2M8EA 5E18F 1R00A 2VC0A 1BM9A 4F7ZA 3F8FA 1IRGA 4OMZA 1S6LA 1RUNA 1HKSA 3VFZA 4ON0A 3WGIA 3HTUA 2HZTA 4MGRA 1YIOA 2CQKA 1JXSA 3T1BA 5LEKA 5DUIA 2HTSA 3CDHA 5LRRA 4HLYA 2CGPA 1R5GA 1LVAA 1QO0D 2QZ8A 1BI1A 3K2ZA 2CSOA 2ZNZA 3KZYA 4I98B 5IT9Z 3R61A 3ECOA 2AS5F 2DBBA 1BI2A 5ICEA 1F5TA 1G4DA 5TRDA 1FBUA 4EM1A 1DDNA 1QGPA 1W5SA 2EK5A 1WI9A 4XBFA 5BQTA 1MZBA 2D1VA 3EDPA 3IC7A 2DT5A 3QP6A 1YW8A 5CYVA 2WV0A 5E8GA 4CHUA 4IPAA 2EV6A 4XRFA 2KJCA 4UNOA 2VOPA 2FEZA 4EJVA 5F64A 2V9VA 5F1RA 2EB7A 3RPUA 1YYVA 1ZREA 2IA1A 1BJAA 2F5CA 5HLIA 1T38A 1AWCA 5FFXA 5CVIA 2UXXA 4KIBA 4QWQA 1T98A 4CZZA 4ENJA 2JPBA 6PAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5E A;  5LEJ A;  4JBA A;  3GFJ A;  3LFK A;  4FHT A;  3BJO A;  4XLP F;  3M7G A;  4M74 A;  4LB6 B;  3GEZ A;  4Q48 A;  3FMQ A;  1R1V A;  2KJB A;  4EQQ A;  2CYY A;  3O6B B;  4HBL A;  1LNW A;  3RPQ A;  3ULQ B;  2MLG A;  3L2C A;  1RZ4 A;  4M73 A;  4R1H A;  2QBY A;  2P4W A;  4KIG A;  1ZRC A;  1IXS B;  1BI0 A;  2D45 A;  2EFO A;  1TQM A;  3ROU A;  3W6K B;  5BOX A;  2Y75 A;  4OMY A;  1G3Y A;  4WX9 A;  1XB4 A;  1R36 A;  2E7X A;  1IN5 A;  4U0V A;  5HS7 A;  5FD5 A;  2IW5 A;  1FSH A;  1QNT A;  1VTN C;  1TNT A;  3F23 A;  5HLH A;  2JT1 A;  1SFU A;  2DO7 A;  2OQG A;  4YFN F;  3JAM K;  3V7R A;  3O3K A;  4I09 A;  4RGU A;  3WTY C;  3G3Z A;  2XVC A;  2IPQ X;  5E17 F;  4P5O A;  4KMF A;  1KU9 A;  4WXH A;  4FT8 A;  1KGS A;  4IRG A;  2QQA A;  5JFR A;  3TDZ C;  3F8C A;  1PUE E;  4UV9 A;  2LDU A;  3BDD A;  3TO7 A;  4HDU A;  1V3F A;  4KNY A;  2HS5 A;  2Y48 A;  3F8M A;  2BYV E;  3HSR A;  3NRV A;  4HAM A;  1R22 A;  2FF4 A;  2ZME A;  3WGH A;  5DCM A;  2W57 A;  4MEY F;  1D5V A;  1XSD A;  3ML6 A;  2HEO A;  1HQC A;  2UXN A;  3M9A A;  1OYY A;  2M45 A;  3ZN0 A;  3WTS C;  4NQW A;  3ZQ7 A;  2DFI A;  1IN8 A;  1KYZ A;  4UV8 A;  1K78 A;  3H92 A;  4PDK A;  1J2X A;  3LAJ A;  1UHM A;  1F9N A;  3K9T A;  3V8L A;  2HTJ A;  2RVC A;  4A0Y A;  1QPM A;  4MQ9 F;  4MQV A;  3KZZ A;  1SD4 A;  3HTS B;  3T5X A;  1P4W A;  1LEA A;  4UVB A;  1Z6R A;  1QZZ A;  1Z05 A;  5D6E A;  4I7H A;  2A6E F;  4R79 A;  2P5L C;  2OU2 A;  5L3E A;  5DD8 A;  4HYE A;  1UST A;  3HHH A;  2M30 A;  1WQ2 A;  2L54 A;  3JW4 A;  1MD0 A;  2X0L A;  1G3W A;  2Q2E A;  4HA8 A;  2DI3 A;  4GYI A;  5K5Q A;  4XSZ F;  5L3G A;  3GFI A;  2P8T A;  2V1X A;  1GHC A;  5D4R A;  1RI7 A;  1XD7 A;  3IRR A;  1KU2 A;  1XSV A;  3ERE D;  2ZFW A;  3I58 A;  3I5U A;  2NNY A;  3RIR A;  1LDK B;  2O3F A;  5A2Q Z;  2CFX A;  1J75 A;  3PQK A;  2EA4 A;  2F5F A;  2KKO A;  1FP1 D;  3QP5 A;  2IP2 A;  3K0L A;  3SFZ A;  3HIF A;  5HLG A;  1FP2 A;  4UHT A;  2EFN A;  4EVI A;  2QBY B;  1T0F A;  3DPL C;  1NHA A;  4RB0 A;  5E1Z B;  4WK8 F;  3KP3 A;  3EET A;  4YII A;  2XGX A;  2ZKZ A;  5L3D A;  5E1X A;  3MQ0 A;  3MEX A;  2YSR A;  3ELK A;  3ZMD A;  4RB3 C;  1FWZ A;  1ZHF A;  1FYL A;  5K5R A;  4MEX F;  4XSX F;  3GWZ A;  1Z1D A;  2P5K A;  4I01 A;  3RKW A;  3MFK A;  2CWE A;  4M6X A;  5LHH A;  3EQL F;  3U1D A;  5HVQ C;  1Z7U A;  1EV7 A;  1BOA A;  4CDG A;  5ICG A;  3F8N A;  3I0T A;  4IVN A;  2QVO A;  2W24 A;  3T0Y A;  3DP7 A;  1ZLJ A;  1TBX A;  5BPD A;  3JSP A;  3WTV C;  1IUY A;  4LG0 A;  3GZ6 A;  1ZGA A;  4ASN A;  1ZG3 A;  4KMU X;  2CO5 A;  1TW3 A;  1S3J A;  4G7Z F;  4B8X A;  4I02 A;  3NEU A;  1Q1H A;  4AVP A;  5FD6 A;  1U3E M;  2ZME B;  1OMI A;  1B6A A;  5J8C A;  3F22 A;  1YO5 C;  4H0E A;  2ZNY A;  1E17 A;  1TQP A;  4ESJ A;  3VOE A;  2VXZ A;  1HKT A;  3DQV C;  4RGS A;  5F6F A;  2XAJ A;  1IAW A;  3W6J B;  1XGO A;  2J5O A;  1MJB A;  3IWZ A;  5LRS A;  3VOD A;  1FLI A;  2LNB A;  2HQR A;  1K78 B;  3J80 K;  3KP7 A;  2IVM A;  1ZG5 A;  2G9W A;  4KUM A;  3HSF A;  4OIR F;  2HDC A;  2KIU A;  2DU9 A;  3JTH A;  2VN2 A;  5CVJ A;  2MLK A;  2ELH A;  3CUQ C;  2GQQ A;  3J81 Z;  1PP7 U;  4LMY A;  2G7H A;  3BJA A;  5HS8 A;  4MTD A;  3KE2 A;  2ZO4 A;  4MTE A;  3E6M A;  4ENN A;  5DV5 A;  2K27 A;  2DW4 A;  4I0A A;  1GXQ A;  4GGG A;  2JTV A;  1XCB A;  4FX0 A;  4L0Y B;  3FHZ A;  2NS0 A;  1DUX C;  1SFX A;  1O7L A;  1T2K A;  3JSO A;  2ESH A;  4N9H A;  3OOP A;  2FBK A;  5JVT A;  1FYM A;  1BC7 C;  2HR3 A;  4LLG F;  3ZMS A;  3Q9S A;  2HQN A;  4A6D A;  2RQP A;  4HX4 A;  3V7S A;  3CUO A;  1OKR A;  1O3R A;  3DPT A;  2TDX A;  3GO5 A;  1SFE A;  2PQ8 A;  4RGR A;  4ZZD A;  3VEP A;  4CXF A;  1WSU A;  2HYG D;  4GO1 A;  5FFZ A;  2QWW A;  2QQB A;  2X4H A;  1CF7 B;  2XAS A;  4ETS A;  5BS6 A;  2RNJ A;  2JRT A;  4AIK A;  1HST A;  1UCR A;  5ILU A;  4CO8 A;  1U5T B;  1D3Y A;  2PJP A;  3BP8 A;  1R58 A;  4RB2 C;  1KYW A;  4KYW A;  2ACJ A;  2VBW A;  4HV5 A;  3JTG A;  1TLH B;  1XMA A;  3GYH X;  3WTT C;  1LB2 A;  4A2U A;  1LDJ A;  1I27 A;  4L9N A;  3RKY A;  1KA8 A;  1L3L A;  1HW2 A;  1MKM A;  3J81 K;  4KIF A;  4PZJ A;  2R7F A;  3GLX A;  5D5X B;  4DNC A;  3IL2 A;  2JPC A;  3CO6 C;  2MBF A;  5E8I A;  5CVR A;  1XN7 A;  4TV7 A;  3WG9 A;  2OQR A;  1QBJ A;  4RS8 A;  4M9X A;  3OV8 A;  2W84 A;  5D8L B;  3LA3 A;  1O57 A;  2FE3 A;  1IN7 A;  3P9I A;  4O5V A;  5JHU A;  2Z99 A;  3C3W A;  1Z6T A;  4OIO F;  3ZPL A;  2RC4 A;  3M8F A;  3K1M A;  2KRF A;  1UFM A;  3E6B A;  2IA0 A;  2PI0 A;  1R1T A;  5JI6 A;  4U0Y A;  2L02 A;  2J5P A;  4HF1 A;  2O8X A;  4WF2 A;  2FNP A;  5D8K B;  3ZN1 A;  3K1P A;  3U2R A;  2VT2 A;  3FMS A;  4ZYG A;  2PG4 A;  2P5V A;  2DK8 A;  3COA C;  1FYK A;  1KU7 A;  1TW2 A;  2XHK A;  2QM3 A;  4MNU A;  3HOT A;  2QUF A;  4UVC A;  2FU4 A;  3MCZ A;  5IT9 K;  3R0A A;  5H6R A;  4G6Q A;  3R0J A;  2O6G E;  3QPH A;  1LQ1 A;  4AWX B;  3QOP A;  4ENM A;  4MHG A;  1P4X A;  3ABU A;  4KDP A;  1I5Z A;  3V8K A;  4HV6 A;  5FO5 A;  4U7D A;  5DD4 A;  5D5U B;  2ZJ2 A;  2RDP A;  4ENK A;  1HW1 A;  3TO6 A;  2E7W A;  4KFC A;  1QQI A;  3H3Z A;  2PFB A;  4Q5S F;  2ISZ A;  1G3S A;  2ISY A;  4OIP F;  1IXR C;  1OYW A;  2DQL A;  5HS9 A;  4N9I A;  4NB5 A;  5LGT A;  1EH8 A;  4YG2 F;  1S29 A;  4OU0 A;  3F6V A;  4QLC U;  1PP8 F;  4M72 A;  3B02 A;  5J6X A;  2WTE A;  2MA3 A;  2GA1 A;  1W7P D;  3E5Q A;  3HRS A;  3C7J A;  2BBY A;  2KIF A;  3I54 A;  4GCV A;  4P9U A;  2A5Y B;  2PN6 A;  1YS6 A;  1J9I A;  3LA2 A;  4E70 A;  5CLS A;  2YX4 A;  1IRF A;  3BRO A;  4EMS A;  3FM3 A;  3HSE A;  5D6F A;  2Z33 A;  3ABT A;  3GZ5 A;  3E97 A;  4RB1 A;  4O6J A;  5KVR A;  1X3U A;  3M8E A;  4L0Z B;  5JR3 A;  2YU3 A;  3J7A O;  3GUD A;  1JHH A;  5ICC A;  3LAP A;  2RN7 A;  2ETH A;  2LKP A;  3CUQ A;  4EM2 A;  5J8F A;  2MC3 A;  1FY7 A;  3BPX A;  4LLN A;  1FBQ A;  5K5O A;  2H94 A;  1YG2 A;  1FT9 A;  1W4M A;  5HDK A;  3CO7 C;  2W25 A;  3ZMZ A;  1OYI A;  2P7V B;  1UB9 A;  1ZRF A;  2NAZ A;  1B9M A;  2FXA A;  3V8J A;  4EJO A;  4IJA A;  2K02 A;  3R4K A;  4M6Y A;  3BPV A;  4G8X A;  1R5H A;  4Q4Z F;  4LK0 F;  3V7C A;  4LK1 F;  2GXG A;  2EV0 A;  3D0S A;  2VE9 A;  2ESN A;  2VE8 A;  1YW7 A;  1J7K A;  3RI4 A;  3SXY A;  3V4G A;  5DUK A;  2VBZ A;  2GIV A;  3E6D A;  1XGS A;  4IRI A;  1ZLK A;  2A68 F;  3RDI A;  1S7O A;  1USS A;  1XDU A;  3L7W A;  5DCF A;  2P6T A;  3QRF F;  2GXB A;  1Z9C A;  4BH9 A;  3EYY A;  4EJW A;  2CW0 F;  3FXR A;  3TOB A;  3LWF A;  2A61 A;  4OOI A;  2VOD A;  4P55 A;  5H20 A;  4YFX F;  1D8K A;  4CGZ A;  4YFK F;  3KET A;  1XSX A;  2R7D A;  4R8H A;  3MWM A;  5ICF A;  2NRA C;  1SAX A;  4G7O F;  1B59 A;  2E1N A;  5FGM A;  2EFW A;  3I59 A;  4PCQ A;  1SD7 A;  1YW9 A;  3KLN A;  2O0Y A;  4AIJ A;  1J0R A;  3FMR A;  4L5J A;  5LHI A;  1IXC A;  4XLN F;  4HF0 A;  3MZY A;  3DV8 A;  1CGP A;  1XGN A;  1YTY A;  2M87 A;  2A69 F;  2A07 F;  4HF2 A;  4LD5 A;  4BNC A;  3D5L A;  1WKM A;  1LDD A;  2XAH A;  3BY6 A;  2PLY A;  2CG4 A;  4JQF A;  2DPD A;  2XIG A;  1XDS A;  4WXD A;  4BAY A;  3N97 A;  3QU3 A;  3SQN A;  3AAF A;  4HQM A;  3GX4 X;  2Z5U A;  3F8B A;  4RGX A;  1RIO H;  4BHB A;  5DCM B;  4HDV A;  1FC3 A;  2O03 A;  3G73 A;  3WOD F;  1R1U A;  4A0Z A;  5L3B A;  3WE3 A;  2VBY A;  2XKP A;  4DQ2 A;  1FSE A;  4A0X A;  3F3X A;  4FX4 A;  1YQA A;  4UVA A;  5H6Q A;  4RAY A;  3LA7 A;  3GFM A;  3ISP A;  3P7N A;  1FZP B;  4KIC A;  2HGC A;  5A2Q K;  4CYD A;  5AIP A;  1G6N A;  3REO A;  4M71 A;  2OA4 A;  3RTR A;  1H9T A;  2B0L A;  1EH6 A;  3CUQ B;  4M9Z A;  2F2E A;  2FMY A;  1BN5 A;  1F1Z A;  2DAO A;  3SZP A;  3S2W A;  1SD5 A;  3K69 A;  5FB2 A;  1ZAR A;  5DEQ A;  1BI3 A;  1ZRD A;  4IXA A;  3TQN A;  1ON1 A;  1FNN A;  3DFG A;  3DKW A;  3IWF A;  1ODD A;  3N4M A;  5K1Y A;  3KCC A;  2EFP A;  1B1B A;  3WTX C;  1RNL A;  2STT A;  1P92 A;  1RUO A;  1STZ A;  2NYX A;  2XV4 S;  1UHW A;  4ZYE A;  2DLL A;  4U7B A;  3T8R A;  3KP4 A;  2XKO A;  3RKX A;  3NQO A;  3E6C C;  4L9V A;  4KN7 X;  2H6B A;  2OD5 A;  3SHF A;  5EEG A;  5ILS A;  4HOB A;  5HOO A;  1O3Q A;  1U78 A;  4EGY A;  2FQ3 A;  5BMZ A;  1SMT A;  4JK1 X;  1S7A A;  2BEO A;  2PMH A;  3IRQ A;  4HX8 A;  4S05 A;  2UZK A;  4WCG A;  2R3S A;  5TJJ A;  4ZYH A;  1WWX A;  1HSJ A;  1FX7 A;  4U88 A;  2HOE A;  2Q0O A;  1ZYR F;  4A12 A;  3Q5F A;  3I59 B;  3PQJ A;  2G7U A;  5FLX Z;  3LQR A;  2VON A;  1TQI A;  3WGG A;  4M9S A;  3QAH A;  1W7P A;  2ADU A;  3F72 A;  3O2P E;  1XCV A;  1O3T A;  1V4R A;  1MJA A;  2FBI A;  4BHP A;  2D2W A;  2M5W A;  1FBS A;  4GYG A;  3RYP A;  4PGH A;  1ZG1 A;  4HW0 A;  1U5T C;  4ZH4 F;  3HHG A;  4LG0 B;  3WE2 A;  3DXJ F;  2XUB A;  3KEQ A;  2Z9O A;  3L9F A;  1TNS A;  2H27 A;  2QLZ A;  1JE8 A;  5L3C A;  3RYR A;  3TO9 A;  3JAM Z;  1G3T A;  2OZU A;  3TOA A;  1OPC A;  4BXU A;  1DP7 P;  2HKX A;  2PBI A;  3KP5 A;  4ZZL A;  4G7H F;  1C0W A;  1YFH A;  3M1E A;  1KQ0 A;  3KFW X;  4K2E A;  2H6C A;  2IT0 A;  4L9T A;  1FOK A;  5LLQ A;  2PMU A;  2O61 A;  3WU0 A;  1ZAO A;  1AOY A;  5CVU A;  5ED4 A;  3BJ6 A;  4OIQ F;  2DQR A;  1T39 A;  1ON2 A;  1P6R A;  3P9K A;  4G9Y A;  2MH2 A;  3I71 A;  5EEH A;  1HBX G;  2L01 A;  4BHC A;  3BOQ A;  4Y15 A;  2GA2 A;  2HFH A;  3KLO A;  5FLX K;  1MGT A;  1PDN C;  2Y0M A;  4NHJ A;  2OBP A;  3QPT A;  4U0W A;  5L3F A;  3TDU C;  3FM5 A;  3PFI A;  2VC1 A;  4EV0 A;  1KQ9 A;  2K4B A;  3R6S A;  3IKT A;  4AIH A;  1O3S A;  4Q47 A;  4LLL A;  1K7A A;  1HKQ A;  1DPR A;  4S04 A;  2DPU A;  2VBX A;  5D5W B;  2LF8 A;  3IHU A;  1YS7 A;  2EJR A;  3RJP A;  4KN4 X;  2YX7 A;  1JGS A;  2XAQ A;  1Z91 A;  1I6X A;  2BV6 A;  5LGN A;  2QQ9 A;  2V1D A;  3WTU C;  3ECH A;  2YR2 A;  2OZ6 A;  2VT3 A;  1E2X A;  1J5Y A;  3WTW C;  2FOK A;  4EM0 B;  3P9C A;  2JSC A;  1XMK A;  2JZY A;  2FNA A;  3ZMU A;  2W85 A;  1W7P B;  3F21 A;  4Y13 A;  1BBY A;  2ZBK A;  1SMY F;  1LJ9 A;  4O3M A;  1ULY A;  2BE5 F;  1WRJ A;  3L00 A;  1P4A A;  2QYO A;  1A04 A;  3GF2 A;  5BPI A;  3R60 A;  2L4A A;  4B09 A;  1ZGJ A;  5LBQ A;  5KK1 A;  3FZV A;  2AXL A;  5E20 A;  3WTZ A;  2L3D A;  4L9J A;  1BIA A;  4ZYD A;  1MDM A;  2EWN A;  3HRU A;  4PGG A;  4IF4 A;  3GXO A;  3GFL A;  3K1N A;  3CTA A;  1U8R A;  4UUV A;  4L5I A;  4HZF A;  2WWY A;  3H3U A;  3HRM A;  1IN4 A;  4L18 B;  4HX7 A;  4KT5 C;  5LGU A;  3KP6 A;  5AON A;  4G94 A;  3HOS A;  5D4S A;  3E5X A;  3FXU A;  3DF8 A;  3FWE A;  2EA2 A;  4IHT A;  4RAZ A;  1YLF A;  2WC2 A;  1KQ8 A;  3CLO A;  1IN6 A;  2XAG A;  4LGW A;  1XGM A;  4CIC A;  1IZ1 A;  4G6D A;  2RGV A;  2KIM A;  2NNN A;  2GAU A;  1ZN2 A;  2P7C B;  5DDG A;  2EV5 A;  5IT3 A;  5DYM A;  1DPU A;  3SZT A;  2K86 A;  4D0P A;  1KU3 A;  4BYY A;  3FXQ A;  3LQQ A;  1B4A A;  2IA2 A;  2FSW A;  3HRT A;  3EUH A;  1OR7 A;  3VB2 A;  2XAF A;  3MZH A;  2V1U A;  2C6Y A;  2V79 A;  3J80 Z;  3I53 A;  4EGZ A;  4HQE A;  3HYI A;  2Q8K A;  3DEU A;  2FBH A;  4A5M A;  5CJ9 A;  3T8T A;  3E3V A;  4OIN F;  3GVA A;  3C18 A;  2IRF G;  1U6G A;  1L0O C;  1CF7 A;  2HKO A;  1R23 A;  3Q9V A;  2L4M A;  1LEB A;  3I4P A;  1U5T A;  3HUG A;  2A6H F;  5E1W A;  4I2O A;  4HLX A;  2RKH A;  3BWG A;  2COM A;  1ZH5 A;  1O7F A;  1H0M A;  1K79 A;  3ZMT A;  4I0B A;  3KEO A;  4GXO A;  2OAZ A;  4N0B A;  2GZW A;  2QEN A;  1P2F A;  1HXD A;  2ZXJ A;  1F4K A;  4P9F A;  2FRH A;  3IKV A;  3TKY A;  2PEX A;  1W5T A;  1SD6 A;  5D5V B;  1ONV A;  3U9G A;  3B73 A;  4YIF A;  3CJN A;  1I1G A;  2DTR A;  3E5U A;  4EJT A;  1T6S A;  2EFQ A;  1I1S A;  1B9N A;  1BC8 C;  2STW A;  1IW7 F;  2RV8 A;  1D8J A;  1GVJ A;  5AIQ A;  3L09 A;  2D1H A;  3GW2 A;  5HDG A;  3C1D A;  2DK5 A;  2XRO A;  4Z2Y A;  1S8N A;  2V6C A;  4LFU A;  3I64 A;  4WXC A;  1U2W A;  5CVV A;  4WWC A;  4IHS A;  2XRN A;  4IRH A;  2A3S A;  1H9G A;  1R7J A;  5ILV A;  1MDM B;  1GXP A;  1J59 A;  4LJZ F;  1MJ9 A;  2LSO A;  3LST A;  3EYI A;  1JHF A;  2FA5 A;  4A5N A;  2VOO A;  2ZCW A;  4P96 A;  3FF5 A;  5LHG A;  2LF7 A;  1EH7 A;  2HYF A;  4UXN A;  2K4J A;  1QZY A;  1IF1 A;  2F5D A;  2M1B A;  5ERI A;  2YPR A;  1REP C;  5HDN A;  4BQA A;  1K6O A;  3ZMV A;  2K7L A;  2UWM A;  3FX3 A;  3BZ6 A;  1Y0U A;  4LB5 A;  4EJU A;  3TGN A;  4AD9 A;  3MAJ A;  2GWR A;  2H09 A;  1TTY A;  4ESF A;  2HWV A;  2MD5 A;  2MH9 A;  1HW5 A;  2FML A;  3KP2 A;  3WU1 B;  3QU6 A;  2IJL A;  2E1C A;  1BIB A;  3ZP5 A;  3F6O A;  2P6S A;  4ESB A;  1FPQ A;  4KA4 A;  4Y17 A;  4A6E A;  2Z3Y A;  2BGC A;  2M8E A;  5E18 F;  1R00 A;  2VC0 A;  1BM9 A;  4F7Z A;  3F8F A;  1IRG A;  4OMZ A;  1S6L A;  1RUN A;  1HKS A;  3VFZ A;  4ON0 A;  3WGI A;  3HTU A;  2HZT A;  4MGR A;  1YIO A;  2CQK A;  1JXS A;  3T1B A;  5LEK A;  5DUI A;  2HTS A;  3CDH A;  5LRR A;  4HLY A;  2CGP A;  1R5G A;  1LVA A;  1QO0 D;  2QZ8 A;  1BI1 A;  3K2Z A;  2CSO A;  2ZNZ A;  3KZY A;  4I98 B;  5IT9 Z;  3R61 A;  3ECO A;  2AS5 F;  2DBB A;  1BI2 A;  5ICE A;  1F5T A;  1G4D A;  5TRD A;  1FBU A;  4EM1 A;  1DDN A;  1QGP A;  1W5S A;  2EK5 A;  1WI9 A;  4XBF A;  5BQT A;  1MZB A;  2D1V A;  3EDP A;  3IC7 A;  2DT5 A;  3QP6 A;  1YW8 A;  5CYV A;  2WV0 A;  5E8G A;  4CHU A;  4IPA A;  2EV6 A;  4XRF A;  2KJC A;  4UNO A;  2VOP A;  2FEZ A;  4EJV A;  5F64 A;  2V9V A;  5F1R A;  2EB7 A;  3RPU A;  1YYV A;  1ZRE A;  2IA1 A;  1BJA A;  2F5C A;  5HLI A;  1T38 A;  1AWC A;  5FFX A;  5CVI A;  2UXX A;  4KIB A;  4QWQ A;  1T98 A;  4CZZ A;  4ENJ A;  2JPB A;  6PAX A; 
#chains in the Genus database with same CATH topology
 2W7N A;  2JUC A;  2F5E A;  5FKM A;  2QCO A;  5LEJ A;  4JBA A;  3FXJ A;  3GFJ A;  1F43 A;  2EZK A;  3LFK A;  4FHT A;  3BJO A;  2LVS A;  4XLP F;  2FUG 2;  3GCM A;  3M7G A;  4M74 A;  1VQL I;  4LB6 B;  9ANT A;  3GEZ A;  4Q48 A;  4IOA F;  3FMQ A;  1R1V A;  2COB A;  2KJB A;  2CYY A;  3O6B B;  3PSF A;  3RCO A;  4HBL A;  4EQQ A;  1LNW A;  3H9Q A;  3RPQ A;  3FK7 A;  3ULQ B;  2MLG A;  3S1R J;  4EAT A;  3L2C A;  1RZ4 A;  1OCO H;  2DMQ A;  2X1C A;  1YIJ I;  4M73 A;  4R1H A;  4F93 B;  2QBY A;  2P4W A;  4CYC A;  4KIG A;  3H0D A;  1ZRC A;  1IXS B;  4NC6 A;  1BI0 A;  2JRM A;  4YEJ A;  4B3A A;  2D45 A;  2EFO A;  4Y7N J;  1TQM A;  2N8G A;  4XLA A;  3LSI A;  3ROU A;  3CCQ I;  2NVX J;  1A31 A;  3W6K B;  3IAS 2;  2XPW A;  5BOX A;  4PFP A;  2Y75 A;  4OMY A;  1G3Y A;  3OIO A;  2JA8 J;  4WX9 A;  1BW5 A;  1XB4 A;  2ZJR F;  1MMD A;  1R36 A;  2E7X A;  1ENH A;  1Q1V A;  1IN5 A;  4XMY A;  4U0V A;  3DLL F;  3JRA A;  5HS7 A;  5JLW A;  5FD5 A;  2XSD C;  4X0G A;  2IW5 A;  5FLM J;  1FSH A;  1QNT A;  3DBR B;  4MFD A;  1TNT A;  1VTN C;  1H88 C;  3F23 A;  1FEX A;  5HLH A;  3ZQL A;  2JT1 A;  1QHG A;  1SFU A;  1MND A;  2E2I J;  2BW3 B;  2DO7 A;  4IL6 C;  2OQG A;  4YFN F;  3JAM K;  2NVT J;  3FK6 A;  1TZL A;  2M4G A;  3V7R A;  1VQP I;  2AQE A;  5J1U A;  3O3K A;  4I09 A;  4RGU A;  2DCE A;  3TP0 A;  3WTY C;  1SVO A;  3G3Z A;  2XVC A;  2IPQ X;  3QPL A;  5E17 F;  3SDB A;  1G2H A;  1VI0 A;  1WJD A;  1RRJ A;  4P5O A;  3K70 C;  2QSH X;  3MZ8 A;  3OYA A;  4KMF A;  1LFP A;  1KU9 A;  2KL4 A;  2MYS A;  2LP0 A;  4WXH A;  3NWT A;  3KYC B;  4FT8 A;  1VZ0 A;  1U8B A;  4M3G A;  3CES A;  1KGS A;  4IRG A;  2BHY A;  2QQA A;  4PJM A;  5JFR A;  3TDZ C;  3F8C A;  1PUE E;  2AXT C;  2XPU A;  2LDU A;  2A6T A;  3NAR A;  4UV9 A;  1MH4 A;  3BDD A;  3TO7 A;  1X2N A;  4HDU A;  1V3F A;  4KNY A;  2DFH A;  3S1Q J;  2F4O B;  2HS5 A;  2Y48 A;  3TED A;  3F8M A;  1T8I A;  2BYV E;  3HSR A;  3NRV A;  4HAM A;  1R22 A;  3GTK J;  2FF4 A;  3OL4 A;  2BXZ A;  1Y8R B;  2ZME A;  5EEA A;  3G4S I;  3WGH A;  5DCM A;  3HOX J;  2W57 A;  4M3F A;  3W2A A;  4MEY F;  1IRX A;  1D5V A;  3FXM A;  3CCU I;  1XSD A;  3CCJ I;  3ML6 A;  1ETX A;  4RLF A;  1HQC A;  2HEO A;  2UXN A;  2DOE A;  3CCY A;  3M9A A;  2CW7 A;  1OYY A;  5B1A H;  2M45 A;  2R7W A;  3ZN0 A;  1MMA A;  3FXO A;  1K61 A;  3SEZ A;  3WTS C;  4NQW A;  4I99 C;  3ZQ7 A;  5LFA A;  2DFI A;  1IN8 A;  1XG1 A;  1KYZ A;  2ZXW H;  4UV8 A;  1W0T A;  1K78 A;  3H92 A;  1YJ9 I;  4PDK A;  1J2X A;  1UG2 A;  3LAJ A;  1UHM A;  1F9N A;  3K9T A;  3V8L A;  2HTJ A;  2RVC A;  3A0B C;  2R7Z J;  3RPU D;  4A0Y A;  1JTY A;  1QPM A;  4MQ9 F;  1RR8 C;  1PYV A;  1I6H J;  1R49 A;  4BEH A;  4MQV A;  1FTT A;  2WY7 Q;  3HZJ A;  3KZZ A;  1SD4 A;  3HTS B;  3H36 A;  4ZYA A;  3T5X A;  5HOD A;  1E3O C;  3PFY A;  3IP4 B;  1VQN I;  1P4W A;  1LEA A;  1S9H A;  4UVB A;  2R7Q A;  4FQG A;  1OCZ H;  1Z6R A;  4PUS A;  1QZZ A;  1UEL B;  2DT7 B;  1WFX A;  1Z05 A;  2DA4 A;  5D6E A;  3KYL A;  4I7H A;  2A6E F;  4R79 A;  2P5L C;  1TWC J;  2OU2 A;  3OIP A;  1IGN A;  3BR3 A;  3LSR A;  1TWF J;  4BXX J;  1R5I D;  5L3E A;  3EPZ A;  3CF2 A;  4C2U A;  2JVG A;  2R93 J;  5DD8 A;  4HYE A;  1UST A;  4D5C A;  3HHH A;  2M30 A;  4E7H A;  3CCS I;  2EBI A;  4LIV A;  3D1N I;  3IUO A;  3HB9 A;  5KAF C;  1WQ2 A;  3OS2 A;  2L54 A;  3JW4 A;  1MD0 A;  3RQI A;  5M3F J;  2X0L A;  3S1M J;  1G3W A;  2Q2E A;  2R4G A;  2Y9Y A;  4HA8 A;  4QPQ A;  2DI3 A;  3GLL A;  4GYI A;  5K5Q A;  4XSZ F;  5L3G A;  1IDY A;  4IZZ A;  3HGG A;  3TBI A;  3GFI A;  2ZC2 A;  2P8T A;  3FKI J;  4MLO A;  2V1X A;  4RMN A;  2DJN A;  1GHC A;  5D4R A;  1RI7 A;  1XD7 A;  3IRR A;  1KU2 A;  1XSV A;  1HDD C;  2CFO A;  4OAZ A;  3ERE D;  2ZFW A;  1ZR4 A;  1N25 A;  1QZE A;  3I58 A;  3I5U A;  4E7K A;  3H3V K;  1EF4 A;  2NNY A;  3RIR A;  5F04 A;  1LDK B;  4XKC A;  2O3F A;  5A2Q Z;  2CFX A;  2JA7 J;  3GZN B;  2JWT A;  1J75 A;  3S2H J;  3PQK A;  2LFB A;  2EA4 A;  2F5F A;  2KKO A;  4RLQ A;  1FP1 D;  2A5W A;  3QP5 A;  2IP2 A;  3K0L A;  3SFZ A;  3HIF A;  5HLG A;  1FP2 A;  4UHT A;  2EFN A;  4EVI A;  2QBY B;  1T0F A;  3TW6 A;  3DPL C;  1NHA A;  4CYC B;  4RB0 A;  5FJ8 J;  3CQZ J;  3H9J A;  3FKJ A;  5E1Z B;  4WK8 F;  1FIP A;  2DDA A;  3KP3 A;  1W36 C;  3EET A;  4YII A;  2XGX A;  2ZKZ A;  5L3D A;  5DTD A;  5E1X A;  1Y1V J;  3MQ0 A;  4UUS A;  3MEX A;  2YSR A;  3ELK A;  3ZMD A;  4RB3 C;  1FWZ A;  4BBR J;  2OTL I;  1ZHF A;  1FYL A;  5K5R A;  4MEX F;  4XSX F;  1UJ8 A;  3GWZ A;  4XK4 A;  2GIZ A;  1BOB A;  1ERD A;  1LPQ A;  1Z1D A;  2P5K A;  4I01 A;  3TP3 A;  3RKW A;  1WGX A;  3MFK A;  2CWE A;  4M6X A;  5LHH A;  3HOW J;  3EQL F;  4F55 A;  2JVH A;  3U1D A;  3S2D J;  3HDD A;  2XGC A;  4W1U A;  5HVQ C;  3L2V A;  4KT6 A;  1Z7U A;  1EV7 A;  1BOA A;  4CDG A;  5ICG A;  2XC7 A;  3BTI A;  3F8N A;  1ZGW A;  3CP8 A;  3I0T A;  2LOO A;  3JRC A;  4IVN A;  1WI3 A;  2QVO A;  2W24 A;  4D9J A;  5BNG A;  2EIN H;  3T0Y A;  3DP7 A;  1LFB A;  5K7H A;  1ZLJ A;  2XB5 A;  1TBX A;  1Y39 A;  5GPC A;  2DFF A;  3K4L A;  5BPD A;  3JSP A;  2L7K A;  1QPI A;  1DQU A;  3WTV C;  1IUY A;  2L5Q A;  2UV1 A;  1V55 H;  4LG0 A;  3GZ6 A;  3HOY J;  1ZGA A;  4ASN A;  1X1A A;  1JI8 A;  1ZG3 A;  4KMU X;  2CO5 A;  2QGU A;  4DW6 A;  4G6T B;  1TW3 A;  1S3J A;  5J4V A;  1XTA A;  4G7Z F;  2DA3 A;  4B8X A;  2RAE A;  4RM3 A;  2CUJ A;  4I02 A;  3NEU A;  1Q1H A;  4AVP A;  3IAM 2;  5FD6 A;  1U3E M;  2IS1 A;  3Q3S A;  2R5Z A;  2Y30 A;  2ZME B;  1OMI A;  3S3M A;  4ZTF A;  1B6A A;  4XN3 A;  5J8C A;  3F22 A;  1YO5 C;  3H35 A;  4H0E A;  4XN0 A;  2ZNY A;  3ABL H;  1OCC H;  2DMU A;  1OLT A;  1E17 A;  2WA0 A;  3DTE A;  4E7L A;  1TL8 A;  3C2G A;  1TQP A;  1N77 A;  2L7Z A;  4ESJ A;  3VOE A;  1Z21 A;  2VXZ A;  3IH2 A;  1HKT A;  2RQQ A;  3DQV C;  4RGS A;  1X1D A;  5F6F A;  1ETV A;  2XAJ A;  1IAW A;  4IHY A;  1MIJ A;  1GT0 C;  2FJ1 A;  3W6J B;  1XGO A;  2J5O A;  3CJQ B;  1LKX A;  1MJB A;  1NG7 A;  1T08 B;  3IWZ A;  5LRS A;  3VOD A;  2P81 A;  4B4C A;  5EGO A;  1FLI A;  2LNB A;  1S7E A;  2NXN B;  2HQR A;  1K78 B;  3ZQI A;  3J80 K;  3KP7 A;  3DCF A;  3D5S C;  2IVM A;  1ZG5 A;  2G9W A;  4KUM A;  4CH7 A;  3HSF A;  5GPA A;  4OIR F;  2HDC A;  2KIU A;  2QEX I;  2DU9 A;  1JT0 A;  3JTH A;  2VN2 A;  5CVJ A;  4BEH B;  2WBM A;  2MLK A;  2ELH A;  4BGD A;  2DDB A;  3CUQ C;  2GQQ A;  3J81 Z;  1PP7 U;  3S14 J;  4LMY A;  2G7H A;  1D5Y A;  3BJA A;  3PUB A;  5HS8 A;  4MTD A;  1UZC A;  2ZO4 A;  3KE2 A;  5IYC J;  4MTE A;  3E6M A;  4ENN A;  5DV5 A;  5F0H A;  1UG0 A;  2K27 A;  2DW4 A;  4I0A A;  1GXQ A;  4GGG A;  5HLT A;  1Z7L A;  2JTV A;  1XCB A;  4FX0 A;  4IOC F;  4L0Y B;  3FHZ A;  2NS0 A;  1DUX C;  1SFX A;  1O7L A;  5GP9 A;  3I55 I;  1T2K A;  5GTH C;  3OYL A;  3JSO A;  2ESH A;  4YIR X;  3A2K A;  2EH3 A;  4N9H A;  3OOP A;  5E3O A;  1Z3Y A;  2FBK A;  5JVT A;  1X3W B;  1FYM A;  5F1J A;  1BC7 C;  3BC8 A;  2HR3 A;  3JRB A;  3O8H A;  3M4O J;  3GTQ J;  4LLG F;  3ZMS A;  3Q9S A;  5CQG A;  4X1E A;  2HQN A;  1FTZ A;  5J3L A;  2LC2 A;  4A6D A;  2E1M C;  2RQP A;  4HX4 A;  3V7S A;  1GDT A;  3CUO A;  2X48 A;  2DTZ A;  1OKR A;  4B48 A;  1MMN A;  2R7R A;  1O3R A;  4HG2 A;  2CMP A;  2OTJ I;  4ZDP A;  5GTI C;  3DPT A;  2TDX A;  3GO5 A;  1SFE A;  4RM2 A;  3OYN A;  1JKP C;  1CQT A;  2PQ8 A;  4RGR A;  4ZZD A;  3VEP A;  5DS9 A;  4CXF A;  5KAI C;  3HOV J;  1WSU A;  2HYG D;  4GO1 A;  4NDL A;  5FFZ A;  2QWW A;  2QQB A;  1MBK A;  1DGW Y;  2OF7 A;  4XKB A;  2X4H A;  1W0U A;  2XAS A;  1YX5 A;  4ETS A;  1CF7 B;  2X6W A;  2D5V A;  5BS6 A;  3RQ4 A;  4A3M J;  2RNJ A;  2JRT A;  4AIK A;  1OIS A;  2X9D A;  1HST A;  2DN0 A;  1UCR A;  2IGK A;  5ILU A;  4GDF A;  4CO8 A;  2IS4 A;  1U5T B;  3HUG B;  2BZT A;  1D3Y A;  3NAU A;  2KZV A;  2ID3 A;  5C4X J;  2BY1 A;  2PJP A;  3BP8 A;  4ZTJ A;  1R58 A;  2G0E A;  5F0F A;  4RB2 C;  1KYW A;  2LY1 A;  4KYW A;  2B63 J;  2OJE D;  2ACJ A;  2VBW A;  4HV5 A;  3JTG A;  3BTJ A;  1MSE C;  2FD5 A;  4RAF A;  3TMO A;  2L0K A;  3KIO A;  1TLH B;  1XMA A;  3GYH X;  2BY0 A;  3S32 A;  1K6Y A;  2CQX A;  3BLY A;  5B1B H;  3WTT C;  1LB2 A;  2MG4 A;  4A2U A;  1LDJ A;  1I27 A;  4L9N A;  2IS2 A;  3RKQ A;  3Q0W A;  3RKY A;  1KA8 A;  3JRH A;  1L3L A;  4FET A;  1TT0 A;  1HW2 A;  4B47 A;  2XRL A;  1MKM A;  5C3E J;  3L2Q A;  3OOU A;  5GAE J;  4CCM A;  3D5R C;  3J81 K;  5M5W J;  4KIF A;  4PZJ A;  2R7F A;  1P7I A;  2F48 A;  1SEU A;  1S5L C;  3VSK A;  3GTJ J;  4E7I A;  3GLX A;  3BTL A;  5D5X B;  4DNC A;  1YHQ I;  3IL2 A;  1DU0 A;  4JX5 A;  4KIT B;  1ITY A;  2JPC A;  5FLV A;  2VJJ A;  1D1C A;  4XR6 A;  1WJB A;  1IG7 A;  4XRM A;  3CO6 C;  2MBF A;  3LSG A;  3IH3 A;  3JRI A;  2CV0 A;  4A69 C;  3SZG A;  2NVY J;  1R6R A;  5E8I A;  2CQ7 A;  1ZTR A;  5CVR A;  1XN7 A;  2HU9 A;  1SVM A;  4TV7 A;  3BT9 A;  3WG9 A;  3BQZ A;  2K9L A;  2OQR A;  1QBJ A;  4NC8 A;  4C3I J;  4UB6 C;  2NVU B;  4RS8 A;  4M9X A;  3OV8 A;  4F91 B;  2W84 A;  5D8L B;  3LA3 A;  1O57 A;  2FE3 A;  3OYI A;  1IN7 A;  3CMY A;  4GFB A;  3P9I A;  2ZB9 A;  4DZP A;  4O5V A;  5JHU A;  2Z99 A;  3C3W A;  3WHB A;  1Z6T A;  4OIO F;  1WCM J;  2LKS A;  2V9K A;  3ZPL A;  2RC4 A;  3M8F A;  3ESW B;  3K1M A;  2KRF A;  3FDY A;  2ECC A;  4XNF A;  1UFM A;  4FE4 A;  3J7A Y;  3ZGK A;  3E6B A;  2IA0 A;  2PI0 A;  1R1T A;  2X6O A;  5JI6 A;  2VPR A;  1ZR2 A;  2KQR A;  2A05 A;  4U0Y A;  2L02 A;  2J5P A;  2K3F A;  4IQJ A;  2VPL A;  4HNV A;  4HF1 A;  1X3Z B;  2BVM A;  2O8X A;  3K2A A;  4WF2 A;  2FNP A;  1AKH A;  5D8K B;  3ZN1 A;  1V5G A;  1FOY A;  3BG7 A;  3K1P A;  3GTO J;  3U2R A;  2VT2 A;  3FMS A;  2WAD A;  3DBL B;  4ZYG A;  2PG4 A;  4AYB N;  1ZQ3 P;  4XQF A;  2P5V A;  3H5R A;  1SVL A;  2DK8 A;  4XKV A;  4Y3O A;  1MBE A;  1PUF A;  3COA C;  1FYK A;  1KU7 A;  1DGR M;  1TW2 A;  2IAI A;  2XHK A;  2QM3 A;  1MSF C;  2HVS A;  3F9K A;  1I39 A;  4MNU A;  3K4J A;  3HOT A;  1X58 A;  2QUF A;  4UVC A;  3CDL A;  3A0H C;  5EDN A;  1H89 C;  2FU4 A;  3MCZ A;  5IT9 K;  3R0A A;  5FKO A;  4XOT A;  5H6R A;  4G6Q A;  3R0J A;  2O6G E;  3QPH A;  1LQ1 A;  4AWX B;  3QOP A;  4ENM A;  4MHG A;  1P4X A;  1LE8 A;  3ABU A;  3DEE A;  3S16 J;  4KDP A;  4BJT A;  3DTK A;  1I5Z A;  3V8K A;  3H5N A;  4HV6 A;  4N4N B;  3K70 D;  5FO5 A;  4XRS A;  2BHZ A;  2VQL A;  4W97 A;  5EJC A;  1Z3X A;  4U7D A;  5DD4 A;  5D5U B;  1VQM I;  2ZJ2 A;  3B6C A;  3TL4 X;  2IGO A;  4AYB A;  2RDP A;  4ENK A;  2GBY A;  2LR8 A;  2VLA A;  4JX6 A;  5E3L A;  1HW1 A;  3TO6 A;  4LOC A;  3ONQ A;  3ZCO A;  1JT6 A;  2E7W A;  1APL C;  5TGT A;  4KFC A;  2L7F P;  1QQI A;  1SAU A;  3H3Z A;  2PFB A;  4Q5S F;  2ISZ A;  1G3S A;  3KPH A;  2EZH A;  2ISY A;  4OIP F;  2QA4 I;  1IXR C;  1OYW A;  2DQL A;  5HS9 A;  4HST A;  4N9I A;  1YJW I;  4XM3 A;  4NB5 A;  2H1L A;  4BS9 A;  1IV8 A;  2LLK A;  5LGT A;  1EH8 A;  2TRT A;  4YG2 F;  1OCP A;  1LVK A;  1S29 A;  4OU0 A;  3ZR8 X;  4IKF A;  3F6V A;  2F6C A;  2K9N A;  4QLC U;  2LRD A;  1PP8 F;  2EIJ H;  1U9O A;  3LSJ A;  3B02 A;  4LIU A;  4M72 A;  5J6X A;  1R4M B;  2WTE A;  4BJ5 C;  4DGW B;  2MA3 A;  2AQF A;  4J00 A;  4BQQ A;  2GA1 A;  1W7P D;  4XID A;  1LUJ B;  3E5Q A;  3J7Y J;  2JUG A;  3HRS A;  2K9Q A;  3C7J A;  1R71 A;  2BBY A;  2KIF A;  3I54 A;  4GCV A;  3SDG A;  2PJR A;  2ICW G;  4D1Q A;  4P9U A;  2NS7 A;  2A5Y B;  3G1L A;  3I4M J;  2PN6 A;  1YS6 A;  4NC7 A;  5FKK A;  3LA2 A;  1J9I A;  4E70 A;  2ECB A;  5CLS A;  2YX4 A;  1IRF A;  3BRO A;  1X19 A;  4IQ4 A;  3GBG A;  4EMS A;  3Q0V A;  3FM3 A;  3HSE A;  2KT0 A;  5D6F A;  2Z33 A;  3GTM J;  3ABT A;  3S15 J;  3GZ5 A;  3E97 A;  2VKE A;  4RB1 A;  4O6J A;  5KVR A;  2E60 A;  1X3U A;  3M8E A;  4N4O B;  4L0Z B;  5JR3 A;  1ZEL A;  3OYM A;  3W6V A;  3H5A A;  4XLC A;  2ZJQ F;  3HGY A;  2YU3 A;  3J7A O;  4CCN A;  2JJ7 A;  3GUD A;  2O8K A;  1JHH A;  5ICC A;  3LAP A;  2RN7 A;  3OL3 A;  1XX5 A;  2LTP A;  1GV5 A;  2X51 A;  2HOT A;  2ETH A;  2LKP A;  3CUQ A;  1Y6I A;  3A03 A;  4EM2 A;  1ORK A;  3ZOB A;  5J8F A;  2CUF A;  2MC3 A;  1FY7 A;  2CRG A;  2H8W A;  2HOA A;  1S72 I;  3BPX A;  4LLN A;  1FBQ A;  2QKL B;  2DA2 A;  4BQN A;  3ZQC A;  5K5O A;  2H94 A;  1A35 A;  1YG2 A;  1FT9 A;  1W4M A;  5HDK A;  3CO7 C;  2W25 A;  3ZMZ A;  1OJL A;  2M0C A;  2VI6 A;  3BCB A;  1OYI A;  3HM5 A;  2P7V B;  1UB9 A;  1ZRF A;  2NAZ A;  1B9M A;  2FXA A;  4A3I J;  3V8J A;  1XPX A;  4EJO A;  2W48 A;  1JKO C;  4IJA A;  1JKR C;  2K02 A;  5JLX A;  3K4N A;  1BR1 A;  3R4K A;  4M6Y A;  1D0Z A;  3BPV A;  4QPO A;  4G8X A;  4FIS A;  1R5H A;  1O4X A;  4Q4Z F;  1WJA A;  4LK0 F;  2VKH A;  3V7C A;  4LK1 F;  2GXG A;  1JJ8 C;  4C2M J;  2EV0 A;  3D0S A;  1AU7 A;  2VE9 A;  2LRE A;  2ESN A;  2VE8 A;  2GOX B;  1YW7 A;  1J7K A;  2LYC A;  3G1M A;  3S3N A;  5J40 A;  3RI4 A;  3SXY A;  4NUB A;  1AKH B;  2R7S A;  4C30 A;  3PUF A;  3V4G A;  1VF9 A;  5DUK A;  2VBZ A;  2GIV A;  5IOY A;  3VPR A;  5DM6 F;  2Z1D A;  2DOA A;  1W36 D;  3I56 I;  2ZSH B;  3E6D A;  1XGS A;  2MD0 A;  4IRI A;  1ZLK A;  1MW7 A;  2A68 F;  3RDI A;  1S7O A;  1USS A;  4XL9 A;  4A93 J;  4UB8 C;  3IH4 A;  3AG2 H;  1XDU A;  4ANJ A;  2CV2 A;  3L7W A;  5DCF A;  5JVG F;  2V26 A;  2P6T A;  3QRF F;  2GXB A;  1Z9C A;  4BH9 A;  3PL8 A;  3EYY A;  4EJW A;  3OYK A;  2CW0 F;  3FXR A;  3TOB A;  3CZ6 A;  4RAG A;  3LWF A;  2A61 A;  4OOI A;  5M5Y J;  2VOD A;  4P55 A;  5H20 A;  1FOW A;  4YFX F;  1D8K A;  2Y0S A;  1X1B A;  4CGZ A;  4YFK F;  3KET A;  4BE1 A;  2EZL A;  4JYK A;  1XSX A;  1LE8 B;  2R7D A;  4R8H A;  3MWM A;  5ICF A;  5FKL A;  2NRA C;  1JUM A;  4NNJ A;  1SAX A;  4G7O F;  2LH9 A;  1B59 A;  3BZC A;  2E1N A;  5FGM A;  2EFW A;  3I59 A;  1MNE A;  4PJN A;  4PCQ A;  3QOE A;  3CF5 F;  1SD7 A;  1YW9 A;  3LSM A;  3S8P A;  4C3J J;  2M7A A;  1ZKG A;  3KLN A;  2M8G X;  2O0Y A;  2VKV A;  4AIJ A;  1J0R A;  2JA6 J;  3FMR A;  4L5J A;  5LHI A;  4JOM A;  2V6E A;  5B3S H;  1IXC A;  3CJR B;  2HVQ A;  4AID A;  4XLN F;  4HF0 A;  1VQ9 I;  3MZY A;  1X2M A;  3X2Q H;  1X4O A;  3AL0 C;  3G1O A;  3DV8 A;  1CGP A;  1XGN A;  2I10 A;  1MH3 A;  1YTY A;  3FBN B;  1D1B A;  2M87 A;  3KX2 A;  2F4M B;  1IRZ A;  2A69 F;  2A07 F;  4HF2 A;  3G6E I;  1P7J A;  4LD5 A;  4BNC A;  3D5L A;  1WKM A;  5IYD J;  3A02 A;  4B3X A;  2XAU A;  1LDD A;  2XAH A;  3BY6 A;  2PLY A;  2CG4 A;  4JQF A;  2DPD A;  4RA2 A;  2M4K A;  2XIG A;  1XDS A;  1EJ9 A;  4WXD A;  4BAY A;  3N97 A;  3QU3 A;  5KCM A;  3SQN A;  3AAF A;  3JRD A;  4HQM A;  3GX4 X;  4E4H A;  2Z5U A;  1B8I A;  4BDZ A;  3F8B A;  4RGX A;  1RIO H;  2HNH A;  4BHB A;  5DCM B;  4HDV A;  1VQ4 I;  1FC3 A;  2O03 A;  3LOC A;  3G73 A;  3WOD F;  1R1U A;  2PJR B;  3FIS A;  4A0Z A;  1NG6 A;  3DTI A;  4M3B A;  5L3B A;  4OWR B;  2VBY A;  3WE3 A;  2XKP A;  3HOU J;  2YS9 A;  1POG A;  4DQ2 A;  1FSE A;  4A0X A;  2YU9 J;  3F3X A;  1JKQ C;  4FX4 A;  1YQA A;  4UVA A;  5H6Q A;  4RAY A;  2X6Y A;  3CJT B;  2R7U A;  4X6A J;  4BAC A;  3LA7 A;  3GFM A;  3ISP A;  3P7N A;  4E6K G;  1FZP B;  4KIC A;  1X4P A;  1WPK A;  1FJL A;  3OYJ A;  4DOZ A;  2HGC A;  2UUZ A;  4NQW B;  3CD6 I;  5A2Q K;  1MMS A;  4CCK A;  4CYD A;  4OAY A;  5AIP A;  2HI3 A;  4D7N A;  1G6N A;  3P5J A;  4KJZ A;  4NBQ A;  1VQK I;  3REO A;  4XIC A;  2EIL H;  2I8D A;  4M71 A;  2OA4 A;  3RTR A;  1H9T A;  2B0L A;  3DWL E;  1EH6 A;  1BA5 A;  3MMY B;  2M34 A;  2BXY A;  2VJI A;  3CUQ B;  4XOR A;  5EYR A;  4M9Z A;  2F2E A;  2FMY A;  3OMY A;  1BN5 A;  1F1Z A;  2DFE A;  3CC2 I;  5EZG A;  2DAO A;  2R0Q C;  3SZP A;  3S2W A;  3L2U A;  2K85 A;  5GAD J;  1SD5 A;  3VSL A;  3JRF A;  1B72 A;  3K69 A;  5FB2 A;  1ZAR A;  2PX9 A;  5H2F C;  5DEQ A;  4DJA A;  2K5C A;  2PMZ N;  5F0C A;  1BI3 A;  2X1E A;  3MKW B;  1ZRD A;  2FOW A;  5HNH A;  2HYJ A;  2Y2Z A;  2X1D A;  4IXA A;  3TQN A;  4MIM A;  1ON1 A;  4ITV A;  1Z0X A;  5IP9 J;  3K6G A;  2R7V A;  1FNN A;  3DFG A;  3HJE A;  3DKW A;  4D7M A;  1K83 J;  1QU3 A;  1TT5 B;  4ZDO A;  3JRG A;  3IWF A;  1ODD A;  2VJ4 A;  3N4M A;  2R7O A;  2OV7 A;  5K1Y A;  4I6Z A;  3ABM H;  3KCC A;  3K7A J;  2KRH A;  3DLA A;  2EFP A;  3MVP A;  1B1B A;  3TW7 A;  1EKE A;  3WTX C;  2R5Y A;  1RNL A;  2STT A;  1P92 A;  3G2B A;  1RUO A;  1STZ A;  3LFU A;  5F08 A;  5HNF A;  1VND A;  2Q2E B;  2NYX A;  2L9R A;  1T95 A;  1IV6 A;  2XV4 S;  2CW8 A;  1UHW A;  4XON A;  1VQ7 I;  4DIQ A;  4ZYE A;  1UMQ A;  5IP7 J;  3HOZ J;  2DLL A;  4U7B A;  3T8R A;  2HPM A;  2R92 J;  3KP4 A;  2XKO A;  5M5X J;  3RKX A;  3NQO A;  2PMZ A;  5EF6 A;  3E6C C;  4L9V A;  3FXK A;  4LG3 A;  4KN7 X;  2H6B A;  2OD5 A;  1Y8Q B;  1TWA J;  3SHF A;  1MBH A;  4U87 A;  3K4C A;  5EEG A;  3CLQ A;  5ILS A;  4HOB A;  1FMW A;  5HOO A;  1U78 A;  1O3Q A;  4EGY A;  2FQ3 A;  5BMZ A;  4JX4 A;  1SMT A;  3K4K A;  4JK1 X;  1S7A A;  2BEO A;  2PMH A;  3IRQ A;  3VWB A;  4GRI A;  3L2W A;  4HX8 A;  2I5U A;  2LD5 A;  3BR5 A;  4S05 A;  1HLV A;  2UZK A;  1ZK8 A;  3I4N J;  3FHN A;  3H1C A;  3QYB A;  4WCG A;  5IYB J;  2R3S A;  4PSW A;  3PJR A;  2X85 A;  5TJJ A;  4ZYH A;  1SAN A;  1WWX A;  1HSJ A;  1FX7 A;  4U88 A;  4UUS B;  1RET A;  2HDW A;  2WAQ A;  3EUH C;  1OR7 C;  4XLH A;  3ZQG A;  2HOE A;  3CCM I;  2Q0O A;  1NK2 P;  2CV1 A;  1ZYR F;  4A12 A;  2ME0 A;  3Q5F A;  3I59 B;  3PQJ A;  4CCJ A;  2HQA A;  1GVD A;  3FIW A;  2G7U A;  5FLX Z;  2E5Z A;  3LQR A;  4V2F A;  3M8J A;  2VON A;  1TQI A;  3WGG A;  3WHC A;  4M9S A;  2WY8 Q;  2Z2S B;  3QAH A;  1W7P A;  4A3E J;  2ADU A;  1Y0N A;  3F72 A;  2KPM A;  2NOJ B;  3O2P E;  1XCV A;  2AHQ A;  3ERM A;  4AVZ A;  1O3T A;  2H1K A;  4BU2 A;  2DA7 A;  3MKY B;  1V4R A;  1MJA A;  2FBI A;  4PJJ A;  4PFO A;  5IOZ A;  4BHP A;  3ZQF A;  4E7J A;  2D2W A;  2M3A A;  2ZFU A;  3CC7 I;  2M5W A;  1FBS A;  2LMD A;  4GYG A;  3RYP A;  4CZC A;  3UKG A;  4PGH A;  1ZG1 A;  2VKD A;  4HW0 A;  4HNT A;  1U5T C;  3MN2 A;  2JQ7 A;  5EZH A;  1YIT I;  3LSP A;  1HC8 A;  4ZH4 F;  3HHG A;  2KRC A;  4LG0 B;  3WE2 A;  3DXJ F;  3VYS B;  2HVR A;  2XUB A;  4LIT A;  3KEQ A;  2Z9O A;  1XC5 A;  3L9F A;  3NWS A;  2XGE A;  1TNS A;  4V2G A;  2H27 A;  2QLZ A;  3HL2 A;  1JE8 A;  2Y31 A;  3BR2 A;  5L3C A;  4BJ6 C;  2R7T A;  3DBH B;  4C3H J;  4JP0 A;  2R5Z B;  3RYR A;  3TO9 A;  2BVL A;  2XGD A;  2XDV A;  3JAM Z;  4RDU A;  1G3T A;  1BJZ A;  2OZU A;  3TOA A;  1OPC A;  4I76 A;  4BXU A;  1DP7 P;  1YX3 A;  2HKX A;  2PBI A;  1Z67 A;  3EUA A;  3KP5 A;  4ZZL A;  3H0G J;  4G7H F;  1C0W A;  2EPF A;  1YFH A;  3BR6 A;  3M1E A;  1KQ0 A;  3KFW X;  4XRS G;  2CU7 A;  2V1N A;  1NH3 A;  2HQ5 A;  2Q1Z B;  3BG3 A;  4K2E A;  2E36 A;  1Y56 A;  2H6C A;  2E34 A;  5EGO B;  2IT0 A;  1AA7 A;  4L9T A;  1FOK A;  5LLQ A;  3S93 A;  2VXD A;  4A3G J;  3KYD B;  2PMU A;  3I3L A;  2O61 A;  2DYS H;  1ZAO A;  3WU0 A;  1AOY A;  5LD2 C;  3PO2 J;  5CVU A;  5ED4 A;  2QSG X;  2E19 A;  3BJ6 A;  4Y52 J;  4OIQ F;  2NVQ J;  4CCL A;  3HG9 A;  2DQR A;  1T39 A;  1HCR A;  1ON2 A;  1P6R A;  1FOX A;  3P9K A;  4G9Y A;  2E35 A;  2KIS A;  3ASO H;  3CP2 A;  4XLF A;  2MH2 A;  2MSY A;  1UHS A;  3DEW A;  3I71 A;  5EEH A;  1HBX G;  1A6I A;  2L01 A;  4BHC A;  1P9Q C;  3BOQ A;  1NK3 P;  3QYE A;  4BBS J;  3QOD A;  4Y15 A;  1U9N A;  3O8G A;  3W2W A;  4BDY A;  3PM1 A;  2GA2 A;  3SJM A;  2FX0 A;  2WV1 A;  2HFH A;  3KLO A;  2KFD A;  1MNM C;  1JJ6 C;  4DYR A;  5FLX K;  2JSP A;  1MGT A;  2CQQ A;  3BR1 A;  1PDN C;  2Y0M A;  4NHJ A;  5E79 C;  3CMM A;  4B44 A;  1E3P A;  1V5F A;  4HRI A;  2OBP A;  2FQ4 A;  4E7Z A;  3QPT A;  5TIS C;  2R5Y B;  4J19 A;  4U0W A;  5L3F A;  3TDU C;  3FM5 A;  2CH0 A;  2VQH A;  4ABZ A;  1D1A A;  3PFI A;  1T56 A;  2KZG A;  2VC1 A;  4EV0 A;  1KQ9 A;  2K4B A;  1LFU P;  3QYF A;  3R6S A;  1N78 A;  2VQG A;  1T33 A;  2K3P A;  3GME A;  3IKT A;  3HXL A;  4AIH A;  3EUK L;  3UR3 C;  3KEY A;  1O3S A;  4Q47 A;  4LLL A;  2HDD A;  3BCA A;  1FMV A;  1K7A A;  3KZI C;  1HKQ A;  1MBG A;  3LSK A;  4Z6Y A;  3V42 A;  1DPR A;  4S04 A;  2DPU A;  3C2B A;  5CPR B;  3HEF A;  2VBX A;  3A1Y A;  3DU5 A;  4CCO A;  5D5W B;  2DMN A;  2LF8 A;  3IHU A;  1N75 A;  1QRY A;  3MKL A;  1YS7 A;  2EJR A;  1WJ5 A;  1HOM A;  4CA0 A;  4HNU A;  3RJP A;  1E3H A;  1X1C A;  4KN4 X;  2YX7 A;  2W82 A;  1JGS A;  2MC4 A;  2XAQ A;  1MBF A;  1Z91 A;  1I6X A;  1JGG A;  2BV6 A;  3M07 A;  3GTG J;  5LGN A;  2VIX A;  1YJN I;  2KMU A;  2OCE A;  2QQ9 A;  2MW8 A;  2V1D A;  1K4T A;  3WTU C;  3ECH A;  2YR2 A;  2OZ6 A;  2NS8 A;  2VT3 A;  1AHD P;  3OYC A;  1E2X A;  2QKM B;  1J5Y A;  1MBJ A;  4DYC A;  3WU2 C;  3WTW C;  2QF7 A;  2FOK A;  1D0X A;  3A01 A;  3PNV A;  4EM0 B;  3QPS A;  3M1C A;  3P9C A;  2JSC A;  1RKW A;  2LY2 A;  3B6A A;  1XMK A;  1W5C C;  2CUE A;  3E1S A;  2JZY A;  2FNA A;  3ZMU A;  4BQO A;  2DOD A;  3VYT B;  4C9Y A;  2W1O A;  2W85 A;  3BR0 A;  1TWG J;  4HSR A;  1W7P B;  3F21 A;  4Y13 A;  4ZJZ A;  1VFC A;  4XLE A;  1BBY A;  3CCV I;  2ZBK A;  5F27 A;  1SMY F;  1LJ9 A;  3UNG C;  2O7O A;  3VYU B;  4FAS D;  3OIQ A;  5B66 C;  4O3M A;  1ULY A;  2BE5 F;  4BKX A;  3CME I;  1WRJ A;  3L00 A;  1WJF A;  4AUX A;  1H8A C;  4MO7 A;  3SYT A;  1P4A A;  4BE0 A;  2QYO A;  2JN6 A;  1A04 A;  2L2O A;  4PJ0 C;  2CUZ A;  2LBF A;  3GF2 A;  3GTP J;  5BPI A;  1EA3 A;  1IO2 A;  3E7L A;  3F0C A;  3R60 A;  2L4A A;  3OY9 A;  4B09 A;  1ZGJ A;  5LBQ A;  2ID6 A;  5KK1 A;  3FZV A;  2AXL A;  5E20 A;  2MAB A;  2EZI A;  1W1W E;  3LSH A;  3WTZ A;  2L3D A;  4L9J A;  1QVT A;  1BIA A;  1JUP A;  2OUM A;  1OCT C;  3DKY A;  4S0H B;  4ZYD A;  1MDM A;  2RNG A;  2EWN A;  5K7F A;  3HRU A;  3Q0U A;  3DPU A;  4PGG A;  4IF4 A;  4HPQ A;  2XPV A;  3BG9 A;  3GXO A;  4IX7 A;  2DT6 A;  3GFL A;  1IUF A;  4PK4 A;  4DYQ A;  3S17 J;  2BY3 A;  3K1N A;  3CTA A;  2KDZ A;  1U8R A;  2ME6 A;  3C2H A;  4L5I A;  4UUV A;  4HZF A;  2WWY A;  4YRV A;  3H3U A;  4MFE A;  2RRE A;  2DMP A;  3HRM A;  1IN4 A;  4B43 A;  4L18 B;  5J1Y A;  3HC7 A;  2Y0S N;  4HX7 A;  1JUS A;  1OQY A;  4KT5 C;  1RPW A;  4M6V A;  5LGU A;  3KP6 A;  5AON A;  2IEK A;  4G94 A;  4HEA 2;  5D4S A;  3E5X A;  3FXU A;  3HOS A;  3DF8 A;  2K40 A;  3FWE A;  2EA2 A;  4IHT A;  4RAZ A;  1YLF A;  2WC2 A;  5IY5 H;  4A3K J;  1KQ8 A;  1WH7 A;  1IN6 A;  3CLO A;  2XAG A;  4LGW A;  1XGM A;  4QIW N;  2WAE A;  4CIC A;  3ZRG A;  1IZ1 A;  4G6D A;  4UUT A;  1BW6 A;  4Y33 A;  2RGV A;  1VQ5 I;  2KIM A;  2NNN A;  3BTC A;  4F92 B;  2GAU A;  1ZN2 A;  2P7C B;  3PNT A;  5DDG A;  1PUF B;  1SC7 A;  2EV5 A;  3N05 A;  2GOM A;  2K9S A;  5IT3 A;  3S1N J;  5DYM A;  1DPU A;  3ABK H;  3SZT A;  2K86 A;  4AC0 A;  5C4J J;  4D0P A;  1KU3 A;  4BYY A;  1K4S A;  3FXQ A;  3LQQ A;  1B4A A;  5J4Y A;  2E5N A;  2JA5 J;  2VUM J;  3U21 A;  4IEJ A;  2IA2 A;  4FE7 A;  4B1R A;  1V5E A;  2MFZ A;  4II2 A;  2E2J J;  2L9S A;  3BZK A;  2FSW A;  3HRT A;  3EUH A;  1OR7 A;  5CQE A;  1OFC X;  4C2T A;  5FKN A;  1TP4 A;  2E1O A;  3M3Y J;  1DU6 A;  3HPH A;  1UAA A;  3AG4 H;  3VB2 A;  2XAF A;  3MZH A;  1WJE A;  1ETK A;  2V1U A;  2OCC H;  2DA5 A;  2C6Y A;  1V54 H;  2V79 A;  3J80 Z;  2HZD A;  3I53 A;  4IO9 F;  4EGZ A;  4HQE A;  2KHM A;  3HYI A;  2VB6 A;  2M7B A;  1G8X A;  3DEU A;  2FBH A;  2EQR A;  2Q8K A;  4A5M A;  5CJ9 A;  3S3O A;  3U1K A;  3OS0 A;  3T8T A;  3E3V A;  4BY7 J;  2EIK H;  2HOS A;  2O5R A;  1GV2 A;  2EIM H;  3GVA A;  3C18 A;  4OIN F;  2IRF G;  1U6G A;  1Z77 A;  4A3D J;  1L0O C;  1CF7 A;  3AL0 B;  5FRN A;  1YRN A;  2HKO A;  2Z16 A;  3W2V A;  4PSX A;  1VQ6 I;  2DYR H;  3HKZ N;  1R23 A;  3Q9V A;  2KP6 A;  2L4M A;  1LEB A;  3I4P A;  1VQO I;  5DM7 F;  1U5T A;  3HUG A;  2A6H F;  5E1W A;  4I2O A;  4HLX A;  2RKH A;  3BWG A;  1ETW A;  2COM A;  3JR9 A;  1ZH5 A;  4A3C J;  1O7F A;  1YOV B;  3FXL A;  1H0M A;  1K79 A;  3ZMT A;  5M3M J;  4I0B A;  2X6X A;  3KEO A;  4GXO A;  2OAZ A;  2VJ5 A;  4N0B A;  4XOP A;  2GZW A;  3PNY A;  2QEN A;  1P2F A;  1M1E B;  2WB1 N;  2B7E A;  4ZDL A;  4DBQ A;  1HXD A;  2IBD A;  2ZXJ A;  2L9V A;  1F4K A;  4P9F A;  4YEL A;  2FRH A;  3MD2 A;  2E2H J;  3IKV A;  2GXA A;  3TKY A;  1I3Q J;  2PEX A;  2IGN A;  3K4M A;  2QSF X;  1W5T A;  2ZXH A;  2LG4 A;  4QSH A;  3VYR B;  1SD6 A;  5D5V B;  4AU7 A;  4IHW A;  1ONV A;  1RES A;  3A01 B;  2VQC A;  3U9G A;  2DJI A;  3B73 A;  4FCY A;  4V19 K;  1F36 A;  3CJN A;  4YIF A;  1I1G A;  3OR2 C;  1HA8 A;  1ETY A;  3HKZ A;  3OYF A;  1KON A;  2DTR A;  4XKW A;  1IJW C;  3E5U A;  2XB0 X;  4M3E A;  5KHD A;  1I50 J;  4A3B J;  1BR2 A;  4EJT A;  1T6S A;  5C44 J;  2XSJ C;  2EFQ A;  1I1S A;  1B9N A;  2W4S A;  1BC8 C;  2STW A;  2CS3 A;  2IXS A;  1IW7 F;  1PJR A;  2RV8 A;  1D8J A;  3AKZ A;  3RZO J;  3QWL A;  1WJC A;  3K4B A;  3PIO F;  3SFI A;  1GVJ A;  5AIQ A;  4G12 A;  1J09 A;  3L09 A;  2DXI A;  3CCR I;  5EG0 A;  2D1H A;  2QQ8 A;  2F5V A;  4CSW A;  2WB1 A;  3BG6 A;  2ZME C;  3GTL J;  3GW2 A;  5HDG A;  2XF7 A;  3C1D A;  2DK5 A;  2LBF B;  2XRO A;  4Z2Y A;  1S8N A;  2V6C A;  1RKT A;  4LFU A;  1QHH D;  3E0J B;  1FIA A;  3I64 A;  3ZQH A;  1RR7 A;  2VL8 A;  3CCE I;  5IP6 A;  4WXC A;  2WAF A;  1U2W A;  4P1W A;  5CVV A;  1YI2 I;  4WWC A;  2B9S A;  2HPI A;  3CDI A;  4IHS A;  4IHV A;  2XRN A;  3DKX A;  4IRH A;  1E0E A;  2A3S A;  1MMG A;  1H9G A;  1R7J A;  5ILV A;  4AM3 A;  1MDM B;  1GXP A;  3OWT A;  1J59 A;  3W3C A;  2ZXI A;  3HBL A;  4LJZ F;  1BR4 A;  2IS6 A;  1MJ9 A;  4KIS A;  3OYH A;  2LSO A;  5KNL A;  1HDP A;  1XMX A;  2BY2 A;  3LST A;  4F52 A;  3EYI A;  2LK2 A;  1JHF A;  5E3M A;  2FA5 A;  4A5N A;  3A4C A;  2VOO A;  1A5J A;  2W00 A;  3IV5 A;  2ZCW A;  2XF6 A;  4P96 A;  3AFH A;  1WZ2 A;  3FF5 A;  4CUG A;  3JRE A;  5LHG A;  2LF7 A;  1HF0 A;  1EH7 A;  3WG7 H;  2HYF A;  3OYB A;  1DP3 A;  4UXN A;  2K4J A;  1QZY A;  4BXF A;  1IF1 A;  5GAG J;  2F5D A;  2M1B A;  1TC3 C;  2DA1 A;  3HPG A;  5ERI A;  2YPR A;  4PJL A;  1D0Y A;  2LY9 A;  3PIP F;  2V7F A;  1REP C;  2E1M B;  2WAQ N;  5E3N A;  1TWH J;  5HDN A;  1G59 A;  1ETQ A;  4BQA A;  1K6O A;  3ZMV A;  2K7L A;  3LL7 A;  2UWM A;  3L1P A;  3FX3 A;  2JK3 A;  3LNQ A;  2BOL A;  2TCT A;  2KLO A;  2HXO A;  3BZ6 A;  1Y0U A;  4LB5 A;  4EJU A;  1IDZ A;  3AG3 H;  3TGN A;  2K9M A;  4AD9 A;  1NTC A;  2GWR A;  2H09 A;  1TTY A;  1X1P A;  2L9N A;  3MAJ A;  4ESF A;  4H4K C;  2HWV A;  2MD5 A;  1RC9 A;  1ETO A;  2MH9 A;  2P0W A;  1HW5 A;  2FML A;  3KP2 A;  3WU1 B;  2O9L A;  3QU6 A;  2IJL A;  2YUS A;  3OYE A;  3OSF A;  2E1C A;  1BIB A;  3ZP5 A;  2OC6 A;  4BE2 A;  3F6O A;  2BW3 A;  2P6S A;  3RZD J;  4DZJ A;  4ESB A;  1XS9 A;  3MKZ A;  2AO9 A;  4A3J J;  1FPQ A;  2M0M A;  2R7X A;  4KA4 A;  1VQ8 I;  4Y17 A;  4A6E A;  2Z3Y A;  1PVE A;  2BGC A;  2KIQ A;  3AG1 H;  3FBI B;  2M8E A;  5E18 F;  1R00 A;  2VC0 A;  1A6Q A;  1BM9 A;  3BG5 A;  4F7Z A;  3F8F A;  4BUP A;  5GAH J;  4BY1 J;  2M9H A;  1IRG A;  4OMZ A;  1JTX A;  1S6L A;  3J7Z I;  3ASN H;  5J47 A;  1RUN A;  1HKS A;  3K10 A;  3VFZ A;  4ON0 A;  5FRM A;  3WGI A;  3HTU A;  4UY8 I;  2HZT A;  2HXI A;  4MGR A;  1YIO A;  2CQK A;  3JCU C;  1JXS A;  3T1B A;  5LEK A;  1ACI A;  2DOF A;  1GLN A;  5DUI A;  2LKX A;  2HTS A;  3CDH A;  2OPT A;  3CCL I;  5LRR A;  1R9T J;  4HLY A;  1A36 A;  1YRN B;  2CGP A;  2GM4 A;  1R5G A;  1LVA A;  1QO0 D;  2QZ8 A;  1T0F C;  2ZJP F;  2H8R A;  1BI1 A;  3K2Z A;  4EEF G;  2JA2 A;  2CSO A;  2NOG A;  1QA6 A;  2DA6 A;  2ZNZ A;  3KZY A;  4I98 B;  3CC4 I;  5IT9 Z;  3R61 A;  3ECO A;  5IPA A;  2AS5 F;  2DBB A;  1WHU A;  4L5E A;  1BI2 A;  2CJJ A;  3L2R A;  3OYD A;  1SFK A;  5ICE A;  3OYG A;  1F5T A;  2V9P A;  3H9G A;  1G4D A;  4A3L J;  5TRD A;  2MGQ A;  1FBU A;  2ZSI B;  2ELJ A;  3PSI A;  4ZC3 A;  1R4N B;  4RBO A;  4EM1 A;  1DDN A;  1QGP A;  1SFO J;  1Y1W J;  2DMT A;  1W5S A;  2F4I A;  3I9V 2;  2EK5 A;  4BL0 B;  1WI9 A;  2JMW A;  4XBF A;  2KDO A;  5BQT A;  1MZB A;  2D1V A;  4D5F A;  3EDP A;  3IC7 A;  4J01 A;  1BL0 A;  4A3F J;  2GLO A;  1B8I B;  2DT5 A;  2VAS A;  3QP6 A;  5JHF A;  1YW8 A;  5CYV A;  4QTR A;  1QVU A;  2WV0 A;  3ZQQ A;  5B5E C;  1WH5 A;  5E8G A;  4CHU A;  3SEQ A;  3OSG A;  4IPA A;  2EV6 A;  1I3A A;  1OCR H;  2V4J C;  1U0J A;  4F3Q A;  4XRF A;  2KJC A;  4UNO A;  2Y69 H;  4II3 A;  2VOP A;  4DBR A;  1YE9 A;  2FEZ A;  4EJV A;  5F64 A;  2V9V A;  5F1R A;  2EB7 A;  3RSN A;  3RPU A;  1GUU A;  5CKT A;  5EG0 B;  1YYV A;  1ZRE A;  3PO3 J;  4IHX A;  2XF5 A;  2CQN A;  2IA1 A;  2E71 A;  1WVR A;  3DU6 A;  4Y4R A;  3ZXS A;  3LMM A;  3G71 I;  1BJA A;  2F5C A;  2Y9Z A;  1IC8 A;  2ELK A;  3QQA A;  5HLI A;  5J1R A;  1T38 A;  1AWC A;  5K7Z A;  5FFX A;  2M2E A;  3VDX A;  5CVI A;  2UXX A;  3OS1 A;  4KIB A;  1KZH A;  4QWQ A;  1B72 B;  1T98 A;  4FTH A;  3CMA I;  2L7M P;  4M3D A;  4CZZ A;  3BQY A;  4ENJ A;  2IGM A;  4E7S A;  2JPB A;  3OR1 C;  5FRO A;  6PAX A; 
#chains in the Genus database with same CATH homology
 2F5E A;  5LEJ A;  4JBA A;  3GFJ A;  3LFK A;  4FHT A;  3BJO A;  4XLP F;  3M7G A;  4M74 A;  4LB6 B;  3GEZ A;  4Q48 A;  3FMQ A;  1R1V A;  2KJB A;  4EQQ A;  2CYY A;  3O6B B;  4HBL A;  1LNW A;  3RPQ A;  3ULQ B;  2MLG A;  3L2C A;  1RZ4 A;  4M73 A;  4R1H A;  2QBY A;  2P4W A;  4KIG A;  1ZRC A;  1IXS B;  1BI0 A;  2D45 A;  2EFO A;  1TQM A;  3ROU A;  3W6K B;  5BOX A;  2Y75 A;  4OMY A;  1G3Y A;  4WX9 A;  1XB4 A;  1R36 A;  2E7X A;  1IN5 A;  4U0V A;  5HS7 A;  5FD5 A;  2IW5 A;  1FSH A;  1QNT A;  1VTN C;  1TNT A;  3F23 A;  5HLH A;  2JT1 A;  1SFU A;  2DO7 A;  2OQG A;  4YFN F;  3JAM K;  3V7R A;  3O3K A;  4I09 A;  4RGU A;  3WTY C;  3G3Z A;  2XVC A;  2IPQ X;  5E17 F;  4P5O A;  4KMF A;  1KU9 A;  4WXH A;  4FT8 A;  1KGS A;  4IRG A;  2QQA A;  5JFR A;  3TDZ C;  3F8C A;  1PUE E;  4UV9 A;  2LDU A;  3BDD A;  3TO7 A;  4HDU A;  1V3F A;  4KNY A;  2HS5 A;  2Y48 A;  3F8M A;  2BYV E;  3HSR A;  3NRV A;  4HAM A;  1R22 A;  2FF4 A;  2ZME A;  3WGH A;  5DCM A;  2W57 A;  4MEY F;  1D5V A;  1XSD A;  3ML6 A;  2HEO A;  1HQC A;  2UXN A;  3M9A A;  1OYY A;  2M45 A;  3ZN0 A;  3WTS C;  4NQW A;  3ZQ7 A;  2DFI A;  1IN8 A;  1KYZ A;  4UV8 A;  1K78 A;  3H92 A;  4PDK A;  1J2X A;  3LAJ A;  1UHM A;  1F9N A;  3K9T A;  3V8L A;  2HTJ A;  2RVC A;  4A0Y A;  1QPM A;  4MQ9 F;  4MQV A;  3KZZ A;  1SD4 A;  3HTS B;  3T5X A;  1P4W A;  1LEA A;  4UVB A;  1Z6R A;  1QZZ A;  1Z05 A;  5D6E A;  4I7H A;  2A6E F;  4R79 A;  2P5L C;  2OU2 A;  5L3E A;  5DD8 A;  4HYE A;  1UST A;  3HHH A;  2M30 A;  1WQ2 A;  2L54 A;  3JW4 A;  1MD0 A;  2X0L A;  1G3W A;  2Q2E A;  4HA8 A;  2DI3 A;  4GYI A;  5K5Q A;  4XSZ F;  5L3G A;  3GFI A;  2P8T A;  2V1X A;  1GHC A;  5D4R A;  1RI7 A;  1XD7 A;  3IRR A;  1KU2 A;  1XSV A;  3ERE D;  2ZFW A;  3I58 A;  3I5U A;  2NNY A;  3RIR A;  1LDK B;  2O3F A;  5A2Q Z;  2CFX A;  1J75 A;  3PQK A;  2EA4 A;  2F5F A;  2KKO A;  1FP1 D;  3QP5 A;  2IP2 A;  3K0L A;  3SFZ A;  3HIF A;  5HLG A;  1FP2 A;  4UHT A;  2EFN A;  4EVI A;  2QBY B;  1T0F A;  3DPL C;  1NHA A;  4RB0 A;  5E1Z B;  4WK8 F;  3KP3 A;  3EET A;  4YII A;  2XGX A;  2ZKZ A;  5L3D A;  5E1X A;  3MQ0 A;  3MEX A;  2YSR A;  3ELK A;  3ZMD A;  4RB3 C;  1FWZ A;  1ZHF A;  1FYL A;  5K5R A;  4MEX F;  4XSX F;  3GWZ A;  1Z1D A;  2P5K A;  4I01 A;  3RKW A;  3MFK A;  2CWE A;  4M6X A;  5LHH A;  3EQL F;  3U1D A;  5HVQ C;  1Z7U A;  1EV7 A;  1BOA A;  4CDG A;  5ICG A;  3F8N A;  3I0T A;  4IVN A;  2QVO A;  2W24 A;  3T0Y A;  3DP7 A;  1ZLJ A;  1TBX A;  5BPD A;  3JSP A;  3WTV C;  1IUY A;  4LG0 A;  3GZ6 A;  1ZGA A;  4ASN A;  1ZG3 A;  4KMU X;  2CO5 A;  1TW3 A;  1S3J A;  4G7Z F;  4B8X A;  4I02 A;  3NEU A;  1Q1H A;  4AVP A;  5FD6 A;  1U3E M;  2ZME B;  1OMI A;  1B6A A;  5J8C A;  3F22 A;  1YO5 C;  4H0E A;  2ZNY A;  1E17 A;  1TQP A;  4ESJ A;  3VOE A;  2VXZ A;  1HKT A;  3DQV C;  4RGS A;  5F6F A;  2XAJ A;  1IAW A;  3W6J B;  1XGO A;  2J5O A;  1MJB A;  3IWZ A;  5LRS A;  3VOD A;  1FLI A;  2LNB A;  2HQR A;  1K78 B;  3J80 K;  3KP7 A;  2IVM A;  1ZG5 A;  2G9W A;  4KUM A;  3HSF A;  4OIR F;  2HDC A;  2KIU A;  2DU9 A;  3JTH A;  2VN2 A;  5CVJ A;  2MLK A;  2ELH A;  3CUQ C;  2GQQ A;  3J81 Z;  1PP7 U;  4LMY A;  2G7H A;  3BJA A;  5HS8 A;  4MTD A;  3KE2 A;  2ZO4 A;  4MTE A;  3E6M A;  4ENN A;  5DV5 A;  2K27 A;  2DW4 A;  4I0A A;  1GXQ A;  4GGG A;  2JTV A;  1XCB A;  4FX0 A;  4L0Y B;  3FHZ A;  2NS0 A;  1DUX C;  1SFX A;  1O7L A;  1T2K A;  3JSO A;  2ESH A;  4N9H A;  3OOP A;  2FBK A;  5JVT A;  1FYM A;  1BC7 C;  2HR3 A;  4LLG F;  3ZMS A;  3Q9S A;  2HQN A;  4A6D A;  2RQP A;  4HX4 A;  3V7S A;  3CUO A;  1OKR A;  1O3R A;  3DPT A;  2TDX A;  3GO5 A;  1SFE A;  2PQ8 A;  4RGR A;  4ZZD A;  3VEP A;  4CXF A;  1WSU A;  2HYG D;  4GO1 A;  5FFZ A;  2QWW A;  2QQB A;  2X4H A;  1CF7 B;  2XAS A;  4ETS A;  5BS6 A;  2RNJ A;  2JRT A;  4AIK A;  1HST A;  1UCR A;  5ILU A;  4CO8 A;  1U5T B;  1D3Y A;  2PJP A;  3BP8 A;  1R58 A;  4RB2 C;  1KYW A;  4KYW A;  2ACJ A;  2VBW A;  4HV5 A;  3JTG A;  1TLH B;  1XMA A;  3GYH X;  3WTT C;  1LB2 A;  4A2U A;  1LDJ A;  1I27 A;  4L9N A;  3RKY A;  1KA8 A;  1L3L A;  1HW2 A;  1MKM A;  3J81 K;  4KIF A;  4PZJ A;  2R7F A;  3GLX A;  5D5X B;  4DNC A;  3IL2 A;  2JPC A;  3CO6 C;  2MBF A;  5E8I A;  5CVR A;  1XN7 A;  4TV7 A;  3WG9 A;  2OQR A;  1QBJ A;  4RS8 A;  4M9X A;  3OV8 A;  2W84 A;  5D8L B;  3LA3 A;  1O57 A;  2FE3 A;  1IN7 A;  3P9I A;  4O5V A;  5JHU A;  2Z99 A;  3C3W A;  1Z6T A;  4OIO F;  3ZPL A;  2RC4 A;  3M8F A;  3K1M A;  2KRF A;  1UFM A;  3E6B A;  2IA0 A;  2PI0 A;  1R1T A;  5JI6 A;  4U0Y A;  2L02 A;  2J5P A;  4HF1 A;  2O8X A;  4WF2 A;  2FNP A;  5D8K B;  3ZN1 A;  3K1P A;  3U2R A;  2VT2 A;  3FMS A;  4ZYG A;  2PG4 A;  2P5V A;  2DK8 A;  3COA C;  1FYK A;  1KU7 A;  1TW2 A;  2XHK A;  2QM3 A;  4MNU A;  3HOT A;  2QUF A;  4UVC A;  2FU4 A;  3MCZ A;  5IT9 K;  3R0A A;  5H6R A;  4G6Q A;  3R0J A;  2O6G E;  3QPH A;  1LQ1 A;  4AWX B;  3QOP A;  4ENM A;  4MHG A;  1P4X A;  3ABU A;  4KDP A;  1I5Z A;  3V8K A;  4HV6 A;  5FO5 A;  4U7D A;  5DD4 A;  5D5U B;  2ZJ2 A;  2RDP A;  4ENK A;  1HW1 A;  3TO6 A;  2E7W A;  4KFC A;  1QQI A;  3H3Z A;  2PFB A;  4Q5S F;  2ISZ A;  1G3S A;  2ISY A;  4OIP F;  1IXR C;  1OYW A;  2DQL A;  5HS9 A;  4N9I A;  4NB5 A;  5LGT A;  1EH8 A;  4YG2 F;  1S29 A;  4OU0 A;  3F6V A;  4QLC U;  1PP8 F;  4M72 A;  3B02 A;  5J6X A;  2WTE A;  2MA3 A;  2GA1 A;  1W7P D;  3E5Q A;  3HRS A;  3C7J A;  2BBY A;  2KIF A;  3I54 A;  4GCV A;  4P9U A;  2A5Y B;  2PN6 A;  1YS6 A;  1J9I A;  3LA2 A;  4E70 A;  5CLS A;  2YX4 A;  1IRF A;  3BRO A;  4EMS A;  3FM3 A;  3HSE A;  5D6F A;  2Z33 A;  3ABT A;  3GZ5 A;  3E97 A;  4RB1 A;  4O6J A;  5KVR A;  1X3U A;  3M8E A;  4L0Z B;  5JR3 A;  2YU3 A;  3J7A O;  3GUD A;  1JHH A;  5ICC A;  3LAP A;  2RN7 A;  2ETH A;  2LKP A;  3CUQ A;  4EM2 A;  5J8F A;  2MC3 A;  1FY7 A;  3BPX A;  4LLN A;  1FBQ A;  5K5O A;  2H94 A;  1YG2 A;  1FT9 A;  1W4M A;  5HDK A;  3CO7 C;  2W25 A;  3ZMZ A;  1OYI A;  2P7V B;  1UB9 A;  1ZRF A;  2NAZ A;  1B9M A;  2FXA A;  3V8J A;  4EJO A;  4IJA A;  2K02 A;  3R4K A;  4M6Y A;  3BPV A;  4G8X A;  1R5H A;  4Q4Z F;  4LK0 F;  3V7C A;  4LK1 F;  2GXG A;  2EV0 A;  3D0S A;  2VE9 A;  2ESN A;  2VE8 A;  1YW7 A;  1J7K A;  3RI4 A;  3SXY A;  3V4G A;  5DUK A;  2VBZ A;  2GIV A;  3E6D A;  1XGS A;  4IRI A;  1ZLK A;  2A68 F;  3RDI A;  1S7O A;  1USS A;  1XDU A;  3L7W A;  5DCF A;  2P6T A;  3QRF F;  2GXB A;  1Z9C A;  4BH9 A;  3EYY A;  4EJW A;  2CW0 F;  3FXR A;  3TOB A;  3LWF A;  2A61 A;  4OOI A;  2VOD A;  4P55 A;  5H20 A;  4YFX F;  1D8K A;  4CGZ A;  4YFK F;  3KET A;  1XSX A;  2R7D A;  4R8H A;  3MWM A;  5ICF A;  2NRA C;  1SAX A;  4G7O F;  1B59 A;  2E1N A;  5FGM A;  2EFW A;  3I59 A;  4PCQ A;  1SD7 A;  1YW9 A;  3KLN A;  2O0Y A;  4AIJ A;  1J0R A;  3FMR A;  4L5J A;  5LHI A;  1IXC A;  4XLN F;  4HF0 A;  3MZY A;  3DV8 A;  1CGP A;  1XGN A;  1YTY A;  2M87 A;  2A69 F;  2A07 F;  4HF2 A;  4LD5 A;  4BNC A;  3D5L A;  1WKM A;  1LDD A;  2XAH A;  3BY6 A;  2PLY A;  2CG4 A;  4JQF A;  2DPD A;  2XIG A;  1XDS A;  4WXD A;  4BAY A;  3N97 A;  3QU3 A;  3SQN A;  3AAF A;  4HQM A;  3GX4 X;  2Z5U A;  3F8B A;  4RGX A;  1RIO H;  4BHB A;  5DCM B;  4HDV A;  1FC3 A;  2O03 A;  3G73 A;  3WOD F;  1R1U A;  4A0Z A;  5L3B A;  3WE3 A;  2VBY A;  2XKP A;  4DQ2 A;  1FSE A;  4A0X A;  3F3X A;  4FX4 A;  1YQA A;  4UVA A;  5H6Q A;  4RAY A;  3LA7 A;  3GFM A;  3ISP A;  3P7N A;  1FZP B;  4KIC A;  2HGC A;  5A2Q K;  4CYD A;  5AIP A;  1G6N A;  3REO A;  4M71 A;  2OA4 A;  3RTR A;  1H9T A;  2B0L A;  1EH6 A;  3CUQ B;  4M9Z A;  2F2E A;  2FMY A;  1BN5 A;  1F1Z A;  2DAO A;  3SZP A;  3S2W A;  1SD5 A;  3K69 A;  5FB2 A;  1ZAR A;  5DEQ A;  1BI3 A;  1ZRD A;  4IXA A;  3TQN A;  1ON1 A;  1FNN A;  3DFG A;  3DKW A;  3IWF A;  1ODD A;  3N4M A;  5K1Y A;  3KCC A;  2EFP A;  1B1B A;  3WTX C;  1RNL A;  2STT A;  1P92 A;  1RUO A;  1STZ A;  2NYX A;  2XV4 S;  1UHW A;  4ZYE A;  2DLL A;  4U7B A;  3T8R A;  3KP4 A;  2XKO A;  3RKX A;  3NQO A;  3E6C C;  4L9V A;  4KN7 X;  2H6B A;  2OD5 A;  3SHF A;  5EEG A;  5ILS A;  4HOB A;  5HOO A;  1O3Q A;  1U78 A;  4EGY A;  2FQ3 A;  5BMZ A;  1SMT A;  4JK1 X;  1S7A A;  2BEO A;  2PMH A;  3IRQ A;  4HX8 A;  4S05 A;  2UZK A;  4WCG A;  2R3S A;  5TJJ A;  4ZYH A;  1WWX A;  1HSJ A;  1FX7 A;  4U88 A;  2HOE A;  2Q0O A;  1ZYR F;  4A12 A;  3Q5F A;  3I59 B;  3PQJ A;  2G7U A;  5FLX Z;  3LQR A;  2VON A;  1TQI A;  3WGG A;  4M9S A;  3QAH A;  1W7P A;  2ADU A;  3F72 A;  3O2P E;  1XCV A;  1O3T A;  1V4R A;  1MJA A;  2FBI A;  4BHP A;  2D2W A;  2M5W A;  1FBS A;  4GYG A;  3RYP A;  4PGH A;  1ZG1 A;  4HW0 A;  1U5T C;  4ZH4 F;  3HHG A;  4LG0 B;  3WE2 A;  3DXJ F;  2XUB A;  3KEQ A;  2Z9O A;  3L9F A;  1TNS A;  2H27 A;  2QLZ A;  1JE8 A;  5L3C A;  3RYR A;  3TO9 A;  3JAM Z;  1G3T A;  2OZU A;  3TOA A;  1OPC A;  4BXU A;  1DP7 P;  2HKX A;  2PBI A;  3KP5 A;  4ZZL A;  4G7H F;  1C0W A;  1YFH A;  3M1E A;  1KQ0 A;  3KFW X;  4K2E A;  2H6C A;  2IT0 A;  4L9T A;  1FOK A;  5LLQ A;  2PMU A;  2O61 A;  3WU0 A;  1ZAO A;  1AOY A;  5CVU A;  5ED4 A;  3BJ6 A;  4OIQ F;  2DQR A;  1T39 A;  1ON2 A;  1P6R A;  3P9K A;  4G9Y A;  2MH2 A;  3I71 A;  5EEH A;  1HBX G;  2L01 A;  4BHC A;  3BOQ A;  4Y15 A;  2GA2 A;  2HFH A;  3KLO A;  5FLX K;  1MGT A;  1PDN C;  2Y0M A;  4NHJ A;  2OBP A;  3QPT A;  4U0W A;  5L3F A;  3TDU C;  3FM5 A;  3PFI A;  2VC1 A;  4EV0 A;  1KQ9 A;  2K4B A;  3R6S A;  3IKT A;  4AIH A;  1O3S A;  4Q47 A;  4LLL A;  1K7A A;  1HKQ A;  1DPR A;  4S04 A;  2DPU A;  2VBX A;  5D5W B;  2LF8 A;  3IHU A;  1YS7 A;  2EJR A;  3RJP A;  4KN4 X;  2YX7 A;  1JGS A;  2XAQ A;  1Z91 A;  1I6X A;  2BV6 A;  5LGN A;  2QQ9 A;  2V1D A;  3WTU C;  3ECH A;  2YR2 A;  2OZ6 A;  2VT3 A;  1E2X A;  1J5Y A;  3WTW C;  2FOK A;  4EM0 B;  3P9C A;  2JSC A;  1XMK A;  2JZY A;  2FNA A;  3ZMU A;  2W85 A;  1W7P B;  3F21 A;  4Y13 A;  1BBY A;  2ZBK A;  1SMY F;  1LJ9 A;  4O3M A;  1ULY A;  2BE5 F;  1WRJ A;  3L00 A;  1P4A A;  2QYO A;  1A04 A;  3GF2 A;  5BPI A;  3R60 A;  2L4A A;  4B09 A;  1ZGJ A;  5LBQ A;  5KK1 A;  3FZV A;  2AXL A;  5E20 A;  3WTZ A;  2L3D A;  4L9J A;  1BIA A;  4ZYD A;  1MDM A;  2EWN A;  3HRU A;  4PGG A;  4IF4 A;  3GXO A;  3GFL A;  3K1N A;  3CTA A;  1U8R A;  4UUV A;  4L5I A;  4HZF A;  2WWY A;  3H3U A;  3HRM A;  1IN4 A;  4L18 B;  4HX7 A;  4KT5 C;  5LGU A;  3KP6 A;  5AON A;  4G94 A;  3HOS A;  5D4S A;  3E5X A;  3FXU A;  3DF8 A;  3FWE A;  2EA2 A;  4IHT A;  4RAZ A;  1YLF A;  2WC2 A;  1KQ8 A;  3CLO A;  1IN6 A;  2XAG A;  4LGW A;  1XGM A;  4CIC A;  1IZ1 A;  4G6D A;  2RGV A;  2KIM A;  2NNN A;  2GAU A;  1ZN2 A;  2P7C B;  5DDG A;  2EV5 A;  5IT3 A;  5DYM A;  1DPU A;  3SZT A;  2K86 A;  4D0P A;  1KU3 A;  4BYY A;  3FXQ A;  3LQQ A;  1B4A A;  2IA2 A;  2FSW A;  3HRT A;  3EUH A;  1OR7 A;  3VB2 A;  2XAF A;  3MZH A;  2V1U A;  2C6Y A;  2V79 A;  3J80 Z;  3I53 A;  4EGZ A;  4HQE A;  3HYI A;  2Q8K A;  3DEU A;  2FBH A;  4A5M A;  5CJ9 A;  3T8T A;  3E3V A;  4OIN F;  3GVA A;  3C18 A;  2IRF G;  1U6G A;  1L0O C;  1CF7 A;  2HKO A;  1R23 A;  3Q9V A;  2L4M A;  1LEB A;  3I4P A;  1U5T A;  3HUG A;  2A6H F;  5E1W A;  4I2O A;  4HLX A;  2RKH A;  3BWG A;  2COM A;  1ZH5 A;  1O7F A;  1H0M A;  1K79 A;  3ZMT A;  4I0B A;  3KEO A;  4GXO A;  2OAZ A;  4N0B A;  2GZW A;  2QEN A;  1P2F A;  1HXD A;  2ZXJ A;  1F4K A;  4P9F A;  2FRH A;  3IKV A;  3TKY A;  2PEX A;  1W5T A;  1SD6 A;  5D5V B;  1ONV A;  3U9G A;  3B73 A;  4YIF A;  3CJN A;  1I1G A;  2DTR A;  3E5U A;  4EJT A;  1T6S A;  2EFQ A;  1I1S A;  1B9N A;  1BC8 C;  2STW A;  1IW7 F;  2RV8 A;  1D8J A;  1GVJ A;  5AIQ A;  3L09 A;  2D1H A;  3GW2 A;  5HDG A;  3C1D A;  2DK5 A;  2XRO A;  4Z2Y A;  1S8N A;  2V6C A;  4LFU A;  3I64 A;  4WXC A;  1U2W A;  5CVV A;  4WWC A;  4IHS A;  2XRN A;  4IRH A;  2A3S A;  1H9G A;  1R7J A;  5ILV A;  1MDM B;  1GXP A;  1J59 A;  4LJZ F;  1MJ9 A;  2LSO A;  3LST A;  3EYI A;  1JHF A;  2FA5 A;  4A5N A;  2VOO A;  2ZCW A;  4P96 A;  3FF5 A;  5LHG A;  2LF7 A;  1EH7 A;  2HYF A;  4UXN A;  2K4J A;  1QZY A;  1IF1 A;  2F5D A;  2M1B A;  5ERI A;  2YPR A;  1REP C;  5HDN A;  4BQA A;  1K6O A;  3ZMV A;  2K7L A;  2UWM A;  3FX3 A;  3BZ6 A;  1Y0U A;  4LB5 A;  4EJU A;  3TGN A;  4AD9 A;  3MAJ A;  2GWR A;  2H09 A;  1TTY A;  4ESF A;  2HWV A;  2MD5 A;  2MH9 A;  1HW5 A;  2FML A;  3KP2 A;  3WU1 B;  3QU6 A;  2IJL A;  2E1C A;  1BIB A;  3ZP5 A;  3F6O A;  2P6S A;  4ESB A;  1FPQ A;  4KA4 A;  4Y17 A;  4A6E A;  2Z3Y A;  2BGC A;  2M8E A;  5E18 F;  1R00 A;  2VC0 A;  1BM9 A;  4F7Z A;  3F8F A;  1IRG A;  4OMZ A;  1S6L A;  1RUN A;  1HKS A;  3VFZ A;  4ON0 A;  3WGI A;  3HTU A;  2HZT A;  4MGR A;  1YIO A;  2CQK A;  1JXS A;  3T1B A;  5LEK A;  5DUI A;  2HTS A;  3CDH A;  5LRR A;  4HLY A;  2CGP A;  1R5G A;  1LVA A;  1QO0 D;  2QZ8 A;  1BI1 A;  3K2Z A;  2CSO A;  2ZNZ A;  3KZY A;  4I98 B;  5IT9 Z;  3R61 A;  3ECO A;  2AS5 F;  2DBB A;  1BI2 A;  5ICE A;  1F5T A;  1G4D A;  5TRD A;  1FBU A;  4EM1 A;  1DDN A;  1QGP A;  1W5S A;  2EK5 A;  1WI9 A;  4XBF A;  5BQT A;  1MZB A;  2D1V A;  3EDP A;  3IC7 A;  2DT5 A;  3QP6 A;  1YW8 A;  5CYV A;  2WV0 A;  5E8G A;  4CHU A;  4IPA A;  2EV6 A;  4XRF A;  2KJC A;  4UNO A;  2VOP A;  2FEZ A;  4EJV A;  5F64 A;  2V9V A;  5F1R A;  2EB7 A;  3RPU A;  1YYV A;  1ZRE A;  2IA1 A;  1BJA A;  2F5C A;  5HLI A;  1T38 A;  1AWC A;  5FFX A;  5CVI A;  2UXX A;  4KIB A;  4QWQ A;  1T98 A;  4CZZ A;  4ENJ A;  2JPB A;  6PAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...