2EK8A

Aminopeptidase from aneurinibacillus sp. strain am-1
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
412
structure length
412
Chain Sequence
b'ADHQITKRTDAENMYNTIQFLSQAPRVAGSPEELKAVRYIEQQFKSYGYHVEVQPFQFEGYTAPSEVTLKIGTEKKEGEAFTYSPNSDVTAELVYVGLGTTADVAGKDLNGKIALIQRGNISFADKVRNAAKQGAKAVIIYNNTDGKLNGTLGGSDASFVAAVGITKQEGDALAANLRAGEKITATVKVAGAEVKTLTSHNVIATKKPDANKKNTNDIIIIGSHHDSVEKAPGANDDASGVAVTLELARVMSKLKTDTELRFITFGAEENGLIGSKKYAASLSEDEIKRTIGMFQLDMVGSKDAGDLIMYTIDGKKNRVTDLGAAASSRLSGVLPYGQEGRSDHESFHALGIPAALFIHAPVEPWYHTPNDTLDKISKEKLDNVADIVGSAVYQAARPGELVIEPIDYPRRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
molecule tags Hydrolase
source organism Aneurinibacillus sp.
publication title Structural characterization of a novel bacterial aminopeptidase with an apical domain from aneurinibacillus sp. strain AM-1
rcsb
total genus 142
structure length 412
sequence length 412
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2ek8A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2ek8A02
3IC1A 1FT7A 3FVLA 2PCUA 2Q51A 4P4FA 4OIDA 4MHNA 1IGBA 1TKJA 4P4DA 3NH8A 2EWBA 4CDJA 4FAIA 2C6GA 2G9DA 1XJOA 3D7GA 2AFUA 2XEGA 4UIBA 4A39A 2F8HA 3IIBA 3SJGA 3TC8A 2IMOA 2PJ9A 2ZENA 4ONWA 4R76A 3NA6A 5LYDA 4H2KA 4LQGA 2JBJA 1TXRA 4P10A 3DGVA 3LMSA 3NH5A 3CDXA 3DLJA 4MCPA 3B7IA 4NGMA 3PB6X 4P4BA 2AFSA 1HEEA 4UIAA 3IFEA 4C9UA 3KI9A 2ABZA 3I6SA 2PVWA 1XMBA 4RUHA 5CPAA 2V8GA 2AFMA 4ZX8A 3PRTA 4P45A 2ZEDA 4MHZA 4PPZA 1LCPA 1VHOA 5CBMA 3B3WA 4ZYQA 3V38A 2OR4A 4P4EA 4Q7AA 4Z65A 1IY7A 1VGYA 2AFZA 3B35A 4FWUA 4OC2A 1CG2A 4A38A 2HB6A 3FH4A 5LYLA 4X3RA 4C84A 7CPAA 3VH9A 1GYTA 3PB7X 4CPAA 3PBEA 3QNVA 4UF4A 5JM6A 4CDKA 2BO9A 3SJFA 3SI2A 2V8DA 2F7VA 4F8ZA 4R8FA 3SJEA 1ELLP 1LANA 4JYWA 1F57A 2I3CA 3PFOA 5LRJA 3I74A 4C8FA 2VL1A 1ZG8A 3B3TA 2PIZA 4WWVA 2ZOGA 1ARLA 1KWMA 2PRQA 3CPXA 4NJRA 5JGFA 3WC6A 1OBRA 2GREA 4C8AA 5IB9A 4PXEA 3PB8X 3BHXA 4OC4A 5JH9A 4A37A 4OP4A 2C1CA 2PJ3A 1PCAA 1ZG9A 4TWEA 2XEJA 3D68A 3TX8A 1VIXA 2IQ6A 2PJ8A 5I4MA 3RAMA 3ISXA 3KHXA 2RB7A 3KQXA 1YLOA 4OIWA 2EK8A 3RBUA 1QMUA 4C86A 3IJ3A 1XRYA 1ZG7A 3GB0A 2HC9A 2DEAA 2V8HA 2NYQA 4NGNA 3PFEA 2PJ1A 3WT4A 4OC3A 4NFRA 4UEFA 2PJCA 4C8PA 4A94A 4C85A 3VATA 3PB9X 2C6PA 1LAMA 3B3CA 1BPMA 4MMOA 3N5FA 2CTCA 3S9NA 4R7MA 3MRUA 2ZEPA 4KNGE 2ZEOA 5HVFA 3K2KA 1TF8A 4P44A 5K8MA 3I1UA 1Z5RA 2XEFA 2PJ6A 3KR4A 3EIFA 2AFOA 4EMEA 4DJLA 4EWTA 4MHYA 2Q4ZA 1VHEA 1CPSA 3VARA 2AFWA 2BOAA 3KZWA 1QQ9A 2EK9A 2PJBA 3VTAA 2ZEFA 3D7DA 5K8OA 1AYEA 4C9EA 1DE4C 4OKOA 3SJXA 1CPXA 1Y7EA 3KQZA 3PBBA 4EFDA 3S9LA 3CT9A 4YWYA 2V8VA 3KGQA 4IHMA 3V7ZA 8CPAA 2BCOA 4NGTA 4K3NA 3D66A 5LRKA 4FBEA 4C8CA 3IWWA 4OMEA 4OC1A 3BI0A 3RZAA 3PB4X 2ANPA 2JBKA 3WABA 2GLJA 4ZY1A 1AMPA 2QYVA 5J1QA 2PJ0A 4OC0A 2OOTA 2PIYA 1R43A 2QJ8A 6CPAA 2RFHA 3KASA 1DTDA 4UEEA 1F2OA 4F9VA 1FNOA 3H8EA 1R3NA 4NGSA 2PVVA 4B6ZA 3H8GA 2QVPA 1LFWA 2C6CA 3D7HA 4ZY0A 3WC5A 1M4LA 4AXVA 1BLLE 2AFXA 5F09A 1BAVA 1Y0YA 3GLJA 5LRGA 4PXCA 1Z8LA 2ZEGA 1CX8A 1Z2LA 1F2PA 5DS0A 3JRUA 2O4HA 3KR5A 5D8NA 1Y0RA 2PJ5A 1ZLHA 5HVGA 1TKFA 1BPNA 3PEIA 3BI1A 1TF9A 4X2TA 4MHPA 1LOKA 4TNUA 4P4JA 4W9YA 3FF3A 4GM5A 4ZY2A 4C9RA 3S9MA 3WC7A 5ELYA 1TKHA 1CBXA 3IO1A 4X8IA 3FX6A 1RTQA 1YSJA 3HUVA 4KSIA 2Q43A 3SI0A 1XBUA 1CP6A 4DYOA 1ARMA 3MN8A 3FJUA 2NSMA 3BXMA 4MCSA 1UWYA 4MCQA 4WJBA 3KHZA 1HDUA 1JQGA 3K9TA 4C99A 2FVGA 5THWA 4MCRA 1LAPA 5HXDA 4NGPA 1NSAA 3CPAA 1PYTB 4TJVA 3FECA 4YN3A 2V77A 1H8LA 4UEZA 2PJ2A 2J9AA 4JZ0A 5K8NA 3D67A 2ZEMA 4G1PA 1Y9ZA 2ZEEA 3ISZA 1YW4A 3IEHA 3L2NA 2JEWA 4NGQA 4PQAA 3D7FA 4ZX9A 1WVMA 5HVHA 4IAVA 2GU2A 2PE3A 3B3SA 4C8TA 1XFOA 1ZLIA 3B2YA 1HDQA 3B3VA 3HLPA 4PXDA 5LYFA 2WZNA 2GLFA 1Q7LA 2PJ4A 2PJ7A 3NH4A 3D4UA 4R6TA 2O53A 4P6YA 4C9AA 3KL9A 3T8WA 3H8FA 1YW6A 5K8PA 5D29A 2ZOFA 2ZEHA 3SI1A 4NJQA 4MRIA 4NGRA 4F9UA 1CP7A 2POKA 4C8UA 3FMCA 4FUUA 4MXUA 2CIJA 2WYRA 1V6CA 1EE3P 2CF4A 4C9VA 4IK2A 3GUXA 4YU9A 1XF1A 3NFZA 2PJAA 4O23A 4OC5A 3FEEA 5LYIA 3ICUA 4TJXA 4PXBA 1ELMP 2CTBA 2XEIA 4BD9A 4ZI6A 2ZELA 3FEDA 1YMEA 2IJZA 4DUKA 3LWUA 4P4IA
chains in the Genus database with same CATH superfamily
3IC1A 5A27A 1FT7A 1M44A 3FVLA 4CGOA 4CGPA 2PCUA 4OLLA 2Q51A 1QSNA 4M6GA 1RO5A 4OIDA 4P4FA 2Z3PA 4MHNA 2FT0A 1IGBA 1TKJA 2F5IA 4P4DA 1NXJA 3NH8A 1CS0B 2HUZA 4KVME 1MJ9A 5K99A 1L0CA 4JJXA 2EWBA 4CDJA 4FAIA 2GP4A 3EZBA 2C6GA 2G9DA 1XJOA 3D7GA 2AFUA 2XEGA 3TFYA 1VKCA 3R9GA 1R61A 4UIBA 4A39A 2F8HA 3IIBA 4PSWA 2Q7BA 2O28A 2Z3LA 2IMOA 3SJGA 3TC8A 1VBHA 5FD8A 2PJ9A 2CNMA 2ZENA 4MI1A 4EYSA 2ZPAA 3CXQA 4C2ZA 4ONWA 4R76A 3NA6A 1Q2YA 1IICA 5LYDA 4LQ6A 3TO7A 4YRHA 4H2KA 4LQGA 1WWZA 4CYPA 2K5TA 3TCVA 2P6GA 2Z3MA 3DR8A 2YGWA 2JBJA 1TXRA 4P10A 3EC4A 3LD2A 4KOTA 1Q5XA 3DGVA 3LMSA 1LRZA 3NH5A 3SR3A 3CDXA 3H5ZA 3DLJA 5G22A 1KUVA 2DF5A 4MCPA 2PDOA 3B7IA 4NGMA 4KOUA 3PB6X 4JXRA 1A9XB 4P4BA 2P0WA 2AFSA 4XNHC 1HEEA 4UIAA 5BWAB 2A4NA 1MK4A 2OU2A 3IFEA 4HNXB 3KI9A 4QC6A 3R9FA 4CYQA 4C9UA 2ABZA 2OB0A 1FY7A 3I6SA 2PVWA 2VI7A 1XMBA 3GY9A 4KUAA 4C8CA 4RUHA 5CPAA 2V8GA 2FIWA 2AFMA 2P6EA 3PRTA 4ZX8A 4P45A 4JVOA 2ZEDA 2WUUA 2Y0MA 1WK4A 3U1BA 2Q7SA 4MHZA 4L89A 2GFQA 1B87A 4KVXA 4PPZA 3TLGB 1LCPA 1VHOA 5CBMA 3G3SA 4LUAA 5H84A 2E28A 1YREA 3B3WA 5H86A 4MFQA 3V38A 4ZYQA 4CYNA 3FBUA 2OR4A 3BJ7A 2AUNA 3TLYA 4XPDC 2CNTA 4P4EA 4Q7AA 4Z65A 1IY7A 1VGYA 2Q0YA 3BLNA 4R87A 4CRYB 1OZPA 2AFZA 3B35A 1IB1E 1ZO0A 4FWUA 4OC2A 2JEVA 4XNHB 1CG2A 4A38A 4ZBGA 2AE6A 2HB6A 3FH4A 5HH1A 5IB0A 1Y9WA 4MY3A 5LYLA 4X3RA 4C84A 7CPAA 3VH9A 1GYTA 2R7HA 3PB7X 4CPAA 4JD6A 4MFJA 3PBEA 3QNVA 4KOVA 4L8AA 4C7IA 3TE4A 2ZW6A 4UF4A 4MFKA 4RN7A 5JM6A 4CDKA 2OZHA 2BO9A 2PRBA 2Z10A 4UFVA 3SJFA 3SI2A 4R3LA 3S6FA 2V8DA 1A2ZA 2F7VA 4F8ZA 4R8FA 3SJEA 5JYBA 4IUSA 2EUIA 3IU1A 1ELLP 2D4OA 1LANA 4JYWA 1F57A 2I3CA 1S7NA 3PFOA 5LRJA 4BBHA 4DNCA 2EZAA 4C8FA 2VL1A 4A32A 4B11A 1ZG8A 4B10A 3I9SA 2HWGA 5F48A 5AG4A 3B3TA 1XMTA 4CAFA 2PIZA 4MY0A 4WWVA 2ZOGA 3C26A 4Y49B 3FNCA 4A31A 3TLBA 5GCNA 3V8IA 2HQYA 2HI6A 1ARLA 1KWMA 2PRQA 4XPLA 1S7LA 2YNDA 3D8PA 3CPXA 4NJRA 5JGFA 3WC6A 1ZYMA 2B5GB 1B6BA 3P2HA 5FVJA 1OBRA 4CRZB 5AG5A 5DWNA 1YQEA 2GREA 5IB9A 4C8AA 4PXEA 2EVNA 4PSXA 3PB8X 3BHXA 4OC4A 5JH9A 4CGMA 4A37A 2FS5A 3TO9A 4OP4A 2C1CA 4KOXA 2PJ3A 4UCNA 4B5PB 1PCAA 1ZG9A 4TWEA 3NOJA 3F8KA 2XEJA 2PR1A 4NEXA 3D68A 1EZBA 1S7FA 2JLMA 4KVOE 4LX9A 1J3LA 2J8NA 3TT2A 4JLYA 1VIXA 3TX8A 2ATRA 3TOAA 2G3AA 2RC4A 1SQHA 2P6FA 4A33A 2IQ6A 2IL4A 4PK3A 2X7BA 2VBQA 2PJ8A 1Z8TA 3RAMA 5I4MA 3ISXA 3KHXA 4H1HA 4J0NA 2B4DB 2RB7A 4JXQA 3LODA 2YNCC 3KQXA 3T90A 2ZXVA 1YLOA 5F47A 2GIVA 5AGEA 4INJA 3R9EA 4OIWA 2QIRA 2WPXA 5IX3A 5KTCA 1GGOA 2EK8A 2OLSA 3JUWA 5IR2A 3RBUA 1QMUA 2ZW7A 4CO9A 1QSRA 2FXFA 1XRYA 1Z4RA 1ZG7A 3GB0A 3IJ3A 2EO8A 4C86A 4C7HA 3S6HA 4IF5A 1ZL0A 2HC9A 1Z4EA 2DEAA 1VHSA 1S7KA 2V8HA 2REEA 2BL1A 2NYQA 3DSBA 4M6HA 4NGNA 2PC1A 2FM4A 3T0TA 2B3VA 4ZGYB 3PFEA 1NMTA 2PJ1A 3D2PA 4MFPA 3WT4A 3T5MA 2PR8A 2QMLA 4OC3A 4B12A 4NFRA 4UEFA 3PZJA 2GE3A 2PJCA 4C8PA 1MJAA 4A94A 1MJBA 3TO6A 2B4BA 4MBUA 4Y49C 1T36B 3DR6A 4C85A 3K4IA 3VATA 4HPSA 2Z0ZA 1YR0A 2ZW4A 2B58A 2C6PA 3PB9X 2VXKA 4GXHA 4AB7A 2B0AA 3T07A 4OAEA 5F46A 5KTAA 1LAMA 5C88A 4E94A 4J3GA 4KNGE 1YVOA 5JVLA 3B3CA 4NF1A 1BPMA 2Q04A 3EFAA 4MMOA 5JPHA 3TLCA 3H4QA 3N5FA 2CTCA 2HROA 3UY5A 2YNCA 3S9NA 3R1KA 3MGDA 4R7MA 3MRUA 1Z8WA 4CGLA 2ZEPA 2ARHA 4GS4A 2Z3OA 5DWMA 2Q4YA 3DNSA 3I3GA 2ZEOA 4BINA 5C82A 2Z3NA 3SXOA 4FD5A 1S60A 5EC4A 2I00A 5HVFA 1BOBA 3K2KA 2BEIA 1TF8A 3K9UA 4AG7A 4P44A 5A28A 3TOBA 3W91A 2CXAA 3I1UA 5K8MA 5F9MA 3N7ZA 4M85A 4RI1A 4E5SA 5G20A 1Z5RA 4KUBA 2XEFA 2PJ6A 2NMTA 4MFZA 2CY2A 4CYOA 4CS0B 3KR4A 4B5PA 4F0YA 3EIFA 2AFOA 4EMEA 1YGHA 4DJLA 4UFWA 4EWTA 4MHYA 1J4JA 1KUYA 4PK2A 5AG7A 2Q4ZA 1VHEA 3GKRA 1CPSA 3KKWA 3R95A 2B3UA 2G3TA 2D0OA 3VARA 1XF8A 2FIAA 1NSLA 4MHDA 2EZCA 1NE9A 2YJTA 1YLEA 2AFWA 5EMIA 2BOAA 1GHEA 4KZTA 3KZWA 4H6UA 1I1DA 1QQ9A 1JWQA 2EK9A 3EZAA 2PJBA 3VTAA 1IOIA 1R57A 4X5KA 3TLAA 4QBJA 3C8OA 1V0CA 2ZEFA 3D7DA 2G0BA 5K8OA 4COGA 1AYEA 1XEBA 4C9EA 1DE4C 1X10A 2BSWA 2B5GA 4OKOA 1CPXA 3SJXA 1Y7EA 2OZUA 3KQZA 3P2FA 2DPTA 3PBBA 2FL4A 4EFDA 1KC7A 5E96A 2WSAA 4KLWA 3S6GA 4E8OA 3S9LA 2EZBA 3CT9A 1BXRB 4KOYA 4YWYA 4AVAA 2V8VA 3D3SA 3KGQA 1Y7RA 4IHMA 1ON0A 4HNWB 3V7ZA 4UA3A 1AUGA 8CPAA 2BCOA 4NGTA 1VI4A 4K3NA 3D66A 5LRKA 4FBEA 1JDBC 3B8GA 2DPSA 2Q4VA 2D4PA 3IWWA 4MI4A 2C27A 1QSMA 1Y9KA 2BUEA 4ONUA 4OC1A 3FXTA 4OMEA 4B5OA 2WPWA 1XE4A 3BI0A 3RZAA 4H6ZA 3PB4X 4F6AA 2ANPA 4KSFA 4IIYA 2JBKA 3WABA 4XPKA 2DIKA 2GLJA 1S3ZA 4CAWA 3CXSA 1P4NA 4ZY1A 2B4DA 3KRVA 1I12A 1AMPA 4E2AA 2QYVA 5J1QA 3TYXA 2PJ0A 4CAXA 4R57A 4MFLA 2J8RA 4YGOA 2ODFA 3DDDA 4OC0A 4YFJA 2OOTA 2PIYA 2Z11A 1R43A 4R3KA 4AG9A 1JDEA 2QJ8A 6CPAA 2RFHA 3KASA 3GJZA 1DTDA 4UEEA 1F2OA 3VWEA 4F9VA 1FNOA 4HNYB 2R1IA 3H8EA 1QSTA 1R3NA 4CAEA 4NGSA 1YVKA 3EXNA 2PVVA 2J8MA 4A30A 4MJXA 4B6ZA 3H8GA 2FSRA 3E0KA 4KOWA 4C68A 3BJ8A 4UFXA 4BMHA 2QVPA 1RXTA 1M4GA 1LFWA 2C6CA 2OZGA 1PUAA 3D7HA 4ZY0A 1QSOA 1YX0A 4PV6A 3WC5A 1M4LA 4EVYA 3ZJ0A 1IOFA 1I21A 4AXVA 3QB8A 1CM0A 1BLLE 4E0AA 1XIXA 2VEZA 3LACA 2AFXA 5F09A 1BO4A 1BAVA 1Y0YA 3GLJA 2D0PA 1CJWA 5LRGA 4PXCA 5F5XA 3NE8A 1Z8LA 2ZEGA 4U9ZA 4CZ1A 5J8CA 1CX8A 1Z2LA 4I49A 1F2PA 5DS0A 3JRUA 3RNZA 4M8DA 2O4HA 3KR5A 5D8NA 1PU9A 2JDCA 1CE8B 1Y0RA 2PJ5A 1ZLHA 1EZAA 4A95A 5HVGA 3G23A 1TKFA 1BPNA 3PEIA 1N71A 3BI1A 2VZZA 3QAHA 1TF9A 4X2TA 4MHPA 1LOKA 3TLGA 3GIUA 4TNUA 3EZEA 2GANA 3VWDA 4KS9A 4H89A 1IU8A 4P4JA 4W9YA 5IV0A 2X0SA 2I79A 2FE7A 3FF3A 4GM5A 1U6MA 3R96A 4ZY2A 2R82A 4C9RA 1UFHA 3S9MA 4ORFA 3WC7A 2ZW5A 1TKHA 5ELYA 1DIKA 1VBGA 4KSAA 2C5QA 3EO4A 4UWJA 3IGRA 3T9YA 4M3SA 4FD7A 1CBXA 3IO1A 1Z8XA 4X8IA 1M1DA 3FX6A 2FCKA 1RTQA 1YSJA 5ISVA 3HUVA 4KSIA 3QAYA 2Q43A 5CNPA 3CZXA 3SI0A 1XBUA 5G1ZA 1NBWA 2AJ6A 1CP6A 4C2YA 4DYOA 1ARMA 2Z3KA 3MN8A 3FJUA 3SXNA 2DXQA 2NSMA 3BXMA 4Q38A 4B14A 2MP0A 1KZFA 4MCSA 2EBJA 1UWYA 2REFA 4IIXA 4MCQA 4WJBA 3G8WA 2CNSA 3JVNA 3F0AA 1HDUA 3KHZA 1JQGA 3K9TA 4AVBA 4K30A 2FVGA 4C99A 5THWA 4MCRA 1M4DA 1LAPA 2PCNA 5HXDA 3NE7A 3PP9A 2YNEA 5F1YA 3W6SA 4NGPA 1NSAA 1M4IA 3CPAA 1PYTB 4TJVA 3FECA 5AG6A 4YN3A 2V77A 4U9YA 1KUXA 1H8LA 4UEZA 1M6VB 2PJ2A 4HKFA 3EY5A 2J9AA 1S5KA 4JZ0A 3SHPA 3TTHA 4NXYA 4UCPA 5K8NA 3D67A 2ZEMA 4G1PA 3RO0A 3IWEA 2ZEEA 3GYAA 1Y9ZA 3CXPA 3ISZA 4JWPA 1YW4A 3IEHA 3L2NA 5G21A 2JEWA 4NGQA 2VQYA 3RYOA 4PQAA 1IYLA 1IIDA 5EBVA 3D7FA 4ZX9A 1WVMA 5HVHA 4KORA 4UCMA 4IAVA 4U5YA 3W6XA 2JDDA 1C30B 5J8FA 5I0CA 2YJVA 2GU2A 2PE3A 3B3SA 4C8TA 1XFOA 3JTKA 1Z9UA 4RS2A 3T05A 1ZLIA 3B2YA 1HDQA 1X12A 3B3VA 3FIXA 4NCZA 3HLPA 4OADA 4QVTA 4C2XA 4PXDA 3FYNA 5LYFA 2WZNA 4AVCA 2GLFA 4QUSA 1Q7LA 2PJ4A 4KLVA 1ZRSA 2H5MA 2QECA 4II9A 2AUMA 2HV2A 2PJ7A 3NH4A 1Q2DA 3D4UA 4R6TA 2KCWA 2O53A 4P6YA 4KOSA 5JQ4A 4NSQA 5KTDA 4C9AA 3KL9A 2OH1A 4M6IA 3T8WA 3H8FA 4CGNA 1YW6A 5K8PA 3I74A 2R98A 5D29A 1KEEB 2ZOFA 2ZEHA 3SI1A 4FD6A 3TLZA 2PSWA 1KBLA 4NJQA 4FD4A 4MRIA 4NGRA 1K4JA 4F9UA 2VZYA 3TLEA 1YK3A 2R8VA 1CP7A 2POKA 3F5BA 4C8UA 4A2ZA 1IYKA 3FMCA 3OWCA 4FUUA 4B13A 3IU2A 4UBRA 4MXUA 2CIJA 2WYRA 4R9MA 1EE3P 1V6CA 2CF4A 1TIQA 3A9LA 1P0HA 4Q36A 3ZZIA 4IK2A 3S6KA 4C9VA 3GUXA 3FRMA 3D2MA 4CAVA 4XPDB 4F0XA 4UWIA 4COBA 4YU9A 5F49A 4MJ8A 1XF1A 1Q2CA 1C3OB 3NFZA 3IWGA 1XOVA 2PJAA 3PGPA 3FEEA 4O23A 4OC5A 4QB9A 5LYIA 3ICUA 4TJXA 4PXBA 5HMNA 1ELMP 2CTBA 2XEIA 4BD9A 4ZI6A 3WR7A 2PQ8A 2ZELA 3FB3A 3FEDA 1YMEA 2Q44A 2IJZA 4DUKA 3LWUA 4P4IA
chains in the Genus database with same CATH topology
3IC1A 1FT7A 3FVLA 2PCUA 2Q51A 4P4FA 4OIDA 4MHNA 1IGBA 1TKJA 4P4DA 3NH8A 2EWBA 4CDJA 4FAIA 2GP4A 2C6GA 2G9DA 1XJOA 3D7GA 2AFUA 2XEGA 4UIBA 4A39A 2F8HA 3IIBA 3SJGA 3TC8A 2IMOA 2PJ9A 2ZENA 4ONWA 4R76A 3NA6A 5LYDA 4H2KA 4LQGA 2JBJA 1TXRA 4P10A 3DGVA 3LMSA 3NH5A 3CDXA 3DLJA 4MCPA 3B7IA 4NGMA 3PB6X 4P4BA 2AFSA 1HEEA 4UIAA 3IFEA 4C9UA 3KI9A 2ABZA 3I6SA 2PVWA 1XMBA 4RUHA 5CPAA 2V8GA 2AFMA 4ZX8A 3PRTA 4P45A 2ZEDA 4MHZA 4PPZA 1LCPA 1VHOA 5CBMA 3B3WA 4ZYQA 3V38A 2OR4A 4P4EA 4Q7AA 4Z65A 1IY7A 1VGYA 2AFZA 3B35A 4FWUA 4OC2A 1CG2A 4A38A 2HB6A 3FH4A 5LYLA 4X3RA 4C84A 7CPAA 3VH9A 1GYTA 3PB7X 4CPAA 3PBEA 3QNVA 4UF4A 5JM6A 4CDKA 2BO9A 3SJFA 3SI2A 2V8DA 2F7VA 4F8ZA 4R8FA 3SJEA 1ELLP 1LANA 4JYWA 1F57A 2I3CA 3PFOA 5LRJA 3I74A 4C8FA 2VL1A 1ZG8A 3B3TA 2PIZA 4WWVA 2ZOGA 1ARLA 1KWMA 2PRQA 3CPXA 4NJRA 5JGFA 3WC6A 1OBRA 2GREA 4C8AA 5IB9A 4PXEA 3PB8X 3BHXA 4OC4A 5JH9A 4A37A 4OP4A 2C1CA 2PJ3A 1PCAA 1ZG9A 4TWEA 2XEJA 3D68A 3TX8A 1VIXA 2IQ6A 2PJ8A 5I4MA 3RAMA 3ISXA 3KHXA 2RB7A 3KQXA 1YLOA 4OIWA 2EK8A 5IR2A 3RBUA 1QMUA 4C86A 3IJ3A 1XRYA 1ZG7A 3GB0A 2HC9A 2DEAA 2V8HA 2NYQA 4NGNA 3PFEA 2PJ1A 3WT4A 4OC3A 4NFRA 4UEFA 2PJCA 4C8PA 4A94A 4C85A 3VATA 3PB9X 2C6PA 1LAMA 3B3CA 1BPMA 4MMOA 3N5FA 2CTCA 3S9NA 4R7MA 3MRUA 2ZEPA 4KNGE 2ZEOA 5HVFA 3K2KA 1TF8A 4P44A 5K8MA 3I1UA 1Z5RA 2XEFA 2PJ6A 3KR4A 3EIFA 2AFOA 4EMEA 4DJLA 4EWTA 4MHYA 2Q4ZA 1VHEA 1CPSA 3VARA 2AFWA 2BOAA 3KZWA 1QQ9A 2EK9A 2PJBA 3VTAA 2ZEFA 3D7DA 5K8OA 1AYEA 4C9EA 1DE4C 4OKOA 3SJXA 1CPXA 1Y7EA 3KQZA 3PBBA 4EFDA 3S9LA 3CT9A 4YWYA 2V8VA 3KGQA 4IHMA 3V7ZA 8CPAA 2BCOA 4NGTA 4K3NA 3D66A 5LRKA 4FBEA 4C8CA 3IWWA 4OMEA 4OC1A 3BI0A 3RZAA 3PB4X 2ANPA 2JBKA 3WABA 2GLJA 4ZY1A 1AMPA 2QYVA 5J1QA 2PJ0A 4OC0A 2OOTA 2PIYA 1R43A 2QJ8A 6CPAA 2RFHA 3KASA 1DTDA 4UEEA 1F2OA 4F9VA 1FNOA 3H8EA 1R3NA 4NGSA 2PVVA 4B6ZA 3H8GA 2QVPA 1LFWA 2C6CA 3D7HA 4ZY0A 3WC5A 1M4LA 4AXVA 1BLLE 2AFXA 5F09A 1BAVA 1Y0YA 3GLJA 5LRGA 4PXCA 1Z8LA 2ZEGA 1CX8A 1Z2LA 1F2PA 5DS0A 3JRUA 2O4HA 3KR5A 5D8NA 1Y0RA 2PJ5A 1ZLHA 5HVGA 1TKFA 1BPNA 3PEIA 3BI1A 1TF9A 4X2TA 4MHPA 1LOKA 4TNUA 4P4JA 4W9YA 3FF3A 4GM5A 4ZY2A 4C9RA 3S9MA 3WC7A 5ELYA 1TKHA 2C5QA 1CBXA 3IO1A 4X8IA 3FX6A 1RTQA 1YSJA 3HUVA 4KSIA 2Q43A 3SI0A 1XBUA 1CP6A 4DYOA 1ARMA 3MN8A 3FJUA 2NSMA 3BXMA 4MCSA 1UWYA 4MCQA 4WJBA 3KHZA 1HDUA 1JQGA 3K9TA 4C99A 2FVGA 5THWA 4MCRA 1LAPA 5HXDA 4NGPA 1NSAA 3CPAA 1PYTB 4TJVA 3FECA 4YN3A 2V77A 1H8LA 4UEZA 2PJ2A 2J9AA 4JZ0A 5K8NA 3D67A 2ZEMA 4G1PA 1Y9ZA 2ZEEA 3ISZA 1YW4A 3IEHA 3L2NA 2JEWA 4NGQA 4PQAA 3D7FA 4ZX9A 1WVMA 5HVHA 4IAVA 2GU2A 2PE3A 3B3SA 4C8TA 1XFOA 1ZLIA 3B2YA 1HDQA 3B3VA 3HLPA 4PXDA 5LYFA 2WZNA 2GLFA 1Q7LA 2PJ4A 2PJ7A 3NH4A 3D4UA 4R6TA 2O53A 4P6YA 4C9AA 3KL9A 3T8WA 3H8FA 1YW6A 5K8PA 5D29A 2ZOFA 2ZEHA 3SI1A 4NJQA 4MRIA 4NGRA 4F9UA 1CP7A 2POKA 4C8UA 3FMCA 4FUUA 4MXUA 2CIJA 2WYRA 1V6CA 1EE3P 2CF4A 4C9VA 4IK2A 3GUXA 4YU9A 1XF1A 3NFZA 2PJAA 4O23A 4OC5A 3FEEA 5LYIA 3ICUA 4TJXA 4PXBA 1ELMP 2CTBA 2XEIA 4BD9A 4ZI6A 2ZELA 3FEDA 1YMEA 2IJZA 4DUKA 3LWUA 4P4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IC1 A;  1FT7 A;  3FVL A;  2PCU A;  2Q51 A;  4P4F A;  4OID A;  4MHN A;  1IGB A;  1TKJ A;  4P4D A;  3NH8 A;  2EWB A;  4CDJ A;  4FAI A;  2C6G A;  2G9D A;  1XJO A;  3D7G A;  2AFU A;  2XEG A;  4UIB A;  4A39 A;  2F8H A;  3IIB A;  3SJG A;  3TC8 A;  2IMO A;  2PJ9 A;  2ZEN A;  4ONW A;  4R76 A;  3NA6 A;  5LYD A;  4H2K A;  4LQG A;  2JBJ A;  1TXR A;  4P10 A;  3DGV A;  3LMS A;  3NH5 A;  3CDX A;  3DLJ A;  4MCP A;  3B7I A;  4NGM A;  3PB6 X;  4P4B A;  2AFS A;  1HEE A;  4UIA A;  3IFE A;  4C9U A;  3KI9 A;  2ABZ A;  3I6S A;  2PVW A;  1XMB A;  4RUH A;  5CPA A;  2V8G A;  2AFM A;  4ZX8 A;  3PRT A;  4P45 A;  2ZED A;  4MHZ A;  4PPZ A;  1LCP A;  1VHO A;  5CBM A;  3B3W A;  4ZYQ A;  3V38 A;  2OR4 A;  4P4E A;  4Q7A A;  4Z65 A;  1IY7 A;  1VGY A;  2AFZ A;  3B35 A;  4FWU A;  4OC2 A;  1CG2 A;  4A38 A;  2HB6 A;  3FH4 A;  5LYL A;  4X3R A;  4C84 A;  7CPA A;  3VH9 A;  1GYT A;  3PB7 X;  4CPA A;  3PBE A;  3QNV A;  4UF4 A;  5JM6 A;  4CDK A;  2BO9 A;  3SJF A;  3SI2 A;  2V8D A;  2F7V A;  4F8Z A;  4R8F A;  3SJE A;  1ELL P;  1LAN A;  4JYW A;  1F57 A;  2I3C A;  3PFO A;  5LRJ A;  3I74 A;  4C8F A;  2VL1 A;  1ZG8 A;  3B3T A;  2PIZ A;  4WWV A;  2ZOG A;  1ARL A;  1KWM A;  2PRQ A;  3CPX A;  4NJR A;  5JGF A;  3WC6 A;  1OBR A;  2GRE A;  4C8A A;  5IB9 A;  4PXE A;  3PB8 X;  3BHX A;  4OC4 A;  5JH9 A;  4A37 A;  4OP4 A;  2C1C A;  2PJ3 A;  1PCA A;  1ZG9 A;  4TWE A;  2XEJ A;  3D68 A;  3TX8 A;  1VIX A;  2IQ6 A;  2PJ8 A;  5I4M A;  3RAM A;  3ISX A;  3KHX A;  2RB7 A;  3KQX A;  1YLO A;  4OIW A;  2EK8 A;  3RBU A;  1QMU A;  4C86 A;  3IJ3 A;  1XRY A;  1ZG7 A;  3GB0 A;  2HC9 A;  2DEA A;  2V8H A;  2NYQ A;  4NGN A;  3PFE A;  2PJ1 A;  3WT4 A;  4OC3 A;  4NFR A;  4UEF A;  2PJC A;  4C8P A;  4A94 A;  4C85 A;  3VAT A;  3PB9 X;  2C6P A;  1LAM A;  3B3C A;  1BPM A;  4MMO A;  3N5F A;  2CTC A;  3S9N A;  4R7M A;  3MRU A;  2ZEP A;  4KNG E;  2ZEO A;  5HVF A;  3K2K A;  1TF8 A;  4P44 A;  5K8M A;  3I1U A;  1Z5R A;  2XEF A;  2PJ6 A;  3KR4 A;  3EIF A;  2AFO A;  4EME A;  4DJL A;  4EWT A;  4MHY A;  2Q4Z A;  1VHE A;  1CPS A;  3VAR A;  2AFW A;  2BOA A;  3KZW A;  1QQ9 A;  2EK9 A;  2PJB A;  3VTA A;  2ZEF A;  3D7D A;  5K8O A;  1AYE A;  4C9E A;  1DE4 C;  4OKO A;  3SJX A;  1CPX A;  1Y7E A;  3KQZ A;  3PBB A;  4EFD A;  3S9L A;  3CT9 A;  4YWY A;  2V8V A;  3KGQ A;  4IHM A;  3V7Z A;  8CPA A;  2BCO A;  4NGT A;  4K3N A;  3D66 A;  5LRK A;  4FBE A;  4C8C A;  3IWW A;  4OME A;  4OC1 A;  3BI0 A;  3RZA A;  3PB4 X;  2ANP A;  2JBK A;  3WAB A;  2GLJ A;  4ZY1 A;  1AMP A;  2QYV A;  5J1Q A;  2PJ0 A;  4OC0 A;  2OOT A;  2PIY A;  1R43 A;  2QJ8 A;  6CPA A;  2RFH A;  3KAS A;  1DTD A;  4UEE A;  1F2O A;  4F9V A;  1FNO A;  3H8E A;  1R3N A;  4NGS A;  2PVV A;  4B6Z A;  3H8G A;  2QVP A;  1LFW A;  2C6C A;  3D7H A;  4ZY0 A;  3WC5 A;  1M4L A;  4AXV A;  1BLL E;  2AFX A;  5F09 A;  1BAV A;  1Y0Y A;  3GLJ A;  5LRG A;  4PXC A;  1Z8L A;  2ZEG A;  1CX8 A;  1Z2L A;  1F2P A;  5DS0 A;  3JRU A;  2O4H A;  3KR5 A;  5D8N A;  1Y0R A;  2PJ5 A;  1ZLH A;  5HVG A;  1TKF A;  1BPN A;  3PEI A;  3BI1 A;  1TF9 A;  4X2T A;  4MHP A;  1LOK A;  4TNU A;  4P4J A;  4W9Y A;  3FF3 A;  4GM5 A;  4ZY2 A;  4C9R A;  3S9M A;  3WC7 A;  5ELY A;  1TKH A;  1CBX A;  3IO1 A;  4X8I A;  3FX6 A;  1RTQ A;  1YSJ A;  3HUV A;  4KSI A;  2Q43 A;  3SI0 A;  1XBU A;  1CP6 A;  4DYO A;  1ARM A;  3MN8 A;  3FJU A;  2NSM A;  3BXM A;  4MCS A;  1UWY A;  4MCQ A;  4WJB A;  3KHZ A;  1HDU A;  1JQG A;  3K9T A;  4C99 A;  2FVG A;  5THW A;  4MCR A;  1LAP A;  5HXD A;  4NGP A;  1NSA A;  3CPA A;  1PYT B;  4TJV A;  3FEC A;  4YN3 A;  2V77 A;  1H8L A;  4UEZ A;  2PJ2 A;  2J9A A;  4JZ0 A;  5K8N A;  3D67 A;  2ZEM A;  4G1P A;  1Y9Z A;  2ZEE A;  3ISZ A;  1YW4 A;  3IEH A;  3L2N A;  2JEW A;  4NGQ A;  4PQA A;  3D7F A;  4ZX9 A;  1WVM A;  5HVH A;  4IAV A;  2GU2 A;  2PE3 A;  3B3S A;  4C8T A;  1XFO A;  1ZLI A;  3B2Y A;  1HDQ A;  3B3V A;  3HLP A;  4PXD A;  5LYF A;  2WZN A;  2GLF A;  1Q7L A;  2PJ4 A;  2PJ7 A;  3NH4 A;  3D4U A;  4R6T A;  2O53 A;  4P6Y A;  4C9A A;  3KL9 A;  3T8W A;  3H8F A;  1YW6 A;  5K8P A;  5D29 A;  2ZOF A;  2ZEH A;  3SI1 A;  4NJQ A;  4MRI A;  4NGR A;  4F9U A;  1CP7 A;  2POK A;  4C8U A;  3FMC A;  4FUU A;  4MXU A;  2CIJ A;  2WYR A;  1V6C A;  1EE3 P;  2CF4 A;  4C9V A;  4IK2 A;  3GUX A;  4YU9 A;  1XF1 A;  3NFZ A;  2PJA A;  4O23 A;  4OC5 A;  3FEE A;  5LYI A;  3ICU A;  4TJX A;  4PXB A;  1ELM P;  2CTB A;  2XEI A;  4BD9 A;  4ZI6 A;  2ZEL A;  3FED A;  1YME A;  2IJZ A;  4DUK A;  3LWU A;  4P4I A; 
#chains in the Genus database with same CATH topology
 3IC1 A;  5A27 A;  1FT7 A;  1M44 A;  3FVL A;  4CGO A;  4CGP A;  2PCU A;  4OLL A;  2Q51 A;  1QSN A;  4M6G A;  1RO5 A;  4OID A;  4P4F A;  2Z3P A;  4MHN A;  2FT0 A;  1IGB A;  1TKJ A;  2F5I A;  4P4D A;  1NXJ A;  3NH8 A;  1CS0 B;  2HUZ A;  4KVM E;  1MJ9 A;  5K99 A;  1L0C A;  4JJX A;  2EWB A;  4CDJ A;  4FAI A;  2GP4 A;  3EZB A;  2C6G A;  2G9D A;  1XJO A;  3D7G A;  2AFU A;  2XEG A;  3TFY A;  1VKC A;  3R9G A;  1R61 A;  4UIB A;  4A39 A;  2F8H A;  3IIB A;  4PSW A;  2Q7B A;  2O28 A;  2Z3L A;  2IMO A;  3SJG A;  3TC8 A;  1VBH A;  5FD8 A;  2PJ9 A;  2CNM A;  2ZEN A;  4MI1 A;  4EYS A;  2ZPA A;  3CXQ A;  4C2Z A;  4ONW A;  4R76 A;  3NA6 A;  1Q2Y A;  1IIC A;  5LYD A;  4LQ6 A;  3TO7 A;  4YRH A;  4H2K A;  4LQG A;  1WWZ A;  4CYP A;  2K5T A;  3TCV A;  2P6G A;  2Z3M A;  3DR8 A;  2YGW A;  2JBJ A;  1TXR A;  4P10 A;  3EC4 A;  3LD2 A;  4KOT A;  1Q5X A;  3DGV A;  3LMS A;  1LRZ A;  3NH5 A;  3SR3 A;  3CDX A;  3H5Z A;  3DLJ A;  5G22 A;  1KUV A;  2DF5 A;  4MCP A;  2PDO A;  3B7I A;  4NGM A;  4KOU A;  3PB6 X;  4JXR A;  1A9X B;  4P4B A;  2P0W A;  2AFS A;  4XNH C;  1HEE A;  4UIA A;  5BWA B;  2A4N A;  1MK4 A;  2OU2 A;  3IFE A;  4HNX B;  3KI9 A;  4QC6 A;  3R9F A;  4CYQ A;  4C9U A;  2ABZ A;  2OB0 A;  1FY7 A;  3I6S A;  2PVW A;  2VI7 A;  1XMB A;  3GY9 A;  4KUA A;  4C8C A;  4RUH A;  5CPA A;  2V8G A;  2FIW A;  2AFM A;  2P6E A;  3PRT A;  4ZX8 A;  4P45 A;  4JVO A;  2ZED A;  2WUU A;  2Y0M A;  1WK4 A;  3U1B A;  2Q7S A;  4MHZ A;  4L89 A;  2GFQ A;  1B87 A;  4KVX A;  4PPZ A;  3TLG B;  1LCP A;  1VHO A;  5CBM A;  3G3S A;  4LUA A;  5H84 A;  2E28 A;  1YRE A;  3B3W A;  5H86 A;  4MFQ A;  3V38 A;  4ZYQ A;  4CYN A;  3FBU A;  2OR4 A;  3BJ7 A;  2AUN A;  3TLY A;  4XPD C;  2CNT A;  4P4E A;  4Q7A A;  4Z65 A;  1IY7 A;  1VGY A;  2Q0Y A;  3BLN A;  4R87 A;  4CRY B;  1OZP A;  2AFZ A;  3B35 A;  1IB1 E;  1ZO0 A;  4FWU A;  4OC2 A;  2JEV A;  4XNH B;  1CG2 A;  4A38 A;  4ZBG A;  2AE6 A;  2HB6 A;  3FH4 A;  5HH1 A;  5IB0 A;  1Y9W A;  4MY3 A;  5LYL A;  4X3R A;  4C84 A;  7CPA A;  3VH9 A;  1GYT A;  2R7H A;  3PB7 X;  4CPA A;  4JD6 A;  4MFJ A;  3PBE A;  3QNV A;  4KOV A;  4L8A A;  4C7I A;  3TE4 A;  2ZW6 A;  4UF4 A;  4MFK A;  4RN7 A;  5JM6 A;  4CDK A;  2OZH A;  2BO9 A;  2PRB A;  2Z10 A;  4UFV A;  3SJF A;  3SI2 A;  4R3L A;  3S6F A;  2V8D A;  1A2Z A;  2F7V A;  4F8Z A;  4R8F A;  3SJE A;  5JYB A;  4IUS A;  2EUI A;  3IU1 A;  1ELL P;  2D4O A;  1LAN A;  4JYW A;  1F57 A;  2I3C A;  1S7N A;  3PFO A;  5LRJ A;  4BBH A;  4DNC A;  2EZA A;  4C8F A;  2VL1 A;  4A32 A;  4B11 A;  1ZG8 A;  4B10 A;  3I9S A;  2HWG A;  5F48 A;  5AG4 A;  3B3T A;  1XMT A;  4CAF A;  2PIZ A;  4MY0 A;  4WWV A;  2ZOG A;  3C26 A;  4Y49 B;  3FNC A;  4A31 A;  3TLB A;  5GCN A;  3V8I A;  2HQY A;  2HI6 A;  1ARL A;  1KWM A;  2PRQ A;  4XPL A;  1S7L A;  2YND A;  3D8P A;  3CPX A;  4NJR A;  5JGF A;  3WC6 A;  1ZYM A;  2B5G B;  1B6B A;  3P2H A;  5FVJ A;  1OBR A;  4CRZ B;  5AG5 A;  5DWN A;  1YQE A;  2GRE A;  5IB9 A;  4C8A A;  4PXE A;  2EVN A;  4PSX A;  3PB8 X;  3BHX A;  4OC4 A;  5JH9 A;  4CGM A;  4A37 A;  2FS5 A;  3TO9 A;  4OP4 A;  2C1C A;  4KOX A;  2PJ3 A;  4UCN A;  4B5P B;  1PCA A;  1ZG9 A;  4TWE A;  3NOJ A;  3F8K A;  2XEJ A;  2PR1 A;  4NEX A;  3D68 A;  1EZB A;  1S7F A;  2JLM A;  4KVO E;  4LX9 A;  1J3L A;  2J8N A;  3TT2 A;  4JLY A;  1VIX A;  3TX8 A;  2ATR A;  3TOA A;  2G3A A;  2RC4 A;  1SQH A;  2P6F A;  4A33 A;  2IQ6 A;  2IL4 A;  4PK3 A;  2X7B A;  2VBQ A;  2PJ8 A;  1Z8T A;  3RAM A;  5I4M A;  3ISX A;  3KHX A;  4H1H A;  4J0N A;  2B4D B;  2RB7 A;  4JXQ A;  3LOD A;  2YNC C;  3KQX A;  3T90 A;  2ZXV A;  1YLO A;  5F47 A;  2GIV A;  5AGE A;  4INJ A;  3R9E A;  4OIW A;  2QIR A;  2WPX A;  5IX3 A;  5KTC A;  1GGO A;  2EK8 A;  2OLS A;  3JUW A;  5IR2 A;  3RBU A;  1QMU A;  2ZW7 A;  4CO9 A;  1QSR A;  2FXF A;  1XRY A;  1Z4R A;  1ZG7 A;  3GB0 A;  3IJ3 A;  2EO8 A;  4C86 A;  4C7H A;  3S6H A;  4IF5 A;  1ZL0 A;  2HC9 A;  1Z4E A;  2DEA A;  1VHS A;  1S7K A;  2V8H A;  2REE A;  2BL1 A;  2NYQ A;  3DSB A;  4M6H A;  4NGN A;  2PC1 A;  2FM4 A;  3T0T A;  2B3V A;  4ZGY B;  3PFE A;  1NMT A;  2PJ1 A;  3D2P A;  4MFP A;  3WT4 A;  3T5M A;  2PR8 A;  2QML A;  4OC3 A;  4B12 A;  4NFR A;  4UEF A;  3PZJ A;  2GE3 A;  2PJC A;  4C8P A;  1MJA A;  4A94 A;  1MJB A;  3TO6 A;  2B4B A;  4MBU A;  4Y49 C;  1T36 B;  3DR6 A;  4C85 A;  3K4I A;  3VAT A;  4HPS A;  2Z0Z A;  1YR0 A;  2ZW4 A;  2B58 A;  2C6P A;  3PB9 X;  2VXK A;  4GXH A;  4AB7 A;  2B0A A;  3T07 A;  4OAE A;  5F46 A;  5KTA A;  1LAM A;  5C88 A;  4E94 A;  4J3G A;  4KNG E;  1YVO A;  5JVL A;  3B3C A;  4NF1 A;  1BPM A;  2Q04 A;  3EFA A;  4MMO A;  5JPH A;  3TLC A;  3H4Q A;  3N5F A;  2CTC A;  2HRO A;  3UY5 A;  2YNC A;  3S9N A;  3R1K A;  3MGD A;  4R7M A;  3MRU A;  1Z8W A;  4CGL A;  2ZEP A;  2ARH A;  4GS4 A;  2Z3O A;  5DWM A;  2Q4Y A;  3DNS A;  3I3G A;  2ZEO A;  4BIN A;  5C82 A;  2Z3N A;  3SXO A;  4FD5 A;  1S60 A;  5EC4 A;  2I00 A;  5HVF A;  1BOB A;  3K2K A;  2BEI A;  1TF8 A;  3K9U A;  4AG7 A;  4P44 A;  5A28 A;  3TOB A;  3W91 A;  2CXA A;  3I1U A;  5K8M A;  5F9M A;  3N7Z A;  4M85 A;  4RI1 A;  4E5S A;  5G20 A;  1Z5R A;  4KUB A;  2XEF A;  2PJ6 A;  2NMT A;  4MFZ A;  2CY2 A;  4CYO A;  4CS0 B;  3KR4 A;  4B5P A;  4F0Y A;  3EIF A;  2AFO A;  4EME A;  1YGH A;  4DJL A;  4UFW A;  4EWT A;  4MHY A;  1J4J A;  1KUY A;  4PK2 A;  5AG7 A;  2Q4Z A;  1VHE A;  3GKR A;  1CPS A;  3KKW A;  3R95 A;  2B3U A;  2G3T A;  2D0O A;  3VAR A;  1XF8 A;  2FIA A;  1NSL A;  4MHD A;  2EZC A;  1NE9 A;  2YJT A;  1YLE A;  2AFW A;  5EMI A;  2BOA A;  1GHE A;  4KZT A;  3KZW A;  4H6U A;  1I1D A;  1QQ9 A;  1JWQ A;  2EK9 A;  3EZA A;  2PJB A;  3VTA A;  1IOI A;  1R57 A;  4X5K A;  3TLA A;  4QBJ A;  3C8O A;  1V0C A;  2ZEF A;  3D7D A;  2G0B A;  5K8O A;  4COG A;  1AYE A;  1XEB A;  4C9E A;  1DE4 C;  1X10 A;  2BSW A;  2B5G A;  4OKO A;  1CPX A;  3SJX A;  1Y7E A;  2OZU A;  3KQZ A;  3P2F A;  2DPT A;  3PBB A;  2FL4 A;  4EFD A;  1KC7 A;  5E96 A;  2WSA A;  4KLW A;  3S6G A;  4E8O A;  3S9L A;  2EZB A;  3CT9 A;  1BXR B;  4KOY A;  4YWY A;  4AVA A;  2V8V A;  3D3S A;  3KGQ A;  1Y7R A;  4IHM A;  1ON0 A;  4HNW B;  3V7Z A;  4UA3 A;  1AUG A;  8CPA A;  2BCO A;  4NGT A;  1VI4 A;  4K3N A;  3D66 A;  5LRK A;  4FBE A;  1JDB C;  3B8G A;  2DPS A;  2Q4V A;  2D4P A;  3IWW A;  4MI4 A;  2C27 A;  1QSM A;  1Y9K A;  2BUE A;  4ONU A;  4OC1 A;  3FXT A;  4OME A;  4B5O A;  2WPW A;  1XE4 A;  3BI0 A;  3RZA A;  4H6Z A;  3PB4 X;  4F6A A;  2ANP A;  4KSF A;  4IIY A;  2JBK A;  3WAB A;  4XPK A;  2DIK A;  2GLJ A;  1S3Z A;  4CAW A;  3CXS A;  1P4N A;  4ZY1 A;  2B4D A;  3KRV A;  1I12 A;  1AMP A;  4E2A A;  2QYV A;  5J1Q A;  3TYX A;  2PJ0 A;  4CAX A;  4R57 A;  4MFL A;  2J8R A;  4YGO A;  2ODF A;  3DDD A;  4OC0 A;  4YFJ A;  2OOT A;  2PIY A;  2Z11 A;  1R43 A;  4R3K A;  4AG9 A;  1JDE A;  2QJ8 A;  6CPA A;  2RFH A;  3KAS A;  3GJZ A;  1DTD A;  4UEE A;  1F2O A;  3VWE A;  4F9V A;  1FNO A;  4HNY B;  2R1I A;  3H8E A;  1QST A;  1R3N A;  4CAE A;  4NGS A;  1YVK A;  3EXN A;  2PVV A;  2J8M A;  4A30 A;  4MJX A;  4B6Z A;  3H8G A;  2FSR A;  3E0K A;  4KOW A;  4C68 A;  3BJ8 A;  4UFX A;  4BMH A;  2QVP A;  1RXT A;  1M4G A;  1LFW A;  2C6C A;  2OZG A;  1PUA A;  3D7H A;  4ZY0 A;  1QSO A;  1YX0 A;  4PV6 A;  3WC5 A;  1M4L A;  4EVY A;  3ZJ0 A;  1IOF A;  1I21 A;  4AXV A;  3QB8 A;  1CM0 A;  1BLL E;  4E0A A;  1XIX A;  2VEZ A;  3LAC A;  2AFX A;  5F09 A;  1BO4 A;  1BAV A;  1Y0Y A;  3GLJ A;  2D0P A;  1CJW A;  5LRG A;  4PXC A;  5F5X A;  3NE8 A;  1Z8L A;  2ZEG A;  4U9Z A;  4CZ1 A;  5J8C A;  1CX8 A;  1Z2L A;  4I49 A;  1F2P A;  5DS0 A;  3JRU A;  3RNZ A;  4M8D A;  2O4H A;  3KR5 A;  5D8N A;  1PU9 A;  2JDC A;  1CE8 B;  1Y0R A;  2PJ5 A;  1ZLH A;  1EZA A;  4A95 A;  5HVG A;  3G23 A;  1TKF A;  1BPN A;  3PEI A;  1N71 A;  3BI1 A;  2VZZ A;  3QAH A;  1TF9 A;  4X2T A;  4MHP A;  1LOK A;  3TLG A;  3GIU A;  4TNU A;  3EZE A;  2GAN A;  3VWD A;  4KS9 A;  4H89 A;  1IU8 A;  4P4J A;  4W9Y A;  5IV0 A;  2X0S A;  2I79 A;  2FE7 A;  3FF3 A;  4GM5 A;  1U6M A;  3R96 A;  4ZY2 A;  2R82 A;  4C9R A;  1UFH A;  3S9M A;  4ORF A;  3WC7 A;  2ZW5 A;  1TKH A;  5ELY A;  1DIK A;  1VBG A;  4KSA A;  2C5Q A;  3EO4 A;  4UWJ A;  3IGR A;  3T9Y A;  4M3S A;  4FD7 A;  1CBX A;  3IO1 A;  1Z8X A;  4X8I A;  1M1D A;  3FX6 A;  2FCK A;  1RTQ A;  1YSJ A;  5ISV A;  3HUV A;  4KSI A;  3QAY A;  2Q43 A;  5CNP A;  3CZX A;  3SI0 A;  1XBU A;  5G1Z A;  1NBW A;  2AJ6 A;  1CP6 A;  4C2Y A;  4DYO A;  1ARM A;  2Z3K A;  3MN8 A;  3FJU A;  3SXN A;  2DXQ A;  2NSM A;  3BXM A;  4Q38 A;  4B14 A;  2MP0 A;  1KZF A;  4MCS A;  2EBJ A;  1UWY A;  2REF A;  4IIX A;  4MCQ A;  4WJB A;  3G8W A;  2CNS A;  3JVN A;  3F0A A;  1HDU A;  3KHZ A;  1JQG A;  3K9T A;  4AVB A;  4K30 A;  2FVG A;  4C99 A;  5THW A;  4MCR A;  1M4D A;  1LAP A;  2PCN A;  5HXD A;  3NE7 A;  3PP9 A;  2YNE A;  5F1Y A;  3W6S A;  4NGP A;  1NSA A;  1M4I A;  3CPA A;  1PYT B;  4TJV A;  3FEC A;  5AG6 A;  4YN3 A;  2V77 A;  4U9Y A;  1KUX A;  1H8L A;  4UEZ A;  1M6V B;  2PJ2 A;  4HKF A;  3EY5 A;  2J9A A;  1S5K A;  4JZ0 A;  3SHP A;  3TTH A;  4NXY A;  4UCP A;  5K8N A;  3D67 A;  2ZEM A;  4G1P A;  3RO0 A;  3IWE A;  2ZEE A;  3GYA A;  1Y9Z A;  3CXP A;  3ISZ A;  4JWP A;  1YW4 A;  3IEH A;  3L2N A;  5G21 A;  2JEW A;  4NGQ A;  2VQY A;  3RYO A;  4PQA A;  1IYL A;  1IID A;  5EBV A;  3D7F A;  4ZX9 A;  1WVM A;  5HVH A;  4KOR A;  4UCM A;  4IAV A;  4U5Y A;  3W6X A;  2JDD A;  1C30 B;  5J8F A;  5I0C A;  2YJV A;  2GU2 A;  2PE3 A;  3B3S A;  4C8T A;  1XFO A;  3JTK A;  1Z9U A;  4RS2 A;  3T05 A;  1ZLI A;  3B2Y A;  1HDQ A;  1X12 A;  3B3V A;  3FIX A;  4NCZ A;  3HLP A;  4OAD A;  4QVT A;  4C2X A;  4PXD A;  3FYN A;  5LYF A;  2WZN A;  4AVC A;  2GLF A;  4QUS A;  1Q7L A;  2PJ4 A;  4KLV A;  1ZRS A;  2H5M A;  2QEC A;  4II9 A;  2AUM A;  2HV2 A;  2PJ7 A;  3NH4 A;  1Q2D A;  3D4U A;  4R6T A;  2KCW A;  2O53 A;  4P6Y A;  4KOS A;  5JQ4 A;  4NSQ A;  5KTD A;  4C9A A;  3KL9 A;  2OH1 A;  4M6I A;  3T8W A;  3H8F A;  4CGN A;  1YW6 A;  5K8P A;  3I74 A;  2R98 A;  5D29 A;  1KEE B;  2ZOF A;  2ZEH A;  3SI1 A;  4FD6 A;  3TLZ A;  2PSW A;  1KBL A;  4NJQ A;  4FD4 A;  4MRI A;  4NGR A;  1K4J A;  4F9U A;  2VZY A;  3TLE A;  1YK3 A;  2R8V A;  1CP7 A;  2POK A;  3F5B A;  4C8U A;  4A2Z A;  1IYK A;  3FMC A;  3OWC A;  4FUU A;  4B13 A;  3IU2 A;  4UBR A;  4MXU A;  2CIJ A;  2WYR A;  4R9M A;  1EE3 P;  1V6C A;  2CF4 A;  1TIQ A;  3A9L A;  1P0H A;  4Q36 A;  3ZZI A;  4IK2 A;  3S6K A;  4C9V A;  3GUX A;  3FRM A;  3D2M A;  4CAV A;  4XPD B;  4F0X A;  4UWI A;  4COB A;  4YU9 A;  5F49 A;  4MJ8 A;  1XF1 A;  1Q2C A;  1C3O B;  3NFZ A;  3IWG A;  1XOV A;  2PJA A;  3PGP A;  3FEE A;  4O23 A;  4OC5 A;  4QB9 A;  5LYI A;  3ICU A;  4TJX A;  4PXB A;  5HMN A;  1ELM P;  2CTB A;  2XEI A;  4BD9 A;  4ZI6 A;  3WR7 A;  2PQ8 A;  2ZEL A;  3FB3 A;  3FED A;  1YME A;  2Q44 A;  2IJZ A;  4DUK A;  3LWU A;  4P4I A; 
#chains in the Genus database with same CATH homology
 3IC1 A;  1FT7 A;  3FVL A;  2PCU A;  2Q51 A;  4P4F A;  4OID A;  4MHN A;  1IGB A;  1TKJ A;  4P4D A;  3NH8 A;  2EWB A;  4CDJ A;  4FAI A;  2GP4 A;  2C6G A;  2G9D A;  1XJO A;  3D7G A;  2AFU A;  2XEG A;  4UIB A;  4A39 A;  2F8H A;  3IIB A;  3SJG A;  3TC8 A;  2IMO A;  2PJ9 A;  2ZEN A;  4ONW A;  4R76 A;  3NA6 A;  5LYD A;  4H2K A;  4LQG A;  2JBJ A;  1TXR A;  4P10 A;  3DGV A;  3LMS A;  3NH5 A;  3CDX A;  3DLJ A;  4MCP A;  3B7I A;  4NGM A;  3PB6 X;  4P4B A;  2AFS A;  1HEE A;  4UIA A;  3IFE A;  4C9U A;  3KI9 A;  2ABZ A;  3I6S A;  2PVW A;  1XMB A;  4RUH A;  5CPA A;  2V8G A;  2AFM A;  4ZX8 A;  3PRT A;  4P45 A;  2ZED A;  4MHZ A;  4PPZ A;  1LCP A;  1VHO A;  5CBM A;  3B3W A;  4ZYQ A;  3V38 A;  2OR4 A;  4P4E A;  4Q7A A;  4Z65 A;  1IY7 A;  1VGY A;  2AFZ A;  3B35 A;  4FWU A;  4OC2 A;  1CG2 A;  4A38 A;  2HB6 A;  3FH4 A;  5LYL A;  4X3R A;  4C84 A;  7CPA A;  3VH9 A;  1GYT A;  3PB7 X;  4CPA A;  3PBE A;  3QNV A;  4UF4 A;  5JM6 A;  4CDK A;  2BO9 A;  3SJF A;  3SI2 A;  2V8D A;  2F7V A;  4F8Z A;  4R8F A;  3SJE A;  1ELL P;  1LAN A;  4JYW A;  1F57 A;  2I3C A;  3PFO A;  5LRJ A;  3I74 A;  4C8F A;  2VL1 A;  1ZG8 A;  3B3T A;  2PIZ A;  4WWV A;  2ZOG A;  1ARL A;  1KWM A;  2PRQ A;  3CPX A;  4NJR A;  5JGF A;  3WC6 A;  1OBR A;  2GRE A;  4C8A A;  5IB9 A;  4PXE A;  3PB8 X;  3BHX A;  4OC4 A;  5JH9 A;  4A37 A;  4OP4 A;  2C1C A;  2PJ3 A;  1PCA A;  1ZG9 A;  4TWE A;  2XEJ A;  3D68 A;  3TX8 A;  1VIX A;  2IQ6 A;  2PJ8 A;  5I4M A;  3RAM A;  3ISX A;  3KHX A;  2RB7 A;  3KQX A;  1YLO A;  4OIW A;  2EK8 A;  5IR2 A;  3RBU A;  1QMU A;  4C86 A;  3IJ3 A;  1XRY A;  1ZG7 A;  3GB0 A;  2HC9 A;  2DEA A;  2V8H A;  2NYQ A;  4NGN A;  3PFE A;  2PJ1 A;  3WT4 A;  4OC3 A;  4NFR A;  4UEF A;  2PJC A;  4C8P A;  4A94 A;  4C85 A;  3VAT A;  3PB9 X;  2C6P A;  1LAM A;  3B3C A;  1BPM A;  4MMO A;  3N5F A;  2CTC A;  3S9N A;  4R7M A;  3MRU A;  2ZEP A;  4KNG E;  2ZEO A;  5HVF A;  3K2K A;  1TF8 A;  4P44 A;  5K8M A;  3I1U A;  1Z5R A;  2XEF A;  2PJ6 A;  3KR4 A;  3EIF A;  2AFO A;  4EME A;  4DJL A;  4EWT A;  4MHY A;  2Q4Z A;  1VHE A;  1CPS A;  3VAR A;  2AFW A;  2BOA A;  3KZW A;  1QQ9 A;  2EK9 A;  2PJB A;  3VTA A;  2ZEF A;  3D7D A;  5K8O A;  1AYE A;  4C9E A;  1DE4 C;  4OKO A;  3SJX A;  1CPX A;  1Y7E A;  3KQZ A;  3PBB A;  4EFD A;  3S9L A;  3CT9 A;  4YWY A;  2V8V A;  3KGQ A;  4IHM A;  3V7Z A;  8CPA A;  2BCO A;  4NGT A;  4K3N A;  3D66 A;  5LRK A;  4FBE A;  4C8C A;  3IWW A;  4OME A;  4OC1 A;  3BI0 A;  3RZA A;  3PB4 X;  2ANP A;  2JBK A;  3WAB A;  2GLJ A;  4ZY1 A;  1AMP A;  2QYV A;  5J1Q A;  2PJ0 A;  4OC0 A;  2OOT A;  2PIY A;  1R43 A;  2QJ8 A;  6CPA A;  2RFH A;  3KAS A;  1DTD A;  4UEE A;  1F2O A;  4F9V A;  1FNO A;  3H8E A;  1R3N A;  4NGS A;  2PVV A;  4B6Z A;  3H8G A;  2QVP A;  1LFW A;  2C6C A;  3D7H A;  4ZY0 A;  3WC5 A;  1M4L A;  4AXV A;  1BLL E;  2AFX A;  5F09 A;  1BAV A;  1Y0Y A;  3GLJ A;  5LRG A;  4PXC A;  1Z8L A;  2ZEG A;  1CX8 A;  1Z2L A;  1F2P A;  5DS0 A;  3JRU A;  2O4H A;  3KR5 A;  5D8N A;  1Y0R A;  2PJ5 A;  1ZLH A;  5HVG A;  1TKF A;  1BPN A;  3PEI A;  3BI1 A;  1TF9 A;  4X2T A;  4MHP A;  1LOK A;  4TNU A;  4P4J A;  4W9Y A;  3FF3 A;  4GM5 A;  4ZY2 A;  4C9R A;  3S9M A;  3WC7 A;  5ELY A;  1TKH A;  2C5Q A;  1CBX A;  3IO1 A;  4X8I A;  3FX6 A;  1RTQ A;  1YSJ A;  3HUV A;  4KSI A;  2Q43 A;  3SI0 A;  1XBU A;  1CP6 A;  4DYO A;  1ARM A;  3MN8 A;  3FJU A;  2NSM A;  3BXM A;  4MCS A;  1UWY A;  4MCQ A;  4WJB A;  3KHZ A;  1HDU A;  1JQG A;  3K9T A;  4C99 A;  2FVG A;  5THW A;  4MCR A;  1LAP A;  5HXD A;  4NGP A;  1NSA A;  3CPA A;  1PYT B;  4TJV A;  3FEC A;  4YN3 A;  2V77 A;  1H8L A;  4UEZ A;  2PJ2 A;  2J9A A;  4JZ0 A;  5K8N A;  3D67 A;  2ZEM A;  4G1P A;  1Y9Z A;  2ZEE A;  3ISZ A;  1YW4 A;  3IEH A;  3L2N A;  2JEW A;  4NGQ A;  4PQA A;  3D7F A;  4ZX9 A;  1WVM A;  5HVH A;  4IAV A;  2GU2 A;  2PE3 A;  3B3S A;  4C8T A;  1XFO A;  1ZLI A;  3B2Y A;  1HDQ A;  3B3V A;  3HLP A;  4PXD A;  5LYF A;  2WZN A;  2GLF A;  1Q7L A;  2PJ4 A;  2PJ7 A;  3NH4 A;  3D4U A;  4R6T A;  2O53 A;  4P6Y A;  4C9A A;  3KL9 A;  3T8W A;  3H8F A;  1YW6 A;  5K8P A;  5D29 A;  2ZOF A;  2ZEH A;  3SI1 A;  4NJQ A;  4MRI A;  4NGR A;  4F9U A;  1CP7 A;  2POK A;  4C8U A;  3FMC A;  4FUU A;  4MXU A;  2CIJ A;  2WYR A;  1V6C A;  1EE3 P;  2CF4 A;  4C9V A;  4IK2 A;  3GUX A;  4YU9 A;  1XF1 A;  3NFZ A;  2PJA A;  4O23 A;  4OC5 A;  3FEE A;  5LYI A;  3ICU A;  4TJX A;  4PXB A;  1ELM P;  2CTB A;  2XEI A;  4BD9 A;  4ZI6 A;  2ZEL A;  3FED A;  1YME A;  2IJZ A;  4DUK A;  3LWU A;  4P4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...