2EK8A

Aminopeptidase from aneurinibacillus sp. strain am-1
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
412
structure length
412
Chain Sequence
ADHQITKRTDAENMYNTIQFLSQAPRVAGSPEELKAVRYIEQQFKSYGYHVEVQPFQFEGYTAPSEVTLKIGTEKKEGEAFTYSPNSDVTAELVYVGLGTTADVAGKDLNGKIALIQRGNISFADKVRNAAKQGAKAVIIYNNTDGKLNGTLGGSDASFVAAVGITKQEGDALAANLRAGEKITATVKVAGAEVKTLTSHNVIATKKPDANKKNTNDIIIIGSHHDSVEKAPGANDDASGVAVTLELARVMSKLKTDTELRFITFGAEENGLIGSKKYAASLSEDEIKRTIGMFQLDMVGSKDAGDLIMYTIDGKKNRVTDLGAAASSRLSGVLPYGQEGRSDHESFHALGIPAALFIHAPVEPWYHTPNDTLDKISKEKLDNVADIVGSAVYQAARPGELVIEPIDYPRRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a novel bacterial aminopeptidase with an apical domain from aneurinibacillus sp. strain AM-1
rcsb
source organism Aneurinibacillus sp.
molecule tags Hydrolase
molecule keywords Aminopeptidase
total genus 142
structure length 412
sequence length 412
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2ek8A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2ek8A02
3T8WA 4JYWA 1AMPA 3SJXA 5LYIA 2OOTA 3BI0A 2PRQA 3S9LA 5HXDA 2F8HA 2AFSA 2WZNA 1R43A 2PCUA 3D4UA 1ZG9A 2POKA 3PFOA 3K2KA 2AFXA 3B3WA 3S9NA 2EK9A 2ZOGA 3WC7A 1ZG7A 4KSIA 4TJXA 2J9AA 5F09A 4FWUA 3BI1A 3LWUA 4R7MA 1BPNA 3IFEA 2ZEFA 1FT7A 5JGFA 2AFZA 2PJBA 4OC2A 2XEFA 3D66A 4TJVA 2NYQA 5K8NA 4C9AA 2PJ3A 3B7IA 1BLLE 4EFDA 2QYVA 4GM5A 4PXCA 4X3RA 4MCSA 2ZEHA 1XFOA 5DS0A 3FECA 1KWMA 2AFMA 1AYEA 2V8GA 1XRYA 5CBMA 3SJEA 3D7FA 3IJ3A 2V8VA 2PJ5A 3D7HA 4ZX9A 2PJ6A 1LAMA 1DE4C 7CPAA 1LANA 4NFRA 3FF3A 1PCAA 4OMEA 2AFWA 1IY7A 3B2YA 2AFOA 1LOKA 3NFZA 4ZY2A 4RUHA 1QQ9A 2AFUA 2F7VA 2ZEEA 5ELYA 4X8IA 3B3TA 3ICUA 1TXRA 1CX8A 1JQGA 1HDQA 2BO9A 4UEZA 3FEDA 1TF8A 3WC6A 3JRUA 2NSMA 2C6PA 3KGQA 2C6GA 4MHZA 3NH4A 1ZLHA 4ZI6A 2IJZA 3RBUA 5K8OA 3KR4A 2XEJA 2ZEOA 4W9YA 2CF4A 2JBJA 5K8PA 3CPXA 2CTCA 4P4EA 4P4FA 2PJCA 1V6CA 1FNOA 3FEEA 3KHXA 4H2KA 2HC9A 4YN3A 4TNUA 4DJLA 3I1UA 4OC5A 5CPAA 3H8GA 3TC8A 3H8EA 1Y7EA 3CT9A 4C9RA 2FVGA 5LRKA 2ZELA 4ONWA 4R76A 4C8UA 2C6CA 1PYTB 1YMEA 3D7GA 2IQ6A 2ZEPA 1ZLIA 3PB7X 1GYTA 4AXVA 1ELLP 5HVFA 2EWBA 4YWYA 4ZX8A 4IK2A 2Q43A 4MHNA 4Z65A 3I74A 4P44A 1QMUA 1CP6A 4MCRA 2BOAA 2GREA 1YSJA 5JH9A 1TKHA 4OKOA 3PB8X 1Z2LA 4EMEA 3NH5A 3V7ZA 3KI9A 4A38A 1R3NA 3GLJA 1Y9ZA 3L2NA 2PJ7A 2PJ1A 4MRIA 4WWVA 3WT4A 3DLJA 3RAMA 4ZY0A 3I6SA 5LRGA 4K3NA 2PVWA 3KL9A 4A37A 4C8CA 4OC1A 3KQXA 5I4MA 4C85A 2I3CA 4FUUA 1CBXA 4UEEA 2ZEMA 2Q4ZA 2PIZA 4Q7AA 2PJ4A 1EE3P 5LYDA 3PB9X 1H8LA 3HLPA 2QJ8A 4C8FA 1DTDA 5J1QA 5THWA 4TWEA 3LMSA 1BAVA 3QNVA 3VATA 4CDJA 2ZOFA 2V77A 4A39A 4UEFA 1ZG8A 4OP4A 3BXMA 3KQZA 5LYFA 1VGYA 1Y0RA 4F9UA 3WABA 3KR5A 4UF4A 4O23A 1XF1A 3IEHA 1VHOA 4C9VA 5D29A 1ARMA 1UWYA 4OC4A 3SI0A 2ABZA 3FH4A 1BPMA 3IO1A 4C86A 4NGTA 4C8TA 1VIXA 4P45A 2EK8A 3SI1A 5IB9A 2PJ0A 4NGNA 1CG2A 1CPSA 2G9DA 2GLFA 4OIDA 4C9EA 4UIAA 2DEAA 2PE3A 3N5FA 3WC5A 8CPAA 3PB6X 3PEIA 4X2TA 2Q51A 2JBKA 2PJ2A 2JEWA 3PBEA 4C8PA 1YW4A 4MMOA 1M4LA 4C8AA 4MXUA 3SJGA 4NGRA 3D7DA 2V8HA 3GUXA 1OBRA 1Z8LA 1Q7LA 3CPAA 2CIJA 4ZY1A 1LAPA 4PQAA 1CPXA 3TX8A 4DUKA 1ARLA 2GLJA 4BD9A 4P4JA 5K8MA 3KASA 1F57A 4PPZA 4IHMA 5D8NA 6CPAA 4NGPA 2QVPA 4B6ZA 1ELMP 2RB7A 2PJAA 4P6YA 3BHXA 4MCPA 2ZEDA 2BCOA 1WVMA 3B3VA 3IIBA 3SI2A 5HVGA 2IMOA 4IAVA 3IWWA 1XBUA 5LYLA 4C9UA 4MHPA 2O53A 2V8DA 3B3CA 4P4IA 2C1CA 3EIFA 4NJRA 1XJOA 3V38A 3ISZA 3CDXA 2XEIA 4KNGE 4NGQA 2RFHA 3NH8A 4OC0A 4P10A 1HEEA 3H8FA 4YU9A 2VL1A 2PJ9A 3KHZA 4UIBA 4PXEA 3HUVA 3S9MA 4CDKA 2PVVA 4LQGA 4FAIA 4NGMA 4P4BA 4NGSA 2ANPA 3VARA 1TKJA 2GU2A 2PJ8A 1RTQA 3FX6A 4G1PA 2WYRA 3ISXA 1YLOA 1F2PA 3VH9A 4PXBA 4PXDA 3GB0A 5LRJA 5HVHA 2O4HA 3PB4X 1F2OA 4MCQA 4DYOA 4WJBA 1YW6A 4R6TA 2ZENA 3NA6A 1TKFA 2OR4A 4ZYQA 1TF9A 4MHYA 3DGVA 4NJQA 1LFWA 2HB6A 4OC3A 3MRUA 1Z5RA 1HDUA 1LCPA 3PFEA 4CPAA 1VHEA 1CP7A 3SJFA 3B35A 3D67A 4A94A 4C99A 3PBBA 1XMBA 1Y0YA 3VTAA 4P4DA 3RZAA 5JM6A 4FBEA 2XEGA 2CTBA 3KZWA 3FVLA 4F8ZA 4F9VA 3PRTA 4JZ0A 4EWTA 4C84A 3B3SA 2ZEGA 3IC1A 2PIYA 3D68A 4OIWA 3FJUA 3MN8A 4R8FA 1NSAA 3K9TA 3FMCA 1IGBA
chains in the Genus database with same CATH superfamily
3T8WA 4JYWA 1I12A 1AMPA 3SJXA 5LYIA 2OB0A 4B13A 2OOTA 4QVTA 3BI0A 2PRQA 3S9LA 4CZ1A 3EZBA 3CXQA 5HXDA 2F8HA 5IR2A 2AFSA 4B5PB 4KLVA 5F49A 2WZNA 1R43A 4AB7A 1YQEA 4CRZB 4E5SA 3CXPA 1Q2DA 2PCUA 4IF5A 1YVOA 5BWAB 4FD7A 3D4UA 1ZG9A 2POKA 3PFOA 3K2KA 2AFXA 3JVNA 3B3WA 3NE7A 4QC6A 4R9MA 2EK9A 1Z9UA 3T90A 3TO7A 1B6BA 2VQYA 3S9NA 2ZOGA 4CYOA 3WC7A 1ZG7A 4ZGYB 4KSIA 4TJXA 2J9AA 3LODA 5F09A 3TCVA 1J3LA 4FWUA 3SHPA 3BI1A 4MBUA 2K5TA 3LWUA 4R7MA 1M44A 1M4IA 1BPNA 3IFEA 2ZEFA 1FT7A 2NMTA 5JGFA 2AFZA 2PJBA 2B4BA 2ZW5A 4OC2A 2XEFA 3T05A 2JEVA 3D66A 1NXJA 4TJVA 2NYQA 4BMHA 1FY7A 4CAXA 2YJTA 5K8NA 2JDCA 3EZEA 3TYXA 4MJXA 2AE6A 4C9AA 2PJ3A 2CXAA 2R7HA 3B7IA 1JDBC 1BLLE 5EC4A 1IB1E 4EFDA 2QYVA 4UWIA 3G3SA 5KTCA 4GM5A 4PXCA 4X3RA 3RO0A 4MCSA 2AUMA 4CO9A 2ZEHA 2MP0A 1AUGA 1KZFA 1XFOA 2R1IA 5DS0A 1XF8A 5EBVA 3C8OA 1XIXA 4AVCA 3FECA 3UY5A 1KWMA 1LRZA 1AYEA 2AFMA 2V8GA 2YJVA 1XRYA 3H4QA 5CBMA 3SJEA 4B11A 2EZBA 2FL4A 3D7FA 5HH1A 3IJ3A 1IOIA 2V8VA 3BLNA 1QSOA 2PJ5A 3D7HA 4ZX9A 3S6FA 4A2ZA 2PJ6A 1LAMA 1DE4C 2G3AA 5F46A 7CPAA 1LANA 1KUXA 5IX3A 4NFRA 2OZHA 3FF3A 3D2MA 4RS2A 1PCAA 4OMEA 2AFWA 2GANA 4PSXA 1QSNA 1NSLA 1IY7A 2RC4A 2D0PA 4FD5A 3EZAA 4E2AA 4KOSA 3B2YA 2AFOA 4BBHA 2BSWA 1LOKA 3NFZA 1S60A 4ZY2A 2AUNA 1WK4A 4PSWA 4RUHA 2QECA 4MJ8A 1QQ9A 2AFUA 2F7VA 2ZEEA 5ELYA 4CAVA 4CS0B 4KUBA 5KTAA 4X8IA 3B3TA 1Y7RA 4YFJA 1TXRA 3ICUA 1CX8A 5AG7A 2B58A 3VWEA 1JQGA 3SR3A 1HDQA 4KUAA 2BO9A 1MK4A 3FEDA 4UEZA 1TF8A 3WC6A 3GJZA 3MGDA 3FNCA 1XMTA 2NSMA 3JRUA 2G0BA 1JWQA 2B5GB 2C6PA 3KGQA 5H84A 4A31A 2C6GA 4L8AA 4MHZA 3T07A 4CGPA 2HI6A 2X7BA 2I79A 4KSAA 3NH4A 3E0KA 4UFXA 1ZLHA 2G3TA 3DSBA 3EFAA 4M6IA 4XPDB 2I00A 4CYQA 4ZI6A 4E0AA 4CYPA 2IJZA 3RBUA 1Z8XA 5K8OA 2PR8A 3KR4A 1XEBA 2XEJA 4AG7A 3F5BA 4UBRA 2ZEOA 1Q2YA 1IICA 5KTDA 3PP9A 5F5XA 2WUUA 4W9YA 1MJ9A 2CF4A 2JBJA 2GP4A 5K8PA 2X0SA 2CTCA 3CPXA 4UFVA 1N71A 2O28A 1T36B 4P4EA 3EXNA 4P4FA 4UA3A 5GCNA 2J8RA 2D0OA 3TLYA 1ZO0A 2PJCA 1RXTA 1V6CA 2P6GA 3P2HA 4AVBA 1FNOA 1YVKA 3FEEA 4MI4A 4A95A 1U6MA 2BUEA 3KRVA 1Z8WA 3KHXA 3T0TA 4AVAA 5ISVA 4H2KA 4C7IA 2HC9A 1Z8TA 4YN3A 4GXHA 3BJ7A 3W91A 4TNUA 4DJLA 2Q7SA 3I1UA 4OC5A 3EC4A 4NCZA 5CPAA 4II9A 5JYBA 4I49A 4KVXA 3QB8A 3H8GA 3TC8A 5EMIA 3H8EA 3JUWA 1VBHA 1YR0A 4UCPA 4U5YA 1JDEA 1Y7EA 2PRBA 4YRHA 3R9GA 1I1DA 3CT9A 4NSQA 4C9RA 2FVGA 5LRKA 2ZELA 4ONWA 4R76A 2P6EA 4C8UA 1RO5A 2C6CA 1PYTB 1R57A 1YMEA 4KVOE 3D7GA 2IQ6A 4K30A 3OWCA 2VBQA 1UFHA 2BEIA 2ZEPA 1VI4A 1C3OB 1ZLIA 3PB7X 1GYTA 4UCMA 4AXVA 4CGOA 1ELLP 1YREA 2EUIA 5HVFA 2EWBA 3CZXA 1B87A 2YNCA 4B5PA 4YWYA 4M6GA 4ZX8A 3TOAA 4IK2A 2Q44A 3FRMA 1ZYMA 2Q43A 3LD2A 3TLCA 4MHNA 2Z0ZA 2Q4VA 1WWZA 4A32A 4Z65A 5HMNA 3I74A 5G22A 1GGOA 4P44A 1QMUA 2YNEA 1CP6A 4MCRA 2BOAA 4KVME 2GREA 1YSJA 4CRYB 5JH9A 4UFWA 4H89A 1OZPA 1TKHA 2DXQA 4OKOA 3PB8X 1Z2LA 4EMEA 4ONUA 3NH5A 2Z3MA 1BOBA 3V7ZA 2DIKA 2FIAA 2PQ8A 2ATRA 3KI9A 4KLWA 4A38A 1R3NA 3GLJA 2Z3OA 4X5KA 1Y9ZA 3L2NA 2PJ7A 2PJ1A 3D3SA 1A2ZA 3D8PA 4MRIA 4WWVA 4NEXA 2ODFA 3WT4A 1DIKA 2REFA 2CNTA 3DLJA 2Y0MA 4M8DA 3RAMA 3NE8A 4ZY0A 3RNZA 4PK3A 3IU2A 4PK2A 3I6SA 5LRGA 2OZGA 4K3NA 2YNCC 2PVWA 3KL9A 1X12A 1CM0A 2A4NA 2ZPAA 5G1ZA 4A37A 4C8CA 4OC1A 1VKCA 3KQXA 5H86A 5I4MA 1ZL0A 3R9FA 4C85A 2Z3LA 1R61A 5G20A 2I3CA 4FUUA 4OADA 4ZBGA 4JLYA 5JVLA 1CBXA 4UEEA 3FYNA 1IOFA 1NMTA 2H5MA 3U1BA 2ZEMA 2Q4ZA 4M3SA 1Z4EA 2PIZA 3T5MA 2ARHA 2DPSA 4RI1A 4Y49C 4JWPA 4Q7AA 4R3LA 2B3UA 2PJ4A 3KKWA 3K4IA 3SXOA 1IIDA 1EE3P 5LYDA 1TIQA 3PB9X 4COBA 3IU1A 1H8LA 1KUYA 3W6SA 3HLPA 4PV6A 3FBUA 2HWGA 2QJ8A 5AG6A 4C8FA 1DTDA 1NE9A 5J1QA 5THWA 4TWEA 3LMSA 1BAVA 3QNVA 1M1DA 4CAFA 3VATA 4CDJA 1Y9KA 3W6XA 2ZOFA 2Q7BA 5JQ4A 2HQYA 1MJAA 2QMLA 2F5IA 3IWEA 3TLZA 4KOYA 1QSMA 2V77A 2PDOA 2YNDA 1K4JA 3VWDA 4A39A 4UEFA 1ZG8A 2Q04A 4KZTA 4OP4A 3BXMA 3KQZA 5LYFA 1VGYA 1Y0RA 4CYNA 4F9UA 1VHSA 3ZJ0A 3H5ZA 4COGA 4LX9A 3V8IA 3WABA 2Z3KA 3KR5A 4KSFA 4UF4A 4KOVA 4O23A 4E94A 1XF1A 3IEHA 1VHOA 2JDDA 1ZRSA 3IGRA 4QBJA 2R82A 4C9VA 5D29A 1ARMA 1CE8B 2B3VA 4QUSA 4MI1A 1UWYA 1MJBA 2HV2A 3DNSA 4FD6A 4OC4A 3SI0A 1VBGA 2ABZA 3FH4A 4MFZA 1BPMA 2GE3A 1Q2CA 2FCKA 2FE7A 3IO1A 4JXRA 4NGTA 5DWNA 4C86A 2CNSA 4HNXB 1A9XB 4C8TA 1VIXA 4P45A 2EK8A 3C26A 4IUSA 3SI1A 5IB9A 2PJ0A 2YGWA 4NGNA 1CG2A 5E96A 1CPSA 2G9DA 2GLFA 4OIDA 4C9EA 1P0HA 2DF5A 2ZW7A 4UIAA 2DEAA 2EZAA 1YGHA 4KOWA 2PE3A 2VXKA 3I3GA 3N5FA 3WC5A 8CPAA 4R87A 3PB6X 4FD4A 3PEIA 4X2TA 2Q51A 4HNYB 2ZW6A 2PSWA 4XNHC 2JBKA 1Y9WA 2PJ2A 4M6HA 1C30B 2ZXVA 4MY0A 2JEWA 1Q5XA 1IU8A 3PBEA 5IV0A 5F1YA 3T9YA 4C8PA 2Z3NA 4B5OA 2AJ6A 4MFLA 1YW4A 1NBWA 4KS9A 2C5QA 4J3GA 4UCNA 4MMOA 1M4LA 3NOJA 3QAYA 4C8AA 4MY3A 4MXUA 3S6GA 3SJGA 4EVYA 2GFQA 1S7NA 1IYKA 5G21A 2GIVA 2JLMA 1YX0A 4Q36A 4NGRA 3D7DA 3GKRA 5J8CA 1S5KA 2V8HA 2Z11A 3GUXA 2J8NA 3S6HA 1OBRA 1Z8LA 1Q7LA 3CPAA 2CY2A 3B8GA 2OLSA 2CIJA 4AG9A 4F6AA 4MHDA 1X10A 4ZY1A 4CGNA 3D2PA 4F0YA 1LAPA 3EY5A 4PQAA 4U9ZA 1CPXA 4CAWA 3TX8A 4DUKA 2VZZA 1ARLA 2GLJA 4BD9A 1XOVA 4P4JA 5K8MA 4J0NA 3LACA 5C88A 3PGPA 5IB0A 2EZCA 4HKFA 2VI7A 3A9LA 3F8KA 4C7HA 2FIWA 4A33A 1QSTA 4XPKA 1M4GA 1XE4A 2C27A 1S3ZA 1J4JA 3KASA 1F57A 4PPZA 4IHMA 4ORFA 5D8NA 4CAEA 6CPAA 5K99A 1KC7A 2OZUA 4NGPA 4BINA 2QVPA 4B6ZA 1ELMP 2Z10A 3F0AA 4U9YA 4INJA 3RYOA 2P6FA 2RB7A 2PJAA 1SQHA 4P6YA 1M4DA 1EZBA 1EZAA 3BHXA 4XNHB 4MCPA 2ZEDA 2BCOA 4A30A 3B3VA 1WVMA 3IIBA 4MFPA 3SI2A 5HVGA 2IMOA 4IAVA 3IWWA 4R57A 1XBUA 4JD6A 3TFYA 2EBJA 5LYLA 3TE4A 3TLGB 4JJXA 4KORA 2ZW4A 4C9UA 2DPTA 3JTKA 4MHPA 4UWJA 2WPWA 2IL4A 2O53A 4CGMA 4CGLA 1PUAA 3TLGA 2V8DA 3B3CA 4P4IA 4C68A 4JXQA 2C1CA 4C2XA 3EIFA 2EO8A 4H6ZA 4OAEA 4NJRA 5AGEA 4JVOA 3R9EA 1XJOA 3V38A 3TTHA 3G23A 3K9UA 3P2FA 3DR6A 3ISZA 3TLBA 3CDXA 4H6UA 4MFKA 4KOUA 4YGOA 1KUVA 2XEIA 1BO4A 4KNGE 2B4DB 4NGQA 2RFHA 3NH8A 3R1KA 4OC0A 4HPSA 5J8FA 4IIYA 4EYSA 4P10A 3FXTA 2CNMA 4B14A 2FM4A 3GIUA 2B4DA 2FS5A 2B0AA 1HEEA 5AG5A 5I0CA 3H8FA 4YU9A 3TLEA 2VZYA 2VL1A 3IWGA 2PJ9A 3KHZA 4LQ6A 4NF1A 3HUVA 4PXEA 4UIBA 5F48A 3S9MA 2D4PA 2PVVA 4LQGA 4FAIA 4CDKA 4NGMA 5A28A 1QSRA 4P4BA 1KBLA 4OLLA 4QB9A 4NGSA 4NXYA 2ANPA 2VEZA 3VARA 1TKJA 2GU2A 2PJ8A 3PZJA 1RTQA 2OH1A 4MFJA 4C2ZA 3TLAA 2OU2A 3FX6A 2FSRA 1PU9A 2E28A 4G1PA 4Q38A 2WYRA 3ISXA 2FXFA 1YLOA 1F2PA 2Q0YA 3FB3A 1IYLA 3VH9A 4PXBA 4PXDA 3GB0A 2FT0A 2WPXA 4DNCA 4HNWB 5LRJA 3SXNA 5HVHA 2J8MA 2O4HA 4B12A 4Y49B 1M6VB 4RN7A 3PB4X 5CNPA 4H1HA 1F2OA 1CJWA 4MCQA 4DYOA 4WJBA 4F0XA 1YW6A 4R6TA 5F9MA 2D4OA 1YK3A 2ZENA 1Z4RA 1GHEA 3NA6A 4M85A 1TKFA 1I21A 2OR4A 3TO6A 4L89A 3GYAA 4ZYQA 2EVNA 2HROA 3G8WA 3R96A 1P4NA 1TF9A 2BL1A 3QAHA 4MHYA 3ZZIA 3DGVA 5FD8A 1KEEB 2Z3PA 2PR1A 4NJQA 3CXSA 1LFWA 2HB6A 2HUZA 1CS0B 2PCNA 4OC3A 1S7FA 4MFQA 1L0CA 1BXRB 4IIXA 3MRUA 4XPDC 1Z5RA 4C2YA 1HDUA 3BJ8A 5F47A 3DR8A 1LCPA 3PFEA 3DDDA 3GY9A 2QIRA 4CPAA 1VHEA 4GS4A 4R3KA 1CP7A 3SJFA 2REEA 3B35A 5FVJA 2PC1A 3D67A 4A94A 4C99A 3PBBA 3TT2A 1XMBA 1Y0YA 3VTAA 5JPHA 3S6KA 3N7ZA 4P4DA 3I9SA 1S7LA 3RZAA 5JM6A 4B10A 4FBEA 2KCWA 4E8OA 5AG4A 1S7KA 3TO9A 2P0WA 1ON0A 2XEGA 4KOXA 4XPLA 2CTBA 2B5GA 3KZWA 2R98A 3FVLA 3TOBA 2R8VA 4F8ZA 3PRTA 4F9VA 4JZ0A 4EWTA 5A27A 4C84A 3B3SA 2ZEGA 5C82A 3IC1A 2PIYA 3D68A 4OIWA 2Q4YA 1V0CA 3FJUA 3FIXA 3MN8A 4KOTA 1NSAA 2WSAA 4R8FA 5DWMA 3R95A 3K9TA 3FMCA 1IGBA 3WR7A 4LUAA 3EO4A 1YLEA
chains in the Genus database with same CATH topology
3T8WA 4JYWA 1AMPA 3SJXA 5LYIA 2OOTA 3BI0A 2PRQA 3S9LA 5HXDA 2F8HA 5IR2A 2AFSA 2WZNA 1R43A 2PCUA 3D4UA 1ZG9A 2POKA 3PFOA 3K2KA 2AFXA 3B3WA 3S9NA 2EK9A 2ZOGA 3WC7A 1ZG7A 4KSIA 4TJXA 2J9AA 5F09A 4FWUA 3BI1A 3LWUA 4R7MA 1BPNA 3IFEA 2ZEFA 1FT7A 5JGFA 2AFZA 2PJBA 4OC2A 2XEFA 3D66A 4TJVA 2NYQA 5K8NA 4C9AA 2PJ3A 3B7IA 1BLLE 4EFDA 2QYVA 4GM5A 4PXCA 4X3RA 4MCSA 2ZEHA 1XFOA 5DS0A 3FECA 1KWMA 2AFMA 1AYEA 2V8GA 1XRYA 5CBMA 3SJEA 3D7FA 3IJ3A 2V8VA 2PJ5A 3D7HA 4ZX9A 2PJ6A 1LAMA 1DE4C 7CPAA 1LANA 4NFRA 3FF3A 1PCAA 4OMEA 2AFWA 1IY7A 3B2YA 2AFOA 1LOKA 3NFZA 4ZY2A 4RUHA 1QQ9A 2AFUA 2F7VA 2ZEEA 5ELYA 4X8IA 3B3TA 3ICUA 1TXRA 1CX8A 1JQGA 1HDQA 2BO9A 4UEZA 3FEDA 1TF8A 3WC6A 3JRUA 2NSMA 2C6PA 3KGQA 2C6GA 4MHZA 3NH4A 1ZLHA 4ZI6A 2IJZA 3RBUA 5K8OA 3KR4A 2XEJA 2ZEOA 4W9YA 2CF4A 2JBJA 2GP4A 5K8PA 3CPXA 2CTCA 4P4EA 4P4FA 2PJCA 1V6CA 1FNOA 3FEEA 3KHXA 4H2KA 2HC9A 4YN3A 4TNUA 4DJLA 3I1UA 4OC5A 5CPAA 3H8GA 3TC8A 3H8EA 1Y7EA 3CT9A 4C9RA 2FVGA 5LRKA 2ZELA 4ONWA 4R76A 4C8UA 2C6CA 1PYTB 1YMEA 3D7GA 2IQ6A 2ZEPA 1ZLIA 3PB7X 1GYTA 4AXVA 1ELLP 5HVFA 2EWBA 4YWYA 4ZX8A 4IK2A 2Q43A 4MHNA 4Z65A 3I74A 4P44A 1QMUA 1CP6A 4MCRA 2BOAA 2GREA 1YSJA 5JH9A 1TKHA 4OKOA 3PB8X 1Z2LA 4EMEA 3NH5A 3V7ZA 3KI9A 4A38A 1R3NA 3GLJA 1Y9ZA 3L2NA 2PJ7A 2PJ1A 4MRIA 4WWVA 3WT4A 3DLJA 3RAMA 4ZY0A 3I6SA 5LRGA 4K3NA 2PVWA 3KL9A 4A37A 4C8CA 4OC1A 3KQXA 5I4MA 4C85A 2I3CA 4FUUA 1CBXA 4UEEA 2ZEMA 2Q4ZA 2PIZA 4Q7AA 2PJ4A 1EE3P 5LYDA 3PB9X 1H8LA 3HLPA 2QJ8A 4C8FA 1DTDA 5J1QA 5THWA 4TWEA 3LMSA 1BAVA 3QNVA 3VATA 4CDJA 2ZOFA 2V77A 4A39A 4UEFA 1ZG8A 4OP4A 3BXMA 3KQZA 5LYFA 1VGYA 1Y0RA 4F9UA 3WABA 3KR5A 4UF4A 4O23A 1XF1A 3IEHA 1VHOA 4C9VA 5D29A 1ARMA 1UWYA 4OC4A 3SI0A 2ABZA 3FH4A 1BPMA 3IO1A 4C86A 4NGTA 4C8TA 1VIXA 4P45A 2EK8A 3SI1A 5IB9A 2PJ0A 4NGNA 1CG2A 1CPSA 2G9DA 2GLFA 4OIDA 4C9EA 4UIAA 2DEAA 2PE3A 3N5FA 3WC5A 8CPAA 3PB6X 3PEIA 4X2TA 2Q51A 2JBKA 2PJ2A 2JEWA 3PBEA 4C8PA 1YW4A 2C5QA 4MMOA 1M4LA 4C8AA 4MXUA 3SJGA 4NGRA 3D7DA 2V8HA 3GUXA 1OBRA 1Z8LA 1Q7LA 3CPAA 2CIJA 4ZY1A 1LAPA 4PQAA 1CPXA 3TX8A 4DUKA 1ARLA 2GLJA 4BD9A 4P4JA 5K8MA 3KASA 1F57A 4PPZA 4IHMA 5D8NA 6CPAA 4NGPA 2QVPA 4B6ZA 1ELMP 2RB7A 2PJAA 4P6YA 3BHXA 4MCPA 2ZEDA 2BCOA 1WVMA 3B3VA 3IIBA 3SI2A 5HVGA 2IMOA 4IAVA 3IWWA 1XBUA 5LYLA 4C9UA 4MHPA 2O53A 2V8DA 3B3CA 4P4IA 2C1CA 3EIFA 4NJRA 1XJOA 3V38A 3ISZA 3CDXA 2XEIA 4KNGE 4NGQA 2RFHA 3NH8A 4OC0A 4P10A 1HEEA 3H8FA 4YU9A 2VL1A 2PJ9A 3KHZA 4UIBA 4PXEA 3HUVA 3S9MA 4CDKA 2PVVA 4LQGA 4FAIA 4NGMA 4P4BA 4NGSA 2ANPA 3VARA 1TKJA 2GU2A 2PJ8A 1RTQA 3FX6A 4G1PA 2WYRA 3ISXA 1YLOA 1F2PA 3VH9A 4PXBA 4PXDA 3GB0A 5LRJA 5HVHA 2O4HA 3PB4X 1F2OA 4MCQA 4DYOA 4WJBA 1YW6A 4R6TA 2ZENA 3NA6A 1TKFA 2OR4A 4ZYQA 1TF9A 4MHYA 3DGVA 4NJQA 1LFWA 2HB6A 4OC3A 3MRUA 1Z5RA 1HDUA 1LCPA 3PFEA 4CPAA 1VHEA 1CP7A 3SJFA 3B35A 3D67A 4A94A 4C99A 3PBBA 1XMBA 1Y0YA 3VTAA 4P4DA 3RZAA 5JM6A 4FBEA 2XEGA 2CTBA 3KZWA 3FVLA 4F8ZA 4F9VA 3PRTA 4JZ0A 4EWTA 4C84A 3B3SA 2ZEGA 3IC1A 2PIYA 3D68A 4OIWA 3FJUA 3MN8A 4R8FA 1NSAA 3K9TA 3FMCA 1IGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T8W A;  4JYW A;  1AMP A;  3SJX A;  5LYI A;  2OOT A;  3BI0 A;  2PRQ A;  3S9L A;  5HXD A;  2F8H A;  2AFS A;  2WZN A;  1R43 A;  2PCU A;  3D4U A;  1ZG9 A;  2POK A;  3PFO A;  3K2K A;  2AFX A;  3B3W A;  3S9N A;  2EK9 A;  2ZOG A;  3WC7 A;  1ZG7 A;  4KSI A;  4TJX A;  2J9A A;  5F09 A;  4FWU A;  3BI1 A;  3LWU A;  4R7M A;  1BPN A;  3IFE A;  2ZEF A;  1FT7 A;  5JGF A;  2AFZ A;  2PJB A;  4OC2 A;  2XEF A;  3D66 A;  4TJV A;  2NYQ A;  5K8N A;  4C9A A;  2PJ3 A;  3B7I A;  1BLL E;  4EFD A;  2QYV A;  4GM5 A;  4PXC A;  4X3R A;  4MCS A;  2ZEH A;  1XFO A;  5DS0 A;  3FEC A;  1KWM A;  2AFM A;  1AYE A;  2V8G A;  1XRY A;  5CBM A;  3SJE A;  3D7F A;  3IJ3 A;  2V8V A;  2PJ5 A;  3D7H A;  4ZX9 A;  2PJ6 A;  1LAM A;  1DE4 C;  7CPA A;  1LAN A;  4NFR A;  3FF3 A;  1PCA A;  4OME A;  2AFW A;  1IY7 A;  3B2Y A;  2AFO A;  1LOK A;  3NFZ A;  4ZY2 A;  4RUH A;  1QQ9 A;  2AFU A;  2F7V A;  2ZEE A;  5ELY A;  4X8I A;  3B3T A;  3ICU A;  1TXR A;  1CX8 A;  1JQG A;  1HDQ A;  2BO9 A;  4UEZ A;  3FED A;  1TF8 A;  3WC6 A;  3JRU A;  2NSM A;  2C6P A;  3KGQ A;  2C6G A;  4MHZ A;  3NH4 A;  1ZLH A;  4ZI6 A;  2IJZ A;  3RBU A;  5K8O A;  3KR4 A;  2XEJ A;  2ZEO A;  4W9Y A;  2CF4 A;  2JBJ A;  5K8P A;  3CPX A;  2CTC A;  4P4E A;  4P4F A;  2PJC A;  1V6C A;  1FNO A;  3FEE A;  3KHX A;  4H2K A;  2HC9 A;  4YN3 A;  4TNU A;  4DJL A;  3I1U A;  4OC5 A;  5CPA A;  3H8G A;  3TC8 A;  3H8E A;  1Y7E A;  3CT9 A;  4C9R A;  2FVG A;  5LRK A;  2ZEL A;  4ONW A;  4R76 A;  4C8U A;  2C6C A;  1PYT B;  1YME A;  3D7G A;  2IQ6 A;  2ZEP A;  1ZLI A;  3PB7 X;  1GYT A;  4AXV A;  1ELL P;  5HVF A;  2EWB A;  4YWY A;  4ZX8 A;  4IK2 A;  2Q43 A;  4MHN A;  4Z65 A;  3I74 A;  4P44 A;  1QMU A;  1CP6 A;  4MCR A;  2BOA A;  2GRE A;  1YSJ A;  5JH9 A;  1TKH A;  4OKO A;  3PB8 X;  1Z2L A;  4EME A;  3NH5 A;  3V7Z A;  3KI9 A;  4A38 A;  1R3N A;  3GLJ A;  1Y9Z A;  3L2N A;  2PJ7 A;  2PJ1 A;  4MRI A;  4WWV A;  3WT4 A;  3DLJ A;  3RAM A;  4ZY0 A;  3I6S A;  5LRG A;  4K3N A;  2PVW A;  3KL9 A;  4A37 A;  4C8C A;  4OC1 A;  3KQX A;  5I4M A;  4C85 A;  2I3C A;  4FUU A;  1CBX A;  4UEE A;  2ZEM A;  2Q4Z A;  2PIZ A;  4Q7A A;  2PJ4 A;  1EE3 P;  5LYD A;  3PB9 X;  1H8L A;  3HLP A;  2QJ8 A;  4C8F A;  1DTD A;  5J1Q A;  5THW A;  4TWE A;  3LMS A;  1BAV A;  3QNV A;  3VAT A;  4CDJ A;  2ZOF A;  2V77 A;  4A39 A;  4UEF A;  1ZG8 A;  4OP4 A;  3BXM A;  3KQZ A;  5LYF A;  1VGY A;  1Y0R A;  4F9U A;  3WAB A;  3KR5 A;  4UF4 A;  4O23 A;  1XF1 A;  3IEH A;  1VHO A;  4C9V A;  5D29 A;  1ARM A;  1UWY A;  4OC4 A;  3SI0 A;  2ABZ A;  3FH4 A;  1BPM A;  3IO1 A;  4C86 A;  4NGT A;  4C8T A;  1VIX A;  4P45 A;  2EK8 A;  3SI1 A;  5IB9 A;  2PJ0 A;  4NGN A;  1CG2 A;  1CPS A;  2G9D A;  2GLF A;  4OID A;  4C9E A;  4UIA A;  2DEA A;  2PE3 A;  3N5F A;  3WC5 A;  8CPA A;  3PB6 X;  3PEI A;  4X2T A;  2Q51 A;  2JBK A;  2PJ2 A;  2JEW A;  3PBE A;  4C8P A;  1YW4 A;  4MMO A;  1M4L A;  4C8A A;  4MXU A;  3SJG A;  4NGR A;  3D7D A;  2V8H A;  3GUX A;  1OBR A;  1Z8L A;  1Q7L A;  3CPA A;  2CIJ A;  4ZY1 A;  1LAP A;  4PQA A;  1CPX A;  3TX8 A;  4DUK A;  1ARL A;  2GLJ A;  4BD9 A;  4P4J A;  5K8M A;  3KAS A;  1F57 A;  4PPZ A;  4IHM A;  5D8N A;  6CPA A;  4NGP A;  2QVP A;  4B6Z A;  1ELM P;  2RB7 A;  2PJA A;  4P6Y A;  3BHX A;  4MCP A;  2ZED A;  2BCO A;  1WVM A;  3B3V A;  3IIB A;  3SI2 A;  5HVG A;  2IMO A;  4IAV A;  3IWW A;  1XBU A;  5LYL A;  4C9U A;  4MHP A;  2O53 A;  2V8D A;  3B3C A;  4P4I A;  2C1C A;  3EIF A;  4NJR A;  1XJO A;  3V38 A;  3ISZ A;  3CDX A;  2XEI A;  4KNG E;  4NGQ A;  2RFH A;  3NH8 A;  4OC0 A;  4P10 A;  1HEE A;  3H8F A;  4YU9 A;  2VL1 A;  2PJ9 A;  3KHZ A;  4UIB A;  4PXE A;  3HUV A;  3S9M A;  4CDK A;  2PVV A;  4LQG A;  4FAI A;  4NGM A;  4P4B A;  4NGS A;  2ANP A;  3VAR A;  1TKJ A;  2GU2 A;  2PJ8 A;  1RTQ A;  3FX6 A;  4G1P A;  2WYR A;  3ISX A;  1YLO A;  1F2P A;  3VH9 A;  4PXB A;  4PXD A;  3GB0 A;  5LRJ A;  5HVH A;  2O4H A;  3PB4 X;  1F2O A;  4MCQ A;  4DYO A;  4WJB A;  1YW6 A;  4R6T A;  2ZEN A;  3NA6 A;  1TKF A;  2OR4 A;  4ZYQ A;  1TF9 A;  4MHY A;  3DGV A;  4NJQ A;  1LFW A;  2HB6 A;  4OC3 A;  3MRU A;  1Z5R A;  1HDU A;  1LCP A;  3PFE A;  4CPA A;  1VHE A;  1CP7 A;  3SJF A;  3B35 A;  3D67 A;  4A94 A;  4C99 A;  3PBB A;  1XMB A;  1Y0Y A;  3VTA A;  4P4D A;  3RZA A;  5JM6 A;  4FBE A;  2XEG A;  2CTB A;  3KZW A;  3FVL A;  4F8Z A;  4F9V A;  3PRT A;  4JZ0 A;  4EWT A;  4C84 A;  3B3S A;  2ZEG A;  3IC1 A;  2PIY A;  3D68 A;  4OIW A;  3FJU A;  3MN8 A;  4R8F A;  1NSA A;  3K9T A;  3FMC A;  1IGB A; 
#chains in the Genus database with same CATH topology
 3T8W A;  4JYW A;  1I12 A;  1AMP A;  3SJX A;  5LYI A;  2OB0 A;  4B13 A;  2OOT A;  4QVT A;  3BI0 A;  2PRQ A;  3S9L A;  4CZ1 A;  3EZB A;  3CXQ A;  5HXD A;  2F8H A;  5IR2 A;  2AFS A;  4B5P B;  4KLV A;  5F49 A;  2WZN A;  1R43 A;  4AB7 A;  1YQE A;  4CRZ B;  4E5S A;  3CXP A;  1Q2D A;  2PCU A;  4IF5 A;  1YVO A;  5BWA B;  4FD7 A;  3D4U A;  1ZG9 A;  2POK A;  3PFO A;  3K2K A;  2AFX A;  3JVN A;  3B3W A;  3NE7 A;  4QC6 A;  4R9M A;  2EK9 A;  1Z9U A;  3T90 A;  3TO7 A;  1B6B A;  2VQY A;  3S9N A;  2ZOG A;  4CYO A;  3WC7 A;  1ZG7 A;  4ZGY B;  4KSI A;  4TJX A;  2J9A A;  3LOD A;  5F09 A;  3TCV A;  1J3L A;  4FWU A;  3SHP A;  3BI1 A;  4MBU A;  2K5T A;  3LWU A;  4R7M A;  1M44 A;  1M4I A;  1BPN A;  3IFE A;  2ZEF A;  1FT7 A;  2NMT A;  5JGF A;  2AFZ A;  2PJB A;  2B4B A;  2ZW5 A;  4OC2 A;  2XEF A;  3T05 A;  2JEV A;  3D66 A;  1NXJ A;  4TJV A;  2NYQ A;  4BMH A;  1FY7 A;  4CAX A;  2YJT A;  5K8N A;  2JDC A;  3EZE A;  3TYX A;  4MJX A;  2AE6 A;  4C9A A;  2PJ3 A;  2CXA A;  2R7H A;  3B7I A;  1JDB C;  1BLL E;  5EC4 A;  1IB1 E;  4EFD A;  2QYV A;  4UWI A;  3G3S A;  5KTC A;  4GM5 A;  4PXC A;  4X3R A;  3RO0 A;  4MCS A;  2AUM A;  4CO9 A;  2ZEH A;  2MP0 A;  1AUG A;  1KZF A;  1XFO A;  2R1I A;  5DS0 A;  1XF8 A;  5EBV A;  3C8O A;  1XIX A;  4AVC A;  3FEC A;  3UY5 A;  1KWM A;  1LRZ A;  1AYE A;  2AFM A;  2V8G A;  2YJV A;  1XRY A;  3H4Q A;  5CBM A;  3SJE A;  4B11 A;  2EZB A;  2FL4 A;  3D7F A;  5HH1 A;  3IJ3 A;  1IOI A;  2V8V A;  3BLN A;  1QSO A;  2PJ5 A;  3D7H A;  4ZX9 A;  3S6F A;  4A2Z A;  2PJ6 A;  1LAM A;  1DE4 C;  2G3A A;  5F46 A;  7CPA A;  1LAN A;  1KUX A;  5IX3 A;  4NFR A;  2OZH A;  3FF3 A;  3D2M A;  4RS2 A;  1PCA A;  4OME A;  2AFW A;  2GAN A;  4PSX A;  1QSN A;  1NSL A;  1IY7 A;  2RC4 A;  2D0P A;  4FD5 A;  3EZA A;  4E2A A;  4KOS A;  3B2Y A;  2AFO A;  4BBH A;  2BSW A;  1LOK A;  3NFZ A;  1S60 A;  4ZY2 A;  2AUN A;  1WK4 A;  4PSW A;  4RUH A;  2QEC A;  4MJ8 A;  1QQ9 A;  2AFU A;  2F7V A;  2ZEE A;  5ELY A;  4CAV A;  4CS0 B;  4KUB A;  5KTA A;  4X8I A;  3B3T A;  1Y7R A;  4YFJ A;  1TXR A;  3ICU A;  1CX8 A;  5AG7 A;  2B58 A;  3VWE A;  1JQG A;  3SR3 A;  1HDQ A;  4KUA A;  2BO9 A;  1MK4 A;  3FED A;  4UEZ A;  1TF8 A;  3WC6 A;  3GJZ A;  3MGD A;  3FNC A;  1XMT A;  2NSM A;  3JRU A;  2G0B A;  1JWQ A;  2B5G B;  2C6P A;  3KGQ A;  5H84 A;  4A31 A;  2C6G A;  4L8A A;  4MHZ A;  3T07 A;  4CGP A;  2HI6 A;  2X7B A;  2I79 A;  4KSA A;  3NH4 A;  3E0K A;  4UFX A;  1ZLH A;  2G3T A;  3DSB A;  3EFA A;  4M6I A;  4XPD B;  2I00 A;  4CYQ A;  4ZI6 A;  4E0A A;  4CYP A;  2IJZ A;  3RBU A;  1Z8X A;  5K8O A;  2PR8 A;  3KR4 A;  1XEB A;  2XEJ A;  4AG7 A;  3F5B A;  4UBR A;  2ZEO A;  1Q2Y A;  1IIC A;  5KTD A;  3PP9 A;  5F5X A;  2WUU A;  4W9Y A;  1MJ9 A;  2CF4 A;  2JBJ A;  2GP4 A;  5K8P A;  2X0S A;  2CTC A;  3CPX A;  4UFV A;  1N71 A;  2O28 A;  1T36 B;  4P4E A;  3EXN A;  4P4F A;  4UA3 A;  5GCN A;  2J8R A;  2D0O A;  3TLY A;  1ZO0 A;  2PJC A;  1RXT A;  1V6C A;  2P6G A;  3P2H A;  4AVB A;  1FNO A;  1YVK A;  3FEE A;  4MI4 A;  4A95 A;  1U6M A;  2BUE A;  3KRV A;  1Z8W A;  3KHX A;  3T0T A;  4AVA A;  5ISV A;  4H2K A;  4C7I A;  2HC9 A;  1Z8T A;  4YN3 A;  4GXH A;  3BJ7 A;  3W91 A;  4TNU A;  4DJL A;  2Q7S A;  3I1U A;  4OC5 A;  3EC4 A;  4NCZ A;  5CPA A;  4II9 A;  5JYB A;  4I49 A;  4KVX A;  3QB8 A;  3H8G A;  3TC8 A;  5EMI A;  3H8E A;  3JUW A;  1VBH A;  1YR0 A;  4UCP A;  4U5Y A;  1JDE A;  1Y7E A;  2PRB A;  4YRH A;  3R9G A;  1I1D A;  3CT9 A;  4NSQ A;  4C9R A;  2FVG A;  5LRK A;  2ZEL A;  4ONW A;  4R76 A;  2P6E A;  4C8U A;  1RO5 A;  2C6C A;  1PYT B;  1R57 A;  1YME A;  4KVO E;  3D7G A;  2IQ6 A;  4K30 A;  3OWC A;  2VBQ A;  1UFH A;  2BEI A;  2ZEP A;  1VI4 A;  1C3O B;  1ZLI A;  3PB7 X;  1GYT A;  4UCM A;  4AXV A;  4CGO A;  1ELL P;  1YRE A;  2EUI A;  5HVF A;  2EWB A;  3CZX A;  1B87 A;  2YNC A;  4B5P A;  4YWY A;  4M6G A;  4ZX8 A;  3TOA A;  4IK2 A;  2Q44 A;  3FRM A;  1ZYM A;  2Q43 A;  3LD2 A;  3TLC A;  4MHN A;  2Z0Z A;  2Q4V A;  1WWZ A;  4A32 A;  4Z65 A;  5HMN A;  3I74 A;  5G22 A;  1GGO A;  4P44 A;  1QMU A;  2YNE A;  1CP6 A;  4MCR A;  2BOA A;  4KVM E;  2GRE A;  1YSJ A;  4CRY B;  5JH9 A;  4UFW A;  4H89 A;  1OZP A;  1TKH A;  2DXQ A;  4OKO A;  3PB8 X;  1Z2L A;  4EME A;  4ONU A;  3NH5 A;  2Z3M A;  1BOB A;  3V7Z A;  2DIK A;  2FIA A;  2PQ8 A;  2ATR A;  3KI9 A;  4KLW A;  4A38 A;  1R3N A;  3GLJ A;  2Z3O A;  4X5K A;  1Y9Z A;  3L2N A;  2PJ7 A;  2PJ1 A;  3D3S A;  1A2Z A;  3D8P A;  4MRI A;  4WWV A;  4NEX A;  2ODF A;  3WT4 A;  1DIK A;  2REF A;  2CNT A;  3DLJ A;  2Y0M A;  4M8D A;  3RAM A;  3NE8 A;  4ZY0 A;  3RNZ A;  4PK3 A;  3IU2 A;  4PK2 A;  3I6S A;  5LRG A;  2OZG A;  4K3N A;  2YNC C;  2PVW A;  3KL9 A;  1X12 A;  1CM0 A;  2A4N A;  2ZPA A;  5G1Z A;  4A37 A;  4C8C A;  4OC1 A;  1VKC A;  3KQX A;  5H86 A;  5I4M A;  1ZL0 A;  3R9F A;  4C85 A;  2Z3L A;  1R61 A;  5G20 A;  2I3C A;  4FUU A;  4OAD A;  4ZBG A;  4JLY A;  5JVL A;  1CBX A;  4UEE A;  3FYN A;  1IOF A;  1NMT A;  2H5M A;  3U1B A;  2ZEM A;  2Q4Z A;  4M3S A;  1Z4E A;  2PIZ A;  3T5M A;  2ARH A;  2DPS A;  4RI1 A;  4Y49 C;  4JWP A;  4Q7A A;  4R3L A;  2B3U A;  2PJ4 A;  3KKW A;  3K4I A;  3SXO A;  1IID A;  1EE3 P;  5LYD A;  1TIQ A;  3PB9 X;  4COB A;  3IU1 A;  1H8L A;  1KUY A;  3W6S A;  3HLP A;  4PV6 A;  3FBU A;  2HWG A;  2QJ8 A;  5AG6 A;  4C8F A;  1DTD A;  1NE9 A;  5J1Q A;  5THW A;  4TWE A;  3LMS A;  1BAV A;  3QNV A;  1M1D A;  4CAF A;  3VAT A;  4CDJ A;  1Y9K A;  3W6X A;  2ZOF A;  2Q7B A;  5JQ4 A;  2HQY A;  1MJA A;  2QML A;  2F5I A;  3IWE A;  3TLZ A;  4KOY A;  1QSM A;  2V77 A;  2PDO A;  2YND A;  1K4J A;  3VWD A;  4A39 A;  4UEF A;  1ZG8 A;  2Q04 A;  4KZT A;  4OP4 A;  3BXM A;  3KQZ A;  5LYF A;  1VGY A;  1Y0R A;  4CYN A;  4F9U A;  1VHS A;  3ZJ0 A;  3H5Z A;  4COG A;  4LX9 A;  3V8I A;  3WAB A;  2Z3K A;  3KR5 A;  4KSF A;  4UF4 A;  4KOV A;  4O23 A;  4E94 A;  1XF1 A;  3IEH A;  1VHO A;  2JDD A;  1ZRS A;  3IGR A;  4QBJ A;  2R82 A;  4C9V A;  5D29 A;  1ARM A;  1CE8 B;  2B3V A;  4QUS A;  4MI1 A;  1UWY A;  1MJB A;  2HV2 A;  3DNS A;  4FD6 A;  4OC4 A;  3SI0 A;  1VBG A;  2ABZ A;  3FH4 A;  4MFZ A;  1BPM A;  2GE3 A;  1Q2C A;  2FCK A;  2FE7 A;  3IO1 A;  4JXR A;  4NGT A;  5DWN A;  4C86 A;  2CNS A;  4HNX B;  1A9X B;  4C8T A;  1VIX A;  4P45 A;  2EK8 A;  3C26 A;  4IUS A;  3SI1 A;  5IB9 A;  2PJ0 A;  2YGW A;  4NGN A;  1CG2 A;  5E96 A;  1CPS A;  2G9D A;  2GLF A;  4OID A;  4C9E A;  1P0H A;  2DF5 A;  2ZW7 A;  4UIA A;  2DEA A;  2EZA A;  1YGH A;  4KOW A;  2PE3 A;  2VXK A;  3I3G A;  3N5F A;  3WC5 A;  8CPA A;  4R87 A;  3PB6 X;  4FD4 A;  3PEI A;  4X2T A;  2Q51 A;  4HNY B;  2ZW6 A;  2PSW A;  4XNH C;  2JBK A;  1Y9W A;  2PJ2 A;  4M6H A;  1C30 B;  2ZXV A;  4MY0 A;  2JEW A;  1Q5X A;  1IU8 A;  3PBE A;  5IV0 A;  5F1Y A;  3T9Y A;  4C8P A;  2Z3N A;  4B5O A;  2AJ6 A;  4MFL A;  1YW4 A;  1NBW A;  4KS9 A;  2C5Q A;  4J3G A;  4UCN A;  4MMO A;  1M4L A;  3NOJ A;  3QAY A;  4C8A A;  4MY3 A;  4MXU A;  3S6G A;  3SJG A;  4EVY A;  2GFQ A;  1S7N A;  1IYK A;  5G21 A;  2GIV A;  2JLM A;  1YX0 A;  4Q36 A;  4NGR A;  3D7D A;  3GKR A;  5J8C A;  1S5K A;  2V8H A;  2Z11 A;  3GUX A;  2J8N A;  3S6H A;  1OBR A;  1Z8L A;  1Q7L A;  3CPA A;  2CY2 A;  3B8G A;  2OLS A;  2CIJ A;  4AG9 A;  4F6A A;  4MHD A;  1X10 A;  4ZY1 A;  4CGN A;  3D2P A;  4F0Y A;  1LAP A;  3EY5 A;  4PQA A;  4U9Z A;  1CPX A;  4CAW A;  3TX8 A;  4DUK A;  2VZZ A;  1ARL A;  2GLJ A;  4BD9 A;  1XOV A;  4P4J A;  5K8M A;  4J0N A;  3LAC A;  5C88 A;  3PGP A;  5IB0 A;  2EZC A;  4HKF A;  2VI7 A;  3A9L A;  3F8K A;  4C7H A;  2FIW A;  4A33 A;  1QST A;  4XPK A;  1M4G A;  1XE4 A;  2C27 A;  1S3Z A;  1J4J A;  3KAS A;  1F57 A;  4PPZ A;  4IHM A;  4ORF A;  5D8N A;  4CAE A;  6CPA A;  5K99 A;  1KC7 A;  2OZU A;  4NGP A;  4BIN A;  2QVP A;  4B6Z A;  1ELM P;  2Z10 A;  3F0A A;  4U9Y A;  4INJ A;  3RYO A;  2P6F A;  2RB7 A;  2PJA A;  1SQH A;  4P6Y A;  1M4D A;  1EZB A;  1EZA A;  3BHX A;  4XNH B;  4MCP A;  2ZED A;  2BCO A;  4A30 A;  3B3V A;  1WVM A;  3IIB A;  4MFP A;  3SI2 A;  5HVG A;  2IMO A;  4IAV A;  3IWW A;  4R57 A;  1XBU A;  4JD6 A;  3TFY A;  2EBJ A;  5LYL A;  3TE4 A;  3TLG B;  4JJX A;  4KOR A;  2ZW4 A;  4C9U A;  2DPT A;  3JTK A;  4MHP A;  4UWJ A;  2WPW A;  2IL4 A;  2O53 A;  4CGM A;  4CGL A;  1PUA A;  3TLG A;  2V8D A;  3B3C A;  4P4I A;  4C68 A;  4JXQ A;  2C1C A;  4C2X A;  3EIF A;  2EO8 A;  4H6Z A;  4OAE A;  4NJR A;  5AGE A;  4JVO A;  3R9E A;  1XJO A;  3V38 A;  3TTH A;  3G23 A;  3K9U A;  3P2F A;  3DR6 A;  3ISZ A;  3TLB A;  3CDX A;  4H6U A;  4MFK A;  4KOU A;  4YGO A;  1KUV A;  2XEI A;  1BO4 A;  4KNG E;  2B4D B;  4NGQ A;  2RFH A;  3NH8 A;  3R1K A;  4OC0 A;  4HPS A;  5J8F A;  4IIY A;  4EYS A;  4P10 A;  3FXT A;  2CNM A;  4B14 A;  2FM4 A;  3GIU A;  2B4D A;  2FS5 A;  2B0A A;  1HEE A;  5AG5 A;  5I0C A;  3H8F A;  4YU9 A;  3TLE A;  2VZY A;  2VL1 A;  3IWG A;  2PJ9 A;  3KHZ A;  4LQ6 A;  4NF1 A;  3HUV A;  4PXE A;  4UIB A;  5F48 A;  3S9M A;  2D4P A;  2PVV A;  4LQG A;  4FAI A;  4CDK A;  4NGM A;  5A28 A;  1QSR A;  4P4B A;  1KBL A;  4OLL A;  4QB9 A;  4NGS A;  4NXY A;  2ANP A;  2VEZ A;  3VAR A;  1TKJ A;  2GU2 A;  2PJ8 A;  3PZJ A;  1RTQ A;  2OH1 A;  4MFJ A;  4C2Z A;  3TLA A;  2OU2 A;  3FX6 A;  2FSR A;  1PU9 A;  2E28 A;  4G1P A;  4Q38 A;  2WYR A;  3ISX A;  2FXF A;  1YLO A;  1F2P A;  2Q0Y A;  3FB3 A;  1IYL A;  3VH9 A;  4PXB A;  4PXD A;  3GB0 A;  2FT0 A;  2WPX A;  4DNC A;  4HNW B;  5LRJ A;  3SXN A;  5HVH A;  2J8M A;  2O4H A;  4B12 A;  4Y49 B;  1M6V B;  4RN7 A;  3PB4 X;  5CNP A;  4H1H A;  1F2O A;  1CJW A;  4MCQ A;  4DYO A;  4WJB A;  4F0X A;  1YW6 A;  4R6T A;  5F9M A;  2D4O A;  1YK3 A;  2ZEN A;  1Z4R A;  1GHE A;  3NA6 A;  4M85 A;  1TKF A;  1I21 A;  2OR4 A;  3TO6 A;  4L89 A;  3GYA A;  4ZYQ A;  2EVN A;  2HRO A;  3G8W A;  3R96 A;  1P4N A;  1TF9 A;  2BL1 A;  3QAH A;  4MHY A;  3ZZI A;  3DGV A;  5FD8 A;  1KEE B;  2Z3P A;  2PR1 A;  4NJQ A;  3CXS A;  1LFW A;  2HB6 A;  2HUZ A;  1CS0 B;  2PCN A;  4OC3 A;  1S7F A;  4MFQ A;  1L0C A;  1BXR B;  4IIX A;  3MRU A;  4XPD C;  1Z5R A;  4C2Y A;  1HDU A;  3BJ8 A;  5F47 A;  3DR8 A;  1LCP A;  3PFE A;  3DDD A;  3GY9 A;  2QIR A;  4CPA A;  1VHE A;  4GS4 A;  4R3K A;  1CP7 A;  3SJF A;  2REE A;  3B35 A;  5FVJ A;  2PC1 A;  3D67 A;  4A94 A;  4C99 A;  3PBB A;  3TT2 A;  1XMB A;  1Y0Y A;  3VTA A;  5JPH A;  3S6K A;  3N7Z A;  4P4D A;  3I9S A;  1S7L A;  3RZA A;  5JM6 A;  4B10 A;  4FBE A;  2KCW A;  4E8O A;  5AG4 A;  1S7K A;  3TO9 A;  2P0W A;  1ON0 A;  2XEG A;  4KOX A;  4XPL A;  2CTB A;  2B5G A;  3KZW A;  2R98 A;  3FVL A;  3TOB A;  2R8V A;  4F8Z A;  3PRT A;  4F9V A;  4JZ0 A;  4EWT A;  5A27 A;  4C84 A;  3B3S A;  2ZEG A;  5C82 A;  3IC1 A;  2PIY A;  3D68 A;  4OIW A;  2Q4Y A;  1V0C A;  3FJU A;  3FIX A;  3MN8 A;  4KOT A;  1NSA A;  2WSA A;  4R8F A;  5DWM A;  3R95 A;  3K9T A;  3FMC A;  1IGB A;  3WR7 A;  4LUA A;  3EO4 A;  1YLE A; 
#chains in the Genus database with same CATH homology
 3T8W A;  4JYW A;  1AMP A;  3SJX A;  5LYI A;  2OOT A;  3BI0 A;  2PRQ A;  3S9L A;  5HXD A;  2F8H A;  5IR2 A;  2AFS A;  2WZN A;  1R43 A;  2PCU A;  3D4U A;  1ZG9 A;  2POK A;  3PFO A;  3K2K A;  2AFX A;  3B3W A;  3S9N A;  2EK9 A;  2ZOG A;  3WC7 A;  1ZG7 A;  4KSI A;  4TJX A;  2J9A A;  5F09 A;  4FWU A;  3BI1 A;  3LWU A;  4R7M A;  1BPN A;  3IFE A;  2ZEF A;  1FT7 A;  5JGF A;  2AFZ A;  2PJB A;  4OC2 A;  2XEF A;  3D66 A;  4TJV A;  2NYQ A;  5K8N A;  4C9A A;  2PJ3 A;  3B7I A;  1BLL E;  4EFD A;  2QYV A;  4GM5 A;  4PXC A;  4X3R A;  4MCS A;  2ZEH A;  1XFO A;  5DS0 A;  3FEC A;  1KWM A;  2AFM A;  1AYE A;  2V8G A;  1XRY A;  5CBM A;  3SJE A;  3D7F A;  3IJ3 A;  2V8V A;  2PJ5 A;  3D7H A;  4ZX9 A;  2PJ6 A;  1LAM A;  1DE4 C;  7CPA A;  1LAN A;  4NFR A;  3FF3 A;  1PCA A;  4OME A;  2AFW A;  1IY7 A;  3B2Y A;  2AFO A;  1LOK A;  3NFZ A;  4ZY2 A;  4RUH A;  1QQ9 A;  2AFU A;  2F7V A;  2ZEE A;  5ELY A;  4X8I A;  3B3T A;  3ICU A;  1TXR A;  1CX8 A;  1JQG A;  1HDQ A;  2BO9 A;  4UEZ A;  3FED A;  1TF8 A;  3WC6 A;  3JRU A;  2NSM A;  2C6P A;  3KGQ A;  2C6G A;  4MHZ A;  3NH4 A;  1ZLH A;  4ZI6 A;  2IJZ A;  3RBU A;  5K8O A;  3KR4 A;  2XEJ A;  2ZEO A;  4W9Y A;  2CF4 A;  2JBJ A;  2GP4 A;  5K8P A;  3CPX A;  2CTC A;  4P4E A;  4P4F A;  2PJC A;  1V6C A;  1FNO A;  3FEE A;  3KHX A;  4H2K A;  2HC9 A;  4YN3 A;  4TNU A;  4DJL A;  3I1U A;  4OC5 A;  5CPA A;  3H8G A;  3TC8 A;  3H8E A;  1Y7E A;  3CT9 A;  4C9R A;  2FVG A;  5LRK A;  2ZEL A;  4ONW A;  4R76 A;  4C8U A;  2C6C A;  1PYT B;  1YME A;  3D7G A;  2IQ6 A;  2ZEP A;  1ZLI A;  3PB7 X;  1GYT A;  4AXV A;  1ELL P;  5HVF A;  2EWB A;  4YWY A;  4ZX8 A;  4IK2 A;  2Q43 A;  4MHN A;  4Z65 A;  3I74 A;  4P44 A;  1QMU A;  1CP6 A;  4MCR A;  2BOA A;  2GRE A;  1YSJ A;  5JH9 A;  1TKH A;  4OKO A;  3PB8 X;  1Z2L A;  4EME A;  3NH5 A;  3V7Z A;  3KI9 A;  4A38 A;  1R3N A;  3GLJ A;  1Y9Z A;  3L2N A;  2PJ7 A;  2PJ1 A;  4MRI A;  4WWV A;  3WT4 A;  3DLJ A;  3RAM A;  4ZY0 A;  3I6S A;  5LRG A;  4K3N A;  2PVW A;  3KL9 A;  4A37 A;  4C8C A;  4OC1 A;  3KQX A;  5I4M A;  4C85 A;  2I3C A;  4FUU A;  1CBX A;  4UEE A;  2ZEM A;  2Q4Z A;  2PIZ A;  4Q7A A;  2PJ4 A;  1EE3 P;  5LYD A;  3PB9 X;  1H8L A;  3HLP A;  2QJ8 A;  4C8F A;  1DTD A;  5J1Q A;  5THW A;  4TWE A;  3LMS A;  1BAV A;  3QNV A;  3VAT A;  4CDJ A;  2ZOF A;  2V77 A;  4A39 A;  4UEF A;  1ZG8 A;  4OP4 A;  3BXM A;  3KQZ A;  5LYF A;  1VGY A;  1Y0R A;  4F9U A;  3WAB A;  3KR5 A;  4UF4 A;  4O23 A;  1XF1 A;  3IEH A;  1VHO A;  4C9V A;  5D29 A;  1ARM A;  1UWY A;  4OC4 A;  3SI0 A;  2ABZ A;  3FH4 A;  1BPM A;  3IO1 A;  4C86 A;  4NGT A;  4C8T A;  1VIX A;  4P45 A;  2EK8 A;  3SI1 A;  5IB9 A;  2PJ0 A;  4NGN A;  1CG2 A;  1CPS A;  2G9D A;  2GLF A;  4OID A;  4C9E A;  4UIA A;  2DEA A;  2PE3 A;  3N5F A;  3WC5 A;  8CPA A;  3PB6 X;  3PEI A;  4X2T A;  2Q51 A;  2JBK A;  2PJ2 A;  2JEW A;  3PBE A;  4C8P A;  1YW4 A;  2C5Q A;  4MMO A;  1M4L A;  4C8A A;  4MXU A;  3SJG A;  4NGR A;  3D7D A;  2V8H A;  3GUX A;  1OBR A;  1Z8L A;  1Q7L A;  3CPA A;  2CIJ A;  4ZY1 A;  1LAP A;  4PQA A;  1CPX A;  3TX8 A;  4DUK A;  1ARL A;  2GLJ A;  4BD9 A;  4P4J A;  5K8M A;  3KAS A;  1F57 A;  4PPZ A;  4IHM A;  5D8N A;  6CPA A;  4NGP A;  2QVP A;  4B6Z A;  1ELM P;  2RB7 A;  2PJA A;  4P6Y A;  3BHX A;  4MCP A;  2ZED A;  2BCO A;  1WVM A;  3B3V A;  3IIB A;  3SI2 A;  5HVG A;  2IMO A;  4IAV A;  3IWW A;  1XBU A;  5LYL A;  4C9U A;  4MHP A;  2O53 A;  2V8D A;  3B3C A;  4P4I A;  2C1C A;  3EIF A;  4NJR A;  1XJO A;  3V38 A;  3ISZ A;  3CDX A;  2XEI A;  4KNG E;  4NGQ A;  2RFH A;  3NH8 A;  4OC0 A;  4P10 A;  1HEE A;  3H8F A;  4YU9 A;  2VL1 A;  2PJ9 A;  3KHZ A;  4UIB A;  4PXE A;  3HUV A;  3S9M A;  4CDK A;  2PVV A;  4LQG A;  4FAI A;  4NGM A;  4P4B A;  4NGS A;  2ANP A;  3VAR A;  1TKJ A;  2GU2 A;  2PJ8 A;  1RTQ A;  3FX6 A;  4G1P A;  2WYR A;  3ISX A;  1YLO A;  1F2P A;  3VH9 A;  4PXB A;  4PXD A;  3GB0 A;  5LRJ A;  5HVH A;  2O4H A;  3PB4 X;  1F2O A;  4MCQ A;  4DYO A;  4WJB A;  1YW6 A;  4R6T A;  2ZEN A;  3NA6 A;  1TKF A;  2OR4 A;  4ZYQ A;  1TF9 A;  4MHY A;  3DGV A;  4NJQ A;  1LFW A;  2HB6 A;  4OC3 A;  3MRU A;  1Z5R A;  1HDU A;  1LCP A;  3PFE A;  4CPA A;  1VHE A;  1CP7 A;  3SJF A;  3B35 A;  3D67 A;  4A94 A;  4C99 A;  3PBB A;  1XMB A;  1Y0Y A;  3VTA A;  4P4D A;  3RZA A;  5JM6 A;  4FBE A;  2XEG A;  2CTB A;  3KZW A;  3FVL A;  4F8Z A;  4F9V A;  3PRT A;  4JZ0 A;  4EWT A;  4C84 A;  3B3S A;  2ZEG A;  3IC1 A;  2PIY A;  3D68 A;  4OIW A;  3FJU A;  3MN8 A;  4R8F A;  1NSA A;  3K9T A;  3FMC A;  1IGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...