2EK8A

Aminopeptidase from aneurinibacillus sp. strain am-1
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
412
structure length
412
Chain Sequence
b'ADHQITKRTDAENMYNTIQFLSQAPRVAGSPEELKAVRYIEQQFKSYGYHVEVQPFQFEGYTAPSEVTLKIGTEKKEGEAFTYSPNSDVTAELVYVGLGTTADVAGKDLNGKIALIQRGNISFADKVRNAAKQGAKAVIIYNNTDGKLNGTLGGSDASFVAAVGITKQEGDALAANLRAGEKITATVKVAGAEVKTLTSHNVIATKKPDANKKNTNDIIIIGSHHDSVEKAPGANDDASGVAVTLELARVMSKLKTDTELRFITFGAEENGLIGSKKYAASLSEDEIKRTIGMFQLDMVGSKDAGDLIMYTIDGKKNRVTDLGAAASSRLSGVLPYGQEGRSDHESFHALGIPAALFIHAPVEPWYHTPNDTLDKISKEKLDNVADIVGSAVYQAARPGELVIEPIDYPRRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Structural characterization of a novel bacterial aminopeptidase with an apical domain from aneurinibacillus sp. strain AM-1
rcsb
source organism Aneurinibacillus sp.
molecule tags Hydrolase
total genus 142
structure length 412
sequence length 412
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2ek8A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2ek8A02
3B3WA 3D67A 4GM5A 5JH9A 1F2OA 3H8FA 4WWVA 2IMOA 2ANPA 3DLJA 4X8IA 2NSMA 1XFOA 1UWYA 4MHYA 4DJLA 4MCQA 1CX8A 2PJ1A 4C86A 4G1PA 2BCOA 3NH5A 2ZOGA 5HVGA 4FBEA 3FEEA 3TC8A 1YW4A 2PJ9A 2Q4ZA 4R6TA 4DYOA 3WT4A 1JQGA 2DEAA 3WABA 2CTBA 2EK8A 1EE3P 1LAPA 4C8UA 1PCAA 3QNVA 4P4IA 3VARA 1VGYA 3SI2A 1Y0YA 4A37A 2C6GA 3MRUA 4PXEA 2ABZA 1YW6A 3FH4A 3B7IA 4ZX9A 2PE3A 3JRUA 1TXRA 4DUKA 1V6CA 4TJVA 4PQAA 1ZG9A 2V77A 2PJBA 2PJ7A 4UF4A 3VH9A 2XEIA 2AFWA 1DE4C 5LRGA 1LOKA 3KI9A 4UIBA 4OC5A 3FECA 1YMEA 3S9MA 4EFDA 1CP7A 2F8HA 3ISZA 2PVVA 4NJQA 2GREA 4ONWA 4MHPA 2RFHA 1WVMA 3WC6A 2C6CA 4FAIA 2F7VA 4C9EA 5LYLA 5JGFA 5K8MA 1VHEA 4C9RA 5K8OA 1Z2LA 4C99A 2I3CA 3ICUA 3HLPA 1QMUA 3I6SA 3SJEA 4NGPA 2Q51A 4YU9A 3BI1A 1AYEA 2HB6A 2GLJA 3D68A 2O53A 4OIWA 4IAVA 3SJXA 1TF9A 3VATA 4A39A 4C8PA 4YN3A 4UEFA 4ZY2A 3D7DA 2PJ3A 4MHNA 1KWMA 8CPAA 2J9AA 3RZAA 1TF8A 3PEIA 1TKJA 4RUHA 4C85A 1OBRA 4P10A 5J1QA 2OOTA 1LCPA 1YLOA 1TKFA 3SI1A 1BPMA 3PB9X 1R43A 2OR4A 2ZEEA 4F8ZA 4MCRA 2ZEDA 4X3RA 4P4EA 5D29A 4ZI6A 3ISXA 4OC4A 2XEGA 1CP6A 3KQZA 3SI0A 1LAMA 3B2YA 3B3TA 4TNUA 2Q43A 2PIZA 1F2PA 2CTCA 3V7ZA 2JBJA 2ZEPA 1FT7A 3NH4A 2PJAA 3BI0A 4OC0A 3PB6X 4OP4A 2AFZA 3L2NA 2PJ0A 3KGQA 1HEEA 1VHOA 5K8NA 2AFSA 4NGNA 1GYTA 2BOAA 2PIYA 5F09A 3S9LA 3PB8X 3MN8A 1ZG8A 2FVGA 3IO1A 1HDUA 1XBUA 5CPAA 5HVFA 1ZLHA 3GUXA 4OMEA 4X2TA 3IEHA 1CG2A 2ZELA 2C6PA 4MHZA 1AMPA 3RBUA 4NFRA 4O23A 4OC3A 3PBBA 2VL1A 4C9VA 4WJBA 2AFXA 5LYIA 4IHMA 4LQGA 4ZY0A 4NGQA 1XJOA 1IGBA 1BLLE 1TKHA 4A94A 2ZENA 4UEZA 4NGRA 3KASA 1BAVA 3EIFA 4PXBA 2ZOFA 4NJRA 4KSIA 2ZEFA 1M4LA 5LYFA 2ZEGA 1VIXA 1NSAA 3CPAA 4A38A 2PJ5A 5LRJA 1ELMP 3B35A 3TX8A 4ZYQA 4IK2A 4OIDA 4CDKA 4PXCA 4K3NA 3GLJA 1XF1A 5IB9A 3N5FA 1Z5RA 2PJ6A 3RAMA 2AFOA 3IWWA 5LYDA 3KL9A 2PJ8A 5HVHA 1Z8LA 1QQ9A 5THWA 2QJ8A 3FEDA 4NGTA 1H8LA 4C8CA 4P4JA 2XEFA 2CIJA 2AFMA 3LWUA 1DTDA 3BXMA 2ZEOA 3IIBA 3D66A 3D4UA 3VTAA 3NH8A 4OC2A 2XEJA 1CPSA 4NGMA 3B3CA 3D7HA 1Y7EA 5DS0A 2JBKA 4W9YA 3PFEA 4F9UA 2PCUA 1PYTB 2GU2A 3FX6A 4ZX8A 4P4BA 4BD9A 2PJCA 1BPNA 3K9TA 2EWBA 4C9AA 4C8TA 5CBMA 2IJZA 2QYVA 5JM6A 4OKOA 3B3SA 2IQ6A 2GLFA 4FWUA 4P4DA 1ARMA 1IY7A 4H2KA 4C8AA 1ZLIA 3GB0A 3PB7X 4TWEA 2JEWA 3KR5A 3KZWA 1LFWA 2AFUA 3IFEA 3WC7A 3KHZA 2QVPA 1LANA 1Y9ZA 4JZ0A 3KHXA 4F9VA 3BHXA 4B6ZA 4CDJA 2V8VA 3V38A 3I74A 4UEEA 2PVWA 3CDXA 1ZG7A 1CBXA 1F57A 2V8HA 4TJXA 1R3NA 3D7FA 4ZY1A 3CPXA 2WYRA 4MXUA 3FMCA 4C9UA 3KQXA 3PFOA 4JYWA 2V8GA 3FF3A 4NGSA 3PBEA 3SJFA 4YWYA 4KNGE 5K8PA 4Q7AA 2ZEHA 2NYQA 4AXVA 3D7GA 5D8NA 4R76A 2V8DA 4MMOA 4MCSA 5HXDA 4R7MA 5LRKA 4EWTA 3LMSA 4EMEA 7CPAA 3WC5A 1XMBA 4R8FA 2PJ4A 1XRYA 3B3VA 4P6YA 2POKA 4PXDA 3FVLA 2O4HA 1ELLP 5I4MA 2HC9A 2PJ2A 3FJUA 2PRQA 1ARLA 4C8FA 1CPXA 4Z65A 4PPZA 4P4FA 1Y0RA 2BO9A 4OC1A 3CT9A 3IJ3A 3PRTA 3K2KA 4P44A 3T8WA 4FUUA 3SJGA 3HUVA 2C1CA 1RTQA 3NFZA 1Q7LA 1HDQA 1FNOA 3I1UA 4C84A 2EK9A 3PB4X 3KR4A 4MCPA 1YSJA 4UIAA 3IC1A 2RB7A 2CF4A 3H8EA 5ELYA 4MRIA 3H8GA 3NA6A 2WZNA 3DGVA 4P45A 4CPAA 6CPAA 2G9DA 3S9NA 2ZEMA
chains in the Genus database with same CATH superfamily
2DXQA 2EO8A 3B3WA 1YGHA 3D67A 4GM5A 2F5IA 3QAHA 4JWPA 1F2OA 1KUXA 3W91A 3WR7A 5JH9A 3TLGB 3H8FA 4KOYA 1GHEA 4WWVA 4OAEA 2IMOA 2PDOA 2ANPA 3DLJA 4X8IA 1C3OB 4XPDB 2NSMA 1XFOA 4PV6A 1UWYA 4HNYB 4MHYA 4II9A 4DJLA 4MCQA 2PCNA 1DIKA 1CX8A 2PJ1A 4C86A 3SXOA 1Y7RA 2FXFA 4G1PA 2BCOA 1GGOA 3NH5A 1Q2YA 1YREA 4CS0B 2RC4A 1ZYMA 2ZOGA 5C82A 2KCWA 2YNCA 5HVGA 2YJTA 3PP9A 5A28A 4FBEA 2JLMA 4RI1A 3JVNA 4ZGYB 4PSXA 4U9YA 1MJBA 3FEEA 3TC8A 1VBGA 3C8OA 1YW4A 2PJ9A 2Q4ZA 3OWCA 2Z10A 2YNCC 3F5BA 2FM4A 5EMIA 1P0HA 2GIVA 3TLYA 4R6TA 2PR8A 3FXTA 4M3SA 3WT4A 4DYOA 5IX3A 4UFVA 2FIWA 1JQGA 2DEAA 3RYOA 5F46A 2X0SA 3T5MA 3WABA 1XMTA 2CTBA 2EK8A 3IWGA 2EVNA 1EE3P 1LAPA 4C8UA 1PCAA 2WUUA 1N71A 5EC4A 3QNVA 3TOBA 1KUYA 4MFQA 4P4IA 2IL4A 2Q4VA 4U5YA 3VARA 3D8PA 2Z3MA 3TLAA 2R8VA 4CGPA 1VGYA 2OH1A 2OZUA 4KOXA 3SI2A 1Y0YA 1S3ZA 4A37A 2C6GA 3MRUA 4PXEA 2ABZA 2AJ6A 1YW6A 2GFQA 3FH4A 2DPSA 1M4GA 2P0WA 3B7IA 4ZX9A 4AVAA 2PE3A 4XNHC 3JRUA 1TXRA 5DWNA 1MJAA 4Q36A 1EZBA 4AVBA 4DUKA 1V6CA 4F0XA 4TJVA 4PQAA 1ZG9A 2HQYA 4H89A 4ORFA 1J4JA 2FIAA 2P6FA 2V77A 3JTKA 5E96A 2AUMA 2PJBA 2PJ7A 4UF4A 3EZEA 3BJ7A 3VH9A 2XEIA 2AFWA 2X7BA 3G8WA 1DE4C 4CYOA 4KOSA 5LRGA 1LOKA 3KI9A 4ZBGA 4UIBA 5BWAB 5JPHA 2I79A 3D3SA 3R9FA 4OC5A 3FECA 1YMEA 2Z3NA 3S9MA 1CP7A 1S7KA 2F8HA 1PUAA 4EFDA 1SQHA 5AG7A 3GYAA 3ISZA 2PVVA 4NJQA 2B3VA 2GREA 2QMLA 1XE4A 4ONWA 4CAEA 3VWDA 4MHPA 2RFHA 1WVMA 4PSWA 5J8CA 4R57A 5FD8A 1CM0A 3WC6A 2C6CA 3TYXA 4FAIA 2F7VA 4C9EA 2PQ8A 2OZHA 1M4IA 5LYLA 2EZCA 5JGFA 1A9XB 2JEVA 5K8MA 1VHEA 4C9RA 5K8OA 3EY5A 1Z4RA 1Z2LA 3TLGA 2YNEA 2I3CA 5C88A 4UBRA 4C99A 1TIQA 3ICUA 3HLPA 1QMUA 1AUGA 5J8FA 3I6SA 3SJEA 4CAWA 3P2HA 1LRZA 4CGMA 2OU2A 4NGPA 1Y9KA 1BOBA 2REFA 2Q51A 4YU9A 3BI1A 3ZJ0A 2PR1A 1AYEA 2HB6A 5I0CA 4I49A 3EFAA 2Z3KA 2GLJA 3D68A 4UFXA 4B10A 2B4BA 2HUZA 2O53A 3A9LA 2VXKA 4IAVA 4OIWA 3SJXA 1TF9A 4J0NA 1VBHA 3GKRA 4A33A 3VATA 4A39A 3S6HA 4C8PA 4YN3A 5IV0A 4FD6A 4UEFA 4KSFA 3CXSA 4ZY2A 4HPSA 3T0TA 4FD4A 5HH1A 3DDDA 3G3SA 3D7DA 4CGLA 4E8OA 2PJ3A 4MHNA 1KWMA 3UY5A 8CPAA 4MJXA 3SR3A 2J9AA 3RZAA 2B5GB 1TF8A 1BO4A 3PEIA 1MJ9A 3FB3A 1TKJA 1IIDA 4NSQA 4RUHA 1OBRA 1XOVA 2P6GA 4KVOE 4P10A 1Q2DA 2OOTA 5J1QA 5AGEA 2R1IA 1LCPA 4UCPA 4YRHA 1IYKA 4B13A 1YLOA 4MI4A 4QUSA 1TKFA 2CNSA 4BBHA 3SI1A 1BPMA 4KLVA 3JUWA 1R43A 3PB9X 4HKFA 4AVCA 3DR8A 2G3TA 2OR4A 4KUBA 4MFZA 1YR0A 3P2FA 2ZEEA 4F8ZA 2VZZA 4MCRA 4UCNA 2ZEDA 2G0BA 1NE9A 4X3RA 4P4EA 5D29A 2B0AA 3TLEA 3U1BA 4ZI6A 4IF5A 2FCKA 3ISXA 1IU8A 4OC4A 3TTHA 4F0YA 1Z8WA 1V0CA 5JQ4A 1QSRA 2XEGA 1CP6A 3KQZA 3RNZA 3SI0A 1LAMA 3B2YA 3GY9A 3B3TA 1A2ZA 4TNUA 3W6XA 3R96A 2Q43A 4UWJA 2PIZA 1F2PA 2CTCA 3S6GA 3S6KA 1CS0B 2NMTA 2G3AA 3V7ZA 2JBJA 2ZEPA 1FT7A 3NH4A 4KOUA 5F49A 2PJAA 2VEZA 3BI0A 5IR2A 4OC0A 3PB6X 1I12A 4OP4A 2AFZA 2Z0ZA 3L2NA 1NMTA 2PJ0A 4QVTA 4UCMA 3KGQA 1HEEA 1VHOA 4RN7A 4CGNA 5K8NA 2AFSA 4JXQA 3R1KA 4NGNA 3TOAA 1GYTA 2A4NA 2B4DB 2BOAA 5IB0A 2GE3A 4DNCA 1RXTA 2PIYA 4CYPA 5F09A 3S9LA 3K4IA 4E5SA 3PB8X 4MFJA 3MN8A 5G1ZA 3H5ZA 1ZRSA 4JVOA 1T36B 1ZG8A 2FVGA 4A32A 2FSRA 3IO1A 1HDUA 4C68A 1XBUA 5CPAA 5HVFA 1ZLHA 2H5MA 3GUXA 4OMEA 4X2TA 3IEHA 1CG2A 5H84A 1Q5XA 2ZELA 4COBA 2C6PA 4MHZA 2ODFA 2VBQA 4LX9A 1M6VB 1AMPA 3RBUA 4KUAA 4M8DA 1M1DA 3I9SA 4NFRA 4O23A 1YX0A 3PBBA 3FBUA 4OC3A 1NSLA 4A31A 4GXHA 4C7HA 1YK3A 4JLYA 4MFKA 4MFPA 3TO6A 4NXYA 4Y49B 2VL1A 4L8AA 4C9VA 4WJBA 2AFXA 5LYIA 2HI6A 4IHMA 1S5KA 1S60A 5DWMA 3IGRA 2B5GA 4LQGA 4ZY0A 5AG4A 4IIXA 4F6AA 4NGQA 1S7LA 1XJOA 1YLEA 4EVYA 1IGBA 4IUSA 3TLBA 3TT2A 1BLLE 2R98A 1TKHA 3EXNA 4CYQA 2D0OA 3FYNA 1Z8TA 4YGOA 3F0AA 4A94A 4CO9A 2YNDA 3C26A 2ZXVA 4FD5A 2ZENA 5G21A 4UEZA 2DPTA 4NGRA 1YVKA 3KASA 4HNXB 3G23A 3FIXA 4XPLA 1BAVA 1Z9UA 2ZW4A 4XPKA 2Z3PA 4PXBA 3EIFA 2ZOFA 3GIUA 4NJRA 4KSIA 1B87A 2ZEFA 1M4LA 1KUVA 3EO4A 5LYFA 2K5TA 2JDDA 2J8RA 1VIXA 2ZEGA 3SXNA 4C2YA 1NSAA 3CPAA 4A38A 2PJ5A 4XPDC 3RO0A 4INJA 5LRJA 2FL4A 1ELMP 2CXAA 1ON0A 2BSWA 1VHSA 1OZPA 3B35A 4OLLA 5KTDA 3FNCA 4ONUA 5F9MA 5F47A 3TX8A 3EZAA 3MGDA 4ZYQA 3TFYA 4AG9A 3I3GA 4IK2A 4OIDA 4R3KA 3ZZIA 4CDKA 5GCNA 4C2ZA 4PXCA 4K3NA 2CNTA 3GLJA 2CNMA 2Q04A 4QBJA 1XF1A 2Q7BA 5IB9A 3N5FA 1Z5RA 3SHPA 2HV2A 4CAFA 2PJ6A 4BINA 2EZBA 2HWGA 1IB1E 3RAMA 2AFOA 2O28A 3IWWA 4OADA 5LYDA 3R9EA 2Q4YA 1RO5A 4KOTA 3KL9A 2B4DA 4E0AA 2PJ8A 4XNHB 5HVHA 1Z8LA 2PC1A 1QQ9A 1QSOA 2REEA 1U6MA 4MFLA 5THWA 2QJ8A 5HMNA 4L89A 2C5QA 3FEDA 4NGTA 5H86A 1H8LA 4UWIA 1KZFA 2Q44A 3QAYA 2XEFA 3LACA 4P4JA 2CIJA 2AFMA 2ZW5A 2FE7A 3LWUA 2BL1A 3E0KA 5F5XA 2ZW7A 2DF5A 1DTDA 1XF8A 3BXMA 4AB7A 2ZEOA 3IIBA 2QIRA 4NCZA 1MK4A 3D66A 3D4UA 4H6ZA 3VTAA 3NH8A 4OC2A 1J3LA 4KVXA 4NEXA 4C7IA 4M85A 1KEEB 2XEJA 2PRBA 1CPSA 4U9ZA 4NGMA 3B3CA 1I21A 2ATRA 2BUEA 2Z11A 3D7HA 1Y7EA 1JDBC 1JDEA 4MY3A 5DS0A 2CY2A 2JBKA 1XEBA 4KOVA 4W9YA 4Y49C 3PFEA 4F9UA 4EYSA 1Z4EA 2PCUA 5KTCA 4KLWA 1PYTB 2GU2A 3NE7A 2YGWA 3FX6A 2OZGA 3N7ZA 4CAVA 2VQYA 4ZX8A 4GS4A 1KBLA 1QSNA 5AG5A 4MJ8A 4P4BA 4BD9A 1WK4A 2PJCA 1BPNA 3K9TA 4Q38A 2EWBA 3CXQA 4C9AA 4C8TA 2J8NA 2IJZA 5CBMA 2OLSA 2QYVA 4PK2A 1YVOA 3T90A 5JM6A 4PK3A 3F8KA 2J8MA 4OKOA 3B3SA 1CJWA 2IQ6A 2AE6A 4IIYA 2GLFA 1KC7A 4FWUA 4P4DA 3R9GA 2Z3LA 1L0CA 2WSAA 3V8IA 4E2AA 1B6BA 2BEIA 1ARMA 1IY7A 4H2KA 4JD6A 5AG6A 1ZLIA 3R95A 4C8AA 4X5KA 3GB0A 3TCVA 3PB7X 1X10A 4TWEA 4KORA 4CYNA 4COGA 1IOIA 2JEWA 3KR5A 3KZWA 4JXRA 3BLNA 4MI1A 3DNSA 1LFWA 1FY7A 2AFUA 2Z3OA 2OB0A 3IFEA 4MY0A 3WC7A 2P6EA 3KHZA 3K9UA 2Y0MA 2AUNA 1LANA 2QVPA 2VI7A 4JZ0A 5F48A 1Y9ZA 3KHXA 4F9VA 3BHXA 3PZJA 3TE4A 1R61A 4B6ZA 5JVLA 4CDJA 2V8VA 4UFWA 4KZTA 4M6HA 1M4DA 2Q0YA 3V38A 4UEEA 4B5OA 3I74A 2B3UA 4KVME 3CXPA 1XIXA 3NE8A 4KS9A 2PVWA 3CDXA 1ZG7A 1EZAA 4FD7A 1CBXA 1F57A 1Q2CA 2DIKA 2FT0A 5FVJA 3EC4A 2V8HA 2WPXA 2Q7SA 3TO9A 2GP4A 4TJXA 1R3NA 3D7FA 4ZY1A 3CPXA 1QSTA 2WYRA 4MXUA 4MHDA 3FMCA 3KKWA 4B11A 1BXRB 1NBWA 4B12A 3KRVA 4C9UA 3KQXA 1Y9WA 3PFOA 4JYWA 4RS2A 4B5PB 2V8GA 2ARHA 3FF3A 4CAXA 4CRYB 4NGSA 2HROA 3PBEA 3SJFA 4YWYA 4KNGE 3H4QA 5K8PA 4QC6A 4Q7AA 1ZL0A 5CNPA 2VZYA 2ZEHA 2GANA 2D4OA 2NYQA 4AXVA 1PU9A 4A30A 3D7GA 2ZPAA 5D8NA 4R76A 2V8DA 4MBUA 5G20A 4MMOA 4MCSA 3EZBA 2EBJA 4CGOA 1IOFA 5HXDA 4R7MA 5LRKA 4EWTA 3LMSA 4EMEA 7CPAA 3WC5A 5A27A 4R9MA 4YFJA 5F1YA 1XMBA 4R8FA 2PJ4A 1XRYA 3B3VA 4P6YA 4BMHA 2POKA 4PXDA 3FVLA 4A2ZA 2R7HA 2O4HA 3S6FA 1ELLP 5I4MA 4A95A 4C8CA 3LD2A 1JWQA 2E28A 4C85A 4C2XA 1VKCA 2HC9A 3TO7A 2PJ2A 4CRZB 3FJUA 2D0PA 1QSMA 3T9YA 1UFHA 3IU1A 2PRQA 3LODA 4J3GA 2R82A 2EUIA 1ARLA 3QB8A 5EBVA 4AG7A 3IWEA 1X12A 1CPXA 2EZAA 4C8FA 1S7FA 4UA3A 4Z65A 4HNWB 1C30B 3T05A 3NOJA 4PPZA 4P4FA 4CZ1A 2ZW6A 1Y0RA 2I00A 2BO9A 4E94A 3FRMA 1I1DA 4OC1A 4LUAA 4JJXA 3CT9A 3IJ3A 2JDCA 3PRTA 4KSAA 2YJVA 3IU2A 3PGPA 2B58A 3K2KA 2PSWA 1K4JA 4FUUA 4K30A 4P44A 3T8WA 3DR6A 3SJGA 4H1HA 3HUVA 4M6GA 5JYBA 3TLZA 2C1CA 2WPWA 1RTQA 2D4PA 1YQEA 3BJ8A 3NFZA 5K99A 1S7NA 1Q7LA 1HDQA 1P4NA 1FNOA 3GJZA 2C27A 3CZXA 3B8GA 3I1UA 1IICA 3DSBA 5G22A 4B14A 4C84A 2EK9A 3PB4X 3KR4A 4MCPA 1NXJA 3D2MA 4KOWA 1CE8B 1YSJA 4UIAA 3IC1A 2RB7A 4M6IA 5ISVA 1IYLA 2CF4A 3H8EA 1R57A 2FS5A 4H6UA 3H8GA 3NA6A 4MRIA 5ELYA 3VWEA 2WZNA 3DGVA 4P45A 1WWZA 3T07A 1M44A 3TLCA 4QB9A 4CPAA 6CPAA 1VI4A 2MP0A 1ZO0A 2G9DA 2QECA 3D2PA 4R3LA 1Z8XA 3W6SA 4B5PA 5KTAA 3S9NA 4NF1A 2ZEMA 4R87A 4LQ6A
chains in the Genus database with same CATH topology
3B3WA 3D67A 4GM5A 5JH9A 1F2OA 3H8FA 4WWVA 2IMOA 2ANPA 3DLJA 4X8IA 2NSMA 1XFOA 1UWYA 4MHYA 4DJLA 4MCQA 1CX8A 2PJ1A 4C86A 4G1PA 2BCOA 3NH5A 2ZOGA 5HVGA 4FBEA 3FEEA 3TC8A 1YW4A 2PJ9A 2Q4ZA 4R6TA 4DYOA 3WT4A 1JQGA 2DEAA 3WABA 2CTBA 2EK8A 1EE3P 1LAPA 4C8UA 1PCAA 3QNVA 4P4IA 3VARA 1VGYA 3SI2A 1Y0YA 4A37A 2C6GA 3MRUA 4PXEA 2ABZA 1YW6A 3FH4A 3B7IA 4ZX9A 2PE3A 3JRUA 1TXRA 4DUKA 1V6CA 4TJVA 4PQAA 1ZG9A 2V77A 2PJBA 2PJ7A 4UF4A 3VH9A 2XEIA 2AFWA 1DE4C 5LRGA 1LOKA 3KI9A 4UIBA 4OC5A 3FECA 1YMEA 3S9MA 4EFDA 1CP7A 2F8HA 3ISZA 2PVVA 4NJQA 2GREA 4ONWA 4MHPA 2RFHA 1WVMA 3WC6A 2C6CA 4FAIA 2F7VA 4C9EA 5LYLA 5JGFA 5K8MA 1VHEA 4C9RA 5K8OA 1Z2LA 4C99A 2I3CA 3ICUA 3HLPA 1QMUA 3I6SA 3SJEA 4NGPA 2Q51A 4YU9A 3BI1A 1AYEA 2HB6A 2GLJA 3D68A 2O53A 4OIWA 4IAVA 3SJXA 1TF9A 3VATA 4A39A 4C8PA 4YN3A 4UEFA 4ZY2A 3D7DA 2PJ3A 4MHNA 1KWMA 8CPAA 2J9AA 3RZAA 1TF8A 3PEIA 1TKJA 4RUHA 4C85A 1OBRA 4P10A 5J1QA 2OOTA 1LCPA 1YLOA 1TKFA 3SI1A 1BPMA 3PB9X 1R43A 2OR4A 2ZEEA 4F8ZA 4MCRA 2ZEDA 4X3RA 4P4EA 5D29A 4ZI6A 3ISXA 4OC4A 2XEGA 1CP6A 3KQZA 3SI0A 1LAMA 3B2YA 3B3TA 4TNUA 2Q43A 2PIZA 1F2PA 2CTCA 3V7ZA 2JBJA 2ZEPA 1FT7A 3NH4A 2PJAA 5IR2A 3BI0A 4OC0A 3PB6X 4OP4A 2AFZA 3L2NA 2PJ0A 3KGQA 1HEEA 1VHOA 5K8NA 2AFSA 4NGNA 1GYTA 2BOAA 2PIYA 5F09A 3S9LA 3PB8X 3MN8A 1ZG8A 2FVGA 3IO1A 1HDUA 1XBUA 5CPAA 5HVFA 1ZLHA 3GUXA 4OMEA 4X2TA 3IEHA 1CG2A 2ZELA 2C6PA 4MHZA 1AMPA 3RBUA 4NFRA 4O23A 4OC3A 3PBBA 2VL1A 4C9VA 4WJBA 2AFXA 5LYIA 4IHMA 4LQGA 4ZY0A 4NGQA 1XJOA 1IGBA 1BLLE 1TKHA 4A94A 2ZENA 4UEZA 4NGRA 3KASA 1BAVA 3EIFA 4PXBA 2ZOFA 4NJRA 4KSIA 2ZEFA 1M4LA 5LYFA 2ZEGA 1VIXA 1NSAA 3CPAA 4A38A 2PJ5A 5LRJA 1ELMP 3B35A 3TX8A 4ZYQA 4IK2A 4OIDA 4CDKA 4PXCA 4K3NA 3GLJA 1XF1A 5IB9A 3N5FA 1Z5RA 2PJ6A 3RAMA 2AFOA 3IWWA 5LYDA 3KL9A 2PJ8A 5HVHA 1Z8LA 1QQ9A 5THWA 2C5QA 2QJ8A 3FEDA 4NGTA 1H8LA 4C8CA 4P4JA 2XEFA 2CIJA 2AFMA 3LWUA 1DTDA 3BXMA 2ZEOA 3IIBA 3D66A 3D4UA 3VTAA 3NH8A 4OC2A 2XEJA 1CPSA 4NGMA 3B3CA 3D7HA 1Y7EA 5DS0A 2JBKA 4W9YA 3PFEA 4F9UA 2PCUA 1PYTB 2GU2A 3FX6A 4ZX8A 4P4BA 4BD9A 2PJCA 1BPNA 3K9TA 2EWBA 4C9AA 4C8TA 5CBMA 2IJZA 2QYVA 5JM6A 4OKOA 3B3SA 2IQ6A 2GLFA 4FWUA 4P4DA 1ARMA 1IY7A 4H2KA 4C8AA 1ZLIA 3GB0A 3PB7X 4TWEA 2JEWA 3KR5A 3KZWA 1LFWA 2AFUA 3IFEA 3WC7A 3KHZA 2QVPA 1LANA 1Y9ZA 4JZ0A 3KHXA 4F9VA 3BHXA 4B6ZA 4CDJA 2V8VA 3V38A 3I74A 4UEEA 2PVWA 3CDXA 1ZG7A 1CBXA 1F57A 2V8HA 2GP4A 4TJXA 1R3NA 3D7FA 4ZY1A 3CPXA 2WYRA 4MXUA 3FMCA 4C9UA 3KQXA 3PFOA 4JYWA 2V8GA 3FF3A 4NGSA 3PBEA 3SJFA 4YWYA 4KNGE 5K8PA 4Q7AA 2ZEHA 2NYQA 4AXVA 3D7GA 5D8NA 4R76A 2V8DA 4MMOA 4MCSA 5HXDA 4R7MA 5LRKA 4EWTA 3LMSA 4EMEA 7CPAA 3WC5A 1XMBA 4R8FA 2PJ4A 1XRYA 3B3VA 4P6YA 2POKA 4PXDA 3FVLA 2O4HA 1ELLP 5I4MA 2HC9A 2PJ2A 3FJUA 2PRQA 1ARLA 4C8FA 1CPXA 4Z65A 4PPZA 4P4FA 1Y0RA 2BO9A 4OC1A 3CT9A 3IJ3A 3PRTA 3K2KA 4P44A 3T8WA 4FUUA 3SJGA 3HUVA 2C1CA 1RTQA 3NFZA 1Q7LA 1HDQA 1FNOA 3I1UA 4C84A 2EK9A 3PB4X 3KR4A 4MCPA 1YSJA 4UIAA 3IC1A 2RB7A 2CF4A 3H8EA 5ELYA 4MRIA 3H8GA 3NA6A 2WZNA 3DGVA 4P45A 4CPAA 6CPAA 2G9DA 3S9NA 2ZEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B3W A;  3D67 A;  4GM5 A;  5JH9 A;  1F2O A;  3H8F A;  4WWV A;  2IMO A;  2ANP A;  3DLJ A;  4X8I A;  2NSM A;  1XFO A;  1UWY A;  4MHY A;  4DJL A;  4MCQ A;  1CX8 A;  2PJ1 A;  4C86 A;  4G1P A;  2BCO A;  3NH5 A;  2ZOG A;  5HVG A;  4FBE A;  3FEE A;  3TC8 A;  1YW4 A;  2PJ9 A;  2Q4Z A;  4R6T A;  4DYO A;  3WT4 A;  1JQG A;  2DEA A;  3WAB A;  2CTB A;  2EK8 A;  1EE3 P;  1LAP A;  4C8U A;  1PCA A;  3QNV A;  4P4I A;  3VAR A;  1VGY A;  3SI2 A;  1Y0Y A;  4A37 A;  2C6G A;  3MRU A;  4PXE A;  2ABZ A;  1YW6 A;  3FH4 A;  3B7I A;  4ZX9 A;  2PE3 A;  3JRU A;  1TXR A;  4DUK A;  1V6C A;  4TJV A;  4PQA A;  1ZG9 A;  2V77 A;  2PJB A;  2PJ7 A;  4UF4 A;  3VH9 A;  2XEI A;  2AFW A;  1DE4 C;  5LRG A;  1LOK A;  3KI9 A;  4UIB A;  4OC5 A;  3FEC A;  1YME A;  3S9M A;  4EFD A;  1CP7 A;  2F8H A;  3ISZ A;  2PVV A;  4NJQ A;  2GRE A;  4ONW A;  4MHP A;  2RFH A;  1WVM A;  3WC6 A;  2C6C A;  4FAI A;  2F7V A;  4C9E A;  5LYL A;  5JGF A;  5K8M A;  1VHE A;  4C9R A;  5K8O A;  1Z2L A;  4C99 A;  2I3C A;  3ICU A;  3HLP A;  1QMU A;  3I6S A;  3SJE A;  4NGP A;  2Q51 A;  4YU9 A;  3BI1 A;  1AYE A;  2HB6 A;  2GLJ A;  3D68 A;  2O53 A;  4OIW A;  4IAV A;  3SJX A;  1TF9 A;  3VAT A;  4A39 A;  4C8P A;  4YN3 A;  4UEF A;  4ZY2 A;  3D7D A;  2PJ3 A;  4MHN A;  1KWM A;  8CPA A;  2J9A A;  3RZA A;  1TF8 A;  3PEI A;  1TKJ A;  4RUH A;  4C85 A;  1OBR A;  4P10 A;  5J1Q A;  2OOT A;  1LCP A;  1YLO A;  1TKF A;  3SI1 A;  1BPM A;  3PB9 X;  1R43 A;  2OR4 A;  2ZEE A;  4F8Z A;  4MCR A;  2ZED A;  4X3R A;  4P4E A;  5D29 A;  4ZI6 A;  3ISX A;  4OC4 A;  2XEG A;  1CP6 A;  3KQZ A;  3SI0 A;  1LAM A;  3B2Y A;  3B3T A;  4TNU A;  2Q43 A;  2PIZ A;  1F2P A;  2CTC A;  3V7Z A;  2JBJ A;  2ZEP A;  1FT7 A;  3NH4 A;  2PJA A;  3BI0 A;  4OC0 A;  3PB6 X;  4OP4 A;  2AFZ A;  3L2N A;  2PJ0 A;  3KGQ A;  1HEE A;  1VHO A;  5K8N A;  2AFS A;  4NGN A;  1GYT A;  2BOA A;  2PIY A;  5F09 A;  3S9L A;  3PB8 X;  3MN8 A;  1ZG8 A;  2FVG A;  3IO1 A;  1HDU A;  1XBU A;  5CPA A;  5HVF A;  1ZLH A;  3GUX A;  4OME A;  4X2T A;  3IEH A;  1CG2 A;  2ZEL A;  2C6P A;  4MHZ A;  1AMP A;  3RBU A;  4NFR A;  4O23 A;  4OC3 A;  3PBB A;  2VL1 A;  4C9V A;  4WJB A;  2AFX A;  5LYI A;  4IHM A;  4LQG A;  4ZY0 A;  4NGQ A;  1XJO A;  1IGB A;  1BLL E;  1TKH A;  4A94 A;  2ZEN A;  4UEZ A;  4NGR A;  3KAS A;  1BAV A;  3EIF A;  4PXB A;  2ZOF A;  4NJR A;  4KSI A;  2ZEF A;  1M4L A;  5LYF A;  2ZEG A;  1VIX A;  1NSA A;  3CPA A;  4A38 A;  2PJ5 A;  5LRJ A;  1ELM P;  3B35 A;  3TX8 A;  4ZYQ A;  4IK2 A;  4OID A;  4CDK A;  4PXC A;  4K3N A;  3GLJ A;  1XF1 A;  5IB9 A;  3N5F A;  1Z5R A;  2PJ6 A;  3RAM A;  2AFO A;  3IWW A;  5LYD A;  3KL9 A;  2PJ8 A;  5HVH A;  1Z8L A;  1QQ9 A;  5THW A;  2QJ8 A;  3FED A;  4NGT A;  1H8L A;  4C8C A;  4P4J A;  2XEF A;  2CIJ A;  2AFM A;  3LWU A;  1DTD A;  3BXM A;  2ZEO A;  3IIB A;  3D66 A;  3D4U A;  3VTA A;  3NH8 A;  4OC2 A;  2XEJ A;  1CPS A;  4NGM A;  3B3C A;  3D7H A;  1Y7E A;  5DS0 A;  2JBK A;  4W9Y A;  3PFE A;  4F9U A;  2PCU A;  1PYT B;  2GU2 A;  3FX6 A;  4ZX8 A;  4P4B A;  4BD9 A;  2PJC A;  1BPN A;  3K9T A;  2EWB A;  4C9A A;  4C8T A;  5CBM A;  2IJZ A;  2QYV A;  5JM6 A;  4OKO A;  3B3S A;  2IQ6 A;  2GLF A;  4FWU A;  4P4D A;  1ARM A;  1IY7 A;  4H2K A;  4C8A A;  1ZLI A;  3GB0 A;  3PB7 X;  4TWE A;  2JEW A;  3KR5 A;  3KZW A;  1LFW A;  2AFU A;  3IFE A;  3WC7 A;  3KHZ A;  2QVP A;  1LAN A;  1Y9Z A;  4JZ0 A;  3KHX A;  4F9V A;  3BHX A;  4B6Z A;  4CDJ A;  2V8V A;  3V38 A;  3I74 A;  4UEE A;  2PVW A;  3CDX A;  1ZG7 A;  1CBX A;  1F57 A;  2V8H A;  4TJX A;  1R3N A;  3D7F A;  4ZY1 A;  3CPX A;  2WYR A;  4MXU A;  3FMC A;  4C9U A;  3KQX A;  3PFO A;  4JYW A;  2V8G A;  3FF3 A;  4NGS A;  3PBE A;  3SJF A;  4YWY A;  4KNG E;  5K8P A;  4Q7A A;  2ZEH A;  2NYQ A;  4AXV A;  3D7G A;  5D8N A;  4R76 A;  2V8D A;  4MMO A;  4MCS A;  5HXD A;  4R7M A;  5LRK A;  4EWT A;  3LMS A;  4EME A;  7CPA A;  3WC5 A;  1XMB A;  4R8F A;  2PJ4 A;  1XRY A;  3B3V A;  4P6Y A;  2POK A;  4PXD A;  3FVL A;  2O4H A;  1ELL P;  5I4M A;  2HC9 A;  2PJ2 A;  3FJU A;  2PRQ A;  1ARL A;  4C8F A;  1CPX A;  4Z65 A;  4PPZ A;  4P4F A;  1Y0R A;  2BO9 A;  4OC1 A;  3CT9 A;  3IJ3 A;  3PRT A;  3K2K A;  4P44 A;  3T8W A;  4FUU A;  3SJG A;  3HUV A;  2C1C A;  1RTQ A;  3NFZ A;  1Q7L A;  1HDQ A;  1FNO A;  3I1U A;  4C84 A;  2EK9 A;  3PB4 X;  3KR4 A;  4MCP A;  1YSJ A;  4UIA A;  3IC1 A;  2RB7 A;  2CF4 A;  3H8E A;  5ELY A;  4MRI A;  3H8G A;  3NA6 A;  2WZN A;  3DGV A;  4P45 A;  4CPA A;  6CPA A;  2G9D A;  3S9N A;  2ZEM A; 
#chains in the Genus database with same CATH topology
 2DXQ A;  2EO8 A;  3B3W A;  1YGH A;  3D67 A;  4GM5 A;  2F5I A;  3QAH A;  4JWP A;  1F2O A;  1KUX A;  3W91 A;  3WR7 A;  5JH9 A;  3TLG B;  3H8F A;  4KOY A;  1GHE A;  4WWV A;  4OAE A;  2IMO A;  2PDO A;  2ANP A;  3DLJ A;  4X8I A;  1C3O B;  4XPD B;  2NSM A;  1XFO A;  4PV6 A;  1UWY A;  4HNY B;  4MHY A;  4II9 A;  4DJL A;  4MCQ A;  2PCN A;  1DIK A;  1CX8 A;  2PJ1 A;  4C86 A;  3SXO A;  1Y7R A;  2FXF A;  4G1P A;  2BCO A;  1GGO A;  3NH5 A;  1Q2Y A;  1YRE A;  4CS0 B;  2RC4 A;  1ZYM A;  2ZOG A;  5C82 A;  2KCW A;  2YNC A;  5HVG A;  2YJT A;  3PP9 A;  5A28 A;  4FBE A;  2JLM A;  4RI1 A;  3JVN A;  4ZGY B;  4PSX A;  4U9Y A;  1MJB A;  3FEE A;  3TC8 A;  1VBG A;  3C8O A;  1YW4 A;  2PJ9 A;  2Q4Z A;  3OWC A;  2Z10 A;  2YNC C;  3F5B A;  2FM4 A;  5EMI A;  1P0H A;  2GIV A;  3TLY A;  4R6T A;  2PR8 A;  3FXT A;  4M3S A;  3WT4 A;  4DYO A;  5IX3 A;  4UFV A;  2FIW A;  1JQG A;  2DEA A;  3RYO A;  5F46 A;  2X0S A;  3T5M A;  3WAB A;  1XMT A;  2CTB A;  2EK8 A;  3IWG A;  2EVN A;  1EE3 P;  1LAP A;  4C8U A;  1PCA A;  2WUU A;  1N71 A;  5EC4 A;  3QNV A;  3TOB A;  1KUY A;  4MFQ A;  4P4I A;  2IL4 A;  2Q4V A;  4U5Y A;  3VAR A;  3D8P A;  2Z3M A;  3TLA A;  2R8V A;  4CGP A;  1VGY A;  2OH1 A;  2OZU A;  4KOX A;  3SI2 A;  1Y0Y A;  1S3Z A;  4A37 A;  2C6G A;  3MRU A;  4PXE A;  2ABZ A;  2AJ6 A;  1YW6 A;  2GFQ A;  3FH4 A;  2DPS A;  1M4G A;  2P0W A;  3B7I A;  4ZX9 A;  4AVA A;  2PE3 A;  4XNH C;  3JRU A;  1TXR A;  5DWN A;  1MJA A;  4Q36 A;  1EZB A;  4AVB A;  4DUK A;  1V6C A;  4F0X A;  4TJV A;  4PQA A;  1ZG9 A;  2HQY A;  4H89 A;  4ORF A;  1J4J A;  2FIA A;  2P6F A;  2V77 A;  3JTK A;  5E96 A;  2AUM A;  2PJB A;  2PJ7 A;  4UF4 A;  3EZE A;  3BJ7 A;  3VH9 A;  2XEI A;  2AFW A;  2X7B A;  3G8W A;  1DE4 C;  4CYO A;  4KOS A;  5LRG A;  1LOK A;  3KI9 A;  4ZBG A;  4UIB A;  5BWA B;  5JPH A;  2I79 A;  3D3S A;  3R9F A;  4OC5 A;  3FEC A;  1YME A;  2Z3N A;  3S9M A;  1CP7 A;  1S7K A;  2F8H A;  1PUA A;  4EFD A;  1SQH A;  5AG7 A;  3GYA A;  3ISZ A;  2PVV A;  4NJQ A;  2B3V A;  2GRE A;  2QML A;  1XE4 A;  4ONW A;  4CAE A;  3VWD A;  4MHP A;  2RFH A;  1WVM A;  4PSW A;  5J8C A;  4R57 A;  5FD8 A;  1CM0 A;  3WC6 A;  2C6C A;  3TYX A;  4FAI A;  2F7V A;  4C9E A;  2PQ8 A;  2OZH A;  1M4I A;  5LYL A;  2EZC A;  5JGF A;  1A9X B;  2JEV A;  5K8M A;  1VHE A;  4C9R A;  5K8O A;  3EY5 A;  1Z4R A;  1Z2L A;  3TLG A;  2YNE A;  2I3C A;  5C88 A;  4UBR A;  4C99 A;  1TIQ A;  3ICU A;  3HLP A;  1QMU A;  1AUG A;  5J8F A;  3I6S A;  3SJE A;  4CAW A;  3P2H A;  1LRZ A;  4CGM A;  2OU2 A;  4NGP A;  1Y9K A;  1BOB A;  2REF A;  2Q51 A;  4YU9 A;  3BI1 A;  3ZJ0 A;  2PR1 A;  1AYE A;  2HB6 A;  5I0C A;  4I49 A;  3EFA A;  2Z3K A;  2GLJ A;  3D68 A;  4UFX A;  4B10 A;  2B4B A;  2HUZ A;  2O53 A;  3A9L A;  2VXK A;  4IAV A;  4OIW A;  3SJX A;  1TF9 A;  4J0N A;  1VBH A;  3GKR A;  4A33 A;  3VAT A;  4A39 A;  3S6H A;  4C8P A;  4YN3 A;  5IV0 A;  4FD6 A;  4UEF A;  4KSF A;  3CXS A;  4ZY2 A;  4HPS A;  3T0T A;  4FD4 A;  5HH1 A;  3DDD A;  3G3S A;  3D7D A;  4CGL A;  4E8O A;  2PJ3 A;  4MHN A;  1KWM A;  3UY5 A;  8CPA A;  4MJX A;  3SR3 A;  2J9A A;  3RZA A;  2B5G B;  1TF8 A;  1BO4 A;  3PEI A;  1MJ9 A;  3FB3 A;  1TKJ A;  1IID A;  4NSQ A;  4RUH A;  1OBR A;  1XOV A;  2P6G A;  4KVO E;  4P10 A;  1Q2D A;  2OOT A;  5J1Q A;  5AGE A;  2R1I A;  1LCP A;  4UCP A;  4YRH A;  1IYK A;  4B13 A;  1YLO A;  4MI4 A;  4QUS A;  1TKF A;  2CNS A;  4BBH A;  3SI1 A;  1BPM A;  4KLV A;  3JUW A;  1R43 A;  3PB9 X;  4HKF A;  4AVC A;  3DR8 A;  2G3T A;  2OR4 A;  4KUB A;  4MFZ A;  1YR0 A;  3P2F A;  2ZEE A;  4F8Z A;  2VZZ A;  4MCR A;  4UCN A;  2ZED A;  2G0B A;  1NE9 A;  4X3R A;  4P4E A;  5D29 A;  2B0A A;  3TLE A;  3U1B A;  4ZI6 A;  4IF5 A;  2FCK A;  3ISX A;  1IU8 A;  4OC4 A;  3TTH A;  4F0Y A;  1Z8W A;  1V0C A;  5JQ4 A;  1QSR A;  2XEG A;  1CP6 A;  3KQZ A;  3RNZ A;  3SI0 A;  1LAM A;  3B2Y A;  3GY9 A;  3B3T A;  1A2Z A;  4TNU A;  3W6X A;  3R96 A;  2Q43 A;  4UWJ A;  2PIZ A;  1F2P A;  2CTC A;  3S6G A;  3S6K A;  1CS0 B;  2NMT A;  2G3A A;  3V7Z A;  2JBJ A;  2ZEP A;  1FT7 A;  3NH4 A;  4KOU A;  5F49 A;  2PJA A;  2VEZ A;  3BI0 A;  5IR2 A;  4OC0 A;  3PB6 X;  1I12 A;  4OP4 A;  2AFZ A;  2Z0Z A;  3L2N A;  1NMT A;  2PJ0 A;  4QVT A;  4UCM A;  3KGQ A;  1HEE A;  1VHO A;  4RN7 A;  4CGN A;  5K8N A;  2AFS A;  4JXQ A;  3R1K A;  4NGN A;  3TOA A;  1GYT A;  2A4N A;  2B4D B;  2BOA A;  5IB0 A;  2GE3 A;  4DNC A;  1RXT A;  2PIY A;  4CYP A;  5F09 A;  3S9L A;  3K4I A;  4E5S A;  3PB8 X;  4MFJ A;  3MN8 A;  5G1Z A;  3H5Z A;  1ZRS A;  4JVO A;  1T36 B;  1ZG8 A;  2FVG A;  4A32 A;  2FSR A;  3IO1 A;  1HDU A;  4C68 A;  1XBU A;  5CPA A;  5HVF A;  1ZLH A;  2H5M A;  3GUX A;  4OME A;  4X2T A;  3IEH A;  1CG2 A;  5H84 A;  1Q5X A;  2ZEL A;  4COB A;  2C6P A;  4MHZ A;  2ODF A;  2VBQ A;  4LX9 A;  1M6V B;  1AMP A;  3RBU A;  4KUA A;  4M8D A;  1M1D A;  3I9S A;  4NFR A;  4O23 A;  1YX0 A;  3PBB A;  3FBU A;  4OC3 A;  1NSL A;  4A31 A;  4GXH A;  4C7H A;  1YK3 A;  4JLY A;  4MFK A;  4MFP A;  3TO6 A;  4NXY A;  4Y49 B;  2VL1 A;  4L8A A;  4C9V A;  4WJB A;  2AFX A;  5LYI A;  2HI6 A;  4IHM A;  1S5K A;  1S60 A;  5DWM A;  3IGR A;  2B5G A;  4LQG A;  4ZY0 A;  5AG4 A;  4IIX A;  4F6A A;  4NGQ A;  1S7L A;  1XJO A;  1YLE A;  4EVY A;  1IGB A;  4IUS A;  3TLB A;  3TT2 A;  1BLL E;  2R98 A;  1TKH A;  3EXN A;  4CYQ A;  2D0O A;  3FYN A;  1Z8T A;  4YGO A;  3F0A A;  4A94 A;  4CO9 A;  2YND A;  3C26 A;  2ZXV A;  4FD5 A;  2ZEN A;  5G21 A;  4UEZ A;  2DPT A;  4NGR A;  1YVK A;  3KAS A;  4HNX B;  3G23 A;  3FIX A;  4XPL A;  1BAV A;  1Z9U A;  2ZW4 A;  4XPK A;  2Z3P A;  4PXB A;  3EIF A;  2ZOF A;  3GIU A;  4NJR A;  4KSI A;  1B87 A;  2ZEF A;  1M4L A;  1KUV A;  3EO4 A;  5LYF A;  2K5T A;  2JDD A;  2J8R A;  1VIX A;  2ZEG A;  3SXN A;  4C2Y A;  1NSA A;  3CPA A;  4A38 A;  2PJ5 A;  4XPD C;  3RO0 A;  4INJ A;  5LRJ A;  2FL4 A;  1ELM P;  2CXA A;  1ON0 A;  2BSW A;  1VHS A;  1OZP A;  3B35 A;  4OLL A;  5KTD A;  3FNC A;  4ONU A;  5F9M A;  5F47 A;  3TX8 A;  3EZA A;  3MGD A;  4ZYQ A;  3TFY A;  4AG9 A;  3I3G A;  4IK2 A;  4OID A;  4R3K A;  3ZZI A;  4CDK A;  5GCN A;  4C2Z A;  4PXC A;  4K3N A;  2CNT A;  3GLJ A;  2CNM A;  2Q04 A;  4QBJ A;  1XF1 A;  2Q7B A;  5IB9 A;  3N5F A;  1Z5R A;  3SHP A;  2HV2 A;  4CAF A;  2PJ6 A;  4BIN A;  2EZB A;  2HWG A;  1IB1 E;  3RAM A;  2AFO A;  2O28 A;  3IWW A;  4OAD A;  5LYD A;  3R9E A;  2Q4Y A;  1RO5 A;  4KOT A;  3KL9 A;  2B4D A;  4E0A A;  2PJ8 A;  4XNH B;  5HVH A;  1Z8L A;  2PC1 A;  1QQ9 A;  1QSO A;  2REE A;  1U6M A;  4MFL A;  5THW A;  2QJ8 A;  5HMN A;  4L89 A;  2C5Q A;  3FED A;  4NGT A;  5H86 A;  1H8L A;  4UWI A;  1KZF A;  2Q44 A;  3QAY A;  2XEF A;  3LAC A;  4P4J A;  2CIJ A;  2AFM A;  2ZW5 A;  2FE7 A;  3LWU A;  2BL1 A;  3E0K A;  5F5X A;  2ZW7 A;  2DF5 A;  1DTD A;  1XF8 A;  3BXM A;  4AB7 A;  2ZEO A;  3IIB A;  2QIR A;  4NCZ A;  1MK4 A;  3D66 A;  3D4U A;  4H6Z A;  3VTA A;  3NH8 A;  4OC2 A;  1J3L A;  4KVX A;  4NEX A;  4C7I A;  4M85 A;  1KEE B;  2XEJ A;  2PRB A;  1CPS A;  4U9Z A;  4NGM A;  3B3C A;  1I21 A;  2ATR A;  2BUE A;  2Z11 A;  3D7H A;  1Y7E A;  1JDB C;  1JDE A;  4MY3 A;  5DS0 A;  2CY2 A;  2JBK A;  1XEB A;  4KOV A;  4W9Y A;  4Y49 C;  3PFE A;  4F9U A;  4EYS A;  1Z4E A;  2PCU A;  5KTC A;  4KLW A;  1PYT B;  2GU2 A;  3NE7 A;  2YGW A;  3FX6 A;  2OZG A;  3N7Z A;  4CAV A;  2VQY A;  4ZX8 A;  4GS4 A;  1KBL A;  1QSN A;  5AG5 A;  4MJ8 A;  4P4B A;  4BD9 A;  1WK4 A;  2PJC A;  1BPN A;  3K9T A;  4Q38 A;  2EWB A;  3CXQ A;  4C9A A;  4C8T A;  2J8N A;  2IJZ A;  5CBM A;  2OLS A;  2QYV A;  4PK2 A;  1YVO A;  3T90 A;  5JM6 A;  4PK3 A;  3F8K A;  2J8M A;  4OKO A;  3B3S A;  1CJW A;  2IQ6 A;  2AE6 A;  4IIY A;  2GLF A;  1KC7 A;  4FWU A;  4P4D A;  3R9G A;  2Z3L A;  1L0C A;  2WSA A;  3V8I A;  4E2A A;  1B6B A;  2BEI A;  1ARM A;  1IY7 A;  4H2K A;  4JD6 A;  5AG6 A;  1ZLI A;  3R95 A;  4C8A A;  4X5K A;  3GB0 A;  3TCV A;  3PB7 X;  1X10 A;  4TWE A;  4KOR A;  4CYN A;  4COG A;  1IOI A;  2JEW A;  3KR5 A;  3KZW A;  4JXR A;  3BLN A;  4MI1 A;  3DNS A;  1LFW A;  1FY7 A;  2AFU A;  2Z3O A;  2OB0 A;  3IFE A;  4MY0 A;  3WC7 A;  2P6E A;  3KHZ A;  3K9U A;  2Y0M A;  2AUN A;  1LAN A;  2QVP A;  2VI7 A;  4JZ0 A;  5F48 A;  1Y9Z A;  3KHX A;  4F9V A;  3BHX A;  3PZJ A;  3TE4 A;  1R61 A;  4B6Z A;  5JVL A;  4CDJ A;  2V8V A;  4UFW A;  4KZT A;  4M6H A;  1M4D A;  2Q0Y A;  3V38 A;  4UEE A;  4B5O A;  3I74 A;  2B3U A;  4KVM E;  3CXP A;  1XIX A;  3NE8 A;  4KS9 A;  2PVW A;  3CDX A;  1ZG7 A;  1EZA A;  4FD7 A;  1CBX A;  1F57 A;  1Q2C A;  2DIK A;  2FT0 A;  5FVJ A;  3EC4 A;  2V8H A;  2WPX A;  2Q7S A;  3TO9 A;  2GP4 A;  4TJX A;  1R3N A;  3D7F A;  4ZY1 A;  3CPX A;  1QST A;  2WYR A;  4MXU A;  4MHD A;  3FMC A;  3KKW A;  4B11 A;  1BXR B;  1NBW A;  4B12 A;  3KRV A;  4C9U A;  3KQX A;  1Y9W A;  3PFO A;  4JYW A;  4RS2 A;  4B5P B;  2V8G A;  2ARH A;  3FF3 A;  4CAX A;  4CRY B;  4NGS A;  2HRO A;  3PBE A;  3SJF A;  4YWY A;  4KNG E;  3H4Q A;  5K8P A;  4QC6 A;  4Q7A A;  1ZL0 A;  5CNP A;  2VZY A;  2ZEH A;  2GAN A;  2D4O A;  2NYQ A;  4AXV A;  1PU9 A;  4A30 A;  3D7G A;  2ZPA A;  5D8N A;  4R76 A;  2V8D A;  4MBU A;  5G20 A;  4MMO A;  4MCS A;  3EZB A;  2EBJ A;  4CGO A;  1IOF A;  5HXD A;  4R7M A;  5LRK A;  4EWT A;  3LMS A;  4EME A;  7CPA A;  3WC5 A;  5A27 A;  4R9M A;  4YFJ A;  5F1Y A;  1XMB A;  4R8F A;  2PJ4 A;  1XRY A;  3B3V A;  4P6Y A;  4BMH A;  2POK A;  4PXD A;  3FVL A;  4A2Z A;  2R7H A;  2O4H A;  3S6F A;  1ELL P;  5I4M A;  4A95 A;  4C8C A;  3LD2 A;  1JWQ A;  2E28 A;  4C85 A;  4C2X A;  1VKC A;  2HC9 A;  3TO7 A;  2PJ2 A;  4CRZ B;  3FJU A;  2D0P A;  1QSM A;  3T9Y A;  1UFH A;  3IU1 A;  2PRQ A;  3LOD A;  4J3G A;  2R82 A;  2EUI A;  1ARL A;  3QB8 A;  5EBV A;  4AG7 A;  3IWE A;  1X12 A;  1CPX A;  2EZA A;  4C8F A;  1S7F A;  4UA3 A;  4Z65 A;  4HNW B;  1C30 B;  3T05 A;  3NOJ A;  4PPZ A;  4P4F A;  4CZ1 A;  2ZW6 A;  1Y0R A;  2I00 A;  2BO9 A;  4E94 A;  3FRM A;  1I1D A;  4OC1 A;  4LUA A;  4JJX A;  3CT9 A;  3IJ3 A;  2JDC A;  3PRT A;  4KSA A;  2YJV A;  3IU2 A;  3PGP A;  2B58 A;  3K2K A;  2PSW A;  1K4J A;  4FUU A;  4K30 A;  4P44 A;  3T8W A;  3DR6 A;  3SJG A;  4H1H A;  3HUV A;  4M6G A;  5JYB A;  3TLZ A;  2C1C A;  2WPW A;  1RTQ A;  2D4P A;  1YQE A;  3BJ8 A;  3NFZ A;  5K99 A;  1S7N A;  1Q7L A;  1HDQ A;  1P4N A;  1FNO A;  3GJZ A;  2C27 A;  3CZX A;  3B8G A;  3I1U A;  1IIC A;  3DSB A;  5G22 A;  4B14 A;  4C84 A;  2EK9 A;  3PB4 X;  3KR4 A;  4MCP A;  1NXJ A;  3D2M A;  4KOW A;  1CE8 B;  1YSJ A;  4UIA A;  3IC1 A;  2RB7 A;  4M6I A;  5ISV A;  1IYL A;  2CF4 A;  3H8E A;  1R57 A;  2FS5 A;  4H6U A;  3H8G A;  3NA6 A;  4MRI A;  5ELY A;  3VWE A;  2WZN A;  3DGV A;  4P45 A;  1WWZ A;  3T07 A;  1M44 A;  3TLC A;  4QB9 A;  4CPA A;  6CPA A;  1VI4 A;  2MP0 A;  1ZO0 A;  2G9D A;  2QEC A;  3D2P A;  4R3L A;  1Z8X A;  3W6S A;  4B5P A;  5KTA A;  3S9N A;  4NF1 A;  2ZEM A;  4R87 A;  4LQ6 A; 
#chains in the Genus database with same CATH homology
 3B3W A;  3D67 A;  4GM5 A;  5JH9 A;  1F2O A;  3H8F A;  4WWV A;  2IMO A;  2ANP A;  3DLJ A;  4X8I A;  2NSM A;  1XFO A;  1UWY A;  4MHY A;  4DJL A;  4MCQ A;  1CX8 A;  2PJ1 A;  4C86 A;  4G1P A;  2BCO A;  3NH5 A;  2ZOG A;  5HVG A;  4FBE A;  3FEE A;  3TC8 A;  1YW4 A;  2PJ9 A;  2Q4Z A;  4R6T A;  4DYO A;  3WT4 A;  1JQG A;  2DEA A;  3WAB A;  2CTB A;  2EK8 A;  1EE3 P;  1LAP A;  4C8U A;  1PCA A;  3QNV A;  4P4I A;  3VAR A;  1VGY A;  3SI2 A;  1Y0Y A;  4A37 A;  2C6G A;  3MRU A;  4PXE A;  2ABZ A;  1YW6 A;  3FH4 A;  3B7I A;  4ZX9 A;  2PE3 A;  3JRU A;  1TXR A;  4DUK A;  1V6C A;  4TJV A;  4PQA A;  1ZG9 A;  2V77 A;  2PJB A;  2PJ7 A;  4UF4 A;  3VH9 A;  2XEI A;  2AFW A;  1DE4 C;  5LRG A;  1LOK A;  3KI9 A;  4UIB A;  4OC5 A;  3FEC A;  1YME A;  3S9M A;  4EFD A;  1CP7 A;  2F8H A;  3ISZ A;  2PVV A;  4NJQ A;  2GRE A;  4ONW A;  4MHP A;  2RFH A;  1WVM A;  3WC6 A;  2C6C A;  4FAI A;  2F7V A;  4C9E A;  5LYL A;  5JGF A;  5K8M A;  1VHE A;  4C9R A;  5K8O A;  1Z2L A;  4C99 A;  2I3C A;  3ICU A;  3HLP A;  1QMU A;  3I6S A;  3SJE A;  4NGP A;  2Q51 A;  4YU9 A;  3BI1 A;  1AYE A;  2HB6 A;  2GLJ A;  3D68 A;  2O53 A;  4OIW A;  4IAV A;  3SJX A;  1TF9 A;  3VAT A;  4A39 A;  4C8P A;  4YN3 A;  4UEF A;  4ZY2 A;  3D7D A;  2PJ3 A;  4MHN A;  1KWM A;  8CPA A;  2J9A A;  3RZA A;  1TF8 A;  3PEI A;  1TKJ A;  4RUH A;  4C85 A;  1OBR A;  4P10 A;  5J1Q A;  2OOT A;  1LCP A;  1YLO A;  1TKF A;  3SI1 A;  1BPM A;  3PB9 X;  1R43 A;  2OR4 A;  2ZEE A;  4F8Z A;  4MCR A;  2ZED A;  4X3R A;  4P4E A;  5D29 A;  4ZI6 A;  3ISX A;  4OC4 A;  2XEG A;  1CP6 A;  3KQZ A;  3SI0 A;  1LAM A;  3B2Y A;  3B3T A;  4TNU A;  2Q43 A;  2PIZ A;  1F2P A;  2CTC A;  3V7Z A;  2JBJ A;  2ZEP A;  1FT7 A;  3NH4 A;  2PJA A;  5IR2 A;  3BI0 A;  4OC0 A;  3PB6 X;  4OP4 A;  2AFZ A;  3L2N A;  2PJ0 A;  3KGQ A;  1HEE A;  1VHO A;  5K8N A;  2AFS A;  4NGN A;  1GYT A;  2BOA A;  2PIY A;  5F09 A;  3S9L A;  3PB8 X;  3MN8 A;  1ZG8 A;  2FVG A;  3IO1 A;  1HDU A;  1XBU A;  5CPA A;  5HVF A;  1ZLH A;  3GUX A;  4OME A;  4X2T A;  3IEH A;  1CG2 A;  2ZEL A;  2C6P A;  4MHZ A;  1AMP A;  3RBU A;  4NFR A;  4O23 A;  4OC3 A;  3PBB A;  2VL1 A;  4C9V A;  4WJB A;  2AFX A;  5LYI A;  4IHM A;  4LQG A;  4ZY0 A;  4NGQ A;  1XJO A;  1IGB A;  1BLL E;  1TKH A;  4A94 A;  2ZEN A;  4UEZ A;  4NGR A;  3KAS A;  1BAV A;  3EIF A;  4PXB A;  2ZOF A;  4NJR A;  4KSI A;  2ZEF A;  1M4L A;  5LYF A;  2ZEG A;  1VIX A;  1NSA A;  3CPA A;  4A38 A;  2PJ5 A;  5LRJ A;  1ELM P;  3B35 A;  3TX8 A;  4ZYQ A;  4IK2 A;  4OID A;  4CDK A;  4PXC A;  4K3N A;  3GLJ A;  1XF1 A;  5IB9 A;  3N5F A;  1Z5R A;  2PJ6 A;  3RAM A;  2AFO A;  3IWW A;  5LYD A;  3KL9 A;  2PJ8 A;  5HVH A;  1Z8L A;  1QQ9 A;  5THW A;  2C5Q A;  2QJ8 A;  3FED A;  4NGT A;  1H8L A;  4C8C A;  4P4J A;  2XEF A;  2CIJ A;  2AFM A;  3LWU A;  1DTD A;  3BXM A;  2ZEO A;  3IIB A;  3D66 A;  3D4U A;  3VTA A;  3NH8 A;  4OC2 A;  2XEJ A;  1CPS A;  4NGM A;  3B3C A;  3D7H A;  1Y7E A;  5DS0 A;  2JBK A;  4W9Y A;  3PFE A;  4F9U A;  2PCU A;  1PYT B;  2GU2 A;  3FX6 A;  4ZX8 A;  4P4B A;  4BD9 A;  2PJC A;  1BPN A;  3K9T A;  2EWB A;  4C9A A;  4C8T A;  5CBM A;  2IJZ A;  2QYV A;  5JM6 A;  4OKO A;  3B3S A;  2IQ6 A;  2GLF A;  4FWU A;  4P4D A;  1ARM A;  1IY7 A;  4H2K A;  4C8A A;  1ZLI A;  3GB0 A;  3PB7 X;  4TWE A;  2JEW A;  3KR5 A;  3KZW A;  1LFW A;  2AFU A;  3IFE A;  3WC7 A;  3KHZ A;  2QVP A;  1LAN A;  1Y9Z A;  4JZ0 A;  3KHX A;  4F9V A;  3BHX A;  4B6Z A;  4CDJ A;  2V8V A;  3V38 A;  3I74 A;  4UEE A;  2PVW A;  3CDX A;  1ZG7 A;  1CBX A;  1F57 A;  2V8H A;  2GP4 A;  4TJX A;  1R3N A;  3D7F A;  4ZY1 A;  3CPX A;  2WYR A;  4MXU A;  3FMC A;  4C9U A;  3KQX A;  3PFO A;  4JYW A;  2V8G A;  3FF3 A;  4NGS A;  3PBE A;  3SJF A;  4YWY A;  4KNG E;  5K8P A;  4Q7A A;  2ZEH A;  2NYQ A;  4AXV A;  3D7G A;  5D8N A;  4R76 A;  2V8D A;  4MMO A;  4MCS A;  5HXD A;  4R7M A;  5LRK A;  4EWT A;  3LMS A;  4EME A;  7CPA A;  3WC5 A;  1XMB A;  4R8F A;  2PJ4 A;  1XRY A;  3B3V A;  4P6Y A;  2POK A;  4PXD A;  3FVL A;  2O4H A;  1ELL P;  5I4M A;  2HC9 A;  2PJ2 A;  3FJU A;  2PRQ A;  1ARL A;  4C8F A;  1CPX A;  4Z65 A;  4PPZ A;  4P4F A;  1Y0R A;  2BO9 A;  4OC1 A;  3CT9 A;  3IJ3 A;  3PRT A;  3K2K A;  4P44 A;  3T8W A;  4FUU A;  3SJG A;  3HUV A;  2C1C A;  1RTQ A;  3NFZ A;  1Q7L A;  1HDQ A;  1FNO A;  3I1U A;  4C84 A;  2EK9 A;  3PB4 X;  3KR4 A;  4MCP A;  1YSJ A;  4UIA A;  3IC1 A;  2RB7 A;  2CF4 A;  3H8E A;  5ELY A;  4MRI A;  3H8G A;  3NA6 A;  2WZN A;  3DGV A;  4P45 A;  4CPA A;  6CPA A;  2G9D A;  3S9N A;  2ZEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...