2EK8A

Aminopeptidase from aneurinibacillus sp. strain am-1
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
412
structure length
412
Chain Sequence
ADHQITKRTDAENMYNTIQFLSQAPRVAGSPEELKAVRYIEQQFKSYGYHVEVQPFQFEGYTAPSEVTLKIGTEKKEGEAFTYSPNSDVTAELVYVGLGTTADVAGKDLNGKIALIQRGNISFADKVRNAAKQGAKAVIIYNNTDGKLNGTLGGSDASFVAAVGITKQEGDALAANLRAGEKITATVKVAGAEVKTLTSHNVIATKKPDANKKNTNDIIIIGSHHDSVEKAPGANDDASGVAVTLELARVMSKLKTDTELRFITFGAEENGLIGSKKYAASLSEDEIKRTIGMFQLDMVGSKDAGDLIMYTIDGKKNRVTDLGAAASSRLSGVLPYGQEGRSDHESFHALGIPAALFIHAPVEPWYHTPNDTLDKISKEKLDNVADIVGSAVYQAARPGELVIEPIDYPRRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Structural characterization of a novel bacterial aminopeptidase with an apical domain from aneurinibacillus sp. strain AM-1
rcsb
source organism Aneurinibacillus sp.
molecule tags Hydrolase
total genus 142
structure length 412
sequence length 412
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2ek8A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2ek8A02
4UEFA 7CPAA 2XEIA 4NGQA 4DYOA 4NGRA 3SI0A 2ZEGA 4UEZA 1LCPA 1TKHA 1ELMP 1LOKA 3I74A 3JRUA 4TJXA 1IGBA 3PBEA 3K2KA 1YW6A 1F2OA 2RB7A 2OOTA 1CP6A 2V8VA 5LYDA 4C9UA 4OC4A 3GB0A 1Y0RA 1BPNA 3B3VA 3IWWA 4Q7AA 4P4IA 4EMEA 3LMSA 4A94A 1BPMA 1XF1A 2C6GA 2GLJA 4C8PA 2PJ8A 3NH4A 3KHZA 2RFHA 3D7HA 4IK2A 1KWMA 2XEJA 2PJ9A 1ZLIA 3BHXA 5LYLA 2NSMA 2GU2A 3PB7X 3MN8A 2BCOA 3KASA 4PXEA 4A38A 1TF8A 2C6PA 4P45A 4UF4A 2EWBA 3B3WA 5DS0A 4C8FA 3B3SA 3RBUA 2JBKA 1ZLHA 4MCQA 2ZEDA 3VTAA 4OC0A 4ZY2A 3PFOA 4OC5A 3IIBA 4UIBA 2ZEFA 3FMCA 1CP7A 3VATA 2C6CA 2ZEOA 1QMUA 4R7MA 3VARA 5D8NA 2IJZA 4A37A 4MHZA 4F9UA 4ZY1A 4C9AA 1F57A 4NGSA 4YU9A 4MCRA 1F2PA 2EK9A 2PJ6A 2BO9A 1Z5RA 1ARLA 1DE4C 5ELYA 2PJ5A 4R8FA 3KR5A 1YSJA 8CPAA 3NH8A 2XEFA 3NH5A 3D7DA 3PBBA 4MXUA 4LQGA 2PJ3A 2PJ7A 3K9TA 3PEIA 4C8AA 1Y7EA 3SI2A 4MCSA 4O23A 1HDQA 2C1CA 2HB6A 5HVHA 3PB8X 4JZ0A 5HVFA 1LAPA 3CDXA 4MMOA 4C85A 3MRUA 2CF4A 3ISZA 4UIAA 2PVWA 4EWTA 1VGYA 1HDUA 5IB9A 2CTCA 4P4JA 4ONWA 1Z8LA 4PXCA 4FAIA 4MHYA 3NFZA 2AFWA 4B6ZA 1ARMA 2ZENA 4BD9A 3S9NA 2WYRA 3H8GA 1OBRA 3FEEA 4C8CA 3N5FA 1M4LA 3BI0A 1TKJA 2ZEPA 3PFEA 1EE3P 2I3CA 3RAMA 1RTQA 2JEWA 2PE3A 4R76A 4P10A 4C9EA 5J1QA 1XMBA 2ZOGA 4H2KA 2AFUA 2V8GA 4F8ZA 4IAVA 1H8LA 1Y0YA 3CT9A 4P44A 4FBEA 1LANA 3V7ZA 5K8PA 3KI9A 4EFDA 2VL1A 3PRTA 3KL9A 1Q7LA 4P4EA 2PJBA 4PXDA 4C9VA 3IC1A 4KNGE 3DLJA 2ZEEA 4NFRA 4NGPA 2PJ2A 3FH4A 4OC1A 2AFMA 4OMEA 2PCUA 1Y9ZA 1PCAA 1TF9A 5D29A 4P6YA 4MHPA 4MCPA 1FNOA 3I1UA 4K3NA 4A39A 3BI1A 3CPXA 4CPAA 2AFSA 3NA6A 2PJCA 3BXMA 2PJAA 1CBXA 3RZAA 4GM5A 4P4FA 3CPAA 2ZOFA 3SI1A 3TC8A 2PJ4A 2ZEMA 4OP4A 2ANPA 3KQXA 1VHEA 4OKOA 2JBJA 3EIFA 3GLJA 3HLPA 3WC6A 2NYQA 2HC9A 4CDJA 3KR4A 3TX8A 2V8DA 4AXVA 4YWYA 3B2YA 1XRYA 2WZNA 2IMOA 2Q51A 2J9AA 3SJXA 1AYEA 1LAMA 1YMEA 4X3RA 4ZYQA 3V38A 4WJBA 1CG2A 2XEGA 5JH9A 2QYVA 2PJ0A 2GLFA 2CTBA 3LWUA 2Q4ZA 2PIYA 5THWA 1YW4A 4NJRA 5LRGA 4RUHA 4KSIA 4F9VA 3FX6A 4TWEA 2EK8A 3S9LA 4ZY0A 1LFWA 4NGMA 3S9MA 2ABZA 2F7VA 3D7GA 1QQ9A 3D68A 3VH9A 4MHNA 3WT4A 2BOAA 4JYWA 4P4DA 4TJVA 4Z65A 4OIDA 2ZEHA 3WABA 1XJOA 4PXBA 4PPZA 3D7FA 2Q43A 5HXDA 4ZX9A 3FEDA 3PB4X 2PJ1A 2OR4A 4NGNA 1XBUA 3FF3A 4YN3A 1TKFA 3L2NA 4TNUA 3GUXA 5JM6A 2CIJA 4NJQA 4ZI6A 1IY7A 1GYTA 1Z2LA 3KZWA 1JQGA 2QJ8A 1ZG8A 4OC2A 3FECA 3SJEA 1BLLE 4DUKA 1PYTB 4C84A 3I6SA 1ELLP 2O4HA 5LRJA 3PB6X 4MRIA 3B7IA 5LRKA 5F09A 3KQZA 5K8OA 4NGTA 5HVGA 1HEEA 2G9DA 5JGFA 3D67A 2POKA 3B35A 4WWVA 1VIXA 3H8EA 2AFXA 3QNVA 3KGQA 2PRQA 4C8TA 2V77A 4OIWA 1CPXA 1R43A 5LYIA 6CPAA 3DGVA 4FWUA 1CPSA 1AMPA 2AFOA 4X2TA 3ICUA 1CX8A 2DEAA 4ZX8A 3FJUA 4W9YA 4IHMA 2F8HA 4R6TA 1DTDA 4C86A 3ISXA 2IQ6A 1V6CA 4G1PA 3B3CA 3H8FA 5CPAA 4FUUA 1UWYA 1WVMA 1TXRA 4DJLA 1NSAA 3IO1A 3SJGA 5K8NA 2FVGA 3T8WA 1FT7A 4CDKA 1XFOA 3PB9X 2PIZA 4C8UA 2O53A 5LYFA 4C9RA 1ZG7A 4X8IA 3FVLA 1VHOA 2AFZA 2ZELA 3IFEA 5CBMA 4C99A 3SJFA 3WC5A 3D4UA 3KHXA 3WC7A 2QVPA 4OC3A 2V8HA 3D66A 2GREA 1BAVA 5I4MA 3IJ3A 1YLOA 3B3TA 4UEEA 1ZG9A 4PQAA 3IEHA 1R3NA 2PVVA 5K8MA 4P4BA 3HUVA
chains in the Genus database with same CATH superfamily
2F5IA 5E96A 4UEFA 5JVLA 7CPAA 3FRMA 2XEIA 4UFWA 1Y7RA 4KS9A 4NGQA 3D2MA 4DYOA 3EZAA 1Z9UA 3TO7A 4NGRA 3SI0A 4BINA 2ZEGA 4UEZA 1LCPA 4KVOE 1TKHA 3R1KA 1ELMP 4JD6A 4CYQA 1LOKA 3I74A 3JRUA 4Y49C 1IICA 3F5BA 2B3UA 4TJXA 1R57A 4NCZA 1IGBA 3H5ZA 5G20A 5IB0A 3TT2A 3PBEA 4R3LA 3W6XA 3K2KA 3WR7A 2VXKA 3EXNA 1YW6A 2OZHA 1F2OA 2ZW4A 2RB7A 2OOTA 1CP6A 2V8VA 5LYDA 4MFJA 4FD5A 2MP0A 4C9UA 4E94A 4R57A 2DF5A 4PK3A 3BLNA 4OC4A 3GB0A 1Y0RA 1BPNA 2H5MA 3B3VA 3IWWA 4IF5A 4Q7AA 4C68A 4DNCA 4C2YA 4P4IA 4EMEA 3TOAA 3VWDA 2DIKA 2GP4A 3FIXA 3LMSA 4A94A 1JDEA 4CZ1A 1BPMA 5K8MA 2BEIA 1KC7A 4KLWA 1XF1A 2C6GA 2GLJA 4BBHA 2PJ8A 4C8PA 3FBUA 4KSAA 3C8OA 3NH4A 4U9ZA 2WPXA 1S7LA 3IU1A 3N7ZA 4UFXA 3KHZA 2RFHA 4MHDA 1AUGA 3D7HA 2K5TA 4IK2A 1KWMA 3SXNA 1IIDA 2PJ9A 2XEJA 1KUYA 3NE7A 1ZLIA 3BHXA 3TLCA 4MBUA 5LYLA 2NSMA 1NSLA 2GU2A 4C7IA 4CGOA 3PB7X 5JPHA 2PR1A 3MN8A 2HROA 2BCOA 4MJ8A 3P2FA 2B5GA 3KASA 2YNCC 5KTDA 4PXEA 3W6SA 3TYXA 2OH1A 2Q4YA 3B8GA 5F46A 4A38A 1TF8A 3P2HA 4H1HA 3F8KA 2C6PA 2G3TA 4P45A 1Q5XA 4UF4A 3TOBA 2EWBA 4F6AA 3B3WA 5DS0A 2Z3NA 3B3SA 4MFPA 4C8FA 2BUEA 5JYBA 5K99A 3LACA 3RBUA 4AVCA 2JBKA 1NE9A 1ZLHA 4MCQA 2ZEDA 2Y0MA 5AG5A 3VTAA 4OC0A 4ZY2A 4KOUA 3E0KA 5H86A 1UFHA 3PFOA 4OC5A 2OLSA 4CS0B 3IIBA 4UIBA 4AVBA 4LX9A 1QSTA 5DWMA 3TE4A 2JLMA 2ZEFA 1CS0B 2FCKA 4E2AA 2EZBA 3KRVA 3FMCA 1CP7A 3T05A 3VATA 2Q4VA 2C6CA 2ZEOA 1QMUA 4CAEA 1VBHA 4R7MA 4B5OA 4KLVA 3VARA 5EMIA 5I0CA 2C27A 2WUUA 2ZPAA 3JVNA 2P6FA 3PGPA 4NF1A 5D8NA 2I00A 2IJZA 4MFZA 5FD8A 4R87A 1XOVA 4A37A 4MHZA 1X12A 4F9UA 4R3KA 4IIYA 4ZY1A 4CAFA 2B4DB 1F57A 4NGSA 4YU9A 4B5PA 4MCRA 2Q44A 4CYOA 5F5XA 4C9AA 5JQ4A 1F2PA 2EK9A 3CZXA 3MGDA 1ZYMA 3JTKA 4CAWA 2PJ6A 2BO9A 4L89A 1Z5RA 5IR2A 1ARLA 1DE4C 1RXTA 2PJ5A 5ELYA 4R8FA 3KR5A 1YSJA 8CPAA 3NH8A 2XEFA 3GJZA 4COBA 1J4JA 3D7DA 3EC4A 3G8WA 3NH5A 3PBBA 4AVAA 2Z3KA 2ZW7A 4K30A 4MXUA 2Z10A 4LQGA 2AJ6A 2PJ3A 2P0WA 2PJ7A 3EY5A 3K9TA 3PEIA 2QECA 4QVTA 1Y7EA 2VQYA 4MCSA 4QB9A 5CNPA 4Y49B 4O23A 3SI2A 2Z3PA 1HDQA 3FB3A 2C1CA 2HB6A 5HVHA 3PB8X 2EO8A 3I3GA 3K4IA 1NMTA 4JZ0A 5HVFA 1LAPA 3CDXA 2YNDA 4MMOA 4C85A 2PR8A 3MRUA 1M6VB 3DSBA 4UCNA 2Z11A 2CF4A 4M6HA 3ISZA 4M8DA 4OADA 4UIAA 4B10A 2PVWA 4EWTA 1VGYA 5J8FA 1YGHA 4CYPA 1HDUA 2FSRA 4CGMA 5IB9A 2R98A 2CTCA 4P4JA 4M3SA 2J8MA 4ONWA 1Z8LA 4HKFA 2YGWA 4PXCA 4QC6A 4RS2A 4MHYA 2OZGA 3R9EA 4CRZB 4FAIA 1IOIA 3NFZA 4CGLA 1B6BA 1U6MA 2AFWA 5DWNA 3TLAA 1YR0A 4B6ZA 1ARMA 2ZENA 3F0AA 4BD9A 3S9NA 2WYRA 3H8GA 1OBRA 3FEEA 4C2XA 5ISVA 2X0SA 2CNTA 1MK4A 3R96A 4YFJA 1QSMA 3JUWA 2QIRA 5F1YA 4C8CA 3N5FA 5H84A 2R1IA 1M4LA 1EZBA 2B3VA 2FIAA 3BI0A 2FT0A 1TKJA 3QAHA 2ZEPA 3PFEA 3VWEA 4E5SA 1EE3P 3H4QA 2I3CA 4OAEA 3RAMA 1CE8B 2YNEA 2WPWA 1RTQA 2B5GB 2FL4A 2FXFA 2JEWA 2PE3A 5F48A 4R76A 3TCVA 4A2ZA 5C88A 1Z4EA 3D2PA 4P10A 4CAXA 1Q2CA 4C9EA 1J3LA 3TTHA 5J1QA 1XMBA 2ZOGA 1IYKA 3CXQA 4H2KA 4KUBA 2AFUA 2V8GA 3S6KA 4UFVA 1ZO0A 3UY5A 4IAVA 4JXQA 5F49A 4PV6A 1H8LA 4F8ZA 4C8AA 1Y0YA 4OLLA 2EZCA 2EUIA 3CT9A 1C30B 2KCWA 2D4PA 2Q0YA 4P44A 4FBEA 4MJXA 1LANA 2FE7A 2PDOA 4B14A 4F0XA 5HMNA 3V7ZA 1Y9KA 4B12A 2E28A 3V8IA 5K8PA 2Q7BA 3KI9A 4EFDA 2VL1A 3PRTA 3TLYA 3KL9A 1Q7LA 4GXHA 4P4EA 1P0HA 2WSAA 3T9YA 2PJBA 3RYOA 1YLEA 4PXDA 3T07A 4FD4A 4MFKA 4C9VA 1OZPA 3ZZIA 3IC1A 4A33A 4KNGE 2ATRA 3TLBA 2B58A 2HI6A 3DLJA 2ZEEA 3K9UA 4HNYB 4NFRA 4NGPA 2EBJA 3TLZA 2PJ2A 3FH4A 4OC1A 2A4NA 2B4BA 4B5PB 3G3SA 3BJ8A 2FS5A 2AFMA 4OMEA 3SXOA 2PCUA 1Y9ZA 2FM4A 1PCAA 1YVOA 1TF9A 2HV2A 1SQHA 4JLYA 5D29A 5IX3A 5EBVA 1QSRA 4BMHA 1R61A 4LQ6A 4P6YA 2REFA 4MHPA 4MCPA 1FNOA 3I1UA 2D0PA 4K3NA 4A39A 5KTAA 3GKRA 4CO9A 3BI1A 1XEBA 3CPXA 4HNWB 2AFSA 4CPAA 3NA6A 2PJCA 3BXMA 2PJAA 3GYAA 1CBXA 1M44A 2NMTA 3RZAA 4GM5A 4P4FA 1KUVA 5G22A 1Z8TA 1I21A 3CPAA 3S6HA 2ZOFA 1MJBA 1ZRSA 4A31A 3SI1A 2O28A 2EVNA 1X10A 2PJ4A 2ZEMA 3TC8A 3DR6A 4OP4A 4YRHA 4M85A 2ANPA 3KQXA 1VHEA 4OKOA 2CY2A 4CYNA 4KVME 2JBJA 4H6UA 1S7FA 2Z0ZA 4KOXA 5G1ZA 3EIFA 4KZTA 3FYNA 3GLJA 3D3SA 1Q2YA 4CRYB 3T90A 2GIVA 1KUXA 4M6IA 2OU2A 3HLPA 3TLGA 1P4NA 4MY3A 1PUAA 3WC6A 2G3AA 2NYQA 1QSOA 2HC9A 1A2ZA 3KR4A 2GE3A 2ARHA 1Z4RA 2V8DA 3TX8A 4AXVA 4YWYA 4MI1A 3B2YA 3OWCA 3S6GA 4U5YA 5C82A 4J3GA 1M4DA 1S7KA 1T36B 1XRYA 1XMTA 1Q2DA 4M6GA 2WZNA 1YREA 4F0YA 2FIWA 2IMOA 2R7HA 3CXSA 2PRBA 1FY7A 2Q51A 2J9AA 3SJXA 1C3OB 1AYEA 1LAMA 1YMEA 4MFQA 4X3RA 4ZYQA 3V38A 4E8OA 4WJBA 1CG2A 2XEGA 2ZW5A 1S5KA 1BO4A 5JH9A 5BWAB 2GANA 3IWEA 2DXQA 2QYVA 3A9LA 4KSFA 4HNXB 4A30A 2PJ0A 2GLFA 2CTBA 3LWUA 1WK4A 2Q4ZA 3R9GA 1I12A 2BL1A 1EZAA 2PIYA 5THWA 1YW4A 4J0NA 3FXTA 1I1DA 4PSWA 4NJRA 5LRGA 3TO9A 4MI4A 4RUHA 4IIXA 3PZJA 4KSIA 3TO6A 4F9VA 1S3ZA 3FX6A 4UCPA 3NE8A 3QB8A 4TWEA 2AUNA 2B0AA 2EK8A 3S9LA 3FNCA 4YGOA 4ZY0A 1LFWA 2C5QA 3EZBA 4NGMA 3S9MA 2Z3OA 2ABZA 2P6GA 2F7VA 4XPDC 3D7GA 1QQ9A 1XE4A 1NXJA 3D68A 1IB1E 2Z3MA 1XF8A 2Q04A 2G0BA 4UBRA 4MHNA 3VH9A 1TIQA 3WT4A 2J8RA 1L0CA 1KZFA 3TFYA 2BOAA 4JYWA 4P4DA 5J8CA 1KEEB 2Q7SA 4Z65A 4OIDA 4TJVA 2ZEHA 3WABA 1B87A 2VI7A 4NSQA 1XJOA 4PXBA 4ORFA 1YQEA 4B13A 4PPZA 4KOYA 2CNSA 4A95A 3D7FA 2Q43A 2RC4A 3S6FA 2VZZA 1Y9WA 5HXDA 4ZX9A 2X7BA 4QUSA 4NXYA 4RI1A 5AG6A 2R8VA 2QMLA 3FEDA 3PB4X 2PJ1A 2OR4A 4NGNA 4PK2A 5FVJA 5F9MA 4H89A 3RNZA 1KBLA 1XBUA 3RO0A 2GFQA 3FF3A 4KOSA 4AG7A 5KTCA 3DR8A 5HH1A 4YN3A 1RO5A 1YK3A 1Z8WA 1TKFA 3L2NA 4TNUA 3W91A 3T0TA 1BOBA 3GUXA 5JM6A 4Q36A 2CIJA 4NJQA 1IOFA 4CGNA 3LODA 4ZI6A 2OZUA 1IY7A 1IYLA 1GYTA 1Z2LA 3EO4A 1JQGA 2QJ8A 3KZWA 4II9A 3R9FA 4EYSA 1ZG8A 4KOVA 3EZEA 4OC2A 3FECA 3SJEA 4CDJA 1BLLE 4DUKA 2PC1A 3SHPA 5A28A 2CXAA 1Z8XA 1PYTB 2OB0A 4HPSA 1DIKA 1V0CA 2JEVA 4KOWA 3I6SA 4C84A 5G21A 1K4JA 1PU9A 1ELLP 1CJWA 2O4HA 4I49A 5LRJA 3PB6X 4MRIA 3B7IA 5LRKA 5F09A 3C26A 5IV0A 1MJAA 4KVXA 1GHEA 3KQZA 5A27A 1IU8A 1LRZA 4NGTA 4XPKA 5GCNA 5HVGA 5K8OA 1HEEA 3I9SA 2G9DA 3KKWA 5JGFA 4INJA 3D67A 2POKA 3B35A 2DPSA 1ZL0A 3R95A 4WWVA 3BJ7A 4COGA 4Q38A 1JWQA 2D4OA 3TLGB 1VKCA 4XNHB 1VIXA 3LD2A 2YNCA 3H8EA 2AFXA 1MJ9A 3QNVA 3KGQA 4UWIA 2PRQA 2PSWA 4C8TA 2JDDA 2V77A 4OIWA 1CPXA 4UCMA 1R43A 2HQYA 2VZYA 5LYIA 6CPAA 3DGVA 4EVYA 4FWUA 1CPSA 4ONUA 1AMPA 4C2ZA 2AFOA 4MY0A 4PSXA 4X2TA 1BXRB 1YVKA 2AUMA 4GS4A 3QAYA 3T5MA 3U1BA 5F47A 3ICUA 1CX8A 1VHSA 2DEAA 1A9XB 4X5KA 5AGEA 2YJVA 4ZX8A 3TLEA 2AE6A 4NEXA 3FJUA 2P6EA 4W9YA 4IHMA 1ON0A 4A32A 2EZAA 3NOJA 3SR3A 2F8HA 4R6TA 1DTDA 4C86A 2CNMA 3ISXA 3PP9A 2REEA 4KUAA 5AG7A 4AB7A 2IQ6A 2PCNA 4E0AA 3GIUA 4FD6A 1V6CA 3IWGA 4G1PA 4AG9A 4XNHC 3B3CA 3H8FA 4XPLA 4U9YA 2HUZA 1S7NA 5CPAA 4FUUA 5EC4A 4XPDB 1YX0A 2VBQA 1UWYA 2I79A 2HWGA 2Z3LA 1CM0A 1WVMA 1M1DA 1M4IA 4C7HA 1TXRA 1N71A 4DJLA 1NSAA 4LUAA 5AG4A 3IO1A 3SJGA 1M4GA 5K8NA 2FVGA 3T8WA 4KOTA 2ODFA 4ZGYB 4RN7A 1FT7A 2R82A 3G23A 1XIXA 1XFOA 4CDKA 3PB9X 2PIZA 4C8UA 3ZJ0A 2O53A 5LYFA 3CXPA 4C9RA 1ZG7A 4X8IA 3FVLA 2VEZA 2PQ8A 4R9MA 4MFLA 1VHOA 2AFZA 1NBWA 2ZELA 2ZXVA 4FD7A 3IFEA 2D0OA 3DNSA 4UWJA 5CBMA 1GGOA 3GY9A 4JVOA 4C99A 3SJFA 3IU2A 3D8PA 1VI4A 3WC5A 3D4UA 3KHXA 3WC7A 1JDBC 2IL4A 2QVPA 4IUSA 4KORA 4OC3A 2V8HA 3D66A 2GREA 3DDDA 2B4DA 2J8NA 1BAVA 4JWPA 4L8AA 1QSNA 4ZBGA 2ZW6A 4B11A 4UA3A 4CAVA 4CGPA 3IGRA 5I4MA 4QBJA 1S60A 3IJ3A 1YLOA 3B3TA 4UEEA 1VBGA 1ZG9A 4JXRA 3EFAA 2JDCA 4H6ZA 1WWZA 4PQAA 3IEHA 1R3NA 4JJXA 2PVVA 2YJTA 2BSWA 4P4BA 2DPTA 3HUVA
chains in the Genus database with same CATH topology
4UEFA 7CPAA 2XEIA 4NGQA 4DYOA 4NGRA 3SI0A 2ZEGA 4UEZA 1LCPA 1TKHA 1ELMP 1LOKA 3I74A 3JRUA 4TJXA 1IGBA 3PBEA 3K2KA 1YW6A 1F2OA 2RB7A 2OOTA 1CP6A 2V8VA 5LYDA 4C9UA 4OC4A 3GB0A 1Y0RA 1BPNA 3B3VA 3IWWA 4Q7AA 4P4IA 4EMEA 2GP4A 3LMSA 4A94A 1BPMA 1XF1A 2C6GA 2GLJA 4C8PA 2PJ8A 3NH4A 3KHZA 2RFHA 3D7HA 4IK2A 1KWMA 2XEJA 2PJ9A 1ZLIA 3BHXA 5LYLA 2NSMA 2GU2A 3PB7X 3MN8A 2BCOA 3KASA 4PXEA 4A38A 1TF8A 2C6PA 4P45A 4UF4A 2EWBA 3B3WA 5DS0A 4C8FA 3B3SA 3RBUA 2JBKA 1ZLHA 4MCQA 2ZEDA 3VTAA 4OC0A 4ZY2A 3PFOA 4OC5A 3IIBA 4UIBA 2ZEFA 3FMCA 1CP7A 3VATA 2C6CA 2ZEOA 1QMUA 4R7MA 3VARA 5D8NA 2IJZA 4A37A 4MHZA 4F9UA 4ZY1A 4C9AA 1F57A 4NGSA 4YU9A 4MCRA 1F2PA 2EK9A 2PJ6A 2BO9A 1Z5RA 5IR2A 1ARLA 1DE4C 5ELYA 2PJ5A 4R8FA 3KR5A 1YSJA 8CPAA 3NH8A 2XEFA 3NH5A 3D7DA 3PBBA 4MXUA 4LQGA 2PJ3A 2PJ7A 3K9TA 3PEIA 4C8AA 1Y7EA 3SI2A 4MCSA 4O23A 1HDQA 2C1CA 2HB6A 5HVHA 3PB8X 4JZ0A 5HVFA 1LAPA 3CDXA 4MMOA 4C85A 3MRUA 2CF4A 3ISZA 4UIAA 2PVWA 4EWTA 1VGYA 1HDUA 5IB9A 2CTCA 4P4JA 4ONWA 1Z8LA 4PXCA 4FAIA 4MHYA 3NFZA 2AFWA 4B6ZA 1ARMA 2ZENA 4BD9A 3S9NA 2WYRA 3H8GA 1OBRA 3FEEA 4C8CA 3N5FA 1M4LA 3BI0A 1TKJA 2ZEPA 3PFEA 1EE3P 2I3CA 3RAMA 1RTQA 2JEWA 2PE3A 4R76A 4P10A 4C9EA 5J1QA 1XMBA 2ZOGA 4H2KA 2AFUA 2V8GA 4F8ZA 4IAVA 1H8LA 1Y0YA 3CT9A 4P44A 4FBEA 1LANA 3V7ZA 5K8PA 3KI9A 4EFDA 2VL1A 3PRTA 3KL9A 1Q7LA 4P4EA 2PJBA 4PXDA 4C9VA 3IC1A 4KNGE 3DLJA 2ZEEA 4NFRA 4NGPA 2PJ2A 3FH4A 4OC1A 2AFMA 4OMEA 2PCUA 1Y9ZA 1PCAA 1TF9A 5D29A 4P6YA 4MHPA 4MCPA 1FNOA 3I1UA 4K3NA 4A39A 3BI1A 3CPXA 4CPAA 2AFSA 3NA6A 2PJCA 3BXMA 2PJAA 1CBXA 3RZAA 4GM5A 4P4FA 3CPAA 2ZOFA 3SI1A 3TC8A 2PJ4A 2ZEMA 4OP4A 2ANPA 3KQXA 1VHEA 4OKOA 2JBJA 3EIFA 3GLJA 3HLPA 3WC6A 2NYQA 2HC9A 4CDJA 3KR4A 3TX8A 2V8DA 4AXVA 4YWYA 3B2YA 1XRYA 2WZNA 2IMOA 2Q51A 2J9AA 3SJXA 1AYEA 1LAMA 1YMEA 4X3RA 4ZYQA 3V38A 4WJBA 1CG2A 2XEGA 5JH9A 2QYVA 2PJ0A 2GLFA 2CTBA 3LWUA 2Q4ZA 2PIYA 5THWA 1YW4A 4NJRA 5LRGA 4RUHA 4KSIA 4F9VA 3FX6A 4TWEA 2EK8A 3S9LA 4ZY0A 1LFWA 2C5QA 4NGMA 3S9MA 2ABZA 2F7VA 3D7GA 1QQ9A 3D68A 3VH9A 4MHNA 3WT4A 2BOAA 4JYWA 4P4DA 4TJVA 4Z65A 4OIDA 2ZEHA 3WABA 1XJOA 4PXBA 4PPZA 3D7FA 2Q43A 5HXDA 4ZX9A 3FEDA 3PB4X 2PJ1A 2OR4A 4NGNA 1XBUA 3FF3A 4YN3A 1TKFA 3L2NA 4TNUA 3GUXA 5JM6A 2CIJA 4NJQA 4ZI6A 1IY7A 1GYTA 1Z2LA 3KZWA 1JQGA 2QJ8A 1ZG8A 4OC2A 3FECA 3SJEA 1BLLE 4DUKA 1PYTB 4C84A 3I6SA 1ELLP 2O4HA 5LRJA 3PB6X 4MRIA 3B7IA 5LRKA 5F09A 3KQZA 5K8OA 4NGTA 5HVGA 1HEEA 2G9DA 5JGFA 3D67A 2POKA 3B35A 4WWVA 1VIXA 3H8EA 2AFXA 3QNVA 3KGQA 2PRQA 4C8TA 2V77A 4OIWA 1CPXA 1R43A 5LYIA 6CPAA 3DGVA 4FWUA 1CPSA 1AMPA 2AFOA 4X2TA 3ICUA 1CX8A 2DEAA 4ZX8A 3FJUA 4W9YA 4IHMA 2F8HA 4R6TA 1DTDA 4C86A 3ISXA 2IQ6A 1V6CA 4G1PA 3B3CA 3H8FA 5CPAA 4FUUA 1UWYA 1WVMA 1TXRA 4DJLA 1NSAA 3IO1A 3SJGA 5K8NA 2FVGA 3T8WA 1FT7A 4CDKA 1XFOA 3PB9X 2PIZA 4C8UA 2O53A 5LYFA 4C9RA 1ZG7A 4X8IA 3FVLA 1VHOA 2AFZA 2ZELA 3IFEA 5CBMA 4C99A 3SJFA 3WC5A 3D4UA 3KHXA 3WC7A 2QVPA 4OC3A 2V8HA 3D66A 2GREA 1BAVA 5I4MA 3IJ3A 1YLOA 3B3TA 4UEEA 1ZG9A 4PQAA 3IEHA 1R3NA 2PVVA 5K8MA 4P4BA 3HUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UEF A;  7CPA A;  2XEI A;  4NGQ A;  4DYO A;  4NGR A;  3SI0 A;  2ZEG A;  4UEZ A;  1LCP A;  1TKH A;  1ELM P;  1LOK A;  3I74 A;  3JRU A;  4TJX A;  1IGB A;  3PBE A;  3K2K A;  1YW6 A;  1F2O A;  2RB7 A;  2OOT A;  1CP6 A;  2V8V A;  5LYD A;  4C9U A;  4OC4 A;  3GB0 A;  1Y0R A;  1BPN A;  3B3V A;  3IWW A;  4Q7A A;  4P4I A;  4EME A;  3LMS A;  4A94 A;  1BPM A;  1XF1 A;  2C6G A;  2GLJ A;  4C8P A;  2PJ8 A;  3NH4 A;  3KHZ A;  2RFH A;  3D7H A;  4IK2 A;  1KWM A;  2XEJ A;  2PJ9 A;  1ZLI A;  3BHX A;  5LYL A;  2NSM A;  2GU2 A;  3PB7 X;  3MN8 A;  2BCO A;  3KAS A;  4PXE A;  4A38 A;  1TF8 A;  2C6P A;  4P45 A;  4UF4 A;  2EWB A;  3B3W A;  5DS0 A;  4C8F A;  3B3S A;  3RBU A;  2JBK A;  1ZLH A;  4MCQ A;  2ZED A;  3VTA A;  4OC0 A;  4ZY2 A;  3PFO A;  4OC5 A;  3IIB A;  4UIB A;  2ZEF A;  3FMC A;  1CP7 A;  3VAT A;  2C6C A;  2ZEO A;  1QMU A;  4R7M A;  3VAR A;  5D8N A;  2IJZ A;  4A37 A;  4MHZ A;  4F9U A;  4ZY1 A;  4C9A A;  1F57 A;  4NGS A;  4YU9 A;  4MCR A;  1F2P A;  2EK9 A;  2PJ6 A;  2BO9 A;  1Z5R A;  1ARL A;  1DE4 C;  5ELY A;  2PJ5 A;  4R8F A;  3KR5 A;  1YSJ A;  8CPA A;  3NH8 A;  2XEF A;  3NH5 A;  3D7D A;  3PBB A;  4MXU A;  4LQG A;  2PJ3 A;  2PJ7 A;  3K9T A;  3PEI A;  4C8A A;  1Y7E A;  3SI2 A;  4MCS A;  4O23 A;  1HDQ A;  2C1C A;  2HB6 A;  5HVH A;  3PB8 X;  4JZ0 A;  5HVF A;  1LAP A;  3CDX A;  4MMO A;  4C85 A;  3MRU A;  2CF4 A;  3ISZ A;  4UIA A;  2PVW A;  4EWT A;  1VGY A;  1HDU A;  5IB9 A;  2CTC A;  4P4J A;  4ONW A;  1Z8L A;  4PXC A;  4FAI A;  4MHY A;  3NFZ A;  2AFW A;  4B6Z A;  1ARM A;  2ZEN A;  4BD9 A;  3S9N A;  2WYR A;  3H8G A;  1OBR A;  3FEE A;  4C8C A;  3N5F A;  1M4L A;  3BI0 A;  1TKJ A;  2ZEP A;  3PFE A;  1EE3 P;  2I3C A;  3RAM A;  1RTQ A;  2JEW A;  2PE3 A;  4R76 A;  4P10 A;  4C9E A;  5J1Q A;  1XMB A;  2ZOG A;  4H2K A;  2AFU A;  2V8G A;  4F8Z A;  4IAV A;  1H8L A;  1Y0Y A;  3CT9 A;  4P44 A;  4FBE A;  1LAN A;  3V7Z A;  5K8P A;  3KI9 A;  4EFD A;  2VL1 A;  3PRT A;  3KL9 A;  1Q7L A;  4P4E A;  2PJB A;  4PXD A;  4C9V A;  3IC1 A;  4KNG E;  3DLJ A;  2ZEE A;  4NFR A;  4NGP A;  2PJ2 A;  3FH4 A;  4OC1 A;  2AFM A;  4OME A;  2PCU A;  1Y9Z A;  1PCA A;  1TF9 A;  5D29 A;  4P6Y A;  4MHP A;  4MCP A;  1FNO A;  3I1U A;  4K3N A;  4A39 A;  3BI1 A;  3CPX A;  4CPA A;  2AFS A;  3NA6 A;  2PJC A;  3BXM A;  2PJA A;  1CBX A;  3RZA A;  4GM5 A;  4P4F A;  3CPA A;  2ZOF A;  3SI1 A;  3TC8 A;  2PJ4 A;  2ZEM A;  4OP4 A;  2ANP A;  3KQX A;  1VHE A;  4OKO A;  2JBJ A;  3EIF A;  3GLJ A;  3HLP A;  3WC6 A;  2NYQ A;  2HC9 A;  4CDJ A;  3KR4 A;  3TX8 A;  2V8D A;  4AXV A;  4YWY A;  3B2Y A;  1XRY A;  2WZN A;  2IMO A;  2Q51 A;  2J9A A;  3SJX A;  1AYE A;  1LAM A;  1YME A;  4X3R A;  4ZYQ A;  3V38 A;  4WJB A;  1CG2 A;  2XEG A;  5JH9 A;  2QYV A;  2PJ0 A;  2GLF A;  2CTB A;  3LWU A;  2Q4Z A;  2PIY A;  5THW A;  1YW4 A;  4NJR A;  5LRG A;  4RUH A;  4KSI A;  4F9V A;  3FX6 A;  4TWE A;  2EK8 A;  3S9L A;  4ZY0 A;  1LFW A;  4NGM A;  3S9M A;  2ABZ A;  2F7V A;  3D7G A;  1QQ9 A;  3D68 A;  3VH9 A;  4MHN A;  3WT4 A;  2BOA A;  4JYW A;  4P4D A;  4TJV A;  4Z65 A;  4OID A;  2ZEH A;  3WAB A;  1XJO A;  4PXB A;  4PPZ A;  3D7F A;  2Q43 A;  5HXD A;  4ZX9 A;  3FED A;  3PB4 X;  2PJ1 A;  2OR4 A;  4NGN A;  1XBU A;  3FF3 A;  4YN3 A;  1TKF A;  3L2N A;  4TNU A;  3GUX A;  5JM6 A;  2CIJ A;  4NJQ A;  4ZI6 A;  1IY7 A;  1GYT A;  1Z2L A;  3KZW A;  1JQG A;  2QJ8 A;  1ZG8 A;  4OC2 A;  3FEC A;  3SJE A;  1BLL E;  4DUK A;  1PYT B;  4C84 A;  3I6S A;  1ELL P;  2O4H A;  5LRJ A;  3PB6 X;  4MRI A;  3B7I A;  5LRK A;  5F09 A;  3KQZ A;  5K8O A;  4NGT A;  5HVG A;  1HEE A;  2G9D A;  5JGF A;  3D67 A;  2POK A;  3B35 A;  4WWV A;  1VIX A;  3H8E A;  2AFX A;  3QNV A;  3KGQ A;  2PRQ A;  4C8T A;  2V77 A;  4OIW A;  1CPX A;  1R43 A;  5LYI A;  6CPA A;  3DGV A;  4FWU A;  1CPS A;  1AMP A;  2AFO A;  4X2T A;  3ICU A;  1CX8 A;  2DEA A;  4ZX8 A;  3FJU A;  4W9Y A;  4IHM A;  2F8H A;  4R6T A;  1DTD A;  4C86 A;  3ISX A;  2IQ6 A;  1V6C A;  4G1P A;  3B3C A;  3H8F A;  5CPA A;  4FUU A;  1UWY A;  1WVM A;  1TXR A;  4DJL A;  1NSA A;  3IO1 A;  3SJG A;  5K8N A;  2FVG A;  3T8W A;  1FT7 A;  4CDK A;  1XFO A;  3PB9 X;  2PIZ A;  4C8U A;  2O53 A;  5LYF A;  4C9R A;  1ZG7 A;  4X8I A;  3FVL A;  1VHO A;  2AFZ A;  2ZEL A;  3IFE A;  5CBM A;  4C99 A;  3SJF A;  3WC5 A;  3D4U A;  3KHX A;  3WC7 A;  2QVP A;  4OC3 A;  2V8H A;  3D66 A;  2GRE A;  1BAV A;  5I4M A;  3IJ3 A;  1YLO A;  3B3T A;  4UEE A;  1ZG9 A;  4PQA A;  3IEH A;  1R3N A;  2PVV A;  5K8M A;  4P4B A;  3HUV A; 
#chains in the Genus database with same CATH topology
 2F5I A;  5E96 A;  4UEF A;  5JVL A;  7CPA A;  3FRM A;  2XEI A;  4UFW A;  1Y7R A;  4KS9 A;  4NGQ A;  3D2M A;  4DYO A;  3EZA A;  1Z9U A;  3TO7 A;  4NGR A;  3SI0 A;  4BIN A;  2ZEG A;  4UEZ A;  1LCP A;  4KVO E;  1TKH A;  3R1K A;  1ELM P;  4JD6 A;  4CYQ A;  1LOK A;  3I74 A;  3JRU A;  4Y49 C;  1IIC A;  3F5B A;  2B3U A;  4TJX A;  1R57 A;  4NCZ A;  1IGB A;  3H5Z A;  5G20 A;  5IB0 A;  3TT2 A;  3PBE A;  4R3L A;  3W6X A;  3K2K A;  3WR7 A;  2VXK A;  3EXN A;  1YW6 A;  2OZH A;  1F2O A;  2ZW4 A;  2RB7 A;  2OOT A;  1CP6 A;  2V8V A;  5LYD A;  4MFJ A;  4FD5 A;  2MP0 A;  4C9U A;  4E94 A;  4R57 A;  2DF5 A;  4PK3 A;  3BLN A;  4OC4 A;  3GB0 A;  1Y0R A;  1BPN A;  2H5M A;  3B3V A;  3IWW A;  4IF5 A;  4Q7A A;  4C68 A;  4DNC A;  4C2Y A;  4P4I A;  4EME A;  3TOA A;  3VWD A;  2DIK A;  2GP4 A;  3FIX A;  3LMS A;  4A94 A;  1JDE A;  4CZ1 A;  1BPM A;  5K8M A;  2BEI A;  1KC7 A;  4KLW A;  1XF1 A;  2C6G A;  2GLJ A;  4BBH A;  2PJ8 A;  4C8P A;  3FBU A;  4KSA A;  3C8O A;  3NH4 A;  4U9Z A;  2WPX A;  1S7L A;  3IU1 A;  3N7Z A;  4UFX A;  3KHZ A;  2RFH A;  4MHD A;  1AUG A;  3D7H A;  2K5T A;  4IK2 A;  1KWM A;  3SXN A;  1IID A;  2PJ9 A;  2XEJ A;  1KUY A;  3NE7 A;  1ZLI A;  3BHX A;  3TLC A;  4MBU A;  5LYL A;  2NSM A;  1NSL A;  2GU2 A;  4C7I A;  4CGO A;  3PB7 X;  5JPH A;  2PR1 A;  3MN8 A;  2HRO A;  2BCO A;  4MJ8 A;  3P2F A;  2B5G A;  3KAS A;  2YNC C;  5KTD A;  4PXE A;  3W6S A;  3TYX A;  2OH1 A;  2Q4Y A;  3B8G A;  5F46 A;  4A38 A;  1TF8 A;  3P2H A;  4H1H A;  3F8K A;  2C6P A;  2G3T A;  4P45 A;  1Q5X A;  4UF4 A;  3TOB A;  2EWB A;  4F6A A;  3B3W A;  5DS0 A;  2Z3N A;  3B3S A;  4MFP A;  4C8F A;  2BUE A;  5JYB A;  5K99 A;  3LAC A;  3RBU A;  4AVC A;  2JBK A;  1NE9 A;  1ZLH A;  4MCQ A;  2ZED A;  2Y0M A;  5AG5 A;  3VTA A;  4OC0 A;  4ZY2 A;  4KOU A;  3E0K A;  5H86 A;  1UFH A;  3PFO A;  4OC5 A;  2OLS A;  4CS0 B;  3IIB A;  4UIB A;  4AVB A;  4LX9 A;  1QST A;  5DWM A;  3TE4 A;  2JLM A;  2ZEF A;  1CS0 B;  2FCK A;  4E2A A;  2EZB A;  3KRV A;  3FMC A;  1CP7 A;  3T05 A;  3VAT A;  2Q4V A;  2C6C A;  2ZEO A;  1QMU A;  4CAE A;  1VBH A;  4R7M A;  4B5O A;  4KLV A;  3VAR A;  5EMI A;  5I0C A;  2C27 A;  2WUU A;  2ZPA A;  3JVN A;  2P6F A;  3PGP A;  4NF1 A;  5D8N A;  2I00 A;  2IJZ A;  4MFZ A;  5FD8 A;  4R87 A;  1XOV A;  4A37 A;  4MHZ A;  1X12 A;  4F9U A;  4R3K A;  4IIY A;  4ZY1 A;  4CAF A;  2B4D B;  1F57 A;  4NGS A;  4YU9 A;  4B5P A;  4MCR A;  2Q44 A;  4CYO A;  5F5X A;  4C9A A;  5JQ4 A;  1F2P A;  2EK9 A;  3CZX A;  3MGD A;  1ZYM A;  3JTK A;  4CAW A;  2PJ6 A;  2BO9 A;  4L89 A;  1Z5R A;  5IR2 A;  1ARL A;  1DE4 C;  1RXT A;  2PJ5 A;  5ELY A;  4R8F A;  3KR5 A;  1YSJ A;  8CPA A;  3NH8 A;  2XEF A;  3GJZ A;  4COB A;  1J4J A;  3D7D A;  3EC4 A;  3G8W A;  3NH5 A;  3PBB A;  4AVA A;  2Z3K A;  2ZW7 A;  4K30 A;  4MXU A;  2Z10 A;  4LQG A;  2AJ6 A;  2PJ3 A;  2P0W A;  2PJ7 A;  3EY5 A;  3K9T A;  3PEI A;  2QEC A;  4QVT A;  1Y7E A;  2VQY A;  4MCS A;  4QB9 A;  5CNP A;  4Y49 B;  4O23 A;  3SI2 A;  2Z3P A;  1HDQ A;  3FB3 A;  2C1C A;  2HB6 A;  5HVH A;  3PB8 X;  2EO8 A;  3I3G A;  3K4I A;  1NMT A;  4JZ0 A;  5HVF A;  1LAP A;  3CDX A;  2YND A;  4MMO A;  4C85 A;  2PR8 A;  3MRU A;  1M6V B;  3DSB A;  4UCN A;  2Z11 A;  2CF4 A;  4M6H A;  3ISZ A;  4M8D A;  4OAD A;  4UIA A;  4B10 A;  2PVW A;  4EWT A;  1VGY A;  5J8F A;  1YGH A;  4CYP A;  1HDU A;  2FSR A;  4CGM A;  5IB9 A;  2R98 A;  2CTC A;  4P4J A;  4M3S A;  2J8M A;  4ONW A;  1Z8L A;  4HKF A;  2YGW A;  4PXC A;  4QC6 A;  4RS2 A;  4MHY A;  2OZG A;  3R9E A;  4CRZ B;  4FAI A;  1IOI A;  3NFZ A;  4CGL A;  1B6B A;  1U6M A;  2AFW A;  5DWN A;  3TLA A;  1YR0 A;  4B6Z A;  1ARM A;  2ZEN A;  3F0A A;  4BD9 A;  3S9N A;  2WYR A;  3H8G A;  1OBR A;  3FEE A;  4C2X A;  5ISV A;  2X0S A;  2CNT A;  1MK4 A;  3R96 A;  4YFJ A;  1QSM A;  3JUW A;  2QIR A;  5F1Y A;  4C8C A;  3N5F A;  5H84 A;  2R1I A;  1M4L A;  1EZB A;  2B3V A;  2FIA A;  3BI0 A;  2FT0 A;  1TKJ A;  3QAH A;  2ZEP A;  3PFE A;  3VWE A;  4E5S A;  1EE3 P;  3H4Q A;  2I3C A;  4OAE A;  3RAM A;  1CE8 B;  2YNE A;  2WPW A;  1RTQ A;  2B5G B;  2FL4 A;  2FXF A;  2JEW A;  2PE3 A;  5F48 A;  4R76 A;  3TCV A;  4A2Z A;  5C88 A;  1Z4E A;  3D2P A;  4P10 A;  4CAX A;  1Q2C A;  4C9E A;  1J3L A;  3TTH A;  5J1Q A;  1XMB A;  2ZOG A;  1IYK A;  3CXQ A;  4H2K A;  4KUB A;  2AFU A;  2V8G A;  3S6K A;  4UFV A;  1ZO0 A;  3UY5 A;  4IAV A;  4JXQ A;  5F49 A;  4PV6 A;  1H8L A;  4F8Z A;  4C8A A;  1Y0Y A;  4OLL A;  2EZC A;  2EUI A;  3CT9 A;  1C30 B;  2KCW A;  2D4P A;  2Q0Y A;  4P44 A;  4FBE A;  4MJX A;  1LAN A;  2FE7 A;  2PDO A;  4B14 A;  4F0X A;  5HMN A;  3V7Z A;  1Y9K A;  4B12 A;  2E28 A;  3V8I A;  5K8P A;  2Q7B A;  3KI9 A;  4EFD A;  2VL1 A;  3PRT A;  3TLY A;  3KL9 A;  1Q7L A;  4GXH A;  4P4E A;  1P0H A;  2WSA A;  3T9Y A;  2PJB A;  3RYO A;  1YLE A;  4PXD A;  3T07 A;  4FD4 A;  4MFK A;  4C9V A;  1OZP A;  3ZZI A;  3IC1 A;  4A33 A;  4KNG E;  2ATR A;  3TLB A;  2B58 A;  2HI6 A;  3DLJ A;  2ZEE A;  3K9U A;  4HNY B;  4NFR A;  4NGP A;  2EBJ A;  3TLZ A;  2PJ2 A;  3FH4 A;  4OC1 A;  2A4N A;  2B4B A;  4B5P B;  3G3S A;  3BJ8 A;  2FS5 A;  2AFM A;  4OME A;  3SXO A;  2PCU A;  1Y9Z A;  2FM4 A;  1PCA A;  1YVO A;  1TF9 A;  2HV2 A;  1SQH A;  4JLY A;  5D29 A;  5IX3 A;  5EBV A;  1QSR A;  4BMH A;  1R61 A;  4LQ6 A;  4P6Y A;  2REF A;  4MHP A;  4MCP A;  1FNO A;  3I1U A;  2D0P A;  4K3N A;  4A39 A;  5KTA A;  3GKR A;  4CO9 A;  3BI1 A;  1XEB A;  3CPX A;  4HNW B;  2AFS A;  4CPA A;  3NA6 A;  2PJC A;  3BXM A;  2PJA A;  3GYA A;  1CBX A;  1M44 A;  2NMT A;  3RZA A;  4GM5 A;  4P4F A;  1KUV A;  5G22 A;  1Z8T A;  1I21 A;  3CPA A;  3S6H A;  2ZOF A;  1MJB A;  1ZRS A;  4A31 A;  3SI1 A;  2O28 A;  2EVN A;  1X10 A;  2PJ4 A;  2ZEM A;  3TC8 A;  3DR6 A;  4OP4 A;  4YRH A;  4M85 A;  2ANP A;  3KQX A;  1VHE A;  4OKO A;  2CY2 A;  4CYN A;  4KVM E;  2JBJ A;  4H6U A;  1S7F A;  2Z0Z A;  4KOX A;  5G1Z A;  3EIF A;  4KZT A;  3FYN A;  3GLJ A;  3D3S A;  1Q2Y A;  4CRY B;  3T90 A;  2GIV A;  1KUX A;  4M6I A;  2OU2 A;  3HLP A;  3TLG A;  1P4N A;  4MY3 A;  1PUA A;  3WC6 A;  2G3A A;  2NYQ A;  1QSO A;  2HC9 A;  1A2Z A;  3KR4 A;  2GE3 A;  2ARH A;  1Z4R A;  2V8D A;  3TX8 A;  4AXV A;  4YWY A;  4MI1 A;  3B2Y A;  3OWC A;  3S6G A;  4U5Y A;  5C82 A;  4J3G A;  1M4D A;  1S7K A;  1T36 B;  1XRY A;  1XMT A;  1Q2D A;  4M6G A;  2WZN A;  1YRE A;  4F0Y A;  2FIW A;  2IMO A;  2R7H A;  3CXS A;  2PRB A;  1FY7 A;  2Q51 A;  2J9A A;  3SJX A;  1C3O B;  1AYE A;  1LAM A;  1YME A;  4MFQ A;  4X3R A;  4ZYQ A;  3V38 A;  4E8O A;  4WJB A;  1CG2 A;  2XEG A;  2ZW5 A;  1S5K A;  1BO4 A;  5JH9 A;  5BWA B;  2GAN A;  3IWE A;  2DXQ A;  2QYV A;  3A9L A;  4KSF A;  4HNX B;  4A30 A;  2PJ0 A;  2GLF A;  2CTB A;  3LWU A;  1WK4 A;  2Q4Z A;  3R9G A;  1I12 A;  2BL1 A;  1EZA A;  2PIY A;  5THW A;  1YW4 A;  4J0N A;  3FXT A;  1I1D A;  4PSW A;  4NJR A;  5LRG A;  3TO9 A;  4MI4 A;  4RUH A;  4IIX A;  3PZJ A;  4KSI A;  3TO6 A;  4F9V A;  1S3Z A;  3FX6 A;  4UCP A;  3NE8 A;  3QB8 A;  4TWE A;  2AUN A;  2B0A A;  2EK8 A;  3S9L A;  3FNC A;  4YGO A;  4ZY0 A;  1LFW A;  2C5Q A;  3EZB A;  4NGM A;  3S9M A;  2Z3O A;  2ABZ A;  2P6G A;  2F7V A;  4XPD C;  3D7G A;  1QQ9 A;  1XE4 A;  1NXJ A;  3D68 A;  1IB1 E;  2Z3M A;  1XF8 A;  2Q04 A;  2G0B A;  4UBR A;  4MHN A;  3VH9 A;  1TIQ A;  3WT4 A;  2J8R A;  1L0C A;  1KZF A;  3TFY A;  2BOA A;  4JYW A;  4P4D A;  5J8C A;  1KEE B;  2Q7S A;  4Z65 A;  4OID A;  4TJV A;  2ZEH A;  3WAB A;  1B87 A;  2VI7 A;  4NSQ A;  1XJO A;  4PXB A;  4ORF A;  1YQE A;  4B13 A;  4PPZ A;  4KOY A;  2CNS A;  4A95 A;  3D7F A;  2Q43 A;  2RC4 A;  3S6F A;  2VZZ A;  1Y9W A;  5HXD A;  4ZX9 A;  2X7B A;  4QUS A;  4NXY A;  4RI1 A;  5AG6 A;  2R8V A;  2QML A;  3FED A;  3PB4 X;  2PJ1 A;  2OR4 A;  4NGN A;  4PK2 A;  5FVJ A;  5F9M A;  4H89 A;  3RNZ A;  1KBL A;  1XBU A;  3RO0 A;  2GFQ A;  3FF3 A;  4KOS A;  4AG7 A;  5KTC A;  3DR8 A;  5HH1 A;  4YN3 A;  1RO5 A;  1YK3 A;  1Z8W A;  1TKF A;  3L2N A;  4TNU A;  3W91 A;  3T0T A;  1BOB A;  3GUX A;  5JM6 A;  4Q36 A;  2CIJ A;  4NJQ A;  1IOF A;  4CGN A;  3LOD A;  4ZI6 A;  2OZU A;  1IY7 A;  1IYL A;  1GYT A;  1Z2L A;  3EO4 A;  1JQG A;  2QJ8 A;  3KZW A;  4II9 A;  3R9F A;  4EYS A;  1ZG8 A;  4KOV A;  3EZE A;  4OC2 A;  3FEC A;  3SJE A;  4CDJ A;  1BLL E;  4DUK A;  2PC1 A;  3SHP A;  5A28 A;  2CXA A;  1Z8X A;  1PYT B;  2OB0 A;  4HPS A;  1DIK A;  1V0C A;  2JEV A;  4KOW A;  3I6S A;  4C84 A;  5G21 A;  1K4J A;  1PU9 A;  1ELL P;  1CJW A;  2O4H A;  4I49 A;  5LRJ A;  3PB6 X;  4MRI A;  3B7I A;  5LRK A;  5F09 A;  3C26 A;  5IV0 A;  1MJA A;  4KVX A;  1GHE A;  3KQZ A;  5A27 A;  1IU8 A;  1LRZ A;  4NGT A;  4XPK A;  5GCN A;  5HVG A;  5K8O A;  1HEE A;  3I9S A;  2G9D A;  3KKW A;  5JGF A;  4INJ A;  3D67 A;  2POK A;  3B35 A;  2DPS A;  1ZL0 A;  3R95 A;  4WWV A;  3BJ7 A;  4COG A;  4Q38 A;  1JWQ A;  2D4O A;  3TLG B;  1VKC A;  4XNH B;  1VIX A;  3LD2 A;  2YNC A;  3H8E A;  2AFX A;  1MJ9 A;  3QNV A;  3KGQ A;  4UWI A;  2PRQ A;  2PSW A;  4C8T A;  2JDD A;  2V77 A;  4OIW A;  1CPX A;  4UCM A;  1R43 A;  2HQY A;  2VZY A;  5LYI A;  6CPA A;  3DGV A;  4EVY A;  4FWU A;  1CPS A;  4ONU A;  1AMP A;  4C2Z A;  2AFO A;  4MY0 A;  4PSX A;  4X2T A;  1BXR B;  1YVK A;  2AUM A;  4GS4 A;  3QAY A;  3T5M A;  3U1B A;  5F47 A;  3ICU A;  1CX8 A;  1VHS A;  2DEA A;  1A9X B;  4X5K A;  5AGE A;  2YJV A;  4ZX8 A;  3TLE A;  2AE6 A;  4NEX A;  3FJU A;  2P6E A;  4W9Y A;  4IHM A;  1ON0 A;  4A32 A;  2EZA A;  3NOJ A;  3SR3 A;  2F8H A;  4R6T A;  1DTD A;  4C86 A;  2CNM A;  3ISX A;  3PP9 A;  2REE A;  4KUA A;  5AG7 A;  4AB7 A;  2IQ6 A;  2PCN A;  4E0A A;  3GIU A;  4FD6 A;  1V6C A;  3IWG A;  4G1P A;  4AG9 A;  4XNH C;  3B3C A;  3H8F A;  4XPL A;  4U9Y A;  2HUZ A;  1S7N A;  5CPA A;  4FUU A;  5EC4 A;  4XPD B;  1YX0 A;  2VBQ A;  1UWY A;  2I79 A;  2HWG A;  2Z3L A;  1CM0 A;  1WVM A;  1M1D A;  1M4I A;  4C7H A;  1TXR A;  1N71 A;  4DJL A;  1NSA A;  4LUA A;  5AG4 A;  3IO1 A;  3SJG A;  1M4G A;  5K8N A;  2FVG A;  3T8W A;  4KOT A;  2ODF A;  4ZGY B;  4RN7 A;  1FT7 A;  2R82 A;  3G23 A;  1XIX A;  1XFO A;  4CDK A;  3PB9 X;  2PIZ A;  4C8U A;  3ZJ0 A;  2O53 A;  5LYF A;  3CXP A;  4C9R A;  1ZG7 A;  4X8I A;  3FVL A;  2VEZ A;  2PQ8 A;  4R9M A;  4MFL A;  1VHO A;  2AFZ A;  1NBW A;  2ZEL A;  2ZXV A;  4FD7 A;  3IFE A;  2D0O A;  3DNS A;  4UWJ A;  5CBM A;  1GGO A;  3GY9 A;  4JVO A;  4C99 A;  3SJF A;  3IU2 A;  3D8P A;  1VI4 A;  3WC5 A;  3D4U A;  3KHX A;  3WC7 A;  1JDB C;  2IL4 A;  2QVP A;  4IUS A;  4KOR A;  4OC3 A;  2V8H A;  3D66 A;  2GRE A;  3DDD A;  2B4D A;  2J8N A;  1BAV A;  4JWP A;  4L8A A;  1QSN A;  4ZBG A;  2ZW6 A;  4B11 A;  4UA3 A;  4CAV A;  4CGP A;  3IGR A;  5I4M A;  4QBJ A;  1S60 A;  3IJ3 A;  1YLO A;  3B3T A;  4UEE A;  1VBG A;  1ZG9 A;  4JXR A;  3EFA A;  2JDC A;  4H6Z A;  1WWZ A;  4PQA A;  3IEH A;  1R3N A;  4JJX A;  2PVV A;  2YJT A;  2BSW A;  4P4B A;  2DPT A;  3HUV A; 
#chains in the Genus database with same CATH homology
 4UEF A;  7CPA A;  2XEI A;  4NGQ A;  4DYO A;  4NGR A;  3SI0 A;  2ZEG A;  4UEZ A;  1LCP A;  1TKH A;  1ELM P;  1LOK A;  3I74 A;  3JRU A;  4TJX A;  1IGB A;  3PBE A;  3K2K A;  1YW6 A;  1F2O A;  2RB7 A;  2OOT A;  1CP6 A;  2V8V A;  5LYD A;  4C9U A;  4OC4 A;  3GB0 A;  1Y0R A;  1BPN A;  3B3V A;  3IWW A;  4Q7A A;  4P4I A;  4EME A;  2GP4 A;  3LMS A;  4A94 A;  1BPM A;  1XF1 A;  2C6G A;  2GLJ A;  4C8P A;  2PJ8 A;  3NH4 A;  3KHZ A;  2RFH A;  3D7H A;  4IK2 A;  1KWM A;  2XEJ A;  2PJ9 A;  1ZLI A;  3BHX A;  5LYL A;  2NSM A;  2GU2 A;  3PB7 X;  3MN8 A;  2BCO A;  3KAS A;  4PXE A;  4A38 A;  1TF8 A;  2C6P A;  4P45 A;  4UF4 A;  2EWB A;  3B3W A;  5DS0 A;  4C8F A;  3B3S A;  3RBU A;  2JBK A;  1ZLH A;  4MCQ A;  2ZED A;  3VTA A;  4OC0 A;  4ZY2 A;  3PFO A;  4OC5 A;  3IIB A;  4UIB A;  2ZEF A;  3FMC A;  1CP7 A;  3VAT A;  2C6C A;  2ZEO A;  1QMU A;  4R7M A;  3VAR A;  5D8N A;  2IJZ A;  4A37 A;  4MHZ A;  4F9U A;  4ZY1 A;  4C9A A;  1F57 A;  4NGS A;  4YU9 A;  4MCR A;  1F2P A;  2EK9 A;  2PJ6 A;  2BO9 A;  1Z5R A;  5IR2 A;  1ARL A;  1DE4 C;  5ELY A;  2PJ5 A;  4R8F A;  3KR5 A;  1YSJ A;  8CPA A;  3NH8 A;  2XEF A;  3NH5 A;  3D7D A;  3PBB A;  4MXU A;  4LQG A;  2PJ3 A;  2PJ7 A;  3K9T A;  3PEI A;  4C8A A;  1Y7E A;  3SI2 A;  4MCS A;  4O23 A;  1HDQ A;  2C1C A;  2HB6 A;  5HVH A;  3PB8 X;  4JZ0 A;  5HVF A;  1LAP A;  3CDX A;  4MMO A;  4C85 A;  3MRU A;  2CF4 A;  3ISZ A;  4UIA A;  2PVW A;  4EWT A;  1VGY A;  1HDU A;  5IB9 A;  2CTC A;  4P4J A;  4ONW A;  1Z8L A;  4PXC A;  4FAI A;  4MHY A;  3NFZ A;  2AFW A;  4B6Z A;  1ARM A;  2ZEN A;  4BD9 A;  3S9N A;  2WYR A;  3H8G A;  1OBR A;  3FEE A;  4C8C A;  3N5F A;  1M4L A;  3BI0 A;  1TKJ A;  2ZEP A;  3PFE A;  1EE3 P;  2I3C A;  3RAM A;  1RTQ A;  2JEW A;  2PE3 A;  4R76 A;  4P10 A;  4C9E A;  5J1Q A;  1XMB A;  2ZOG A;  4H2K A;  2AFU A;  2V8G A;  4F8Z A;  4IAV A;  1H8L A;  1Y0Y A;  3CT9 A;  4P44 A;  4FBE A;  1LAN A;  3V7Z A;  5K8P A;  3KI9 A;  4EFD A;  2VL1 A;  3PRT A;  3KL9 A;  1Q7L A;  4P4E A;  2PJB A;  4PXD A;  4C9V A;  3IC1 A;  4KNG E;  3DLJ A;  2ZEE A;  4NFR A;  4NGP A;  2PJ2 A;  3FH4 A;  4OC1 A;  2AFM A;  4OME A;  2PCU A;  1Y9Z A;  1PCA A;  1TF9 A;  5D29 A;  4P6Y A;  4MHP A;  4MCP A;  1FNO A;  3I1U A;  4K3N A;  4A39 A;  3BI1 A;  3CPX A;  4CPA A;  2AFS A;  3NA6 A;  2PJC A;  3BXM A;  2PJA A;  1CBX A;  3RZA A;  4GM5 A;  4P4F A;  3CPA A;  2ZOF A;  3SI1 A;  3TC8 A;  2PJ4 A;  2ZEM A;  4OP4 A;  2ANP A;  3KQX A;  1VHE A;  4OKO A;  2JBJ A;  3EIF A;  3GLJ A;  3HLP A;  3WC6 A;  2NYQ A;  2HC9 A;  4CDJ A;  3KR4 A;  3TX8 A;  2V8D A;  4AXV A;  4YWY A;  3B2Y A;  1XRY A;  2WZN A;  2IMO A;  2Q51 A;  2J9A A;  3SJX A;  1AYE A;  1LAM A;  1YME A;  4X3R A;  4ZYQ A;  3V38 A;  4WJB A;  1CG2 A;  2XEG A;  5JH9 A;  2QYV A;  2PJ0 A;  2GLF A;  2CTB A;  3LWU A;  2Q4Z A;  2PIY A;  5THW A;  1YW4 A;  4NJR A;  5LRG A;  4RUH A;  4KSI A;  4F9V A;  3FX6 A;  4TWE A;  2EK8 A;  3S9L A;  4ZY0 A;  1LFW A;  2C5Q A;  4NGM A;  3S9M A;  2ABZ A;  2F7V A;  3D7G A;  1QQ9 A;  3D68 A;  3VH9 A;  4MHN A;  3WT4 A;  2BOA A;  4JYW A;  4P4D A;  4TJV A;  4Z65 A;  4OID A;  2ZEH A;  3WAB A;  1XJO A;  4PXB A;  4PPZ A;  3D7F A;  2Q43 A;  5HXD A;  4ZX9 A;  3FED A;  3PB4 X;  2PJ1 A;  2OR4 A;  4NGN A;  1XBU A;  3FF3 A;  4YN3 A;  1TKF A;  3L2N A;  4TNU A;  3GUX A;  5JM6 A;  2CIJ A;  4NJQ A;  4ZI6 A;  1IY7 A;  1GYT A;  1Z2L A;  3KZW A;  1JQG A;  2QJ8 A;  1ZG8 A;  4OC2 A;  3FEC A;  3SJE A;  1BLL E;  4DUK A;  1PYT B;  4C84 A;  3I6S A;  1ELL P;  2O4H A;  5LRJ A;  3PB6 X;  4MRI A;  3B7I A;  5LRK A;  5F09 A;  3KQZ A;  5K8O A;  4NGT A;  5HVG A;  1HEE A;  2G9D A;  5JGF A;  3D67 A;  2POK A;  3B35 A;  4WWV A;  1VIX A;  3H8E A;  2AFX A;  3QNV A;  3KGQ A;  2PRQ A;  4C8T A;  2V77 A;  4OIW A;  1CPX A;  1R43 A;  5LYI A;  6CPA A;  3DGV A;  4FWU A;  1CPS A;  1AMP A;  2AFO A;  4X2T A;  3ICU A;  1CX8 A;  2DEA A;  4ZX8 A;  3FJU A;  4W9Y A;  4IHM A;  2F8H A;  4R6T A;  1DTD A;  4C86 A;  3ISX A;  2IQ6 A;  1V6C A;  4G1P A;  3B3C A;  3H8F A;  5CPA A;  4FUU A;  1UWY A;  1WVM A;  1TXR A;  4DJL A;  1NSA A;  3IO1 A;  3SJG A;  5K8N A;  2FVG A;  3T8W A;  1FT7 A;  4CDK A;  1XFO A;  3PB9 X;  2PIZ A;  4C8U A;  2O53 A;  5LYF A;  4C9R A;  1ZG7 A;  4X8I A;  3FVL A;  1VHO A;  2AFZ A;  2ZEL A;  3IFE A;  5CBM A;  4C99 A;  3SJF A;  3WC5 A;  3D4U A;  3KHX A;  3WC7 A;  2QVP A;  4OC3 A;  2V8H A;  3D66 A;  2GRE A;  1BAV A;  5I4M A;  3IJ3 A;  1YLO A;  3B3T A;  4UEE A;  1ZG9 A;  4PQA A;  3IEH A;  1R3N A;  2PVV A;  5K8M A;  4P4B A;  3HUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...