2EK8A

Aminopeptidase from aneurinibacillus sp. strain am-1
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
412
structure length
412
Chain Sequence
ADHQITKRTDAENMYNTIQFLSQAPRVAGSPEELKAVRYIEQQFKSYGYHVEVQPFQFEGYTAPSEVTLKIGTEKKEGEAFTYSPNSDVTAELVYVGLGTTADVAGKDLNGKIALIQRGNISFADKVRNAAKQGAKAVIIYNNTDGKLNGTLGGSDASFVAAVGITKQEGDALAANLRAGEKITATVKVAGAEVKTLTSHNVIATKKPDANKKNTNDIIIIGSHHDSVEKAPGANDDASGVAVTLELARVMSKLKTDTELRFITFGAEENGLIGSKKYAASLSEDEIKRTIGMFQLDMVGSKDAGDLIMYTIDGKKNRVTDLGAAASSRLSGVLPYGQEGRSDHESFHALGIPAALFIHAPVEPWYHTPNDTLDKISKEKLDNVADIVGSAVYQAARPGELVIEPIDYPRRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a novel bacterial aminopeptidase with an apical domain from aneurinibacillus sp. strain AM-1
rcsb
source organism Aneurinibacillus sp.
molecule tags Hydrolase
molecule keywords Aminopeptidase
total genus 142
structure length 412
sequence length 412
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2ek8A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2ek8A02
2VL1A 3D4UA 3GB0A 3PRTA 3BI0A 2ZEMA 3CPAA 4CDJA 1R3NA 1ZLIA 3FEDA 1BPMA 3FJUA 1ARLA 3VH9A 2ZEHA 4DUKA 5JGFA 1BPNA 2PJ2A 1QMUA 1HEEA 4OC0A 3FEEA 3KASA 3I6SA 3H8FA 2AFXA 4TNUA 3S9NA 4NGTA 4OC3A 3D7HA 1DE4C 3IO1A 2OR4A 3B3TA 2F7VA 1CPSA 5IB9A 2HB6A 2PJ6A 1LAMA 4NGNA 1F2OA 3LWUA 1LAPA 3SJFA 4MMOA 3VARA 3V7ZA 5D29A 3FH4A 2OOTA 3FMCA 4A38A 3SI0A 1IGBA 2C6GA 4CPAA 4OC1A 3DGVA 5HVGA 2JEWA 7CPAA 2IJZA 3IEHA 4C86A 1LCPA 4C8PA 3PFEA 6CPAA 1F57A 4P4FA 1LOKA 5HVFA 4C9EA 4MCSA 4ONWA 5JM6A 3K2KA 4IAVA 3B7IA 2ZELA 3JRUA 1CPXA 4NJQA 3D7FA 2JBKA 2PJCA 1ZG9A 1KWMA 2ZOFA 4EFDA 2PIYA 4MXUA 4WWVA 1XF1A 4R8FA 2XEJA 3MRUA 5K8PA 1CBXA 2POKA 2ZEOA 4OIWA 1PYTB 3KHXA 4PXCA 1XMBA 2ZOGA 4KSIA 3TC8A 5K8OA 4NGMA 4NJRA 1AYEA 3CPXA 2C6CA 1TF8A 2GU2A 5ELYA 5DS0A 2NSMA 2PIZA 2PJ0A 1WVMA 1ARMA 4C99A 3PEIA 3B3SA 3B2YA 1ZG7A 2PJ5A 4OMEA 3FX6A 1TKJA 3RZAA 3WC7A 2I3CA 2PRQA 4ZY0A 2ZENA 4C8TA 3IJ3A 3GLJA 4NGRA 4EMEA 1AMPA 4F8ZA 1XJOA 2J9AA 1Z8LA 1ZG8A 1CP7A 1CG2A 4PXDA 4UEZA 2FVGA 4PPZA 4PQAA 3MN8A 5CBMA 3KQXA 4DYOA 1VHEA 2XEIA 1VIXA 3WC5A 3FECA 4ZY1A 3CT9A 5LYDA 1M4LA 4MCRA 4FBEA 4F9UA 4C8AA 2PVVA 5J1QA 3FVLA 3H8GA 3KR4A 4P44A 5K8NA 2CF4A 4W9YA 1UWYA 1TXRA 4UEFA 3GUXA 4P45A 4NFRA 4FAIA 4JZ0A 1F2PA 1JQGA 3KL9A 1OBRA 4OC5A 2C6PA 4FWUA 3D67A 4TWEA 5D8NA 5K8MA 3IWWA 2RFHA 4C84A 2NYQA 3VATA 2ZEDA 4C9UA 2EK9A 2PJ1A 2CTBA 1Y9ZA 3B3CA 3K9TA 2GLJA 3KHZA 3PB6X 5F09A 5HXDA 4C85A 1Z5RA 3N5FA 3FF3A 2XEFA 4P10A 1TKFA 4ZX8A 5HVHA 4C8FA 2PE3A 3ISZA 1BAVA 4K3NA 3S9MA 4LQGA 2AFOA 3PBEA 3V38A 3HLPA 4KNGE 4NGSA 3RBUA 1YSJA 2AFUA 2WZNA 1RTQA 4UIAA 3IFEA 5LYIA 3I74A 4MHZA 3D68A 2AFSA 1HDQA 4IHMA 2Q4ZA 3SJXA 1BLLE 4X2TA 4Z65A 3NA6A 4OC4A 4Q7AA 2BCOA 4RUHA 3PB4X 4G1PA 2PVWA 2QYVA 4DJLA 4TJXA 3RAMA 4R76A 1DTDA 1YW4A 5I4MA 3KQZA 2ZEEA 2AFZA 2ZEFA 4MHNA 2PCUA 4H2KA 3T8WA 5THWA 4P4DA 3PB8X 1QQ9A 1XRYA 3PB9X 3D7DA 4X8IA 1R43A 4MRIA 4P6YA 1IY7A 3BHXA 3ISXA 4C9VA 2GLFA 4ZX9A 3SI1A 2AFWA 4F9VA 1FT7A 5LYLA 1NSAA 4NGPA 2F8HA 5LRKA 4GM5A 2EK8A 1LFWA 2AFMA 2BOAA 2Q43A 3EIFA 4YU9A 2V8HA 4UIBA 4BD9A 2GREA 3PB7X 3S9LA 1CP6A 1H8LA 1ELLP 4TJVA 2V8DA 3D66A 4ZI6A 4MCPA 4A94A 2V77A 3B35A 4A37A 1XBUA 2QVPA 4ZYQA 3IC1A 4EWTA 3H8EA 2PJAA 4MHPA 5LRGA 3HUVA 2PJ4A 4ZY2A 4X3RA 4MHYA 2ANPA 4MCQA 4C8CA 2IQ6A 3B3WA 3NH8A 4P4JA 3WT4A 4P4IA 2O53A 1Y0RA 4UF4A 1YMEA 1PCAA 1Y0YA 4YWYA 3KZWA 1Z2LA 4A39A 3QNVA 5LRJA 2ZEGA 4IK2A 1GYTA 1TF9A 2PJBA 4NGQA 4OC2A 1V6CA 3PFOA 3WC6A 2C1CA 3KI9A 3WABA 4O23A 3SI2A 1LANA 3SJEA 2Q51A 2CIJA 2PJ9A 4PXEA 3DLJA 2JBJA 4R6TA 3KGQA 2IMOA 1XFOA 2QJ8A 3BI1A 5LYFA 3KR5A 3L2NA 1HDUA 1EE3P 5CPAA 2WYRA 3D7GA 4FUUA 5JH9A 4C9AA 2PJ8A 4P4EA 3VTAA 2EWBA 4R7MA 3TX8A 1YW6A 3LMSA 2ZEPA 4JYWA 4CDKA 2ABZA 4OIDA 1YLOA 1VHOA 4AXVA 3SJGA 2BO9A 8CPAA 2DEAA 1TKHA 2PJ7A 2G9DA 4P4BA 4UEEA 2CTCA 4WJBA 3ICUA 2O4HA 2PJ3A 1FNOA 4OP4A 1ELMP 2HC9A 2RB7A 3B3VA 4B6ZA 3BXMA 3CDXA 1Q7LA 3PBBA 2V8VA 3IIBA 2V8GA 3NH5A 1ZLHA 2XEGA 4C8UA 1Y7EA 3I1UA 3NFZA 4PXBA 4YN3A 3NH4A 4C9RA 1CX8A 1VGYA 4OKOA
chains in the Genus database with same CATH superfamily
1IIDA 2VL1A 2FE7A 3D4UA 1QSMA 2I00A 3GB0A 3PRTA 2Z3NA 2Q0YA 4LX9A 4QUSA 2QIRA 4KOXA 3BI0A 1RXTA 2J8MA 4C7HA 1JDEA 2ZEMA 3CPAA 5F1YA 4CDJA 1IYLA 1R3NA 1ZLIA 2FS5A 3FEDA 1BPMA 3FJUA 1ARLA 3SHPA 3VH9A 2Q04A 2ZEHA 4DUKA 5JGFA 3V8IA 1NE9A 2R1IA 3RNZA 1BPNA 1X12A 1QMUA 1HEEA 2B3VA 2PJ2A 4KSAA 4OC0A 3FEEA 3KASA 4UFXA 4COBA 2GIVA 5C88A 3I6SA 1VHSA 2D0PA 5DWNA 3H8FA 2AFXA 3I3GA 4TNUA 3S9NA 4NGTA 2OLSA 4CYQA 2CXAA 4OC3A 4B11A 3D7HA 1DE4C 4GS4A 3DSBA 4KOTA 3IO1A 3RO0A 4C7IA 1J3LA 2OR4A 3B3TA 2CNSA 2F7VA 1Z9UA 1CPSA 2REEA 5IB9A 4M6GA 2GP4A 2HB6A 3GYAA 2PJ6A 1LAMA 2B58A 2HUZA 3CXPA 2EVNA 3KKWA 5G21A 3T0TA 4NGNA 1F2OA 4BMHA 4CRZB 3CXSA 2QMLA 4A31A 2B4DA 3LWUA 1S7FA 5JVLA 3P2HA 1LAPA 2Y0MA 3BJ8A 4MMOA 3R9GA 3SJFA 4C68A 2Q44A 4J0NA 1QSOA 3VARA 3TLEA 1EZAA 5AG4A 1VBHA 3V7ZA 4M6HA 1M4DA 4YFJA 1XE4A 1IYKA 5D29A 4BBHA 3JVNA 2BEIA 1KZFA 2K5TA 2P6FA 3FYNA 3E0KA 1P4NA 2VZYA 1FY7A 3FH4A 4HNXB 4XPDB 2OOTA 1UFHA 3FMCA 4H6ZA 2GFQA 4A38A 2DPTA 3SI0A 2HQYA 4ORFA 1S3ZA 3TLAA 2EZCA 4QB9A 1IGBA 2C6GA 4CPAA 2KCWA 3TT2A 4OC1A 3DGVA 5HVGA 2JEWA 7CPAA 1Z8WA 2IJZA 3IEHA 3FIXA 4C86A 1LCPA 1J4JA 2Z11A 2ATRA 3PFEA 4C8PA 6CPAA 5DWMA 1JDBC 1F57A 4PV6A 4P4FA 1LOKA 1TIQA 2FIWA 4B13A 3ZJ0A 5HVFA 4C9EA 4MCSA 4ONWA 5JM6A 2FIAA 2Z3PA 3D2PA 3H4QA 3K2KA 4IAVA 2WPWA 3B7IA 2E28A 2ZELA 1Y9KA 2AE6A 1CPXA 3JRUA 4NJQA 3D7FA 4KSFA 2JBKA 2PJCA 4XPLA 1ZG9A 4C2XA 4AG9A 4B5PA 1KWMA 2B0AA 2ZOFA 4M85A 3TO7A 2PIYA 3VWEA 4EFDA 2ZW6A 3R96A 3W6SA 5BWAB 4L8AA 2FL4A 3TOBA 4MXUA 4WWVA 4CGPA 5J8FA 1XF1A 4R8FA 1A2ZA 2XEJA 3MRUA 5K8PA 3LD2A 1R61A 1CBXA 2OB0A 2POKA 2ZEOA 4OIWA 1PYTB 1Q5XA 3KHXA 4E2AA 4PXCA 1XMBA 2ZOGA 4ZBGA 3SR3A 4KSIA 4Q38A 3TC8A 4ZGYB 3I9SA 2EZAA 3TE4A 5K8OA 4MI1A 1PU9A 4XNHC 3QAHA 5AG6A 4NGMA 4NJRA 4CAXA 1ZO0A 4H6UA 4MFKA 1AYEA 3CPXA 4M3SA 4NF1A 1T36B 2C6CA 4UFWA 2PCNA 1TF8A 1YGHA 2CNMA 2GU2A 4KOSA 4UCPA 5ELYA 5DS0A 5G22A 5IX3A 4UWIA 2NSMA 2PIZA 2PJ0A 2PR8A 1ARMA 4OAEA 4UBRA 3B3SA 3PEIA 5F48A 4C99A 3B2YA 3FB3A 4M6IA 2ZXVA 3QB8A 4MY0A 4OADA 2HWGA 1ZG7A 1X10A 2PJ5A 3FX6A 4OMEA 3DNSA 4KLVA 4KOUA 5G1ZA 1XOVA 5CNPA 1TKJA 2EBJA 3RZAA 4YRHA 3WC7A 2I3CA 4FD6A 2PRQA 5H84A 4KNGE 4ZY0A 4B14A 5F5XA 4KUAA 2ZENA 3G23A 4E5SA 2CNTA 4C8TA 2R7HA 3IJ3A 3GLJA 4LQ6A 4NGRA 2AUNA 1VBGA 4JWPA 4A32A 2P0WA 3GKRA 4R3KA 4EMEA 1AMPA 1MJBA 1YK3A 4F8ZA 1XJOA 2J9AA 3IWEA 4PSWA 4QC6A 1Z8LA 1CP7A 1ZG8A 1CG2A 4BINA 4H89A 2ODFA 4PXDA 1XMTA 4UEZA 2FVGA 2B4DB 3LODA 4KVXA 2OU2A 4PPZA 4PQAA 2OZGA 1BOBA 4MBUA 2GANA 3MN8A 5CBMA 3KQXA 4CGMA 2BSWA 4DYOA 1VHEA 2XEIA 1VIXA 5AGEA 3SXNA 3WC5A 3FECA 4RS2A 1B6BA 4CGLA 3K4IA 4ZY1A 3BLNA 3CT9A 5LYDA 1U6MA 1M4LA 1NBWA 4C2ZA 3TLGA 4MCRA 2JEVA 1SQHA 4B12A 4FBEA 4F9UA 3D3SA 4C8AA 3F8KA 2PVVA 4R87A 4CZ1A 5J1QA 3FVLA 3H8GA 4NEXA 3KR4A 4P44A 3VWDA 5K8NA 2YNCC 2CF4A 5F46A 4W9YA 1UWYA 4U9YA 4C2YA 1TXRA 4UEFA 3GJZA 2BUEA 3GUXA 3JUWA 1P0HA 4MJ8A 3DR8A 3S6KA 1CE8B 4P45A 4NFRA 4FAIA 2D4PA 3CZXA 4JZ0A 1F2PA 1JQGA 1XIXA 3KL9A 4HNWB 4X5KA 1OBRA 4NSQA 4OC5A 2C6PA 4FWUA 1M44A 3D67A 1I21A 4TWEA 5D8NA 3IWWA 4CAVA 2RFHA 5K8MA 1YREA 4C84A 1EZBA 2NYQA 4U9ZA 2NMTA 2IL4A 2GE3A 1IB1E 2EK9A 2ZEDA 3N7ZA 3VATA 4AVCA 2R82A 4C9UA 2PJ1A 2B5GB 2CTBA 2ZW5A 1Y9ZA 4F0YA 3B3CA 3K9TA 2GLJA 3KHZA 5JPHA 3PB6X 2DPSA 4MY3A 4A95A 2B5GA 5F09A 5HXDA 2EUIA 4C85A 1Z5RA 2RC4A 3N5FA 3FF3A 2XEFA 1C30B 4P10A 1M1DA 1V0CA 2QECA 4JLYA 3NE8A 1TKFA 4ZX8A 2OZUA 2FSRA 2PC1A 3EFAA 2Q4VA 1R57A 2YNEA 2X0SA 5HVHA 3C8OA 4C8FA 2PE3A 3ISZA 1BAVA 4A2ZA 4JVOA 3TYXA 4CYOA 2F5IA 4PSXA 1YVOA 4K3NA 3S9MA 3P2FA 1S7LA 3H5ZA 4LQGA 4B5OA 4I49A 2AFOA 3UY5A 3PBEA 2VBQA 3HLPA 4R3LA 3A9LA 3QAYA 4NGSA 3V38A 2Z3KA 4AG7A 5FD8A 3RBUA 2O28A 2VQYA 2PSWA 3IGRA 1YSJA 2AFUA 2WZNA 1RTQA 5GCNA 4LUAA 4UIAA 3EZAA 3IFEA 5LYIA 3U1BA 3I74A 3W6XA 5F49A 4F6AA 4MHZA 4ONUA 3T90A 4GXHA 3D68A 2AFSA 4FD5A 4UCMA 2HROA 1PUAA 1HDQA 3BJ7A 4MFPA 4IHMA 4MFZA 4R57A 2Q4ZA 1JWQA 3SJXA 1BLLE 4X2TA 2P6EA 2OZHA 4Z65A 5FVJA 5IV0A 3NA6A 4OC4A 4Q7AA 2BCOA 4RUHA 4JXQA 1MJAA 3T5MA 1I12A 3PB4X 4G1PA 2PVWA 2QYVA 1WWZA 5G20A 4DJLA 4TJXA 1CJWA 3RAMA 1LRZA 2G3AA 2YGWA 4Y49B 5EBVA 4R76A 4CS0B 2D0OA 1DTDA 1YW4A 5I4MA 3KQZA 2FCKA 1WVMA 5AG7A 1NSLA 1NMTA 2ZEEA 2REFA 2AFZA 2ZEFA 4MHNA 2X7BA 5IR2A 4FD7A 2PCUA 4H2KA 1S60A 4JD6A 3T8WA 5THWA 4II9A 1AUGA 3GY9A 5C82A 4P4DA 3FNCA 2I79A 1QQ9A 3PB8X 3SXOA 1XRYA 3PB9X 2DF5A 1BXRB 3D7DA 5KTDA 3EO4A 4X8IA 1R43A 2JDDA 3K9UA 4MRIA 5JQ4A 2Z10A 4JXRA 4P6YA 1IY7A 2Z3MA 3BHXA 2ZW7A 2GLFA 3ISXA 4ZX9A 4NXYA 3TLGB 1Z4RA 3SI1A 4C9VA 3NE7A 4PK3A 4NCZA 1Z8TA 4CAEA 4CGNA 2AFWA 4CAFA 1M4GA 5I0CA 3TLBA 4RN7A 4CRYB 4F9VA 2WUUA 1FT7A 1KUVA 5LYLA 1MK4A 5KTCA 1NSAA 2R98A 3DDDA 4NGPA 2HV2A 4E8OA 4KZTA 1Q2CA 2F8HA 4MJXA 2FM4A 2Z3LA 5LRKA 4GM5A 1S5KA 2EK8A 4EYSA 1LFWA 2AFMA 1IICA 2YNCA 3PP9A 3TCVA 2BOAA 2Q43A 1QSNA 3EIFA 4A33A 5KTAA 1YVKA 2CY2A 4OLLA 4B5PB 4YU9A 2V8HA 4UIBA 5A28A 1Z4EA 4BD9A 2GREA 4HNYB 3WR7A 5HMNA 3PB7X 3S9LA 1CP6A 1H8LA 1ELLP 4TJVA 2WPXA 2V8DA 3D66A 4ZI6A 4DNCA 1Y7RA 1WK4A 2VXKA 4MCPA 4A94A 1VI4A 2EO8A 4AB7A 2V77A 3B35A 4A37A 1XBUA 1QSRA 2QVPA 1IU8A 4KOWA 3S6HA 4R9MA 4ZYQA 3IC1A 4KOYA 3R95A 4EWTA 2G0BA 1C3OB 3H8EA 2PJAA 5HH1A 1M4IA 3EC4A 4KOVA 3R9FA 4MHPA 1ZL0A 1Q2YA 3OWCA 3MGDA 5LRGA 5JYBA 2B3UA 2Z0ZA 2JLMA 3HUVA 2PJ4A 4UFVA 2PRBA 5EC4A 4ZY2A 4X3RA 4QBJA 2VEZA 4MHYA 2ANPA 4PK2A 1N71A 4MCQA 2J8RA 4C8CA 3DR6A 2C5QA 5K99A 2YNDA 2R8VA 2IQ6A 2YJVA 3B3WA 3NH8A 1ZYMA 4P4JA 1B87A 3WT4A 4P4IA 2O53A 4MFLA 1Y0RA 1VKCA 3R1KA 3C26A 4HKFA 4KORA 1YMEA 1PCAA 4UF4A 3TO9A 1KBLA 1IOFA 1Y0YA 3IU1A 3KZWA 4YWYA 4K30A 1Z2LA 4AVBA 5F47A 4IIYA 4M8DA 3ZZIA 4A39A 5J8CA 2D4OA 3CXQA 1QSTA 3QNVA 1XF8A 2A4NA 4KLWA 5LRJA 2ZEGA 4IK2A 4KVME 5ISVA 1GYTA 1TF9A 1OZPA 2PJBA 4NGQA 4OC2A 1Z8XA 4MFQA 2VZZA 3PFOA 3TTHA 1V6CA 4MFJA 1L0CA 3F5BA 3WC6A 3T07A 2C1CA 3KI9A 3WABA 1BO4A 3F0AA 4CYNA 4O23A 2C27A 3SI2A 1M6VB 4CO9A 4KUBA 1GGOA 2EZBA 1LANA 3SJEA 2Q51A 2CIJA 1YR0A 2PJ9A 4PXEA 2FXFA 4CYPA 3DLJA 4CGOA 4JJXA 4IUSA 1KUXA 2JBJA 4KVOE 3TOAA 4R6TA 1YQEA 3S6GA 3KGQA 1NXJA 2B4BA 2PQ8A 3TLCA 1CS0B 2IMOA 1XFOA 2VI7A 4B10A 3FRMA 2HI6A 4U5YA 5AG5A 4EVYA 2QJ8A 4HPSA 4MI4A 3EXNA 2AJ6A 2BL1A 2WSAA 3BI1A 5LYFA 3S6FA 4UA3A 4IIXA 2AUMA 3KR5A 2J8NA 4CAWA 1Q2DA 1HDUA 1EE3P 3L2NA 5CPAA 4UCNA 1CM0A 2MP0A 3IU2A 4XNHB 2Q7BA 3EY5A 2WYRA 3D7GA 2ZPAA 4FUUA 5JH9A 2H5MA 3KRVA 2Q7SA 3FXTA 4XPDC 1DIKA 4MHDA 2DIKA 4FD4A 4QVTA 4C9AA 5H86A 2PJ8A 4P4EA 3R9EA 3VTAA 2EWBA 3GIUA 3IWGA 4R7MA 1YW6A 3TX8A 1KUYA 4COGA 4AVAA 2OH1A 4E0AA 4KS9A 4A30A 3LMSA 2ZEPA 4JYWA 4CDKA 1RO5A 3D8PA 5EMIA 2ABZA 2Z3OA 1YLOA 4OIDA 2PR1A 1VHOA 4AXVA 1A9XB 4UWJA 1XEBA 1GHEA 1KC7A 3G8WA 3SJGA 2YJTA 2BO9A 4Y49C 4F0XA 1ZRSA 8CPAA 2DEAA 1TKHA 2PJ7A 1K4JA 4H1HA 3LACA 2G9DA 4YGOA 4P4BA 4INJA 3B8GA 4UEEA 3TFYA 2CTCA 3EZBA 4WJBA 3ICUA 5F9MA 2G3TA 3T05A 3FBUA 1YX0A 4E94A 2O4HA 2ARHA 2PJ3A 1FNOA 2ZW4A 3RYOA 3PZJA 4OP4A 3NOJA 2Q4YA 1ELMP 2HC9A 2JDCA 4L89A 4J3GA 3TLYA 2RB7A 3B3VA 3TO6A 5IB0A 3TLZA 4B6ZA 3T9YA 1S7KA 3BXMA 3CDXA 1Q7LA 1I1DA 1Y9WA 2DXQA 1IOIA 3D2MA 3PBBA 2V8VA 3EZEA 4RI1A 1KEEB 3IIBA 2V8GA 2P6GA 1S7NA 3NH5A 1ON0A 3JTKA 4IF5A 1ZLHA 4Q36A 2XEGA 5E96A 3PGPA 4C8UA 5A27A 1Y7EA 3I1UA 3NFZA 2PDOA 4PXBA 1MJ9A 3NH4A 1CX8A 1VGYA 4XPKA 4YN3A 4C9RA 3G3SA 4OKOA 2FT0A 3W91A 1YLEA
chains in the Genus database with same CATH topology
2VL1A 3D4UA 3GB0A 3PRTA 3BI0A 2ZEMA 3CPAA 4CDJA 1R3NA 1ZLIA 3FEDA 1BPMA 3FJUA 1ARLA 3VH9A 2ZEHA 4DUKA 5JGFA 1BPNA 2PJ2A 1QMUA 1HEEA 4OC0A 3FEEA 3KASA 3I6SA 3H8FA 2AFXA 4TNUA 3S9NA 4NGTA 4OC3A 3D7HA 1DE4C 3IO1A 2OR4A 3B3TA 2F7VA 1CPSA 5IB9A 2GP4A 2HB6A 2PJ6A 1LAMA 4NGNA 1F2OA 3LWUA 1LAPA 3SJFA 4MMOA 3VARA 3V7ZA 5D29A 3FH4A 2OOTA 3FMCA 4A38A 3SI0A 1IGBA 2C6GA 4CPAA 4OC1A 3DGVA 5HVGA 2JEWA 7CPAA 2IJZA 3IEHA 4C86A 1LCPA 4C8PA 3PFEA 6CPAA 1F57A 4P4FA 1LOKA 5HVFA 4C9EA 4MCSA 4ONWA 5JM6A 3K2KA 4IAVA 3B7IA 2ZELA 3JRUA 1CPXA 4NJQA 3D7FA 2JBKA 2PJCA 1ZG9A 1KWMA 2ZOFA 4EFDA 2PIYA 4MXUA 4WWVA 1XF1A 4R8FA 2XEJA 3MRUA 5K8PA 1CBXA 2POKA 2ZEOA 4OIWA 1PYTB 3KHXA 4PXCA 1XMBA 2ZOGA 4KSIA 3TC8A 5K8OA 4NGMA 4NJRA 1AYEA 3CPXA 2C6CA 1TF8A 2GU2A 5ELYA 5DS0A 2NSMA 2PIZA 2PJ0A 1WVMA 1ARMA 4C99A 3PEIA 3B3SA 3B2YA 1ZG7A 2PJ5A 4OMEA 3FX6A 1TKJA 3RZAA 3WC7A 2I3CA 2PRQA 4ZY0A 2ZENA 4C8TA 3IJ3A 3GLJA 4NGRA 4EMEA 1AMPA 4F8ZA 1XJOA 2J9AA 1Z8LA 1ZG8A 1CP7A 1CG2A 4PXDA 4UEZA 2FVGA 4PPZA 4PQAA 3MN8A 5CBMA 3KQXA 4DYOA 1VHEA 2XEIA 1VIXA 3WC5A 3FECA 4ZY1A 3CT9A 5LYDA 1M4LA 4MCRA 4FBEA 4F9UA 4C8AA 2PVVA 5J1QA 3FVLA 3H8GA 3KR4A 4P44A 5K8NA 2CF4A 4W9YA 1UWYA 1TXRA 4UEFA 3GUXA 4P45A 4NFRA 4FAIA 4JZ0A 1F2PA 1JQGA 3KL9A 1OBRA 4OC5A 2C6PA 4FWUA 3D67A 4TWEA 5D8NA 5K8MA 3IWWA 2RFHA 4C84A 2NYQA 3VATA 2ZEDA 4C9UA 2EK9A 2PJ1A 2CTBA 1Y9ZA 3B3CA 3K9TA 2GLJA 3KHZA 3PB6X 5F09A 5HXDA 4C85A 1Z5RA 3N5FA 3FF3A 2XEFA 4P10A 1TKFA 4ZX8A 5HVHA 4C8FA 2PE3A 3ISZA 1BAVA 4K3NA 3S9MA 4LQGA 2AFOA 3PBEA 3V38A 3HLPA 4KNGE 4NGSA 3RBUA 1YSJA 2AFUA 2WZNA 1RTQA 4UIAA 3IFEA 5LYIA 3I74A 4MHZA 3D68A 2AFSA 1HDQA 4IHMA 2Q4ZA 3SJXA 1BLLE 4X2TA 4Z65A 3NA6A 4OC4A 4Q7AA 2BCOA 4RUHA 3PB4X 4G1PA 2PVWA 2QYVA 4DJLA 4TJXA 3RAMA 4R76A 1DTDA 1YW4A 5I4MA 3KQZA 2ZEEA 2AFZA 2ZEFA 4MHNA 5IR2A 2PCUA 4H2KA 3T8WA 5THWA 4P4DA 3PB8X 1QQ9A 1XRYA 3PB9X 3D7DA 4X8IA 1R43A 4MRIA 4P6YA 1IY7A 3BHXA 3ISXA 4C9VA 2GLFA 4ZX9A 3SI1A 2AFWA 4F9VA 1FT7A 5LYLA 1NSAA 4NGPA 2F8HA 5LRKA 4GM5A 2EK8A 1LFWA 2AFMA 2BOAA 2Q43A 3EIFA 4YU9A 2V8HA 4UIBA 4BD9A 2GREA 3PB7X 3S9LA 1CP6A 1H8LA 1ELLP 4TJVA 2V8DA 3D66A 4ZI6A 4MCPA 4A94A 2V77A 3B35A 4A37A 1XBUA 2QVPA 4ZYQA 3IC1A 4EWTA 3H8EA 2PJAA 4MHPA 5LRGA 3HUVA 2PJ4A 4ZY2A 4X3RA 4MHYA 2ANPA 4MCQA 4C8CA 2C5QA 2IQ6A 3B3WA 3NH8A 4P4JA 3WT4A 4P4IA 2O53A 1Y0RA 4UF4A 1YMEA 1PCAA 1Y0YA 4YWYA 3KZWA 1Z2LA 4A39A 3QNVA 5LRJA 2ZEGA 4IK2A 1GYTA 1TF9A 2PJBA 4NGQA 4OC2A 1V6CA 3PFOA 3WC6A 2C1CA 3KI9A 3WABA 4O23A 3SI2A 1LANA 3SJEA 2Q51A 2CIJA 2PJ9A 4PXEA 3DLJA 2JBJA 4R6TA 3KGQA 2IMOA 1XFOA 2QJ8A 3BI1A 5LYFA 3KR5A 3L2NA 1HDUA 1EE3P 5CPAA 2WYRA 3D7GA 4FUUA 5JH9A 4C9AA 2PJ8A 4P4EA 3VTAA 2EWBA 4R7MA 3TX8A 1YW6A 3LMSA 2ZEPA 4JYWA 4CDKA 2ABZA 4OIDA 1YLOA 1VHOA 4AXVA 3SJGA 2BO9A 8CPAA 2DEAA 1TKHA 2PJ7A 2G9DA 4P4BA 4UEEA 2CTCA 4WJBA 3ICUA 2O4HA 2PJ3A 1FNOA 4OP4A 1ELMP 2HC9A 2RB7A 3B3VA 4B6ZA 3BXMA 3CDXA 1Q7LA 3PBBA 2V8VA 3IIBA 2V8GA 3NH5A 1ZLHA 2XEGA 4C8UA 1Y7EA 3I1UA 3NFZA 4PXBA 4YN3A 3NH4A 4C9RA 1CX8A 1VGYA 4OKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VL1 A;  3D4U A;  3GB0 A;  3PRT A;  3BI0 A;  2ZEM A;  3CPA A;  4CDJ A;  1R3N A;  1ZLI A;  3FED A;  1BPM A;  3FJU A;  1ARL A;  3VH9 A;  2ZEH A;  4DUK A;  5JGF A;  1BPN A;  2PJ2 A;  1QMU A;  1HEE A;  4OC0 A;  3FEE A;  3KAS A;  3I6S A;  3H8F A;  2AFX A;  4TNU A;  3S9N A;  4NGT A;  4OC3 A;  3D7H A;  1DE4 C;  3IO1 A;  2OR4 A;  3B3T A;  2F7V A;  1CPS A;  5IB9 A;  2HB6 A;  2PJ6 A;  1LAM A;  4NGN A;  1F2O A;  3LWU A;  1LAP A;  3SJF A;  4MMO A;  3VAR A;  3V7Z A;  5D29 A;  3FH4 A;  2OOT A;  3FMC A;  4A38 A;  3SI0 A;  1IGB A;  2C6G A;  4CPA A;  4OC1 A;  3DGV A;  5HVG A;  2JEW A;  7CPA A;  2IJZ A;  3IEH A;  4C86 A;  1LCP A;  4C8P A;  3PFE A;  6CPA A;  1F57 A;  4P4F A;  1LOK A;  5HVF A;  4C9E A;  4MCS A;  4ONW A;  5JM6 A;  3K2K A;  4IAV A;  3B7I A;  2ZEL A;  3JRU A;  1CPX A;  4NJQ A;  3D7F A;  2JBK A;  2PJC A;  1ZG9 A;  1KWM A;  2ZOF A;  4EFD A;  2PIY A;  4MXU A;  4WWV A;  1XF1 A;  4R8F A;  2XEJ A;  3MRU A;  5K8P A;  1CBX A;  2POK A;  2ZEO A;  4OIW A;  1PYT B;  3KHX A;  4PXC A;  1XMB A;  2ZOG A;  4KSI A;  3TC8 A;  5K8O A;  4NGM A;  4NJR A;  1AYE A;  3CPX A;  2C6C A;  1TF8 A;  2GU2 A;  5ELY A;  5DS0 A;  2NSM A;  2PIZ A;  2PJ0 A;  1WVM A;  1ARM A;  4C99 A;  3PEI A;  3B3S A;  3B2Y A;  1ZG7 A;  2PJ5 A;  4OME A;  3FX6 A;  1TKJ A;  3RZA A;  3WC7 A;  2I3C A;  2PRQ A;  4ZY0 A;  2ZEN A;  4C8T A;  3IJ3 A;  3GLJ A;  4NGR A;  4EME A;  1AMP A;  4F8Z A;  1XJO A;  2J9A A;  1Z8L A;  1ZG8 A;  1CP7 A;  1CG2 A;  4PXD A;  4UEZ A;  2FVG A;  4PPZ A;  4PQA A;  3MN8 A;  5CBM A;  3KQX A;  4DYO A;  1VHE A;  2XEI A;  1VIX A;  3WC5 A;  3FEC A;  4ZY1 A;  3CT9 A;  5LYD A;  1M4L A;  4MCR A;  4FBE A;  4F9U A;  4C8A A;  2PVV A;  5J1Q A;  3FVL A;  3H8G A;  3KR4 A;  4P44 A;  5K8N A;  2CF4 A;  4W9Y A;  1UWY A;  1TXR A;  4UEF A;  3GUX A;  4P45 A;  4NFR A;  4FAI A;  4JZ0 A;  1F2P A;  1JQG A;  3KL9 A;  1OBR A;  4OC5 A;  2C6P A;  4FWU A;  3D67 A;  4TWE A;  5D8N A;  5K8M A;  3IWW A;  2RFH A;  4C84 A;  2NYQ A;  3VAT A;  2ZED A;  4C9U A;  2EK9 A;  2PJ1 A;  2CTB A;  1Y9Z A;  3B3C A;  3K9T A;  2GLJ A;  3KHZ A;  3PB6 X;  5F09 A;  5HXD A;  4C85 A;  1Z5R A;  3N5F A;  3FF3 A;  2XEF A;  4P10 A;  1TKF A;  4ZX8 A;  5HVH A;  4C8F A;  2PE3 A;  3ISZ A;  1BAV A;  4K3N A;  3S9M A;  4LQG A;  2AFO A;  3PBE A;  3V38 A;  3HLP A;  4KNG E;  4NGS A;  3RBU A;  1YSJ A;  2AFU A;  2WZN A;  1RTQ A;  4UIA A;  3IFE A;  5LYI A;  3I74 A;  4MHZ A;  3D68 A;  2AFS A;  1HDQ A;  4IHM A;  2Q4Z A;  3SJX A;  1BLL E;  4X2T A;  4Z65 A;  3NA6 A;  4OC4 A;  4Q7A A;  2BCO A;  4RUH A;  3PB4 X;  4G1P A;  2PVW A;  2QYV A;  4DJL A;  4TJX A;  3RAM A;  4R76 A;  1DTD A;  1YW4 A;  5I4M A;  3KQZ A;  2ZEE A;  2AFZ A;  2ZEF A;  4MHN A;  2PCU A;  4H2K A;  3T8W A;  5THW A;  4P4D A;  3PB8 X;  1QQ9 A;  1XRY A;  3PB9 X;  3D7D A;  4X8I A;  1R43 A;  4MRI A;  4P6Y A;  1IY7 A;  3BHX A;  3ISX A;  4C9V A;  2GLF A;  4ZX9 A;  3SI1 A;  2AFW A;  4F9V A;  1FT7 A;  5LYL A;  1NSA A;  4NGP A;  2F8H A;  5LRK A;  4GM5 A;  2EK8 A;  1LFW A;  2AFM A;  2BOA A;  2Q43 A;  3EIF A;  4YU9 A;  2V8H A;  4UIB A;  4BD9 A;  2GRE A;  3PB7 X;  3S9L A;  1CP6 A;  1H8L A;  1ELL P;  4TJV A;  2V8D A;  3D66 A;  4ZI6 A;  4MCP A;  4A94 A;  2V77 A;  3B35 A;  4A37 A;  1XBU A;  2QVP A;  4ZYQ A;  3IC1 A;  4EWT A;  3H8E A;  2PJA A;  4MHP A;  5LRG A;  3HUV A;  2PJ4 A;  4ZY2 A;  4X3R A;  4MHY A;  2ANP A;  4MCQ A;  4C8C A;  2IQ6 A;  3B3W A;  3NH8 A;  4P4J A;  3WT4 A;  4P4I A;  2O53 A;  1Y0R A;  4UF4 A;  1YME A;  1PCA A;  1Y0Y A;  4YWY A;  3KZW A;  1Z2L A;  4A39 A;  3QNV A;  5LRJ A;  2ZEG A;  4IK2 A;  1GYT A;  1TF9 A;  2PJB A;  4NGQ A;  4OC2 A;  1V6C A;  3PFO A;  3WC6 A;  2C1C A;  3KI9 A;  3WAB A;  4O23 A;  3SI2 A;  1LAN A;  3SJE A;  2Q51 A;  2CIJ A;  2PJ9 A;  4PXE A;  3DLJ A;  2JBJ A;  4R6T A;  3KGQ A;  2IMO A;  1XFO A;  2QJ8 A;  3BI1 A;  5LYF A;  3KR5 A;  3L2N A;  1HDU A;  1EE3 P;  5CPA A;  2WYR A;  3D7G A;  4FUU A;  5JH9 A;  4C9A A;  2PJ8 A;  4P4E A;  3VTA A;  2EWB A;  4R7M A;  3TX8 A;  1YW6 A;  3LMS A;  2ZEP A;  4JYW A;  4CDK A;  2ABZ A;  4OID A;  1YLO A;  1VHO A;  4AXV A;  3SJG A;  2BO9 A;  8CPA A;  2DEA A;  1TKH A;  2PJ7 A;  2G9D A;  4P4B A;  4UEE A;  2CTC A;  4WJB A;  3ICU A;  2O4H A;  2PJ3 A;  1FNO A;  4OP4 A;  1ELM P;  2HC9 A;  2RB7 A;  3B3V A;  4B6Z A;  3BXM A;  3CDX A;  1Q7L A;  3PBB A;  2V8V A;  3IIB A;  2V8G A;  3NH5 A;  1ZLH A;  2XEG A;  4C8U A;  1Y7E A;  3I1U A;  3NFZ A;  4PXB A;  4YN3 A;  3NH4 A;  4C9R A;  1CX8 A;  1VGY A;  4OKO A; 
#chains in the Genus database with same CATH topology
 1IID A;  2VL1 A;  2FE7 A;  3D4U A;  1QSM A;  2I00 A;  3GB0 A;  3PRT A;  2Z3N A;  2Q0Y A;  4LX9 A;  4QUS A;  2QIR A;  4KOX A;  3BI0 A;  1RXT A;  2J8M A;  4C7H A;  1JDE A;  2ZEM A;  3CPA A;  5F1Y A;  4CDJ A;  1IYL A;  1R3N A;  1ZLI A;  2FS5 A;  3FED A;  1BPM A;  3FJU A;  1ARL A;  3SHP A;  3VH9 A;  2Q04 A;  2ZEH A;  4DUK A;  5JGF A;  3V8I A;  1NE9 A;  2R1I A;  3RNZ A;  1BPN A;  1X12 A;  1QMU A;  1HEE A;  2B3V A;  2PJ2 A;  4KSA A;  4OC0 A;  3FEE A;  3KAS A;  4UFX A;  4COB A;  2GIV A;  5C88 A;  3I6S A;  1VHS A;  2D0P A;  5DWN A;  3H8F A;  2AFX A;  3I3G A;  4TNU A;  3S9N A;  4NGT A;  2OLS A;  4CYQ A;  2CXA A;  4OC3 A;  4B11 A;  3D7H A;  1DE4 C;  4GS4 A;  3DSB A;  4KOT A;  3IO1 A;  3RO0 A;  4C7I A;  1J3L A;  2OR4 A;  3B3T A;  2CNS A;  2F7V A;  1Z9U A;  1CPS A;  2REE A;  5IB9 A;  4M6G A;  2GP4 A;  2HB6 A;  3GYA A;  2PJ6 A;  1LAM A;  2B58 A;  2HUZ A;  3CXP A;  2EVN A;  3KKW A;  5G21 A;  3T0T A;  4NGN A;  1F2O A;  4BMH A;  4CRZ B;  3CXS A;  2QML A;  4A31 A;  2B4D A;  3LWU A;  1S7F A;  5JVL A;  3P2H A;  1LAP A;  2Y0M A;  3BJ8 A;  4MMO A;  3R9G A;  3SJF A;  4C68 A;  2Q44 A;  4J0N A;  1QSO A;  3VAR A;  3TLE A;  1EZA A;  5AG4 A;  1VBH A;  3V7Z A;  4M6H A;  1M4D A;  4YFJ A;  1XE4 A;  1IYK A;  5D29 A;  4BBH A;  3JVN A;  2BEI A;  1KZF A;  2K5T A;  2P6F A;  3FYN A;  3E0K A;  1P4N A;  2VZY A;  1FY7 A;  3FH4 A;  4HNX B;  4XPD B;  2OOT A;  1UFH A;  3FMC A;  4H6Z A;  2GFQ A;  4A38 A;  2DPT A;  3SI0 A;  2HQY A;  4ORF A;  1S3Z A;  3TLA A;  2EZC A;  4QB9 A;  1IGB A;  2C6G A;  4CPA A;  2KCW A;  3TT2 A;  4OC1 A;  3DGV A;  5HVG A;  2JEW A;  7CPA A;  1Z8W A;  2IJZ A;  3IEH A;  3FIX A;  4C86 A;  1LCP A;  1J4J A;  2Z11 A;  2ATR A;  3PFE A;  4C8P A;  6CPA A;  5DWM A;  1JDB C;  1F57 A;  4PV6 A;  4P4F A;  1LOK A;  1TIQ A;  2FIW A;  4B13 A;  3ZJ0 A;  5HVF A;  4C9E A;  4MCS A;  4ONW A;  5JM6 A;  2FIA A;  2Z3P A;  3D2P A;  3H4Q A;  3K2K A;  4IAV A;  2WPW A;  3B7I A;  2E28 A;  2ZEL A;  1Y9K A;  2AE6 A;  1CPX A;  3JRU A;  4NJQ A;  3D7F A;  4KSF A;  2JBK A;  2PJC A;  4XPL A;  1ZG9 A;  4C2X A;  4AG9 A;  4B5P A;  1KWM A;  2B0A A;  2ZOF A;  4M85 A;  3TO7 A;  2PIY A;  3VWE A;  4EFD A;  2ZW6 A;  3R96 A;  3W6S A;  5BWA B;  4L8A A;  2FL4 A;  3TOB A;  4MXU A;  4WWV A;  4CGP A;  5J8F A;  1XF1 A;  4R8F A;  1A2Z A;  2XEJ A;  3MRU A;  5K8P A;  3LD2 A;  1R61 A;  1CBX A;  2OB0 A;  2POK A;  2ZEO A;  4OIW A;  1PYT B;  1Q5X A;  3KHX A;  4E2A A;  4PXC A;  1XMB A;  2ZOG A;  4ZBG A;  3SR3 A;  4KSI A;  4Q38 A;  3TC8 A;  4ZGY B;  3I9S A;  2EZA A;  3TE4 A;  5K8O A;  4MI1 A;  1PU9 A;  4XNH C;  3QAH A;  5AG6 A;  4NGM A;  4NJR A;  4CAX A;  1ZO0 A;  4H6U A;  4MFK A;  1AYE A;  3CPX A;  4M3S A;  4NF1 A;  1T36 B;  2C6C A;  4UFW A;  2PCN A;  1TF8 A;  1YGH A;  2CNM A;  2GU2 A;  4KOS A;  4UCP A;  5ELY A;  5DS0 A;  5G22 A;  5IX3 A;  4UWI A;  2NSM A;  2PIZ A;  2PJ0 A;  2PR8 A;  1ARM A;  4OAE A;  4UBR A;  3B3S A;  3PEI A;  5F48 A;  4C99 A;  3B2Y A;  3FB3 A;  4M6I A;  2ZXV A;  3QB8 A;  4MY0 A;  4OAD A;  2HWG A;  1ZG7 A;  1X10 A;  2PJ5 A;  3FX6 A;  4OME A;  3DNS A;  4KLV A;  4KOU A;  5G1Z A;  1XOV A;  5CNP A;  1TKJ A;  2EBJ A;  3RZA A;  4YRH A;  3WC7 A;  2I3C A;  4FD6 A;  2PRQ A;  5H84 A;  4KNG E;  4ZY0 A;  4B14 A;  5F5X A;  4KUA A;  2ZEN A;  3G23 A;  4E5S A;  2CNT A;  4C8T A;  2R7H A;  3IJ3 A;  3GLJ A;  4LQ6 A;  4NGR A;  2AUN A;  1VBG A;  4JWP A;  4A32 A;  2P0W A;  3GKR A;  4R3K A;  4EME A;  1AMP A;  1MJB A;  1YK3 A;  4F8Z A;  1XJO A;  2J9A A;  3IWE A;  4PSW A;  4QC6 A;  1Z8L A;  1CP7 A;  1ZG8 A;  1CG2 A;  4BIN A;  4H89 A;  2ODF A;  4PXD A;  1XMT A;  4UEZ A;  2FVG A;  2B4D B;  3LOD A;  4KVX A;  2OU2 A;  4PPZ A;  4PQA A;  2OZG A;  1BOB A;  4MBU A;  2GAN A;  3MN8 A;  5CBM A;  3KQX A;  4CGM A;  2BSW A;  4DYO A;  1VHE A;  2XEI A;  1VIX A;  5AGE A;  3SXN A;  3WC5 A;  3FEC A;  4RS2 A;  1B6B A;  4CGL A;  3K4I A;  4ZY1 A;  3BLN A;  3CT9 A;  5LYD A;  1U6M A;  1M4L A;  1NBW A;  4C2Z A;  3TLG A;  4MCR A;  2JEV A;  1SQH A;  4B12 A;  4FBE A;  4F9U A;  3D3S A;  4C8A A;  3F8K A;  2PVV A;  4R87 A;  4CZ1 A;  5J1Q A;  3FVL A;  3H8G A;  4NEX A;  3KR4 A;  4P44 A;  3VWD A;  5K8N A;  2YNC C;  2CF4 A;  5F46 A;  4W9Y A;  1UWY A;  4U9Y A;  4C2Y A;  1TXR A;  4UEF A;  3GJZ A;  2BUE A;  3GUX A;  3JUW A;  1P0H A;  4MJ8 A;  3DR8 A;  3S6K A;  1CE8 B;  4P45 A;  4NFR A;  4FAI A;  2D4P A;  3CZX A;  4JZ0 A;  1F2P A;  1JQG A;  1XIX A;  3KL9 A;  4HNW B;  4X5K A;  1OBR A;  4NSQ A;  4OC5 A;  2C6P A;  4FWU A;  1M44 A;  3D67 A;  1I21 A;  4TWE A;  5D8N A;  3IWW A;  4CAV A;  2RFH A;  5K8M A;  1YRE A;  4C84 A;  1EZB A;  2NYQ A;  4U9Z A;  2NMT A;  2IL4 A;  2GE3 A;  1IB1 E;  2EK9 A;  2ZED A;  3N7Z A;  3VAT A;  4AVC A;  2R82 A;  4C9U A;  2PJ1 A;  2B5G B;  2CTB A;  2ZW5 A;  1Y9Z A;  4F0Y A;  3B3C A;  3K9T A;  2GLJ A;  3KHZ A;  5JPH A;  3PB6 X;  2DPS A;  4MY3 A;  4A95 A;  2B5G A;  5F09 A;  5HXD A;  2EUI A;  4C85 A;  1Z5R A;  2RC4 A;  3N5F A;  3FF3 A;  2XEF A;  1C30 B;  4P10 A;  1M1D A;  1V0C A;  2QEC A;  4JLY A;  3NE8 A;  1TKF A;  4ZX8 A;  2OZU A;  2FSR A;  2PC1 A;  3EFA A;  2Q4V A;  1R57 A;  2YNE A;  2X0S A;  5HVH A;  3C8O A;  4C8F A;  2PE3 A;  3ISZ A;  1BAV A;  4A2Z A;  4JVO A;  3TYX A;  4CYO A;  2F5I A;  4PSX A;  1YVO A;  4K3N A;  3S9M A;  3P2F A;  1S7L A;  3H5Z A;  4LQG A;  4B5O A;  4I49 A;  2AFO A;  3UY5 A;  3PBE A;  2VBQ A;  3HLP A;  4R3L A;  3A9L A;  3QAY A;  4NGS A;  3V38 A;  2Z3K A;  4AG7 A;  5FD8 A;  3RBU A;  2O28 A;  2VQY A;  2PSW A;  3IGR A;  1YSJ A;  2AFU A;  2WZN A;  1RTQ A;  5GCN A;  4LUA A;  4UIA A;  3EZA A;  3IFE A;  5LYI A;  3U1B A;  3I74 A;  3W6X A;  5F49 A;  4F6A A;  4MHZ A;  4ONU A;  3T90 A;  4GXH A;  3D68 A;  2AFS A;  4FD5 A;  4UCM A;  2HRO A;  1PUA A;  1HDQ A;  3BJ7 A;  4MFP A;  4IHM A;  4MFZ A;  4R57 A;  2Q4Z A;  1JWQ A;  3SJX A;  1BLL E;  4X2T A;  2P6E A;  2OZH A;  4Z65 A;  5FVJ A;  5IV0 A;  3NA6 A;  4OC4 A;  4Q7A A;  2BCO A;  4RUH A;  4JXQ A;  1MJA A;  3T5M A;  1I12 A;  3PB4 X;  4G1P A;  2PVW A;  2QYV A;  1WWZ A;  5G20 A;  4DJL A;  4TJX A;  1CJW A;  3RAM A;  1LRZ A;  2G3A A;  2YGW A;  4Y49 B;  5EBV A;  4R76 A;  4CS0 B;  2D0O A;  1DTD A;  1YW4 A;  5I4M A;  3KQZ A;  2FCK A;  1WVM A;  5AG7 A;  1NSL A;  1NMT A;  2ZEE A;  2REF A;  2AFZ A;  2ZEF A;  4MHN A;  2X7B A;  5IR2 A;  4FD7 A;  2PCU A;  4H2K A;  1S60 A;  4JD6 A;  3T8W A;  5THW A;  4II9 A;  1AUG A;  3GY9 A;  5C82 A;  4P4D A;  3FNC A;  2I79 A;  1QQ9 A;  3PB8 X;  3SXO A;  1XRY A;  3PB9 X;  2DF5 A;  1BXR B;  3D7D A;  5KTD A;  3EO4 A;  4X8I A;  1R43 A;  2JDD A;  3K9U A;  4MRI A;  5JQ4 A;  2Z10 A;  4JXR A;  4P6Y A;  1IY7 A;  2Z3M A;  3BHX A;  2ZW7 A;  2GLF A;  3ISX A;  4ZX9 A;  4NXY A;  3TLG B;  1Z4R A;  3SI1 A;  4C9V A;  3NE7 A;  4PK3 A;  4NCZ A;  1Z8T A;  4CAE A;  4CGN A;  2AFW A;  4CAF A;  1M4G A;  5I0C A;  3TLB A;  4RN7 A;  4CRY B;  4F9V A;  2WUU A;  1FT7 A;  1KUV A;  5LYL A;  1MK4 A;  5KTC A;  1NSA A;  2R98 A;  3DDD A;  4NGP A;  2HV2 A;  4E8O A;  4KZT A;  1Q2C A;  2F8H A;  4MJX A;  2FM4 A;  2Z3L A;  5LRK A;  4GM5 A;  1S5K A;  2EK8 A;  4EYS A;  1LFW A;  2AFM A;  1IIC A;  2YNC A;  3PP9 A;  3TCV A;  2BOA A;  2Q43 A;  1QSN A;  3EIF A;  4A33 A;  5KTA A;  1YVK A;  2CY2 A;  4OLL A;  4B5P B;  4YU9 A;  2V8H A;  4UIB A;  5A28 A;  1Z4E A;  4BD9 A;  2GRE A;  4HNY B;  3WR7 A;  5HMN A;  3PB7 X;  3S9L A;  1CP6 A;  1H8L A;  1ELL P;  4TJV A;  2WPX A;  2V8D A;  3D66 A;  4ZI6 A;  4DNC A;  1Y7R A;  1WK4 A;  2VXK A;  4MCP A;  4A94 A;  1VI4 A;  2EO8 A;  4AB7 A;  2V77 A;  3B35 A;  4A37 A;  1XBU A;  1QSR A;  2QVP A;  1IU8 A;  4KOW A;  3S6H A;  4R9M A;  4ZYQ A;  3IC1 A;  4KOY A;  3R95 A;  4EWT A;  2G0B A;  1C3O B;  3H8E A;  2PJA A;  5HH1 A;  1M4I A;  3EC4 A;  4KOV A;  3R9F A;  4MHP A;  1ZL0 A;  1Q2Y A;  3OWC A;  3MGD A;  5LRG A;  5JYB A;  2B3U A;  2Z0Z A;  2JLM A;  3HUV A;  2PJ4 A;  4UFV A;  2PRB A;  5EC4 A;  4ZY2 A;  4X3R A;  4QBJ A;  2VEZ A;  4MHY A;  2ANP A;  4PK2 A;  1N71 A;  4MCQ A;  2J8R A;  4C8C A;  3DR6 A;  2C5Q A;  5K99 A;  2YND A;  2R8V A;  2IQ6 A;  2YJV A;  3B3W A;  3NH8 A;  1ZYM A;  4P4J A;  1B87 A;  3WT4 A;  4P4I A;  2O53 A;  4MFL A;  1Y0R A;  1VKC A;  3R1K A;  3C26 A;  4HKF A;  4KOR A;  1YME A;  1PCA A;  4UF4 A;  3TO9 A;  1KBL A;  1IOF A;  1Y0Y A;  3IU1 A;  3KZW A;  4YWY A;  4K30 A;  1Z2L A;  4AVB A;  5F47 A;  4IIY A;  4M8D A;  3ZZI A;  4A39 A;  5J8C A;  2D4O A;  3CXQ A;  1QST A;  3QNV A;  1XF8 A;  2A4N A;  4KLW A;  5LRJ A;  2ZEG A;  4IK2 A;  4KVM E;  5ISV A;  1GYT A;  1TF9 A;  1OZP A;  2PJB A;  4NGQ A;  4OC2 A;  1Z8X A;  4MFQ A;  2VZZ A;  3PFO A;  3TTH A;  1V6C A;  4MFJ A;  1L0C A;  3F5B A;  3WC6 A;  3T07 A;  2C1C A;  3KI9 A;  3WAB A;  1BO4 A;  3F0A A;  4CYN A;  4O23 A;  2C27 A;  3SI2 A;  1M6V B;  4CO9 A;  4KUB A;  1GGO A;  2EZB A;  1LAN A;  3SJE A;  2Q51 A;  2CIJ A;  1YR0 A;  2PJ9 A;  4PXE A;  2FXF A;  4CYP A;  3DLJ A;  4CGO A;  4JJX A;  4IUS A;  1KUX A;  2JBJ A;  4KVO E;  3TOA A;  4R6T A;  1YQE A;  3S6G A;  3KGQ A;  1NXJ A;  2B4B A;  2PQ8 A;  3TLC A;  1CS0 B;  2IMO A;  1XFO A;  2VI7 A;  4B10 A;  3FRM A;  2HI6 A;  4U5Y A;  5AG5 A;  4EVY A;  2QJ8 A;  4HPS A;  4MI4 A;  3EXN A;  2AJ6 A;  2BL1 A;  2WSA A;  3BI1 A;  5LYF A;  3S6F A;  4UA3 A;  4IIX A;  2AUM A;  3KR5 A;  2J8N A;  4CAW A;  1Q2D A;  1HDU A;  1EE3 P;  3L2N A;  5CPA A;  4UCN A;  1CM0 A;  2MP0 A;  3IU2 A;  4XNH B;  2Q7B A;  3EY5 A;  2WYR A;  3D7G A;  2ZPA A;  4FUU A;  5JH9 A;  2H5M A;  3KRV A;  2Q7S A;  3FXT A;  4XPD C;  1DIK A;  4MHD A;  2DIK A;  4FD4 A;  4QVT A;  4C9A A;  5H86 A;  2PJ8 A;  4P4E A;  3R9E A;  3VTA A;  2EWB A;  3GIU A;  3IWG A;  4R7M A;  1YW6 A;  3TX8 A;  1KUY A;  4COG A;  4AVA A;  2OH1 A;  4E0A A;  4KS9 A;  4A30 A;  3LMS A;  2ZEP A;  4JYW A;  4CDK A;  1RO5 A;  3D8P A;  5EMI A;  2ABZ A;  2Z3O A;  1YLO A;  4OID A;  2PR1 A;  1VHO A;  4AXV A;  1A9X B;  4UWJ A;  1XEB A;  1GHE A;  1KC7 A;  3G8W A;  3SJG A;  2YJT A;  2BO9 A;  4Y49 C;  4F0X A;  1ZRS A;  8CPA A;  2DEA A;  1TKH A;  2PJ7 A;  1K4J A;  4H1H A;  3LAC A;  2G9D A;  4YGO A;  4P4B A;  4INJ A;  3B8G A;  4UEE A;  3TFY A;  2CTC A;  3EZB A;  4WJB A;  3ICU A;  5F9M A;  2G3T A;  3T05 A;  3FBU A;  1YX0 A;  4E94 A;  2O4H A;  2ARH A;  2PJ3 A;  1FNO A;  2ZW4 A;  3RYO A;  3PZJ A;  4OP4 A;  3NOJ A;  2Q4Y A;  1ELM P;  2HC9 A;  2JDC A;  4L89 A;  4J3G A;  3TLY A;  2RB7 A;  3B3V A;  3TO6 A;  5IB0 A;  3TLZ A;  4B6Z A;  3T9Y A;  1S7K A;  3BXM A;  3CDX A;  1Q7L A;  1I1D A;  1Y9W A;  2DXQ A;  1IOI A;  3D2M A;  3PBB A;  2V8V A;  3EZE A;  4RI1 A;  1KEE B;  3IIB A;  2V8G A;  2P6G A;  1S7N A;  3NH5 A;  1ON0 A;  3JTK A;  4IF5 A;  1ZLH A;  4Q36 A;  2XEG A;  5E96 A;  3PGP A;  4C8U A;  5A27 A;  1Y7E A;  3I1U A;  3NFZ A;  2PDO A;  4PXB A;  1MJ9 A;  3NH4 A;  1CX8 A;  1VGY A;  4XPK A;  4YN3 A;  4C9R A;  3G3S A;  4OKO A;  2FT0 A;  3W91 A;  1YLE A; 
#chains in the Genus database with same CATH homology
 2VL1 A;  3D4U A;  3GB0 A;  3PRT A;  3BI0 A;  2ZEM A;  3CPA A;  4CDJ A;  1R3N A;  1ZLI A;  3FED A;  1BPM A;  3FJU A;  1ARL A;  3VH9 A;  2ZEH A;  4DUK A;  5JGF A;  1BPN A;  2PJ2 A;  1QMU A;  1HEE A;  4OC0 A;  3FEE A;  3KAS A;  3I6S A;  3H8F A;  2AFX A;  4TNU A;  3S9N A;  4NGT A;  4OC3 A;  3D7H A;  1DE4 C;  3IO1 A;  2OR4 A;  3B3T A;  2F7V A;  1CPS A;  5IB9 A;  2GP4 A;  2HB6 A;  2PJ6 A;  1LAM A;  4NGN A;  1F2O A;  3LWU A;  1LAP A;  3SJF A;  4MMO A;  3VAR A;  3V7Z A;  5D29 A;  3FH4 A;  2OOT A;  3FMC A;  4A38 A;  3SI0 A;  1IGB A;  2C6G A;  4CPA A;  4OC1 A;  3DGV A;  5HVG A;  2JEW A;  7CPA A;  2IJZ A;  3IEH A;  4C86 A;  1LCP A;  4C8P A;  3PFE A;  6CPA A;  1F57 A;  4P4F A;  1LOK A;  5HVF A;  4C9E A;  4MCS A;  4ONW A;  5JM6 A;  3K2K A;  4IAV A;  3B7I A;  2ZEL A;  3JRU A;  1CPX A;  4NJQ A;  3D7F A;  2JBK A;  2PJC A;  1ZG9 A;  1KWM A;  2ZOF A;  4EFD A;  2PIY A;  4MXU A;  4WWV A;  1XF1 A;  4R8F A;  2XEJ A;  3MRU A;  5K8P A;  1CBX A;  2POK A;  2ZEO A;  4OIW A;  1PYT B;  3KHX A;  4PXC A;  1XMB A;  2ZOG A;  4KSI A;  3TC8 A;  5K8O A;  4NGM A;  4NJR A;  1AYE A;  3CPX A;  2C6C A;  1TF8 A;  2GU2 A;  5ELY A;  5DS0 A;  2NSM A;  2PIZ A;  2PJ0 A;  1WVM A;  1ARM A;  4C99 A;  3PEI A;  3B3S A;  3B2Y A;  1ZG7 A;  2PJ5 A;  4OME A;  3FX6 A;  1TKJ A;  3RZA A;  3WC7 A;  2I3C A;  2PRQ A;  4ZY0 A;  2ZEN A;  4C8T A;  3IJ3 A;  3GLJ A;  4NGR A;  4EME A;  1AMP A;  4F8Z A;  1XJO A;  2J9A A;  1Z8L A;  1ZG8 A;  1CP7 A;  1CG2 A;  4PXD A;  4UEZ A;  2FVG A;  4PPZ A;  4PQA A;  3MN8 A;  5CBM A;  3KQX A;  4DYO A;  1VHE A;  2XEI A;  1VIX A;  3WC5 A;  3FEC A;  4ZY1 A;  3CT9 A;  5LYD A;  1M4L A;  4MCR A;  4FBE A;  4F9U A;  4C8A A;  2PVV A;  5J1Q A;  3FVL A;  3H8G A;  3KR4 A;  4P44 A;  5K8N A;  2CF4 A;  4W9Y A;  1UWY A;  1TXR A;  4UEF A;  3GUX A;  4P45 A;  4NFR A;  4FAI A;  4JZ0 A;  1F2P A;  1JQG A;  3KL9 A;  1OBR A;  4OC5 A;  2C6P A;  4FWU A;  3D67 A;  4TWE A;  5D8N A;  5K8M A;  3IWW A;  2RFH A;  4C84 A;  2NYQ A;  3VAT A;  2ZED A;  4C9U A;  2EK9 A;  2PJ1 A;  2CTB A;  1Y9Z A;  3B3C A;  3K9T A;  2GLJ A;  3KHZ A;  3PB6 X;  5F09 A;  5HXD A;  4C85 A;  1Z5R A;  3N5F A;  3FF3 A;  2XEF A;  4P10 A;  1TKF A;  4ZX8 A;  5HVH A;  4C8F A;  2PE3 A;  3ISZ A;  1BAV A;  4K3N A;  3S9M A;  4LQG A;  2AFO A;  3PBE A;  3V38 A;  3HLP A;  4KNG E;  4NGS A;  3RBU A;  1YSJ A;  2AFU A;  2WZN A;  1RTQ A;  4UIA A;  3IFE A;  5LYI A;  3I74 A;  4MHZ A;  3D68 A;  2AFS A;  1HDQ A;  4IHM A;  2Q4Z A;  3SJX A;  1BLL E;  4X2T A;  4Z65 A;  3NA6 A;  4OC4 A;  4Q7A A;  2BCO A;  4RUH A;  3PB4 X;  4G1P A;  2PVW A;  2QYV A;  4DJL A;  4TJX A;  3RAM A;  4R76 A;  1DTD A;  1YW4 A;  5I4M A;  3KQZ A;  2ZEE A;  2AFZ A;  2ZEF A;  4MHN A;  5IR2 A;  2PCU A;  4H2K A;  3T8W A;  5THW A;  4P4D A;  3PB8 X;  1QQ9 A;  1XRY A;  3PB9 X;  3D7D A;  4X8I A;  1R43 A;  4MRI A;  4P6Y A;  1IY7 A;  3BHX A;  3ISX A;  4C9V A;  2GLF A;  4ZX9 A;  3SI1 A;  2AFW A;  4F9V A;  1FT7 A;  5LYL A;  1NSA A;  4NGP A;  2F8H A;  5LRK A;  4GM5 A;  2EK8 A;  1LFW A;  2AFM A;  2BOA A;  2Q43 A;  3EIF A;  4YU9 A;  2V8H A;  4UIB A;  4BD9 A;  2GRE A;  3PB7 X;  3S9L A;  1CP6 A;  1H8L A;  1ELL P;  4TJV A;  2V8D A;  3D66 A;  4ZI6 A;  4MCP A;  4A94 A;  2V77 A;  3B35 A;  4A37 A;  1XBU A;  2QVP A;  4ZYQ A;  3IC1 A;  4EWT A;  3H8E A;  2PJA A;  4MHP A;  5LRG A;  3HUV A;  2PJ4 A;  4ZY2 A;  4X3R A;  4MHY A;  2ANP A;  4MCQ A;  4C8C A;  2C5Q A;  2IQ6 A;  3B3W A;  3NH8 A;  4P4J A;  3WT4 A;  4P4I A;  2O53 A;  1Y0R A;  4UF4 A;  1YME A;  1PCA A;  1Y0Y A;  4YWY A;  3KZW A;  1Z2L A;  4A39 A;  3QNV A;  5LRJ A;  2ZEG A;  4IK2 A;  1GYT A;  1TF9 A;  2PJB A;  4NGQ A;  4OC2 A;  1V6C A;  3PFO A;  3WC6 A;  2C1C A;  3KI9 A;  3WAB A;  4O23 A;  3SI2 A;  1LAN A;  3SJE A;  2Q51 A;  2CIJ A;  2PJ9 A;  4PXE A;  3DLJ A;  2JBJ A;  4R6T A;  3KGQ A;  2IMO A;  1XFO A;  2QJ8 A;  3BI1 A;  5LYF A;  3KR5 A;  3L2N A;  1HDU A;  1EE3 P;  5CPA A;  2WYR A;  3D7G A;  4FUU A;  5JH9 A;  4C9A A;  2PJ8 A;  4P4E A;  3VTA A;  2EWB A;  4R7M A;  3TX8 A;  1YW6 A;  3LMS A;  2ZEP A;  4JYW A;  4CDK A;  2ABZ A;  4OID A;  1YLO A;  1VHO A;  4AXV A;  3SJG A;  2BO9 A;  8CPA A;  2DEA A;  1TKH A;  2PJ7 A;  2G9D A;  4P4B A;  4UEE A;  2CTC A;  4WJB A;  3ICU A;  2O4H A;  2PJ3 A;  1FNO A;  4OP4 A;  1ELM P;  2HC9 A;  2RB7 A;  3B3V A;  4B6Z A;  3BXM A;  3CDX A;  1Q7L A;  3PBB A;  2V8V A;  3IIB A;  2V8G A;  3NH5 A;  1ZLH A;  2XEG A;  4C8U A;  1Y7E A;  3I1U A;  3NFZ A;  4PXB A;  4YN3 A;  3NH4 A;  4C9R A;  1CX8 A;  1VGY A;  4OKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...