2EKFA

Solution structure of ruh-075, a human cue domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
GSSGSSGSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RUH-075, a human CUE domain
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ancient ubiquitous protein 1
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ekfA01
2BWEA 2L4EA 2KNZA 5JI2E 2DAIA 2OOAA 1F4IA 2BWBA 1P3QQ 1ZV1A 1TR8A 2CP8A 3IHPA 3GLFE 1G3IA 1VEKA 1T6OA 2JUJA 1NV9A 4F2LA 1DV0A 2QSFX 2EKKA 2MGWA 1VQ1A 2EJSA 2L2DA 2DENA 2DNAA 2DI0A 1NV8A 2MROB 2JZ0A 2JY7A 3FRHA 3GLIE 2LBCA 1G41A 1R4GA 4Q7JA 3K9OA 3IECA 2KNVA 2QNJA 2DAKA 1WR1B 3E46A 2LVNC 1CUKA 1ZMVA 2JZ1A 1A5TA 1IM2A 1OAIA 3FRIA 3GLHE 2MJ5B 1BVSA 1SG9A 1UFZA 1OQYA 2LVQD 2EKFA 1HJPA 3LCVB 1VG5A 1G4AE 2DAGA 1JR3E 1WIVA 3T6PA 2QHOB 3K9PA 2JY6B 1DO2A 1WHCA 2B3TA 4F1IA 2RRUA 2WZJA 1T43A 2DAMA 5DFLA 2KHHA 2ZTDA 3MMPA 1XXHE 2L4FA 1KYIA 3BBZA 3H4JA 4GEWA 4R71A 1Y8GA 4WP2A 1QZEA 1ZMWA 3LCUA 1HT2E 2H5XA 1Q02A 2KNAA 2HWJA 2DKLA 1VEGA 2JY8A 2ZTCA 1AIPC 1YLAA 3B89A 1IXSA 2DZLA 1C7YA 2OOBA 3F92A 2JY5A 3GLGE 4G3OA 1E94E 2DAEA 1HQYE 4DBGB 1ZMUA 2LTUA 1WJ7A 1IFYA 1HT1E 1OTRA 1PGYA 2LVOC 3FE3A 2MR9A 1VDLA 1MN3A 1GO5A 1VEJA 2HAKA 2O25A 1EFUB 2OO9A 1DO0A 1XB2B 1V92A 1WGNA 1TTEA 2R0IA 2JP7A 2LVPC 3E21A 2G3QA 2DHYA 1WGLA 2K9DA 1OKSA 2K0BX 2JNHA 4HEOA 4UN2B 2CWBA 2LVAA
chains in the Genus database with same CATH superfamily
2BJVA 5DYGA 4NXMM 4RF1A 4NOOB 5ITQA 1P3QQ 4D82A 1NNJA 1K3WA 4X64M 1QQWA 2Z4RA 3IHPA 3C58A 1IXZA 4LGYA 1XMQM 3HU1A 2NQ8C 1DV0A 3PVSA 4QNMA 3SMPA 2DWMA 1LV7A 2MGWA 1VQ1A 4Y28F 4PT5A 5GKNA 3B9PA 3HJQA 4MM3B 2R45A 3FRHA 2JA2A 1MU5A 3GLIE 4JI4M 2R4EA 3C3EA 4ZPXA 2C99A 2R18A 1XXHA 4OVZB 4Q7JA 1TGUA 2C5RA 1N77A 1QUSA 3J2PB 3HHWA 3D8BA 1WR1B 3E46A 2R65A 4LJ7A 1UM8A 1TH2A 1ZMVA 5FTJA 4R7GA 3VKHA 2RGHA 4MB7A 2YNMD 3GLHE 3I04M 4MGIE 5E6JA 1FNNA 1MJGM 4GKJM 3AFHA 3K8ZA 1OAOC 1XWIA 2XF3A 3M7GA 1OQYA 4NXNM 3U6LA 2EKFA 4EIWA 1Z5CA 3GLGB 5FLXS 2DAGA 1QAOA 4JV5M 2J7OA 1SXJD 4LCBA 4LJ6A 2I7NA 1DO2A 1WXQA 2B3TA 2R4JA 4HL4A 4IBGA 3AOEC 3T1YM 4B3RM 1GLNA 3HJ8A 4QOZC 4M0DA 5FTLA 3HX3A 4GIPA 3B7ZA 4QNRA 3JR4A 1T43A 2DAMA 5DFLA 2KXEA 1XMOM 2KDLA 5EP2A 1QDTA 2LWXA 2ZTDA 1OIPA 3HGIA 3W67A 3TWLA 4W5WA 3HKPA 4GEWA 1Y8GA 3BXWA 1ZMWA 1OFIA 1HT2E 2H5XA 1Q02A 4L78A 2C9CA 3R8FA 2DWNA 1W5TA 4M9SA 3DZDA 4RF0A 2DKLA 1VEGA 4HLQA 4JI3M 3K2LA 4B7FA 4JI5M 1AIPC 3B89A 3V76A 2P5TA 3VDUA 4BBAA 5DNYA 3GO8A 1IBKM 3F92A 4G3OA 1E94E 2LTUA 5E26A 1IFYA 2X4AA 4QOSA 2LH0A 4L4UA 2Y21A 5EQTA 4DV1M 2E5LM 3FUXA 2CV1A 4CISA 1D2NA 3I4YA 3C3DA 4GH9A 1VEJA 2C96A 2O25A 5ITTA 1EFUB 2OO9A 3A42A 3ILKA 4DR5M 3U6EA 2F5PA 2FE8A 1TTEA 2D7GA 1R7RA 4LF7M 1AUAA 2XLJA 3QYBA 4L15A 4KT0F 5JI3E 2CUZA 4GHLA 3U6MA 1RU3A 5EP3A 3VK8A 4NSRA 4LFAM 1HNZM 2F5OA 5KO3A 3UMMA 2H1RA 2XGNA 4AKGA 3HY5A 1SXJE 4TUWA 3Q8GA 2K0BX 2JNHA 3CGWA 4JI8M 4LF4M 3UGJA 3KOWE 2CRUA 4AI6A 2HCBA 1G59A 2BWEA 2L4EA 2K47A 5BPVA 2BWBA 1ZV1A 1ORYB 2EA0A 3B74A 4FWDA 2CP8A 2C9OA 3W0FA 4FCTA 4DR1M 1X37A 3GQ5A 2XZFA 2VQEM 2OPFA 2QBYA 2QSFX 4GRIA 4PCZA 1J7KA 3HJSA 1Z59A 4WW0A 2DI0A 2MROB 3SYLA 3VK7A 4MGZE 3GLGA 1Z6TA 1HQCA 1XNRM 2KZUA 4OX9M 4Z6YA 2LBCA 3U6CA 4X66M 1G41A 2M5ZA 2XZUA 4IBDA 1HNWM 3QWLA 3SBJA 2UXBM 4LF6M 3SAUA 1GABA 3HHZA 2Z7JA 3FTDA 4FWHA 5FTKA 1CUKA 1NJGA 2LNHC 2QQ8A 1A5TA 3K1JA 2DXIA 2FS1A 3SASA 5EP4A 4FCWA 4LFCM 3U5ZB 3JR5A 2RKOA 3FRIA 3GLHA 4D81A 4DR7M 3HU3A 4DR3M 4IJEA 2MJ5B 4DUZM 1UFZA 4CHTB 4JI0M 1T3TA 3SARA 3SATA 4GC5A 2XSZD 4G4NA 3J7AS 3LCVB 4OU7A 4NRWA 1G4AE 2BNKA 3PNYA 5C18A 3FKEA 3K9PA 4KLNA 1SXJC 5ITYA 2JXNA 1S3SA 4KODA 2X8AA 3OTOM 1N75A 4I81A 3L2AA 4F1IA 3UK6A 2ZBKB 2ERCA 2HL7A 2WSCF 3M6AA 4DR2M 4B3TM 1JQJC 2WSEF 1PJJA 4AG5A 5EXPA 2WZJA 4IJFA 4L8RC 1W5SA 3AJIB 3I01M 2XFTA 1NNUC 4LRSA 3FYCA 4G4RA 2L4FA 3GQ4A 3BBZA 1K3XA 5LMUM 1L1TA 1IN8A 2VIIA 4WP2A 1QZEA 1SXJB 4YY3M 3HHYA 3L27A 3LCUA 1N78A 1NO1A 3GPXA 4AQYM 3KOZE 2X49A 2JWSA 4IIWA 1Z5BA 3PXGA 4LF5M 2ZTCA 1YLAA 3M0EA 1NSFA 2R6FA 1DGHB 1IXSA 4RKUF 5ITXE 2DZLA 4I4LA 2OOBA 5H37D 4DV7M 1C7YA 3TQSA 2JY5A 4JI7M 2MH8A 2UXDM 2DAEA 4MH0E 1R2ZA 1QZMA 1WJ7A 3E9SA 1GJTA 2EO2A 4MGKE 5FSWA 4JYAM 3H4MA 5L8RF 1N34M 1K82A 4GMQA 3FE3A 2V6ZM 2MR9A 2HAKA 2L7IA 3TE6A 3WHKA 1DO0A 5EXTA 2QPAA 4DV4M 1WGNA 3UZUA 1NHGC 3QYEA 2JP7A 3ZC7B 2LVPC 4CGYB 1LTMA 1YSYA 2QZ4A 1EIJA 3AOEA 2G3QA 2DHYA 2FFJA 2O5RA 4GC9A 3KSXA 5EXXA 2J5YA 4QHTA 4B3MM 1JB0F 2D7EA 3KP0E 3J7BA 4LY6A 1OKSA 3VFDA 5KQDA 1YUBA 4G6ZA 3U60A 2XSZA 1IN4A 1G71A 1Q3BA 1L1ZA 4R3DA 2XFSA 2LVAA 1D0LA 2CHVA 4XK8F 2LXEA 4IBEA 2FNAA 1C1KA 3THGA 3ZQJA 3CF6E 2CFOA 4X65M 3T1HM 3KSJA 3KVWA 2KNZA 4BB9A 5DYIA 3TL4X 1KSFX 1VDDA 2Y20A 4LZZA 1TR8A 4P17A 2KW0A 1H6UA 3KOXE 4LRTA 2QCUA 4AG6A 2VQFM 3FUWA 1N33M 1NVMA 1OIZA 3J81S 4PDGA 3DOAA 1G3IA 1VEKA 2CE7A 3TWKA 3A46A 1NV9A 4JXJA 2KRKA 3E4RA 2EKKA 4Z8XA 5C1BA 4DV5M 3D8LA 1JR3A 4BLCA 2L2DA 4LG2A 2ZAMA 1NV8A 2M60A 2JZ0A 2JY7A 1IQPA 3LQRA 3FYDA 3KOYE 5KPZA 3AV0A 3FTFA 4K0KM 1HNXM 1GJSA 3U6DA 4JI2M 3FTCA 3GLHB 4AKIA 2KNVA 4FCVA 4REZA 3VLFB 2QNJA 3RGSA 2UUCM 3L28A 3KP1E 1N32M 2JZ1A 2R46A 5EXSA 4XBOA 3DA1A 4G4QA 1Q39A 1NHWC 3B7QA 3WHLA 2N35A 2VF7A 4FVMA 1BVSA 1SG9A 3W68A 4M0WA 3GRRA 5FTNA 1I94M 2FOIC 2VDBB 1HJPA 3J27B 4DR4M 3GPPA 4LF9M 3SC3A 4S12A 4ANRA 1JR3E 4AZFA 4II7A 4XGIA 4B7HA 3T6PA 2QHOB 2VF8A 2JY6B 3J80S 2F5SA 4MGYE 2Q2EB 2Z3XA 3MK6A 2UUBM 4GITA 2RRUA 2WSFF 2EUCA 3KS4A 2FH0A 3HHXA 4LJAA 2RGOA 4AW4A 3MJ5A 4GKKM 3A45A 4L16A 2Y0TA 1L2BA 2G5GX 3H4JA 2CV0A 1IY0A 4R71A 4I8OA 1MX0A 1D0KA 1IY1A 1N36M 2UU9M 3PFIA 4LFBM 2V1CA 4DR6M 2JY8A 3HZJA 1OFHA 4IBBA 2XH9A 3KXEC 1IXRC 2I7PA 3IG5A 2AHMA 3NWLA 3ZH9B 1I4WA 1TH3A 3L29A 3GLIB 3GLIA 4JI1M 3TPZA 2L09A 1DGGA 4MGHA 2R62A 4NRVA 1NY5A 1DGFA 2KEBA 1HQYE 2HKJA 1JR3D 1ZMUA 1GVNA 1QUTA 3SHGB 1HT1E 2LVOC 3LMMA 3QAUA 4B7GA 3UJNA 3FD9A 3BOSA 4FW9A 3GP1A 1DGHA 3GPYA 1GKIA 4IBFA 8CATA 4JN6A 1VDLA 1MN3A 2DZOB 1L2DA 4ITQA 2L6OA 3I4VA 2R44A 3EIHA 1TDZA 2ZAOA 1E32A 1GL6A 4IBIA 1PJIA 5IREB 1TH4A 2R0IA 1SXJA 3PNVA 5EJCA 1QAQA 1V33A 2DHRA 4I5SA 1OJLA 3L25A 1WGLA 3CTWB 4DUYM 1R6BX 1QYRA 1QANA 2A5YB 5KPRA 3VDPA 2CHQA 4DV6M 1IN6A 1IY2A 4HEOA 2UUAM 4UN2B 7CATA 3C9PA 4OW0A 4QHSA 4LGMA 2DZNB 3FUVA 3U6QA 1TDHA 1R5LA 4OVZA 3KS8A 4NC6A 5JI2E 2DAIA 2Z8YM 5IT9S 4M9XA 2OOAA 1F4IA 1G8PA 2D7HA 4NL4H 2DWZB 3RGPA 3TWMA 4KHPM 3GLFE 3R9XB 3HWSA 1T6OA 2JUJA 3T38A 4F2LA 2V1UA 5KPTA 4CIZA 2EJSA 2DENA 4G4OA 2DNAA 2F5NA 3U6SA 1QAMA 1J09A 1NJFA 1IBMM 2O01F 5BR8M 5ITXA 3SFZA 3A98B 3U6OA 4KO8A 3L26A 5F3WA 1IN5A 3SYKA 1PJTA 1Q3CA 1R4GA 2CV2A 1V34A 3K9OA 3IECA 3ZCBB 3JAMS 5FTMA 1NY6A 1QDRA 4GHAA 3B7NA 2DAKA 2APLA 2LVNC 1PJQA 3LQQA 3AL0C 3DFZA 4AKHA 3FUUA 1IM2A 1OAIA 2XEPA 3Q8XA 1XXHB 2YFQA 2UXCM 3LVWA 4PDIA 3GRVA 4IBKA 4LJ8A 4LZJA 2QENA 4LJ9A 2LVQD 3FTEA 2GQFA 3KW6A 3W0LB 1IXSB 2YQZA 3IG8A 5A2QS 2F4VM 3LVVA 1VG5A 3RFWA 3AKZA 4A3VB 2CHGA 4IBJA 1WIVA 1IN7A 2ZANA 1WHCA 3U61A 3GLFB 4WURA 2KZSA 3KDSE 3CF2A 4L6V6 4DV2M 2GNOA 2KA6B 1E9RA 3T15A 4YHHM 1EE8A 2G8LA 3CF0A 4DV3M 3EIEA 5ITUA 4JI6M 3GPUA 1DGBA 2KHHA 2DVWB 2KRUA 3MMPA 1PM5A 1KFVA 1XXHE 1E9SA 1KYIA 1XC8A 1PRBA 5EP1A 2KNAA 1XHBA 3U60B 2HWJA 4RNAA 2OQ4A 3GRUA 4PD2A 2BJWA 3FUTA 1L8QA 4D80A 2F5QA 3NBXX 1D0MA 1YE9A 2K6BA 2L7HA 5LMNM 1FJGM 3KFUG 2DWLA 3GQ3A 4CJ6A 3GLGE 1R2YA 3K92A 4DBGB 2LHGA 3GRYA 1OTRA 1PGYA 3I51A 5IWAM 1XNQM 3U5ZA 2CEAA 3RE8A 1PJSA 4LJ4A 4FWGA 1QVRA 3HU2A 2LHCA 1TF0B 1ZAEA 5ITRA 3U6PA 1GO5A 4P16A 3GLFA 5KQ8A 1IBLM 4LJ5A 1XB2B 3NBIA 1GL7A 1V92A 2ZM6M 2W82A 4IBCA 3E21A 1ZQ9A 3MHVC 4DV0M 4LF8M 2QBYB 2K9DA 4B08A 2QP9X 5IZ7D 4NSOB 3SHFA 4B3SM 3SAVA 3LW5F 3U61B 4FD2A 2HHHM 4M9ZA 2C98A 3SAWA 3AOGA 2CWBA 1J5EM 3VKGA 2YR0A 4X62M 2Z4SA 2J7NA 1L2CA 3SMSA 1HR0M 2Y0QA 1Z5AA
chains in the Genus database with same CATH topology
2BWEA 2L4EA 2KNZA 5JI2E 2DAIA 2OOAA 1F4IA 2BWBA 1P3QQ 1ZV1A 1TR8A 2CP8A 3IHPA 3GLFE 1G3IA 1VEKA 1T6OA 2JUJA 1NV9A 4F2LA 1DV0A 2QSFX 2EKKA 2MGWA 1VQ1A 2EJSA 2L2DA 2DENA 2DNAA 2DI0A 1NV8A 2MROB 2JZ0A 2JY7A 3FRHA 3GLIE 2LBCA 1G41A 1R4GA 4Q7JA 3K9OA 3IECA 2KNVA 2QNJA 2DAKA 1WR1B 3E46A 2LVNC 1CUKA 1ZMVA 2JZ1A 1A5TA 1IM2A 1OAIA 3FRIA 3GLHE 2MJ5B 1BVSA 1SG9A 1UFZA 1OQYA 2LVQD 2EKFA 1HJPA 3LCVB 1VG5A 1G4AE 2DAGA 1JR3E 1WIVA 3T6PA 2QHOB 3K9PA 2JY6B 1DO2A 1WHCA 2B3TA 4F1IA 2RRUA 2WZJA 1T43A 2DAMA 5DFLA 2KHHA 2ZTDA 3MMPA 1XXHE 2L4FA 1KYIA 3BBZA 3H4JA 4GEWA 4R71A 1Y8GA 4WP2A 1QZEA 1ZMWA 3LCUA 1HT2E 2H5XA 1Q02A 2KNAA 2HWJA 2DKLA 1VEGA 2JY8A 2ZTCA 1AIPC 1YLAA 3B89A 1IXSA 2DZLA 1C7YA 2OOBA 3F92A 2JY5A 3GLGE 4G3OA 1E94E 2DAEA 1HQYE 4DBGB 1ZMUA 2LTUA 1WJ7A 1IFYA 1HT1E 1OTRA 1PGYA 2LVOC 3FE3A 2MR9A 1VDLA 1MN3A 1GO5A 1VEJA 2HAKA 2O25A 1EFUB 2OO9A 1DO0A 1XB2B 1V92A 1WGNA 1TTEA 2R0IA 2JP7A 2LVPC 3E21A 2G3QA 2DHYA 1WGLA 2K9DA 1OKSA 2K0BX 2JNHA 4HEOA 4UN2B 2CWBA 2LVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWE A;  2L4E A;  2KNZ A;  5JI2 E;  2DAI A;  2OOA A;  1F4I A;  2BWB A;  1P3Q Q;  1ZV1 A;  1TR8 A;  2CP8 A;  3IHP A;  3GLF E;  1G3I A;  1VEK A;  1T6O A;  2JUJ A;  1NV9 A;  4F2L A;  1DV0 A;  2QSF X;  2EKK A;  2MGW A;  1VQ1 A;  2EJS A;  2L2D A;  2DEN A;  2DNA A;  2DI0 A;  1NV8 A;  2MRO B;  2JZ0 A;  2JY7 A;  3FRH A;  3GLI E;  2LBC A;  1G41 A;  1R4G A;  4Q7J A;  3K9O A;  3IEC A;  2KNV A;  2QNJ A;  2DAK A;  1WR1 B;  3E46 A;  2LVN C;  1CUK A;  1ZMV A;  2JZ1 A;  1A5T A;  1IM2 A;  1OAI A;  3FRI A;  3GLH E;  2MJ5 B;  1BVS A;  1SG9 A;  1UFZ A;  1OQY A;  2LVQ D;  2EKF A;  1HJP A;  3LCV B;  1VG5 A;  1G4A E;  2DAG A;  1JR3 E;  1WIV A;  3T6P A;  2QHO B;  3K9P A;  2JY6 B;  1DO2 A;  1WHC A;  2B3T A;  4F1I A;  2RRU A;  2WZJ A;  1T43 A;  2DAM A;  5DFL A;  2KHH A;  2ZTD A;  3MMP A;  1XXH E;  2L4F A;  1KYI A;  3BBZ A;  3H4J A;  4GEW A;  4R71 A;  1Y8G A;  4WP2 A;  1QZE A;  1ZMW A;  3LCU A;  1HT2 E;  2H5X A;  1Q02 A;  2KNA A;  2HWJ A;  2DKL A;  1VEG A;  2JY8 A;  2ZTC A;  1AIP C;  1YLA A;  3B89 A;  1IXS A;  2DZL A;  1C7Y A;  2OOB A;  3F92 A;  2JY5 A;  3GLG E;  4G3O A;  1E94 E;  2DAE A;  1HQY E;  4DBG B;  1ZMU A;  2LTU A;  1WJ7 A;  1IFY A;  1HT1 E;  1OTR A;  1PGY A;  2LVO C;  3FE3 A;  2MR9 A;  1VDL A;  1MN3 A;  1GO5 A;  1VEJ A;  2HAK A;  2O25 A;  1EFU B;  2OO9 A;  1DO0 A;  1XB2 B;  1V92 A;  1WGN A;  1TTE A;  2R0I A;  2JP7 A;  2LVP C;  3E21 A;  2G3Q A;  2DHY A;  1WGL A;  2K9D A;  1OKS A;  2K0B X;  2JNH A;  4HEO A;  4UN2 B;  2CWB A;  2LVA A; 
#chains in the Genus database with same CATH topology
 2BJV A;  5DYG A;  4NXM M;  4RF1 A;  4NOO B;  5ITQ A;  1P3Q Q;  4D82 A;  1NNJ A;  1K3W A;  4X64 M;  1QQW A;  2Z4R A;  3IHP A;  3C58 A;  1IXZ A;  4LGY A;  1XMQ M;  3HU1 A;  2NQ8 C;  1DV0 A;  3PVS A;  4QNM A;  3SMP A;  2DWM A;  1LV7 A;  2MGW A;  1VQ1 A;  4Y28 F;  4PT5 A;  5GKN A;  3B9P A;  3HJQ A;  4MM3 B;  2R45 A;  3FRH A;  2JA2 A;  1MU5 A;  3GLI E;  4JI4 M;  2R4E A;  3C3E A;  4ZPX A;  2C99 A;  2R18 A;  1XXH A;  4OVZ B;  4Q7J A;  1TGU A;  2C5R A;  1N77 A;  1QUS A;  3J2P B;  3HHW A;  3D8B A;  1WR1 B;  3E46 A;  2R65 A;  4LJ7 A;  1UM8 A;  1TH2 A;  1ZMV A;  5FTJ A;  4R7G A;  3VKH A;  2RGH A;  4MB7 A;  2YNM D;  3GLH E;  3I04 M;  4MGI E;  5E6J A;  1FNN A;  1MJG M;  4GKJ M;  3AFH A;  3K8Z A;  1OAO C;  1XWI A;  2XF3 A;  3M7G A;  1OQY A;  4NXN M;  3U6L A;  2EKF A;  4EIW A;  1Z5C A;  3GLG B;  5FLX S;  2DAG A;  1QAO A;  4JV5 M;  2J7O A;  1SXJ D;  4LCB A;  4LJ6 A;  2I7N A;  1DO2 A;  1WXQ A;  2B3T A;  2R4J A;  4HL4 A;  4IBG A;  3AOE C;  3T1Y M;  4B3R M;  1GLN A;  3HJ8 A;  4QOZ C;  4M0D A;  5FTL A;  3HX3 A;  4GIP A;  3B7Z A;  4QNR A;  3JR4 A;  1T43 A;  2DAM A;  5DFL A;  2KXE A;  1XMO M;  2KDL A;  5EP2 A;  1QDT A;  2LWX A;  2ZTD A;  1OIP A;  3HGI A;  3W67 A;  3TWL A;  4W5W A;  3HKP A;  4GEW A;  1Y8G A;  3BXW A;  1ZMW A;  1OFI A;  1HT2 E;  2H5X A;  1Q02 A;  4L78 A;  2C9C A;  3R8F A;  2DWN A;  1W5T A;  4M9S A;  3DZD A;  4RF0 A;  2DKL A;  1VEG A;  4HLQ A;  4JI3 M;  3K2L A;  4B7F A;  4JI5 M;  1AIP C;  3B89 A;  3V76 A;  2P5T A;  3VDU A;  4BBA A;  5DNY A;  3GO8 A;  1IBK M;  3F92 A;  4G3O A;  1E94 E;  2LTU A;  5E26 A;  1IFY A;  2X4A A;  4QOS A;  2LH0 A;  4L4U A;  2Y21 A;  5EQT A;  4DV1 M;  2E5L M;  3FUX A;  2CV1 A;  4CIS A;  1D2N A;  3I4Y A;  3C3D A;  4GH9 A;  1VEJ A;  2C96 A;  2O25 A;  5ITT A;  1EFU B;  2OO9 A;  3A42 A;  3ILK A;  4DR5 M;  3U6E A;  2F5P A;  2FE8 A;  1TTE A;  2D7G A;  1R7R A;  4LF7 M;  1AUA A;  2XLJ A;  3QYB A;  4L15 A;  4KT0 F;  5JI3 E;  2CUZ A;  4GHL A;  3U6M A;  1RU3 A;  5EP3 A;  3VK8 A;  4NSR A;  4LFA M;  1HNZ M;  2F5O A;  5KO3 A;  3UMM A;  2H1R A;  2XGN A;  4AKG A;  3HY5 A;  1SXJ E;  4TUW A;  3Q8G A;  2K0B X;  2JNH A;  3CGW A;  4JI8 M;  4LF4 M;  3UGJ A;  3KOW E;  2CRU A;  4AI6 A;  2HCB A;  1G59 A;  2BWE A;  2L4E A;  2K47 A;  5BPV A;  2BWB A;  1ZV1 A;  1ORY B;  2EA0 A;  3B74 A;  4FWD A;  2CP8 A;  2C9O A;  3W0F A;  4FCT A;  4DR1 M;  1X37 A;  3GQ5 A;  2XZF A;  2VQE M;  2OPF A;  2QBY A;  2QSF X;  4GRI A;  4PCZ A;  1J7K A;  3HJS A;  1Z59 A;  4WW0 A;  2DI0 A;  2MRO B;  3SYL A;  3VK7 A;  4MGZ E;  3GLG A;  1Z6T A;  1HQC A;  1XNR M;  2KZU A;  4OX9 M;  4Z6Y A;  2LBC A;  3U6C A;  4X66 M;  1G41 A;  2M5Z A;  2XZU A;  4IBD A;  1HNW M;  3QWL A;  3SBJ A;  2UXB M;  4LF6 M;  3SAU A;  1GAB A;  3HHZ A;  2Z7J A;  3FTD A;  4FWH A;  5FTK A;  1CUK A;  1NJG A;  2LNH C;  2QQ8 A;  1A5T A;  3K1J A;  2DXI A;  2FS1 A;  3SAS A;  5EP4 A;  4FCW A;  4LFC M;  3U5Z B;  3JR5 A;  2RKO A;  3FRI A;  3GLH A;  4D81 A;  4DR7 M;  3HU3 A;  4DR3 M;  4IJE A;  2MJ5 B;  4DUZ M;  1UFZ A;  4CHT B;  4JI0 M;  1T3T A;  3SAR A;  3SAT A;  4GC5 A;  2XSZ D;  4G4N A;  3J7A S;  3LCV B;  4OU7 A;  4NRW A;  1G4A E;  2BNK A;  3PNY A;  5C18 A;  3FKE A;  3K9P A;  4KLN A;  1SXJ C;  5ITY A;  2JXN A;  1S3S A;  4KOD A;  2X8A A;  3OTO M;  1N75 A;  4I81 A;  3L2A A;  4F1I A;  3UK6 A;  2ZBK B;  2ERC A;  2HL7 A;  2WSC F;  3M6A A;  4DR2 M;  4B3T M;  1JQJ C;  2WSE F;  1PJJ A;  4AG5 A;  5EXP A;  2WZJ A;  4IJF A;  4L8R C;  1W5S A;  3AJI B;  3I01 M;  2XFT A;  1NNU C;  4LRS A;  3FYC A;  4G4R A;  2L4F A;  3GQ4 A;  3BBZ A;  1K3X A;  5LMU M;  1L1T A;  1IN8 A;  2VII A;  4WP2 A;  1QZE A;  1SXJ B;  4YY3 M;  3HHY A;  3L27 A;  3LCU A;  1N78 A;  1NO1 A;  3GPX A;  4AQY M;  3KOZ E;  2X49 A;  2JWS A;  4IIW A;  1Z5B A;  3PXG A;  4LF5 M;  2ZTC A;  1YLA A;  3M0E A;  1NSF A;  2R6F A;  1DGH B;  1IXS A;  4RKU F;  5ITX E;  2DZL A;  4I4L A;  2OOB A;  5H37 D;  4DV7 M;  1C7Y A;  3TQS A;  2JY5 A;  4JI7 M;  2MH8 A;  2UXD M;  2DAE A;  4MH0 E;  1R2Z A;  1QZM A;  1WJ7 A;  3E9S A;  1GJT A;  2EO2 A;  4MGK E;  5FSW A;  4JYA M;  3H4M A;  5L8R F;  1N34 M;  1K82 A;  4GMQ A;  3FE3 A;  2V6Z M;  2MR9 A;  2HAK A;  2L7I A;  3TE6 A;  3WHK A;  1DO0 A;  5EXT A;  2QPA A;  4DV4 M;  1WGN A;  3UZU A;  1NHG C;  3QYE A;  2JP7 A;  3ZC7 B;  2LVP C;  4CGY B;  1LTM A;  1YSY A;  2QZ4 A;  1EIJ A;  3AOE A;  2G3Q A;  2DHY A;  2FFJ A;  2O5R A;  4GC9 A;  3KSX A;  5EXX A;  2J5Y A;  4QHT A;  4B3M M;  1JB0 F;  2D7E A;  3KP0 E;  3J7B A;  4LY6 A;  1OKS A;  3VFD A;  5KQD A;  1YUB A;  4G6Z A;  3U60 A;  2XSZ A;  1IN4 A;  1G71 A;  1Q3B A;  1L1Z A;  4R3D A;  2XFS A;  2LVA A;  1D0L A;  2CHV A;  4XK8 F;  2LXE A;  4IBE A;  2FNA A;  1C1K A;  3THG A;  3ZQJ A;  3CF6 E;  2CFO A;  4X65 M;  3T1H M;  3KSJ A;  3KVW A;  2KNZ A;  4BB9 A;  5DYI A;  3TL4 X;  1KSF X;  1VDD A;  2Y20 A;  4LZZ A;  1TR8 A;  4P17 A;  2KW0 A;  1H6U A;  3KOX E;  4LRT A;  2QCU A;  4AG6 A;  2VQF M;  3FUW A;  1N33 M;  1NVM A;  1OIZ A;  3J81 S;  4PDG A;  3DOA A;  1G3I A;  1VEK A;  2CE7 A;  3TWK A;  3A46 A;  1NV9 A;  4JXJ A;  2KRK A;  3E4R A;  2EKK A;  4Z8X A;  5C1B A;  4DV5 M;  3D8L A;  1JR3 A;  4BLC A;  2L2D A;  4LG2 A;  2ZAM A;  1NV8 A;  2M60 A;  2JZ0 A;  2JY7 A;  1IQP A;  3LQR A;  3FYD A;  3KOY E;  5KPZ A;  3AV0 A;  3FTF A;  4K0K M;  1HNX M;  1GJS A;  3U6D A;  4JI2 M;  3FTC A;  3GLH B;  4AKI A;  2KNV A;  4FCV A;  4REZ A;  3VLF B;  2QNJ A;  3RGS A;  2UUC M;  3L28 A;  3KP1 E;  1N32 M;  2JZ1 A;  2R46 A;  5EXS A;  4XBO A;  3DA1 A;  4G4Q A;  1Q39 A;  1NHW C;  3B7Q A;  3WHL A;  2N35 A;  2VF7 A;  4FVM A;  1BVS A;  1SG9 A;  3W68 A;  4M0W A;  3GRR A;  5FTN A;  1I94 M;  2FOI C;  2VDB B;  1HJP A;  3J27 B;  4DR4 M;  3GPP A;  4LF9 M;  3SC3 A;  4S12 A;  4ANR A;  1JR3 E;  4AZF A;  4II7 A;  4XGI A;  4B7H A;  3T6P A;  2QHO B;  2VF8 A;  2JY6 B;  3J80 S;  2F5S A;  4MGY E;  2Q2E B;  2Z3X A;  3MK6 A;  2UUB M;  4GIT A;  2RRU A;  2WSF F;  2EUC A;  3KS4 A;  2FH0 A;  3HHX A;  4LJA A;  2RGO A;  4AW4 A;  3MJ5 A;  4GKK M;  3A45 A;  4L16 A;  2Y0T A;  1L2B A;  2G5G X;  3H4J A;  2CV0 A;  1IY0 A;  4R71 A;  4I8O A;  1MX0 A;  1D0K A;  1IY1 A;  1N36 M;  2UU9 M;  3PFI A;  4LFB M;  2V1C A;  4DR6 M;  2JY8 A;  3HZJ A;  1OFH A;  4IBB A;  2XH9 A;  3KXE C;  1IXR C;  2I7P A;  3IG5 A;  2AHM A;  3NWL A;  3ZH9 B;  1I4W A;  1TH3 A;  3L29 A;  3GLI B;  3GLI A;  4JI1 M;  3TPZ A;  2L09 A;  1DGG A;  4MGH A;  2R62 A;  4NRV A;  1NY5 A;  1DGF A;  2KEB A;  1HQY E;  2HKJ A;  1JR3 D;  1ZMU A;  1GVN A;  1QUT A;  3SHG B;  1HT1 E;  2LVO C;  3LMM A;  3QAU A;  4B7G A;  3UJN A;  3FD9 A;  3BOS A;  4FW9 A;  3GP1 A;  1DGH A;  3GPY A;  1GKI A;  4IBF A;  8CAT A;  4JN6 A;  1VDL A;  1MN3 A;  2DZO B;  1L2D A;  4ITQ A;  2L6O A;  3I4V A;  2R44 A;  3EIH A;  1TDZ A;  2ZAO A;  1E32 A;  1GL6 A;  4IBI A;  1PJI A;  5IRE B;  1TH4 A;  2R0I A;  1SXJ A;  3PNV A;  5EJC A;  1QAQ A;  1V33 A;  2DHR A;  4I5S A;  1OJL A;  3L25 A;  1WGL A;  3CTW B;  4DUY M;  1R6B X;  1QYR A;  1QAN A;  2A5Y B;  5KPR A;  3VDP A;  2CHQ A;  4DV6 M;  1IN6 A;  1IY2 A;  4HEO A;  2UUA M;  4UN2 B;  7CAT A;  3C9P A;  4OW0 A;  4QHS A;  4LGM A;  2DZN B;  3FUV A;  3U6Q A;  1TDH A;  1R5L A;  4OVZ A;  3KS8 A;  4NC6 A;  5JI2 E;  2DAI A;  2Z8Y M;  5IT9 S;  4M9X A;  2OOA A;  1F4I A;  1G8P A;  2D7H A;  4NL4 H;  2DWZ B;  3RGP A;  3TWM A;  4KHP M;  3GLF E;  3R9X B;  3HWS A;  1T6O A;  2JUJ A;  3T38 A;  4F2L A;  2V1U A;  5KPT A;  4CIZ A;  2EJS A;  2DEN A;  4G4O A;  2DNA A;  2F5N A;  3U6S A;  1QAM A;  1J09 A;  1NJF A;  1IBM M;  2O01 F;  5BR8 M;  5ITX A;  3SFZ A;  3A98 B;  3U6O A;  4KO8 A;  3L26 A;  5F3W A;  1IN5 A;  3SYK A;  1PJT A;  1Q3C A;  1R4G A;  2CV2 A;  1V34 A;  3K9O A;  3IEC A;  3ZCB B;  3JAM S;  5FTM A;  1NY6 A;  1QDR A;  4GHA A;  3B7N A;  2DAK A;  2APL A;  2LVN C;  1PJQ A;  3LQQ A;  3AL0 C;  3DFZ A;  4AKH A;  3FUU A;  1IM2 A;  1OAI A;  2XEP A;  3Q8X A;  1XXH B;  2YFQ A;  2UXC M;  3LVW A;  4PDI A;  3GRV A;  4IBK A;  4LJ8 A;  4LZJ A;  2QEN A;  4LJ9 A;  2LVQ D;  3FTE A;  2GQF A;  3KW6 A;  3W0L B;  1IXS B;  2YQZ A;  3IG8 A;  5A2Q S;  2F4V M;  3LVV A;  1VG5 A;  3RFW A;  3AKZ A;  4A3V B;  2CHG A;  4IBJ A;  1WIV A;  1IN7 A;  2ZAN A;  1WHC A;  3U61 A;  3GLF B;  4WUR A;  2KZS A;  3KDS E;  3CF2 A;  4L6V 6;  4DV2 M;  2GNO A;  2KA6 B;  1E9R A;  3T15 A;  4YHH M;  1EE8 A;  2G8L A;  3CF0 A;  4DV3 M;  3EIE A;  5ITU A;  4JI6 M;  3GPU A;  1DGB A;  2KHH A;  2DVW B;  2KRU A;  3MMP A;  1PM5 A;  1KFV A;  1XXH E;  1E9S A;  1KYI A;  1XC8 A;  1PRB A;  5EP1 A;  2KNA A;  1XHB A;  3U60 B;  2HWJ A;  4RNA A;  2OQ4 A;  3GRU A;  4PD2 A;  2BJW A;  3FUT A;  1L8Q A;  4D80 A;  2F5Q A;  3NBX X;  1D0M A;  1YE9 A;  2K6B A;  2L7H A;  5LMN M;  1FJG M;  3KFU G;  2DWL A;  3GQ3 A;  4CJ6 A;  3GLG E;  1R2Y A;  3K92 A;  4DBG B;  2LHG A;  3GRY A;  1OTR A;  1PGY A;  3I51 A;  5IWA M;  1XNQ M;  3U5Z A;  2CEA A;  3RE8 A;  1PJS A;  4LJ4 A;  4FWG A;  1QVR A;  3HU2 A;  2LHC A;  1TF0 B;  1ZAE A;  5ITR A;  3U6P A;  1GO5 A;  4P16 A;  3GLF A;  5KQ8 A;  1IBL M;  4LJ5 A;  1XB2 B;  3NBI A;  1GL7 A;  1V92 A;  2ZM6 M;  2W82 A;  4IBC A;  3E21 A;  1ZQ9 A;  3MHV C;  4DV0 M;  4LF8 M;  2QBY B;  2K9D A;  4B08 A;  2QP9 X;  5IZ7 D;  4NSO B;  3SHF A;  4B3S M;  3SAV A;  3LW5 F;  3U61 B;  4FD2 A;  2HHH M;  4M9Z A;  2C98 A;  3SAW A;  3AOG A;  2CWB A;  1J5E M;  3VKG A;  2YR0 A;  4X62 M;  2Z4S A;  2J7N A;  1L2C A;  3SMS A;  1HR0 M;  2Y0Q A;  1Z5A A; 
#chains in the Genus database with same CATH homology
 2BWE A;  2L4E A;  2KNZ A;  5JI2 E;  2DAI A;  2OOA A;  1F4I A;  2BWB A;  1P3Q Q;  1ZV1 A;  1TR8 A;  2CP8 A;  3IHP A;  3GLF E;  1G3I A;  1VEK A;  1T6O A;  2JUJ A;  1NV9 A;  4F2L A;  1DV0 A;  2QSF X;  2EKK A;  2MGW A;  1VQ1 A;  2EJS A;  2L2D A;  2DEN A;  2DNA A;  2DI0 A;  1NV8 A;  2MRO B;  2JZ0 A;  2JY7 A;  3FRH A;  3GLI E;  2LBC A;  1G41 A;  1R4G A;  4Q7J A;  3K9O A;  3IEC A;  2KNV A;  2QNJ A;  2DAK A;  1WR1 B;  3E46 A;  2LVN C;  1CUK A;  1ZMV A;  2JZ1 A;  1A5T A;  1IM2 A;  1OAI A;  3FRI A;  3GLH E;  2MJ5 B;  1BVS A;  1SG9 A;  1UFZ A;  1OQY A;  2LVQ D;  2EKF A;  1HJP A;  3LCV B;  1VG5 A;  1G4A E;  2DAG A;  1JR3 E;  1WIV A;  3T6P A;  2QHO B;  3K9P A;  2JY6 B;  1DO2 A;  1WHC A;  2B3T A;  4F1I A;  2RRU A;  2WZJ A;  1T43 A;  2DAM A;  5DFL A;  2KHH A;  2ZTD A;  3MMP A;  1XXH E;  2L4F A;  1KYI A;  3BBZ A;  3H4J A;  4GEW A;  4R71 A;  1Y8G A;  4WP2 A;  1QZE A;  1ZMW A;  3LCU A;  1HT2 E;  2H5X A;  1Q02 A;  2KNA A;  2HWJ A;  2DKL A;  1VEG A;  2JY8 A;  2ZTC A;  1AIP C;  1YLA A;  3B89 A;  1IXS A;  2DZL A;  1C7Y A;  2OOB A;  3F92 A;  2JY5 A;  3GLG E;  4G3O A;  1E94 E;  2DAE A;  1HQY E;  4DBG B;  1ZMU A;  2LTU A;  1WJ7 A;  1IFY A;  1HT1 E;  1OTR A;  1PGY A;  2LVO C;  3FE3 A;  2MR9 A;  1VDL A;  1MN3 A;  1GO5 A;  1VEJ A;  2HAK A;  2O25 A;  1EFU B;  2OO9 A;  1DO0 A;  1XB2 B;  1V92 A;  1WGN A;  1TTE A;  2R0I A;  2JP7 A;  2LVP C;  3E21 A;  2G3Q A;  2DHY A;  1WGL A;  2K9D A;  1OKS A;  2K0B X;  2JNH A;  4HEO A;  4UN2 B;  2CWB A;  2LVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...