2EKFA

Solution structure of ruh-075, a human cue domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
GSSGSSGSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ancient ubiquitous protein 1
publication title Solution structure of RUH-075, a human CUE domain
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ekfA01
2ZTDA 1TR8A 3T6PA 2BWBA 2KHHA 1DV0A 2QNJA 1QZEA 1TTEA 1EFUB 2QSFX 1G41A 1VEJA 2K0BX 2JZ1A 1OAIA 1GO5A 1YLAA 4GEWA 1V92A 1ZV1A 3IHPA 2BWEA 1Y8GA 2KNZA 2HWJA 3H4JA 2QHOB 1WJ7A 3GLHE 2DAGA 3FRHA 1OQYA 1A5TA 2MROB 3LCVB 2JY5A 1PGYA 3FRIA 2MR9A 3BBZA 2L4EA 1NV8A 2DAMA 1ZMWA 1P3QQ 4F2LA 4Q7JA 3F92A 2LTUA 3MMPA 2KNVA 2DHYA 2DZLA 2DKLA 2EKKA 4HEOA 4R71A 1MN3A 2LVOC 3E46A 1G3IA 3GLFE 1R4GA 1KYIA 2L2DA 1IFYA 2DAEA 2JY7A 3K9OA 2MGWA 1OTRA 1JR3E 2OO9A 4UN2B 1XB2B 2JY8A 2B3TA 1E94E 1IM2A 3GLIE 3FE3A 1CUKA 2LVQD 1IXSA 5JI2E 1NV9A 1Q02A 2DAKA 1HT2E 1WIVA 1VEKA 2DENA 2EKFA 2JP7A 4WP2A 1F4IA 2OOBA 1HQYE 2EJSA 2CWBA 2LBCA 3IECA 1ZMUA 2WZJA 3GLGE 1BVSA 1G4AE 2JUJA 1UFZA 2MJ5B 2LVNC 1C7YA 1VDLA 5DFLA 1WGNA 2JY6B 2DI0A 1VEGA 1OKSA 2KNAA 1T6OA 2H5XA 4F1IA 2LVPC 1WHCA 1AIPC 3B89A 2K9DA 2HAKA 2R0IA 4DBGB 1HT1E 2JZ0A 2DNAA 1WGLA 1WR1B 3K9PA 1DO2A 2JNHA 3LCUA 2LVAA 1SG9A 4G3OA 2OOAA 2RRUA 1VQ1A 2L4FA 1XXHE 2CP8A 2O25A 1HJPA 1T43A 2G3QA 1VG5A 1ZMVA 1DO0A 3E21A 2DAIA 2ZTCA
chains in the Genus database with same CATH superfamily
2F5QA 4CIZA 2KDLA 3T6PA 5E26A 3LQQA 5IREB 4GMQA 3VLFB 4B3SM 1QQWA 4QHTA 4PD2A 1Z5AA 3CF2A 3VKGA 3FYCA 4I81A 5EXTA 3W0FA 2F4VM 3VK8A 2KZUA 3THGA 3H4MA 1N77A 8CATA 2VQEM 4G4RA 3FUUA 2EO2A 3MK6A 1OAIA 4G4QA 1IBLM 5KO3A 4DV7M 1K3XA 1YE9A 1ZQ9A 4Y28F 1LV7A 4JI3M 2BWEA 1Y8GA 3GQ5A 3KSJA 3RFWA 3H4JA 1PJQA 3SYLA 5DNYA 1L2DA 1HNZM 2CV1A 3SATA 3I4YA 4LF4M 4QHSA 4LF7M 1WJ7A 2VDBB 3GLHE 4LG2A 3TWKA 3C3EA 3M6AA 2CRUA 1FNNA 2BJVA 3DFZA 3R8FA 3CTWB 1WXQA 3AV0A 3UJNA 2VIIA 3U6SA 1NV8A 2YR0A 4DR6M 1D0LA 4NOOB 3ZCBB 4KLNA 2E5LM 3ILKA 2KW0A 5A2QS 4MGKE 4JI5M 2RGHA 1XMOM 4IBEA 1TH4A 2MH8A 4Q7JA 2UUAM 2DXIA 3SHFA 4ANRA 1UM8A 1K82A 4I8OA 2XGNA 4LY6A 1MJGM 3HJSA 1I94M 2XEPA 2QBYB 3UGJA 2EKKA 4HEOA 4R71A 2LVOC 1W5TA 1PJTA 4JI6M 2GNOA 4KHPM 2Q2EB 2XH9A 1AUAA 2Y0QA 3J7AS 3AOEA 4CISA 4RKUF 1OIZA 3B74A 2R6FA 5EXXA 3CF6E 4IBKA 3KW6A 2L09A 3FYDA 4LGMA 3KS8A 4UN2B 4LZZA 4QOSA 3LQRA 4LF9M 2JY8A 3HU2A 4LF6M 4LRTA 1IM2A 3AL0C 2RGOA 2LVQD 1IXSA 1SXJA 2LNHC 2KA6B 1W5SA 3U6MA 3FTDA 4IIWA 2KZSA 2J7NA 1N75A 2DENA 4LJ8A 4WP2A 3IG8A 3T1YM 4DR7M 3SYKA 2EJSA 2CWBA 5EXPA 3U5ZA 3IECA 1ZMUA 1QAMA 2D7GA 2J7OA 2WZJA 2Z7JA 2QP9X 3M0EA 2QENA 1E9SA 2DWMA 2JUJA 2CHQA 3L26A 1L1TA 1NVMA 3HJ8A 4X65M 2JY6B 2DI0A 1Q39A 3LVVA 4M9XA 4LFCM 2KNAA 3KSXA 2H5XA 3CGWA 2ZAOA 2UXCM 2XZUA 2L7HA 4OVZA 2LVPC 2HKJA 3KFUG 2R45A 5EXSA 2HL7A 4FVMA 2R0IA 1S3SA 3T38A 3OTOM 4NRVA 4LJ9A 4JI7M 4OW0A 2DNAA 2W82A 2XZFA 3LVWA 1WGLA 4GIPA 4DV1M 1NJGA 3LCUA 4QOZC 3HGIA 3LW5F 1IN7A 1MX0A 1G8PA 1HNWM 2YQZA 3M7GA 1XXHE 1V33A 4I4LA 2G3QA 4LJ4A 1XNQM 1NY6A 1XWIA 2VF8A 3EIEA 4QNMA 2I7NA 1OTRA 3DA1A 1DGHA 2XF3A 2X49A 5ITUA 1VDDA 2C9CA 3HKPA 2LH0A 3TPZA 3B7ZA 4AG6A 3VDPA 3GPPA 4II7A 1L2CA 2CUZA 3E9SA 2BWBA 2C96A 3GLHB 5KQDA 2QNJA 5EP1A 2Z3XA 1TDZA 4PDGA 1QANA 3KP1E 2DHRA 2D7EA 1EE8A 1N36M 2K47A 1TTEA 2UXDM 2QSFX 1G41A 3TWLA 1QDRA 3HY5A 4FWGA 1YLAA 4AKGA 3GRYA 2OQ4A 3HU1A 4CHTB 4GC5A 3TL4X 3L27A 4W5WA 4MH0E 3RE8A 5FLXS 3U5ZB 4NXMM 1QUTA 2HWJA 1PJSA 4NXNM 3HZJA 2LWXA 2QHOB 4LGYA 1IY2A 2WSFF 3AJIB 3NBXX 2R18A 2MROB 2DWLA 2JY5A 4IJEA 1PGYA 3BBZA 2CV2A 4IBCA 2QZ4A 4L6V6 1IN6A 1TF0B 4B3MM 4GHAA 1E9RA 3C9PA 1IXRC 2P5TA 3K1JA 2WSEF 1GKIA 3BOSA 4LCBA 2K6BA 4LJ5A 4JYAM 1Z5CA 3L28A 4G4NA 3F92A 3WHLA 2DHYA 3WHKA 3CF0A 2DKLA 1GJSA 4AKIA 4NSOB 4FWDA 3D8LA 1G3IA 3GLFA 1R4GA 1KYIA 1IFYA 3GQ4A 2BJWA 4REZA 4FD2A 2MGWA 3JR4A 2QPAA 2V1CA 5ITRA 1TDHA 5E6JA 2OO9A 4LJ7A 4P16A 3UMMA 3VKHA 2DVWB 3JAMS 2B3TA 5ITXA 1R2YA 2UUBM 4JI2M 4LFAM 3GLIA 3FTEA 1SXJE 3GPUA 4B7FA 2ZAMA 4GRIA 3A45A 3C58A 1K3WA 1N32M 1VEKA 2FOIC 2EKFA 2V6ZM 1F4IA 1HQYE 5BR8M 4IBGA 1IN8A 4IJFA 2Z4RA 1DGGA 2JXNA 4XGIA 1QUSA 1X37A 2XFTA 2I7PA 2APLA 2M60A 3PNYA 2FH0A 1OAOC 4ZPXA 4LJ6A 4LZJA 4G6ZA 3KS4A 2F5SA 3A98B 4KODA 1PM5A 4MGHA 1TH2A 1NO1A 2A5YB 4NSRA 2RKOA 1IBMM 4RNAA 3GLGB 3FD9A 4QNRA 2F5OA 4OX9M 1XXHB 1TGUA 1JQJC 4X64M 4F1IA 2DZNB 1GL6A 2R46A 3HHWA 2VF7A 3B89A 2K9DA 3U61A 3D8BA 4MGZE 5FTJA 1HT1E 1QDTA 1R5LA 1IN4A 1YUBA 2C5RA 3KP0E 2J5YA 5GKNA 1OFIA 4IBDA 3GPYA 3U6CA 4LF8M 4LF5M 1IY0A 1QAQA 1IY1A 3V76A 4JI8M 3Q8GA 2CFOA 2R62A 2RRUA 1VQ1A 2LHGA 3SFZA 5C1BA 1XNRM 5EJCA 1HR0M 3T15A 1JB0F 3KOYE 1VG5A 1SXJD 4S12A 2ZTDA 5FTKA 2GQFA 3SBJA 2YFQA 2D7HA 2JA2A 1RU3A 1GABA 3U6LA 4MGYE 3SASA 3BXWA 2G5GX 3B9PA 5L8RF 2YNMD 1G59A 1NNUC 4I5SA 1QZEA 1NHWC 1D2NA 1EFUB 1VEJA 3QWLA 2X4AA 2JZ1A 1GO5A 3JR5A 4MB7A 4AKHA 4AW4A 3SAUA 4WW0A 3GO8A 3GPXA 5DYIA 2LHCA 1V92A 3B7QA 1ORYB 1ZV1A 4BBAA 4B7GA 2DWZB 3ZH9B 4L8RC 4GHLA 2DAGA 3GRVA 1A5TA 3HHXA 5ITYA 1C1KA 3LCVB 3U6EA 3SMSA 4ITQA 3FRIA 4X66M 2L4EA 5IWAM 4YY3M 1P3QQ 5FTNA 5EQTA 4NL4H 3U6QA 2R44A 1Z59A 3EIHA 2CV0A 1T3TA 4F2LA 1QVRA 1HQCA 1PRBA 2LTUA 4D81A 4EIWA 3U61B 3PXGA 2KNVA 2F5PA 1IQPA 1IXSB 4GITA 1SXJB 1V34A 3QYBA 3E46A 4DR3M 3GLFE 3GQ3A 2L2DA 5KPZA 3L29A 1XC8A 3U6PA 3K9OA 2L7IA 2WSCF 2R65A 3MHVC 4NC6A 3DOAA 2L6OA 1NSFA 1N78A 5LMNM 1XB2B 5ITXE 2DZOB 4L16A 1DGBA 3SAWA 3GLIE 3HHZA 2KXEA 3K8ZA 2QBYA 5JI2E 1NV9A 1Z6TA 4DR5M 2DAKA 1HT2E 4M9SA 4OVZB 2NQ8C 3FUWA 1OIPA 3UK6A 1NNJA 1Q3CA 2OOBA 4P17A 4IBFA 3J27B 3KOXE 3SMPA 5C18A 4LRSA 3QYEA 3U6DA 1BVSA 5FTLA 4M9ZA 4R3DA 5FSWA 1G71A 4JN6A 4JV5M 1VDLA 2XLJA 5DFLA 1L8QA 1WGNA 1Z5BA 2ZANA 4B08A 2CE7A 1OKSA 2F5NA 4PDIA 1T6OA 3PVSA 1QAOA 3SAVA 3K2LA 3AFHA 1NHGC 3VDUA 4R7GA 5DYGA 3W0LB 3HX3A 4GKKM 1R7RA 1WHCA 1AIPC 1DGHB 2FNAA 5IZ7D 2UUCM 4RF1A 3I4VA 4DR4M 2ERCA 3I51A 1GLNA 4NRWA 1KSFX 1GJTA 3HWSA 4CJ6A 2JZ0A 4DV3M 4DV5M 3FTFA 4FCVA 1E32A 1H6UA 2JWSA 1WR1B 3K9PA 2JNHA 2EA0A 4IBJA 3W68A 1SG9A 3GRRA 3PFIA 4G3OA 4GC9A 5EP3A 3ZQJA 2OPFA 4DR2M 2OOAA 5EP2A 3U6OA 4GKJM 2R4EA 2CP8A 4XK8F 2O25A 1HJPA 1T43A 1GL7A 4B3RM 1MU5A 1DO0A 4K0KM 2DAIA 1HNXM 5KQ8A 3L2AA 1TR8A 4AQYM 3KXEC 2C98A 4AZFA 5F3WA 4KO8A 2N35A 2KRKA 4PT5A 1N34M 1J5EM 2UXBM 3I04M 1YSYA 2KHHA 5BPVA 5ITTA 3J81S 1DV0A 3TQSA 3FUVA 3SARA 4GH9A 5H37D 1FJGM 4DV6M 3U60A 1PJIA 2UU9M 4RF0A 3GRUA 2K0BX 1LTMA 4XBOA 5KPTA 3RGPA 4D80A 2Y0TA 2G8LA 4IBBA 5IT9S 4WURA 2BNKA 4GEWA 4HL4A 5ITQA 3IHPA 2KNZA 4M0WA 3ZC7B 4B7HA 3FUTA 2HHHM 3FRHA 3GLHA 3DZDA 1OQYA 4DV4M 3AOGA 3GLFB 2XSZA 3LMMA 4DUZM 1QZMA 1EIJA 2O5RA 3HJQA 3SHGB 2Y20A 4MGIE 5LMUM 2H1RA 2MR9A 1KFVA 2CHGA 2DAMA 3E4RA 4PCZA 1ZMWA 1R2ZA 1N33M 4IBIA 4HLQA 3T1HM 2Y21A 1QYRA 3KVWA 3NBIA 3B7NA 4X62M 1XHBA 3TE6A 1D0KA 3RGSA 3GLIB 3MMPA 1J7KA 1OFHA 2XSZD 3K92A 2KRUA 3SC3A 1NJFA 4DR1M 2DZLA 3FKEA 4AG5A 1MN3A 4FW9A 5EP4A 4DUYM 2DAEA 2ZM6M 2JY7A 1GVNA 2FFJA 1OJLA 2KEBA 4JI4M 2LXEA 1JR3E 1D0MA 3MJ5A 4JXJA 4D82A 4YHHM 1XMQM 2VQFM 1E94E 3FE3A 1CUKA 3J7BA 1NY5A 1Q3BA 2M5ZA 3VK7A 2DWNA 4FWHA 1J09A 4Z8XA 1Q02A 4A3VB 3L25A 3KOZE 1WIVA 4LFBM 4DV0M 2Z8YM 2JP7A 1IXZA 2LBCA 3FTCA 3GLGE 3U60B 3Q8XA 3QAUA 3I01M 4L78A 2ZBKB 3A46A 1G4AE 3IG5A 1UFZA 2CEAA 2Z4SA 4LJAA 2QQ8A 5FTMA 2MJ5B 2LVNC 1C7YA 2HCBA 3J80S 2R4JA 4OU7A 2CHVA 4Z6YA 2EUCA 1VEGA 4MM3B 2C9OA 4JI0M 3AKZA 4JI1M 4B3TM 1JR3A 3FUXA 3W67A 4AI6A 1L2BA 1L1ZA 3R9XB 4BLCA 4DV2M 1DGFA 4KT0F 2QCUA 3VFDA 3HU3A 4CGYB 5KPRA 5JI3E 2HAKA 2FS1A 4DBGB 3AOEC 4M0DA 1IN5A 2XFSA 3KDSE 3C3DA 4FCWA 2O01F 1I4WA 7CATA 4BB9A 2C99A 1DO2A 3TWMA 1JR3D 4L4UA 4TUWA 2LVAA 3HHYA 1PJJA 1R6BX 2AHMA 4G4OA 1TH3A 3NWLA 4FCTA 3GP1A 2L4FA 3UZUA 3A42A 3GLGA 3KOWE 1XXHA 3PNVA 4L15A 1SXJC 1IBKM 3J2PB 1ZMVA 2FE8A 1ZAEA 2V1UA 3E21A 2ZTCA 2X8AA
chains in the Genus database with same CATH topology
2ZTDA 1TR8A 3T6PA 2BWBA 2KHHA 1DV0A 2QNJA 1QZEA 1TTEA 1EFUB 2QSFX 1G41A 1VEJA 2K0BX 2JZ1A 1OAIA 1GO5A 1YLAA 4GEWA 1V92A 1ZV1A 3IHPA 2BWEA 1Y8GA 2KNZA 2HWJA 3H4JA 2QHOB 1WJ7A 3GLHE 2DAGA 3FRHA 1OQYA 1A5TA 2MROB 3LCVB 2JY5A 1PGYA 3FRIA 2MR9A 3BBZA 2L4EA 1NV8A 2DAMA 1ZMWA 1P3QQ 4F2LA 4Q7JA 3F92A 2LTUA 3MMPA 2KNVA 2DHYA 2DZLA 2DKLA 2EKKA 4HEOA 4R71A 1MN3A 2LVOC 3E46A 1G3IA 3GLFE 1R4GA 1KYIA 2L2DA 1IFYA 2DAEA 2JY7A 3K9OA 2MGWA 1OTRA 1JR3E 2OO9A 4UN2B 1XB2B 2JY8A 2B3TA 1E94E 1IM2A 3GLIE 3FE3A 1CUKA 2LVQD 1IXSA 5JI2E 1NV9A 1Q02A 2DAKA 1HT2E 1WIVA 1VEKA 2DENA 2EKFA 2JP7A 4WP2A 1F4IA 2OOBA 1HQYE 2EJSA 2CWBA 2LBCA 3IECA 1ZMUA 2WZJA 3GLGE 1BVSA 1G4AE 2JUJA 1UFZA 2MJ5B 2LVNC 1C7YA 1VDLA 5DFLA 1WGNA 2JY6B 2DI0A 1VEGA 1OKSA 2KNAA 1T6OA 2H5XA 4F1IA 2LVPC 1WHCA 1AIPC 3B89A 2K9DA 2HAKA 2R0IA 4DBGB 1HT1E 2JZ0A 2DNAA 1WGLA 1WR1B 3K9PA 1DO2A 2JNHA 3LCUA 2LVAA 1SG9A 4G3OA 2OOAA 2RRUA 1VQ1A 2L4FA 1XXHE 2CP8A 2O25A 1HJPA 1T43A 2G3QA 1VG5A 1ZMVA 1DO0A 3E21A 2DAIA 2ZTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZTD A;  1TR8 A;  3T6P A;  2BWB A;  2KHH A;  1DV0 A;  2QNJ A;  1QZE A;  1TTE A;  1EFU B;  2QSF X;  1G41 A;  1VEJ A;  2K0B X;  2JZ1 A;  1OAI A;  1GO5 A;  1YLA A;  4GEW A;  1V92 A;  1ZV1 A;  3IHP A;  2BWE A;  1Y8G A;  2KNZ A;  2HWJ A;  3H4J A;  2QHO B;  1WJ7 A;  3GLH E;  2DAG A;  3FRH A;  1OQY A;  1A5T A;  2MRO B;  3LCV B;  2JY5 A;  1PGY A;  3FRI A;  2MR9 A;  3BBZ A;  2L4E A;  1NV8 A;  2DAM A;  1ZMW A;  1P3Q Q;  4F2L A;  4Q7J A;  3F92 A;  2LTU A;  3MMP A;  2KNV A;  2DHY A;  2DZL A;  2DKL A;  2EKK A;  4HEO A;  4R71 A;  1MN3 A;  2LVO C;  3E46 A;  1G3I A;  3GLF E;  1R4G A;  1KYI A;  2L2D A;  1IFY A;  2DAE A;  2JY7 A;  3K9O A;  2MGW A;  1OTR A;  1JR3 E;  2OO9 A;  4UN2 B;  1XB2 B;  2JY8 A;  2B3T A;  1E94 E;  1IM2 A;  3GLI E;  3FE3 A;  1CUK A;  2LVQ D;  1IXS A;  5JI2 E;  1NV9 A;  1Q02 A;  2DAK A;  1HT2 E;  1WIV A;  1VEK A;  2DEN A;  2EKF A;  2JP7 A;  4WP2 A;  1F4I A;  2OOB A;  1HQY E;  2EJS A;  2CWB A;  2LBC A;  3IEC A;  1ZMU A;  2WZJ A;  3GLG E;  1BVS A;  1G4A E;  2JUJ A;  1UFZ A;  2MJ5 B;  2LVN C;  1C7Y A;  1VDL A;  5DFL A;  1WGN A;  2JY6 B;  2DI0 A;  1VEG A;  1OKS A;  2KNA A;  1T6O A;  2H5X A;  4F1I A;  2LVP C;  1WHC A;  1AIP C;  3B89 A;  2K9D A;  2HAK A;  2R0I A;  4DBG B;  1HT1 E;  2JZ0 A;  2DNA A;  1WGL A;  1WR1 B;  3K9P A;  1DO2 A;  2JNH A;  3LCU A;  2LVA A;  1SG9 A;  4G3O A;  2OOA A;  2RRU A;  1VQ1 A;  2L4F A;  1XXH E;  2CP8 A;  2O25 A;  1HJP A;  1T43 A;  2G3Q A;  1VG5 A;  1ZMV A;  1DO0 A;  3E21 A;  2DAI A;  2ZTC A; 
#chains in the Genus database with same CATH topology
 2F5Q A;  4CIZ A;  2KDL A;  3T6P A;  5E26 A;  3LQQ A;  5IRE B;  4GMQ A;  3VLF B;  4B3S M;  1QQW A;  4QHT A;  4PD2 A;  1Z5A A;  3CF2 A;  3VKG A;  3FYC A;  4I81 A;  5EXT A;  3W0F A;  2F4V M;  3VK8 A;  2KZU A;  3THG A;  3H4M A;  1N77 A;  8CAT A;  2VQE M;  4G4R A;  3FUU A;  2EO2 A;  3MK6 A;  1OAI A;  4G4Q A;  1IBL M;  5KO3 A;  4DV7 M;  1K3X A;  1YE9 A;  1ZQ9 A;  4Y28 F;  1LV7 A;  4JI3 M;  2BWE A;  1Y8G A;  3GQ5 A;  3KSJ A;  3RFW A;  3H4J A;  1PJQ A;  3SYL A;  5DNY A;  1L2D A;  1HNZ M;  2CV1 A;  3SAT A;  3I4Y A;  4LF4 M;  4QHS A;  4LF7 M;  1WJ7 A;  2VDB B;  3GLH E;  4LG2 A;  3TWK A;  3C3E A;  3M6A A;  2CRU A;  1FNN A;  2BJV A;  3DFZ A;  3R8F A;  3CTW B;  1WXQ A;  3AV0 A;  3UJN A;  2VII A;  3U6S A;  1NV8 A;  2YR0 A;  4DR6 M;  1D0L A;  4NOO B;  3ZCB B;  4KLN A;  2E5L M;  3ILK A;  2KW0 A;  5A2Q S;  4MGK E;  4JI5 M;  2RGH A;  1XMO M;  4IBE A;  1TH4 A;  2MH8 A;  4Q7J A;  2UUA M;  2DXI A;  3SHF A;  4ANR A;  1UM8 A;  1K82 A;  4I8O A;  2XGN A;  4LY6 A;  1MJG M;  3HJS A;  1I94 M;  2XEP A;  2QBY B;  3UGJ A;  2EKK A;  4HEO A;  4R71 A;  2LVO C;  1W5T A;  1PJT A;  4JI6 M;  2GNO A;  4KHP M;  2Q2E B;  2XH9 A;  1AUA A;  2Y0Q A;  3J7A S;  3AOE A;  4CIS A;  4RKU F;  1OIZ A;  3B74 A;  2R6F A;  5EXX A;  3CF6 E;  4IBK A;  3KW6 A;  2L09 A;  3FYD A;  4LGM A;  3KS8 A;  4UN2 B;  4LZZ A;  4QOS A;  3LQR A;  4LF9 M;  2JY8 A;  3HU2 A;  4LF6 M;  4LRT A;  1IM2 A;  3AL0 C;  2RGO A;  2LVQ D;  1IXS A;  1SXJ A;  2LNH C;  2KA6 B;  1W5S A;  3U6M A;  3FTD A;  4IIW A;  2KZS A;  2J7N A;  1N75 A;  2DEN A;  4LJ8 A;  4WP2 A;  3IG8 A;  3T1Y M;  4DR7 M;  3SYK A;  2EJS A;  2CWB A;  5EXP A;  3U5Z A;  3IEC A;  1ZMU A;  1QAM A;  2D7G A;  2J7O A;  2WZJ A;  2Z7J A;  2QP9 X;  3M0E A;  2QEN A;  1E9S A;  2DWM A;  2JUJ A;  2CHQ A;  3L26 A;  1L1T A;  1NVM A;  3HJ8 A;  4X65 M;  2JY6 B;  2DI0 A;  1Q39 A;  3LVV A;  4M9X A;  4LFC M;  2KNA A;  3KSX A;  2H5X A;  3CGW A;  2ZAO A;  2UXC M;  2XZU A;  2L7H A;  4OVZ A;  2LVP C;  2HKJ A;  3KFU G;  2R45 A;  5EXS A;  2HL7 A;  4FVM A;  2R0I A;  1S3S A;  3T38 A;  3OTO M;  4NRV A;  4LJ9 A;  4JI7 M;  4OW0 A;  2DNA A;  2W82 A;  2XZF A;  3LVW A;  1WGL A;  4GIP A;  4DV1 M;  1NJG A;  3LCU A;  4QOZ C;  3HGI A;  3LW5 F;  1IN7 A;  1MX0 A;  1G8P A;  1HNW M;  2YQZ A;  3M7G A;  1XXH E;  1V33 A;  4I4L A;  2G3Q A;  4LJ4 A;  1XNQ M;  1NY6 A;  1XWI A;  2VF8 A;  3EIE A;  4QNM A;  2I7N A;  1OTR A;  3DA1 A;  1DGH A;  2XF3 A;  2X49 A;  5ITU A;  1VDD A;  2C9C A;  3HKP A;  2LH0 A;  3TPZ A;  3B7Z A;  4AG6 A;  3VDP A;  3GPP A;  4II7 A;  1L2C A;  2CUZ A;  3E9S A;  2BWB A;  2C96 A;  3GLH B;  5KQD A;  2QNJ A;  5EP1 A;  2Z3X A;  1TDZ A;  4PDG A;  1QAN A;  3KP1 E;  2DHR A;  2D7E A;  1EE8 A;  1N36 M;  2K47 A;  1TTE A;  2UXD M;  2QSF X;  1G41 A;  3TWL A;  1QDR A;  3HY5 A;  4FWG A;  1YLA A;  4AKG A;  3GRY A;  2OQ4 A;  3HU1 A;  4CHT B;  4GC5 A;  3TL4 X;  3L27 A;  4W5W A;  4MH0 E;  3RE8 A;  5FLX S;  3U5Z B;  4NXM M;  1QUT A;  2HWJ A;  1PJS A;  4NXN M;  3HZJ A;  2LWX A;  2QHO B;  4LGY A;  1IY2 A;  2WSF F;  3AJI B;  3NBX X;  2R18 A;  2MRO B;  2DWL A;  2JY5 A;  4IJE A;  1PGY A;  3BBZ A;  2CV2 A;  4IBC A;  2QZ4 A;  4L6V 6;  1IN6 A;  1TF0 B;  4B3M M;  4GHA A;  1E9R A;  3C9P A;  1IXR C;  2P5T A;  3K1J A;  2WSE F;  1GKI A;  3BOS A;  4LCB A;  2K6B A;  4LJ5 A;  4JYA M;  1Z5C A;  3L28 A;  4G4N A;  3F92 A;  3WHL A;  2DHY A;  3WHK A;  3CF0 A;  2DKL A;  1GJS A;  4AKI A;  4NSO B;  4FWD A;  3D8L A;  1G3I A;  3GLF A;  1R4G A;  1KYI A;  1IFY A;  3GQ4 A;  2BJW A;  4REZ A;  4FD2 A;  2MGW A;  3JR4 A;  2QPA A;  2V1C A;  5ITR A;  1TDH A;  5E6J A;  2OO9 A;  4LJ7 A;  4P16 A;  3UMM A;  3VKH A;  2DVW B;  3JAM S;  2B3T A;  5ITX A;  1R2Y A;  2UUB M;  4JI2 M;  4LFA M;  3GLI A;  3FTE A;  1SXJ E;  3GPU A;  4B7F A;  2ZAM A;  4GRI A;  3A45 A;  3C58 A;  1K3W A;  1N32 M;  1VEK A;  2FOI C;  2EKF A;  2V6Z M;  1F4I A;  1HQY E;  5BR8 M;  4IBG A;  1IN8 A;  4IJF A;  2Z4R A;  1DGG A;  2JXN A;  4XGI A;  1QUS A;  1X37 A;  2XFT A;  2I7P A;  2APL A;  2M60 A;  3PNY A;  2FH0 A;  1OAO C;  4ZPX A;  4LJ6 A;  4LZJ A;  4G6Z A;  3KS4 A;  2F5S A;  3A98 B;  4KOD A;  1PM5 A;  4MGH A;  1TH2 A;  1NO1 A;  2A5Y B;  4NSR A;  2RKO A;  1IBM M;  4RNA A;  3GLG B;  3FD9 A;  4QNR A;  2F5O A;  4OX9 M;  1XXH B;  1TGU A;  1JQJ C;  4X64 M;  4F1I A;  2DZN B;  1GL6 A;  2R46 A;  3HHW A;  2VF7 A;  3B89 A;  2K9D A;  3U61 A;  3D8B A;  4MGZ E;  5FTJ A;  1HT1 E;  1QDT A;  1R5L A;  1IN4 A;  1YUB A;  2C5R A;  3KP0 E;  2J5Y A;  5GKN A;  1OFI A;  4IBD A;  3GPY A;  3U6C A;  4LF8 M;  4LF5 M;  1IY0 A;  1QAQ A;  1IY1 A;  3V76 A;  4JI8 M;  3Q8G A;  2CFO A;  2R62 A;  2RRU A;  1VQ1 A;  2LHG A;  3SFZ A;  5C1B A;  1XNR M;  5EJC A;  1HR0 M;  3T15 A;  1JB0 F;  3KOY E;  1VG5 A;  1SXJ D;  4S12 A;  2ZTD A;  5FTK A;  2GQF A;  3SBJ A;  2YFQ A;  2D7H A;  2JA2 A;  1RU3 A;  1GAB A;  3U6L A;  4MGY E;  3SAS A;  3BXW A;  2G5G X;  3B9P A;  5L8R F;  2YNM D;  1G59 A;  1NNU C;  4I5S A;  1QZE A;  1NHW C;  1D2N A;  1EFU B;  1VEJ A;  3QWL A;  2X4A A;  2JZ1 A;  1GO5 A;  3JR5 A;  4MB7 A;  4AKH A;  4AW4 A;  3SAU A;  4WW0 A;  3GO8 A;  3GPX A;  5DYI A;  2LHC A;  1V92 A;  3B7Q A;  1ORY B;  1ZV1 A;  4BBA A;  4B7G A;  2DWZ B;  3ZH9 B;  4L8R C;  4GHL A;  2DAG A;  3GRV A;  1A5T A;  3HHX A;  5ITY A;  1C1K A;  3LCV B;  3U6E A;  3SMS A;  4ITQ A;  3FRI A;  4X66 M;  2L4E A;  5IWA M;  4YY3 M;  1P3Q Q;  5FTN A;  5EQT A;  4NL4 H;  3U6Q A;  2R44 A;  1Z59 A;  3EIH A;  2CV0 A;  1T3T A;  4F2L A;  1QVR A;  1HQC A;  1PRB A;  2LTU A;  4D81 A;  4EIW A;  3U61 B;  3PXG A;  2KNV A;  2F5P A;  1IQP A;  1IXS B;  4GIT A;  1SXJ B;  1V34 A;  3QYB A;  3E46 A;  4DR3 M;  3GLF E;  3GQ3 A;  2L2D A;  5KPZ A;  3L29 A;  1XC8 A;  3U6P A;  3K9O A;  2L7I A;  2WSC F;  2R65 A;  3MHV C;  4NC6 A;  3DOA A;  2L6O A;  1NSF A;  1N78 A;  5LMN M;  1XB2 B;  5ITX E;  2DZO B;  4L16 A;  1DGB A;  3SAW A;  3GLI E;  3HHZ A;  2KXE A;  3K8Z A;  2QBY A;  5JI2 E;  1NV9 A;  1Z6T A;  4DR5 M;  2DAK A;  1HT2 E;  4M9S A;  4OVZ B;  2NQ8 C;  3FUW A;  1OIP A;  3UK6 A;  1NNJ A;  1Q3C A;  2OOB A;  4P17 A;  4IBF A;  3J27 B;  3KOX E;  3SMP A;  5C18 A;  4LRS A;  3QYE A;  3U6D A;  1BVS A;  5FTL A;  4M9Z A;  4R3D A;  5FSW A;  1G71 A;  4JN6 A;  4JV5 M;  1VDL A;  2XLJ A;  5DFL A;  1L8Q A;  1WGN A;  1Z5B A;  2ZAN A;  4B08 A;  2CE7 A;  1OKS A;  2F5N A;  4PDI A;  1T6O A;  3PVS A;  1QAO A;  3SAV A;  3K2L A;  3AFH A;  1NHG C;  3VDU A;  4R7G A;  5DYG A;  3W0L B;  3HX3 A;  4GKK M;  1R7R A;  1WHC A;  1AIP C;  1DGH B;  2FNA A;  5IZ7 D;  2UUC M;  4RF1 A;  3I4V A;  4DR4 M;  2ERC A;  3I51 A;  1GLN A;  4NRW A;  1KSF X;  1GJT A;  3HWS A;  4CJ6 A;  2JZ0 A;  4DV3 M;  4DV5 M;  3FTF A;  4FCV A;  1E32 A;  1H6U A;  2JWS A;  1WR1 B;  3K9P A;  2JNH A;  2EA0 A;  4IBJ A;  3W68 A;  1SG9 A;  3GRR A;  3PFI A;  4G3O A;  4GC9 A;  5EP3 A;  3ZQJ A;  2OPF A;  4DR2 M;  2OOA A;  5EP2 A;  3U6O A;  4GKJ M;  2R4E A;  2CP8 A;  4XK8 F;  2O25 A;  1HJP A;  1T43 A;  1GL7 A;  4B3R M;  1MU5 A;  1DO0 A;  4K0K M;  2DAI A;  1HNX M;  5KQ8 A;  3L2A A;  1TR8 A;  4AQY M;  3KXE C;  2C98 A;  4AZF A;  5F3W A;  4KO8 A;  2N35 A;  2KRK A;  4PT5 A;  1N34 M;  1J5E M;  2UXB M;  3I04 M;  1YSY A;  2KHH A;  5BPV A;  5ITT A;  3J81 S;  1DV0 A;  3TQS A;  3FUV A;  3SAR A;  4GH9 A;  5H37 D;  1FJG M;  4DV6 M;  3U60 A;  1PJI A;  2UU9 M;  4RF0 A;  3GRU A;  2K0B X;  1LTM A;  4XBO A;  5KPT A;  3RGP A;  4D80 A;  2Y0T A;  2G8L A;  4IBB A;  5IT9 S;  4WUR A;  2BNK A;  4GEW A;  4HL4 A;  5ITQ A;  3IHP A;  2KNZ A;  4M0W A;  3ZC7 B;  4B7H A;  3FUT A;  2HHH M;  3FRH A;  3GLH A;  3DZD A;  1OQY A;  4DV4 M;  3AOG A;  3GLF B;  2XSZ A;  3LMM A;  4DUZ M;  1QZM A;  1EIJ A;  2O5R A;  3HJQ A;  3SHG B;  2Y20 A;  4MGI E;  5LMU M;  2H1R A;  2MR9 A;  1KFV A;  2CHG A;  2DAM A;  3E4R A;  4PCZ A;  1ZMW A;  1R2Z A;  1N33 M;  4IBI A;  4HLQ A;  3T1H M;  2Y21 A;  1QYR A;  3KVW A;  3NBI A;  3B7N A;  4X62 M;  1XHB A;  3TE6 A;  1D0K A;  3RGS A;  3GLI B;  3MMP A;  1J7K A;  1OFH A;  2XSZ D;  3K92 A;  2KRU A;  3SC3 A;  1NJF A;  4DR1 M;  2DZL A;  3FKE A;  4AG5 A;  1MN3 A;  4FW9 A;  5EP4 A;  4DUY M;  2DAE A;  2ZM6 M;  2JY7 A;  1GVN A;  2FFJ A;  1OJL A;  2KEB A;  4JI4 M;  2LXE A;  1JR3 E;  1D0M A;  3MJ5 A;  4JXJ A;  4D82 A;  4YHH M;  1XMQ M;  2VQF M;  1E94 E;  3FE3 A;  1CUK A;  3J7B A;  1NY5 A;  1Q3B A;  2M5Z A;  3VK7 A;  2DWN A;  4FWH A;  1J09 A;  4Z8X A;  1Q02 A;  4A3V B;  3L25 A;  3KOZ E;  1WIV A;  4LFB M;  4DV0 M;  2Z8Y M;  2JP7 A;  1IXZ A;  2LBC A;  3FTC A;  3GLG E;  3U60 B;  3Q8X A;  3QAU A;  3I01 M;  4L78 A;  2ZBK B;  3A46 A;  1G4A E;  3IG5 A;  1UFZ A;  2CEA A;  2Z4S A;  4LJA A;  2QQ8 A;  5FTM A;  2MJ5 B;  2LVN C;  1C7Y A;  2HCB A;  3J80 S;  2R4J A;  4OU7 A;  2CHV A;  4Z6Y A;  2EUC A;  1VEG A;  4MM3 B;  2C9O A;  4JI0 M;  3AKZ A;  4JI1 M;  4B3T M;  1JR3 A;  3FUX A;  3W67 A;  4AI6 A;  1L2B A;  1L1Z A;  3R9X B;  4BLC A;  4DV2 M;  1DGF A;  4KT0 F;  2QCU A;  3VFD A;  3HU3 A;  4CGY B;  5KPR A;  5JI3 E;  2HAK A;  2FS1 A;  4DBG B;  3AOE C;  4M0D A;  1IN5 A;  2XFS A;  3KDS E;  3C3D A;  4FCW A;  2O01 F;  1I4W A;  7CAT A;  4BB9 A;  2C99 A;  1DO2 A;  3TWM A;  1JR3 D;  4L4U A;  4TUW A;  2LVA A;  3HHY A;  1PJJ A;  1R6B X;  2AHM A;  4G4O A;  1TH3 A;  3NWL A;  4FCT A;  3GP1 A;  2L4F A;  3UZU A;  3A42 A;  3GLG A;  3KOW E;  1XXH A;  3PNV A;  4L15 A;  1SXJ C;  1IBK M;  3J2P B;  1ZMV A;  2FE8 A;  1ZAE A;  2V1U A;  3E21 A;  2ZTC A;  2X8A A; 
#chains in the Genus database with same CATH homology
 2ZTD A;  1TR8 A;  3T6P A;  2BWB A;  2KHH A;  1DV0 A;  2QNJ A;  1QZE A;  1TTE A;  1EFU B;  2QSF X;  1G41 A;  1VEJ A;  2K0B X;  2JZ1 A;  1OAI A;  1GO5 A;  1YLA A;  4GEW A;  1V92 A;  1ZV1 A;  3IHP A;  2BWE A;  1Y8G A;  2KNZ A;  2HWJ A;  3H4J A;  2QHO B;  1WJ7 A;  3GLH E;  2DAG A;  3FRH A;  1OQY A;  1A5T A;  2MRO B;  3LCV B;  2JY5 A;  1PGY A;  3FRI A;  2MR9 A;  3BBZ A;  2L4E A;  1NV8 A;  2DAM A;  1ZMW A;  1P3Q Q;  4F2L A;  4Q7J A;  3F92 A;  2LTU A;  3MMP A;  2KNV A;  2DHY A;  2DZL A;  2DKL A;  2EKK A;  4HEO A;  4R71 A;  1MN3 A;  2LVO C;  3E46 A;  1G3I A;  3GLF E;  1R4G A;  1KYI A;  2L2D A;  1IFY A;  2DAE A;  2JY7 A;  3K9O A;  2MGW A;  1OTR A;  1JR3 E;  2OO9 A;  4UN2 B;  1XB2 B;  2JY8 A;  2B3T A;  1E94 E;  1IM2 A;  3GLI E;  3FE3 A;  1CUK A;  2LVQ D;  1IXS A;  5JI2 E;  1NV9 A;  1Q02 A;  2DAK A;  1HT2 E;  1WIV A;  1VEK A;  2DEN A;  2EKF A;  2JP7 A;  4WP2 A;  1F4I A;  2OOB A;  1HQY E;  2EJS A;  2CWB A;  2LBC A;  3IEC A;  1ZMU A;  2WZJ A;  3GLG E;  1BVS A;  1G4A E;  2JUJ A;  1UFZ A;  2MJ5 B;  2LVN C;  1C7Y A;  1VDL A;  5DFL A;  1WGN A;  2JY6 B;  2DI0 A;  1VEG A;  1OKS A;  2KNA A;  1T6O A;  2H5X A;  4F1I A;  2LVP C;  1WHC A;  1AIP C;  3B89 A;  2K9D A;  2HAK A;  2R0I A;  4DBG B;  1HT1 E;  2JZ0 A;  2DNA A;  1WGL A;  1WR1 B;  3K9P A;  1DO2 A;  2JNH A;  3LCU A;  2LVA A;  1SG9 A;  4G3O A;  2OOA A;  2RRU A;  1VQ1 A;  2L4F A;  1XXH E;  2CP8 A;  2O25 A;  1HJP A;  1T43 A;  2G3Q A;  1VG5 A;  1ZMV A;  1DO0 A;  3E21 A;  2DAI A;  2ZTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...