2EKFA

Solution structure of ruh-075, a human cue domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
b'GSSGSSGSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ancient ubiquitous protein 1
publication title Solution structure of RUH-075, a human CUE domain
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ekfA01
1DV0A 1XB2B 1TR8A 2JY8A 1BVSA 2L4FA 3K9OA 2DKLA 1G41A 2KHHA 4Q7JA 1A5TA 2LTUA 1EFUB 2LBCA 1OTRA 2HWJA 1IFYA 3E21A 1WGLA 1VEJA 2BWEA 3FRHA 2LVNC 2H5XA 2QSFX 2JNHA 2JZ0A 3GLIE 1R4GA 2HAKA 2B3TA 1JR3E 2JY7A 1P3QQ 1WJ7A 2DHYA 2DAEA 1G3IA 1V92A 3IECA 1PGYA 2LVPC 3MMPA 1VEKA 2EKKA 1VEGA 1XXHE 1WR1B 1F4IA 1OQYA 3E46A 4F1IA 1C7YA 3IHPA 5DFLA 2MJ5B 2K0BX 1SG9A 2LVQD 2OO9A 3GLGE 2CP8A 2BWBA 4G3OA 5JI2E 3GLHE 1OKSA 2QHOB 2G3QA 1ZMWA 1IM2A 2MR9A 1ZMVA 4R71A 2JP7A 3T6PA 1VG5A 2JZ1A 1AIPC 1E94E 1UFZA 1VQ1A 2JY5A 3B89A 1HQYE 2JUJA 2DZLA 4WP2A 1Q02A 2JY6B 2ZTCA 2K9DA 4HEOA 2WZJA 1ZV1A 2DI0A 1HT1E 3K9PA 3LCVB 2R0IA 3GLFE 3FRIA 2DENA 1G4AE 2DNAA 2OOAA 1OAIA 2LVAA 2L2DA 2MGWA 1MN3A 2QNJA 2KNZA 4F2LA 1CUKA 1Y8GA 2CWBA 2EKFA 1T6OA 2RRUA 3H4JA 1ZMUA 2L4EA 3LCUA 1WHCA 2KNVA 2O25A 2OOBA 2ZTDA 1IXSA 1NV9A 2DAIA 2EJSA 4UN2B 1HJPA 2DAMA 3F92A 1NV8A 4DBGB 1HT2E 4GEWA 1WIVA 2DAGA 1VDLA 2KNAA 3FE3A 1WGNA 1DO2A 3BBZA 1DO0A 1KYIA 2MROB 1GO5A 1TTEA 1YLAA 2DAKA 1QZEA 1T43A 2LVOC
chains in the Genus database with same CATH superfamily
3EIHA 4RF1A 5KO3A 1XB2B 1YUBA 2FE8A 2JY8A 4I81A 1BVSA 3B9PA 2KZSA 2L4FA 5EXPA 4DV7M 4RNAA 5BR8M 1Q3BA 2LHGA 4Q7JA 2APLA 1A5TA 4AKHA 1EFUB 4JI2M 3MJ5A 1N32M 3GRYA 3SFZA 3E21A 3HY5A 1SXJB 4LJAA 4KLNA 1I4WA 4LJ9A 5LMUM 3C3EA 2R18A 2UXBM 5FTKA 4LRSA 3ZC7B 1DGBA 1NNUC 1QDRA 1R4GA 4NL4H 4DV0M 4TUWA 4JV5M 2VF8A 3MK6A 4Z8XA 1E9SA 1P3QQ 4L15A 1WJ7A 2DHYA 3A98B 4JI3M 1HNWM 4GC5A 3GLGB 1G3IA 4X64M 4AKIA 4RKUF 3GPXA 2V1CA 1V92A 3IECA 4CJ6A 3L26A 3U6SA 2R46A 3TL4X 3GLHB 2DVWB 4JI8M 4CIZA 1IY1A 3MMPA 1LV7A 2ZAMA 2EKKA 2X8AA 4BLCA 1IBKM 1XXHE 3QAUA 3TWKA 2DWLA 4D81A 2UXCM 2FFJA 3IHPA 5DFLA 4LF6M 4B3TM 2CP8A 4LGYA 2BWBA 2HL7A 4QOSA 3UMMA 5C1BA 4CHTB 1IM2A 3A45A 1NJFA 4LJ7A 1L1TA 1ZMVA 2JP7A 2OPFA 3DZDA 3KW6A 2JZ1A 1ORYB 3HJQA 4LF5M 2QENA 1UFZA 5DYGA 3TWLA 3B7QA 3TWMA 4M0WA 2HKJA 1N34M 4JI7M 4G4NA 3SATA 5DNYA 1UM8A 2Y0QA 1XXHA 4DUZM 2JY6B 4LF4M 3KOYE 4B3MM 3HHYA 1QANA 4LFAM 2K9DA 1ZQ9A 2WZJA 2X4AA 3GQ5A 2W82A 4JYAM 3QYEA 2DI0A 3J7BA 3K9PA 3VLFB 5IT9S 3HJSA 3K1JA 2DENA 3ZQJA 2DNAA 1TDHA 3W68A 1NHGC 1G59A 2CHGA 2C98A 4AZFA 2LVAA 3VDUA 1QDTA 2C5RA 4IBEA 1HNXM 3Q8GA 2CV2A 1L2DA 3LQQA 4LJ5A 2F5QA 2R4EA 4R7GA 5EJCA 3PVSA 5ITTA 3I04M 4DV5M 4IBKA 1OIZA 1IXSA 4LF8M 4YHHM 3T15A 4GKJM 3FYCA 3E4RA 4FWGA 1XMOM 3C58A 2LWXA 3UGJA 4JI1M 2F5NA 1GJTA 1Z6TA 2DAMA 2J7NA 2DZNB 2LH0A 3H4MA 3HWSA 1HT2E 3VKHA 3L25A 4G4RA 4REZA 3GQ4A 3VK8A 3SC3A 3SYKA 4GRIA 4GHAA 1OAOC 3FE3A 1WGNA 3DFZA 1DO0A 1TTEA 3KXEC 1XHBA 2OQ4A 3HKPA 1JR3E 1VDDA 4LJ8A 2H1RA 4LY6A 5EP3A 1TR8A 4OW0A 1YSYA 5A2QS 4AG6A 3HZJA 4L4UA 4X62M 2ZANA 1OJLA 1R5LA 3FUXA 3BOSA 2DKLA 3BXWA 1NO1A 1PJQA 3TPZA 5ITXA 4FCVA 3SMPA 2ZM6M 4HL4A 3V76A 1OTRA 4FWHA 2UXDM 2HWJA 2X49A 4II7A 4S12A 2EO2A 2XH9A 2V1UA 2L09A 4FW9A 1E9RA 2Y0TA 3W0LB 5KQ8A 3UJNA 3GLIE 2KDLA 3AOEC 3I4VA 1N33M 4FCWA 2CE7A 1PJSA 1JR3A 1EIJA 4M9XA 1EE8A 4OX9M 3KVWA 1QQWA 4DUYM 2BJWA 3HU1A 4X66M 4YY3M 3WHLA 4L16A 1T3TA 1HNZM 3U6QA 3OTOM 2LNHC 2I7PA 3L2AA 2L7HA 3KSXA 4PDGA 4IBCA 1GL7A 4JI5M 1QZMA 1WR1B 1C1KA 3JR4A 4ITQA 1IN5A 2YNMD 5JI3E 1OIPA 1C7YA 2DXIA 1FNNA 5IZ7D 3HHWA 2K0BX 3KS4A 2DZOB 4MGHA 5FLXS 3KS8A 1IXSB 4D80A 4G3OA 3SAWA 1HR0M 4EIWA 3GLIA 1XNQM 1OKSA 1ZAEA 3A42A 2QHOB 4X65M 1J7KA 1GLNA 1ZMWA 2MH8A 2C99A 3FTCA 1GL6A 2G8LA 3CF2A 4GIPA 4R71A 3FUVA 3T6PA 2I7NA 1SXJC 4QHSA 4A3VB 4P17A 1XC8A 1AIPC 1TH4A 2C9CA 1VQ1A 2JY5A 1NNJA 4LRTA 2CUZA 2JUJA 1FJGM 4WURA 1N36M 4OVZB 2JXNA 4WP2A 2VIIA 1GABA 1Q02A 2Z7JA 1IN6A 2ZBKB 3PNVA 3FUWA 4MH0E 1V33A 1QAOA 4WW0A 1TH2A 1HT1E 3L29A 2UUCM 2DWMA 3DOAA 2QQ8A 2R0IA 2UU9M 3U6PA 1OAIA 4MGIE 2VDBB 2MGWA 1MN3A 3KOXE 3QWLA 1R6BX 2DWNA 1N75A 1CUKA 1T6OA 1Y8GA 2CWBA 2GNOA 2V6ZM 3H4JA 1TH3A 4DR6M 3LCUA 1WHCA 2KNVA 2RGOA 1W5SA 1N78A 4NOOB 1NV9A 3KOZE 3U61B 2F5SA 3GLFB 5DYIA 5EXXA 3KP0E 1L2CA 1KSFX 2QBYA 1Z5BA 2L6OA 4AI6A 3GRRA 3LVWA 3Q8XA 4UN2B 1JR3D 3RFWA 1H6UA 4DBGB 5L8RF 1WIVA 3RGSA 4LFBM 2EUCA 2XZUA 4LJ4A 1IXRC 1Q39A 4QNMA 2C96A 3AJIB 3AOEA 2MROB 2DAKA 4GC9A 4QNRA 4LJ6A 4L6V6 4PT5A 1DV0A 1SXJE 1TDZA 3K9OA 3PXGA 1D0LA 2CHQA 5IWAM 3GLIB 3D8BA 3FTFA 2M5ZA 3AL0C 2FNAA 2LTUA 7CATA 3VK7A 5EP2A 2LBCA 3HHXA 3IG5A 3B74A 5ITXE 3R8FA 2HHHM 3UZUA 3B7NA 3U6EA 1IFYA 5H37D 2K47A 2R44A 2KW0A 3L27A 2E5LM 2EA0A 1VEJA 2BWEA 2WSFF 3FRHA 2LVNC 2H5XA 1GVNA 3GRUA 4Y28F 1QUTA 2CFOA 5IREB 2JZ0A 5KQDA 3J81S 2Y21A 2CEAA 3SMSA 2YFQA 4NSOB 2JY7A 4BBAA 3HU3A 1OFIA 1Z59A 3W0FA 3U6DA 3U6CA 4GMQA 3C3DA 1SXJA 4LZJA 1IN8A 4CGYB 3RGPA 3HHZA 1E32A 4B7FA 3ILKA 3ZH9B 2LVPC 3GPYA 1HQCA 1VEKA 1VEGA 3IG8A 3U6LA 1GKIA 4IBGA 4PD2A 3PFIA 3EIEA 3D8LA 2Z8YM 4QHTA 3LVVA 1PM5A 4F1IA 3E9SA 4B08A 1AUAA 1W5TA 4DV3M 4XBOA 2LVQD 1SG9A 2OO9A 2VQFM 3CGWA 4CISA 4JI4M 1QUSA 3GLHA 4MM3B 2CV1A 5JI2E 2JA2A 1IN7A 1MX0A 4L78A 2QBYB 3LW5F 2MR9A 4FWDA 3WHKA 1XXHB 1WXQA 3AV0A 2Q2EB 4I5SA 4DV2M 5ITQA 4NRVA 3HU2A 4IBIA 3KDSE 1E94E 3KFUG 4LGMA 3U6OA 3L28A 3JAMS 1G8PA 3CF0A 4FCTA 3M0EA 4B7HA 4DR1M 2G5GX 4IBFA 2DZLA 4MB7A 3T1YM 2F5PA 4DR4M 4GHLA 4DV6M 4IJFA 3GRVA 4I4LA 3GP1A 2XGNA 3ZCBB 5FTNA 4LG2A 4JN6A 1ZV1A 1D0MA 4RF0A 2JWSA 1RU3A 2J5YA 3FTDA 2LXEA 4M0DA 1S3SA 2LHCA 2XFSA 2N35A 3J80S 3SHFA 1G4AE 3K8ZA 4NXNM 3TQSA 1N77A 1PJIA 2FS1A 4GKKM 2R4JA 2L2DA 2GQFA 2XF3A 2KNZA 3UK6A 4L8RC 1QVRA 2EKFA 1IY2A 1ZMUA 2L4EA 2ZTDA 2OOBA 3FTEA 2Z3XA 3GO8A 2KA6B 5FTJA 2XLJA 3DA1A 4IIWA 4DR7M 4KHPM 4IBDA 1R2ZA 1GJSA 3LMMA 3HGIA 4K0KM 4AQYM 2F4VM 2WSEF 3A46A 3SASA 2EJSA 3FUTA 2R62A 2ZAOA 3HX3A 1HJPA 3AKZA 3U60A 1K3XA 4NRWA 4FD2A 2KZUA 5ITUA 5LMNM 4B3RM 1DGFA 1SXJD 4ANRA 4MGZE 2UUAM 1NJGA 1I94M 4KT0F 3VFDA 2DAGA 3R9XB 1IN4A 2CRUA 2Y20A 1IQPA 4PCZA 4NXMM 2KNAA 1QAMA 2KEBA 3FYDA 3GQ3A 1DO2A 2DHRA 1LTMA 2K6BA 3NBIA 4BB9A 4FVMA 4I8OA 2P5TA 2VF7A 4LF7M 1HQYE 4GEWA 1IBLM 3M7GA 3KOWE 3SAVA 4LCBA 2HCBA 4QOZC 1MJGM 3AFHA 3M6AA 5FTMA 2C9OA 2D7HA 4ZPXA 3I01M 2KXEA 4B3SM 1G41A 1PJTA 2KHHA 4KO8A 5F3WA 4IJEA 1L2BA 3T38A 2AHMA 3NBXX 4G4QA 5EP1A 2O01F 1K3WA 4G4OA 3NWLA 4XGIA 3HJ8A 4JXJA 1WGLA 1Z5AA 2UUBM 2QP9X 3SHGB 4AW4A 2QZ4A 3I51A 1JB0F 3U5ZA 2XFTA 2QSFX 3RE8A 2JNHA 3KSJA 4P16A 1NVMA 2HAKA 2B3TA 1R2YA 3T1HM 2XSZA 2DAEA 2CHVA 5FSWA 3SARA 2QPAA 1F4IA 3SAUA 1IXZA 3VKGA 2F5OA 4LF9M 1QAQA 2FH0A 1DGHA 1PGYA 5C18A 2ERCA 2KRKA 1TF0B 3JR5A 4M9SA 1KFVA 1J5EM 1L1ZA 1OQYA 3AOGA 1NHWC 3E46A 1IY0A 4MGYE 1PRBA 2L7IA 2MJ5B 2R45A 2M60A 5EXSA 3FD9A 5KPZA 3GLGE 5E6JA 5E26A 3K92A 3VDPA 1Z5CA 4W5WA 3GLHE 1D2NA 3SBJA 5BPVA 3QYBA 2NQ8C 2G3QA 1X37A 3J27B 2Z4RA 2O5RA 2YR0A 2YQZA 3LQRA 1G71A 1VG5A 2D7GA 4M9ZA 4NC6A 3W67A 4DR3M 3U60B 3C9PA 2A5YB 4DR2M 1L8QA 3B89A 2RKOA 1V34A 3U6MA 4KODA 1K82A 1DGGA 4LFCM 2J7OA 4G6ZA 2ZTCA 2BJVA 4R3DA 3GPUA 4HEOA 1XNRM 5ITRA 1R7RA 2CV0A 3MHVC 3GLGA 2VQEM 3PNYA 3LCVB 2QCUA 3SYLA 4JI6M 4GITA 1YE9A 1Q3CA 5EXTA 1NY6A 3GLFE 3FRIA 4OVZA 1PJJA 2OOAA 4DV4M 5KPTA 4IBJA 4XK8F 1MU5A 4MGKE 4PDIA 1J09A 2KRUA 2QNJA 4D82A 4F2LA 1XMQM 2WSCF 2RRUA 5EP4A 4DV1M 4DR5M 3KP1E 1NSFA 4JI0M 2DWZB 3B7ZA 2O25A 3GPPA 2XZFA 1TGUA 4LZZA 5GKNA 4NSRA 1JQJC 1XWIA 2RGHA 3U5ZB 3J7AS 5ITYA 8CATA 3FUUA 2DAIA 4HLQA 2BNKA 5EQTA 4Z6YA 1IBMM 4AKGA 2XSZD 2FOIC 3CTWB 1NV8A 3F92A 3K2LA 4IBBA 1NY5A 3THGA 3U61A 3J2PB 3GLFA 3FKEA 3I4YA 2Z4SA 1DGHB 1VDLA 5KPRA 4GH9A 4OU7A 3BBZA 4B7GA 1OFHA 3CF6E 1QYRA 3TE6A 1KYIA 1GO5A 2R65A 1YLAA 1D0KA 4AG5A 2XEPA 1QZEA 2R6FA 1T43A 5FTLA 2D7EA 2LVOC
chains in the Genus database with same CATH topology
1DV0A 1XB2B 1TR8A 2JY8A 1BVSA 2L4FA 3K9OA 2DKLA 1G41A 2KHHA 4Q7JA 1A5TA 2LTUA 1EFUB 2LBCA 1OTRA 2HWJA 1IFYA 3E21A 1WGLA 1VEJA 2BWEA 3FRHA 2LVNC 2H5XA 2QSFX 2JNHA 2JZ0A 3GLIE 1R4GA 2HAKA 2B3TA 1JR3E 2JY7A 1P3QQ 1WJ7A 2DHYA 2DAEA 1G3IA 1V92A 3IECA 1PGYA 2LVPC 3MMPA 1VEKA 2EKKA 1VEGA 1XXHE 1WR1B 1F4IA 1OQYA 3E46A 4F1IA 1C7YA 3IHPA 5DFLA 2MJ5B 2K0BX 1SG9A 2LVQD 2OO9A 3GLGE 2CP8A 2BWBA 4G3OA 5JI2E 3GLHE 1OKSA 2QHOB 2G3QA 1ZMWA 1IM2A 2MR9A 1ZMVA 4R71A 2JP7A 3T6PA 1VG5A 2JZ1A 1AIPC 1E94E 1UFZA 1VQ1A 2JY5A 3B89A 1HQYE 2JUJA 2DZLA 4WP2A 1Q02A 2JY6B 2ZTCA 2K9DA 4HEOA 2WZJA 1ZV1A 2DI0A 1HT1E 3K9PA 3LCVB 2R0IA 3GLFE 3FRIA 2DENA 1G4AE 2DNAA 2OOAA 1OAIA 2LVAA 2L2DA 2MGWA 1MN3A 2QNJA 2KNZA 4F2LA 1CUKA 1Y8GA 2CWBA 2EKFA 1T6OA 2RRUA 3H4JA 1ZMUA 2L4EA 3LCUA 1WHCA 2KNVA 2O25A 2OOBA 2ZTDA 1IXSA 1NV9A 2DAIA 2EJSA 4UN2B 1HJPA 2DAMA 3F92A 1NV8A 4DBGB 1HT2E 4GEWA 1WIVA 2DAGA 1VDLA 2KNAA 3FE3A 1WGNA 1DO2A 3BBZA 1DO0A 1KYIA 2MROB 1GO5A 1TTEA 1YLAA 2DAKA 1QZEA 1T43A 2LVOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DV0 A;  1XB2 B;  1TR8 A;  2JY8 A;  1BVS A;  2L4F A;  3K9O A;  2DKL A;  1G41 A;  2KHH A;  4Q7J A;  1A5T A;  2LTU A;  1EFU B;  2LBC A;  1OTR A;  2HWJ A;  1IFY A;  3E21 A;  1WGL A;  1VEJ A;  2BWE A;  3FRH A;  2LVN C;  2H5X A;  2QSF X;  2JNH A;  2JZ0 A;  3GLI E;  1R4G A;  2HAK A;  2B3T A;  1JR3 E;  2JY7 A;  1P3Q Q;  1WJ7 A;  2DHY A;  2DAE A;  1G3I A;  1V92 A;  3IEC A;  1PGY A;  2LVP C;  3MMP A;  1VEK A;  2EKK A;  1VEG A;  1XXH E;  1WR1 B;  1F4I A;  1OQY A;  3E46 A;  4F1I A;  1C7Y A;  3IHP A;  5DFL A;  2MJ5 B;  2K0B X;  1SG9 A;  2LVQ D;  2OO9 A;  3GLG E;  2CP8 A;  2BWB A;  4G3O A;  5JI2 E;  3GLH E;  1OKS A;  2QHO B;  2G3Q A;  1ZMW A;  1IM2 A;  2MR9 A;  1ZMV A;  4R71 A;  2JP7 A;  3T6P A;  1VG5 A;  2JZ1 A;  1AIP C;  1E94 E;  1UFZ A;  1VQ1 A;  2JY5 A;  3B89 A;  1HQY E;  2JUJ A;  2DZL A;  4WP2 A;  1Q02 A;  2JY6 B;  2ZTC A;  2K9D A;  4HEO A;  2WZJ A;  1ZV1 A;  2DI0 A;  1HT1 E;  3K9P A;  3LCV B;  2R0I A;  3GLF E;  3FRI A;  2DEN A;  1G4A E;  2DNA A;  2OOA A;  1OAI A;  2LVA A;  2L2D A;  2MGW A;  1MN3 A;  2QNJ A;  2KNZ A;  4F2L A;  1CUK A;  1Y8G A;  2CWB A;  2EKF A;  1T6O A;  2RRU A;  3H4J A;  1ZMU A;  2L4E A;  3LCU A;  1WHC A;  2KNV A;  2O25 A;  2OOB A;  2ZTD A;  1IXS A;  1NV9 A;  2DAI A;  2EJS A;  4UN2 B;  1HJP A;  2DAM A;  3F92 A;  1NV8 A;  4DBG B;  1HT2 E;  4GEW A;  1WIV A;  2DAG A;  1VDL A;  2KNA A;  3FE3 A;  1WGN A;  1DO2 A;  3BBZ A;  1DO0 A;  1KYI A;  2MRO B;  1GO5 A;  1TTE A;  1YLA A;  2DAK A;  1QZE A;  1T43 A;  2LVO C; 
#chains in the Genus database with same CATH topology
 3EIH A;  4RF1 A;  5KO3 A;  1XB2 B;  1YUB A;  2FE8 A;  2JY8 A;  4I81 A;  1BVS A;  3B9P A;  2KZS A;  2L4F A;  5EXP A;  4DV7 M;  4RNA A;  5BR8 M;  1Q3B A;  2LHG A;  4Q7J A;  2APL A;  1A5T A;  4AKH A;  1EFU B;  4JI2 M;  3MJ5 A;  1N32 M;  3GRY A;  3SFZ A;  3E21 A;  3HY5 A;  1SXJ B;  4LJA A;  4KLN A;  1I4W A;  4LJ9 A;  5LMU M;  3C3E A;  2R18 A;  2UXB M;  5FTK A;  4LRS A;  3ZC7 B;  1DGB A;  1NNU C;  1QDR A;  1R4G A;  4NL4 H;  4DV0 M;  4TUW A;  4JV5 M;  2VF8 A;  3MK6 A;  4Z8X A;  1E9S A;  1P3Q Q;  4L15 A;  1WJ7 A;  2DHY A;  3A98 B;  4JI3 M;  1HNW M;  4GC5 A;  3GLG B;  1G3I A;  4X64 M;  4AKI A;  4RKU F;  3GPX A;  2V1C A;  1V92 A;  3IEC A;  4CJ6 A;  3L26 A;  3U6S A;  2R46 A;  3TL4 X;  3GLH B;  2DVW B;  4JI8 M;  4CIZ A;  1IY1 A;  3MMP A;  1LV7 A;  2ZAM A;  2EKK A;  2X8A A;  4BLC A;  1IBK M;  1XXH E;  3QAU A;  3TWK A;  2DWL A;  4D81 A;  2UXC M;  2FFJ A;  3IHP A;  5DFL A;  4LF6 M;  4B3T M;  2CP8 A;  4LGY A;  2BWB A;  2HL7 A;  4QOS A;  3UMM A;  5C1B A;  4CHT B;  1IM2 A;  3A45 A;  1NJF A;  4LJ7 A;  1L1T A;  1ZMV A;  2JP7 A;  2OPF A;  3DZD A;  3KW6 A;  2JZ1 A;  1ORY B;  3HJQ A;  4LF5 M;  2QEN A;  1UFZ A;  5DYG A;  3TWL A;  3B7Q A;  3TWM A;  4M0W A;  2HKJ A;  1N34 M;  4JI7 M;  4G4N A;  3SAT A;  5DNY A;  1UM8 A;  2Y0Q A;  1XXH A;  4DUZ M;  2JY6 B;  4LF4 M;  3KOY E;  4B3M M;  3HHY A;  1QAN A;  4LFA M;  2K9D A;  1ZQ9 A;  2WZJ A;  2X4A A;  3GQ5 A;  2W82 A;  4JYA M;  3QYE A;  2DI0 A;  3J7B A;  3K9P A;  3VLF B;  5IT9 S;  3HJS A;  3K1J A;  2DEN A;  3ZQJ A;  2DNA A;  1TDH A;  3W68 A;  1NHG C;  1G59 A;  2CHG A;  2C98 A;  4AZF A;  2LVA A;  3VDU A;  1QDT A;  2C5R A;  4IBE A;  1HNX M;  3Q8G A;  2CV2 A;  1L2D A;  3LQQ A;  4LJ5 A;  2F5Q A;  2R4E A;  4R7G A;  5EJC A;  3PVS A;  5ITT A;  3I04 M;  4DV5 M;  4IBK A;  1OIZ A;  1IXS A;  4LF8 M;  4YHH M;  3T15 A;  4GKJ M;  3FYC A;  3E4R A;  4FWG A;  1XMO M;  3C58 A;  2LWX A;  3UGJ A;  4JI1 M;  2F5N A;  1GJT A;  1Z6T A;  2DAM A;  2J7N A;  2DZN B;  2LH0 A;  3H4M A;  3HWS A;  1HT2 E;  3VKH A;  3L25 A;  4G4R A;  4REZ A;  3GQ4 A;  3VK8 A;  3SC3 A;  3SYK A;  4GRI A;  4GHA A;  1OAO C;  3FE3 A;  1WGN A;  3DFZ A;  1DO0 A;  1TTE A;  3KXE C;  1XHB A;  2OQ4 A;  3HKP A;  1JR3 E;  1VDD A;  4LJ8 A;  2H1R A;  4LY6 A;  5EP3 A;  1TR8 A;  4OW0 A;  1YSY A;  5A2Q S;  4AG6 A;  3HZJ A;  4L4U A;  4X62 M;  2ZAN A;  1OJL A;  1R5L A;  3FUX A;  3BOS A;  2DKL A;  3BXW A;  1NO1 A;  1PJQ A;  3TPZ A;  5ITX A;  4FCV A;  3SMP A;  2ZM6 M;  4HL4 A;  3V76 A;  1OTR A;  4FWH A;  2UXD M;  2HWJ A;  2X49 A;  4II7 A;  4S12 A;  2EO2 A;  2XH9 A;  2V1U A;  2L09 A;  4FW9 A;  1E9R A;  2Y0T A;  3W0L B;  5KQ8 A;  3UJN A;  3GLI E;  2KDL A;  3AOE C;  3I4V A;  1N33 M;  4FCW A;  2CE7 A;  1PJS A;  1JR3 A;  1EIJ A;  4M9X A;  1EE8 A;  4OX9 M;  3KVW A;  1QQW A;  4DUY M;  2BJW A;  3HU1 A;  4X66 M;  4YY3 M;  3WHL A;  4L16 A;  1T3T A;  1HNZ M;  3U6Q A;  3OTO M;  2LNH C;  2I7P A;  3L2A A;  2L7H A;  3KSX A;  4PDG A;  4IBC A;  1GL7 A;  4JI5 M;  1QZM A;  1WR1 B;  1C1K A;  3JR4 A;  4ITQ A;  1IN5 A;  2YNM D;  5JI3 E;  1OIP A;  1C7Y A;  2DXI A;  1FNN A;  5IZ7 D;  3HHW A;  2K0B X;  3KS4 A;  2DZO B;  4MGH A;  5FLX S;  3KS8 A;  1IXS B;  4D80 A;  4G3O A;  3SAW A;  1HR0 M;  4EIW A;  3GLI A;  1XNQ M;  1OKS A;  1ZAE A;  3A42 A;  2QHO B;  4X65 M;  1J7K A;  1GLN A;  1ZMW A;  2MH8 A;  2C99 A;  3FTC A;  1GL6 A;  2G8L A;  3CF2 A;  4GIP A;  4R71 A;  3FUV A;  3T6P A;  2I7N A;  1SXJ C;  4QHS A;  4A3V B;  4P17 A;  1XC8 A;  1AIP C;  1TH4 A;  2C9C A;  1VQ1 A;  2JY5 A;  1NNJ A;  4LRT A;  2CUZ A;  2JUJ A;  1FJG M;  4WUR A;  1N36 M;  4OVZ B;  2JXN A;  4WP2 A;  2VII A;  1GAB A;  1Q02 A;  2Z7J A;  1IN6 A;  2ZBK B;  3PNV A;  3FUW A;  4MH0 E;  1V33 A;  1QAO A;  4WW0 A;  1TH2 A;  1HT1 E;  3L29 A;  2UUC M;  2DWM A;  3DOA A;  2QQ8 A;  2R0I A;  2UU9 M;  3U6P A;  1OAI A;  4MGI E;  2VDB B;  2MGW A;  1MN3 A;  3KOX E;  3QWL A;  1R6B X;  2DWN A;  1N75 A;  1CUK A;  1T6O A;  1Y8G A;  2CWB A;  2GNO A;  2V6Z M;  3H4J A;  1TH3 A;  4DR6 M;  3LCU A;  1WHC A;  2KNV A;  2RGO A;  1W5S A;  1N78 A;  4NOO B;  1NV9 A;  3KOZ E;  3U61 B;  2F5S A;  3GLF B;  5DYI A;  5EXX A;  3KP0 E;  1L2C A;  1KSF X;  2QBY A;  1Z5B A;  2L6O A;  4AI6 A;  3GRR A;  3LVW A;  3Q8X A;  4UN2 B;  1JR3 D;  3RFW A;  1H6U A;  4DBG B;  5L8R F;  1WIV A;  3RGS A;  4LFB M;  2EUC A;  2XZU A;  4LJ4 A;  1IXR C;  1Q39 A;  4QNM A;  2C96 A;  3AJI B;  3AOE A;  2MRO B;  2DAK A;  4GC9 A;  4QNR A;  4LJ6 A;  4L6V 6;  4PT5 A;  1DV0 A;  1SXJ E;  1TDZ A;  3K9O A;  3PXG A;  1D0L A;  2CHQ A;  5IWA M;  3GLI B;  3D8B A;  3FTF A;  2M5Z A;  3AL0 C;  2FNA A;  2LTU A;  7CAT A;  3VK7 A;  5EP2 A;  2LBC A;  3HHX A;  3IG5 A;  3B74 A;  5ITX E;  3R8F A;  2HHH M;  3UZU A;  3B7N A;  3U6E A;  1IFY A;  5H37 D;  2K47 A;  2R44 A;  2KW0 A;  3L27 A;  2E5L M;  2EA0 A;  1VEJ A;  2BWE A;  2WSF F;  3FRH A;  2LVN C;  2H5X A;  1GVN A;  3GRU A;  4Y28 F;  1QUT A;  2CFO A;  5IRE B;  2JZ0 A;  5KQD A;  3J81 S;  2Y21 A;  2CEA A;  3SMS A;  2YFQ A;  4NSO B;  2JY7 A;  4BBA A;  3HU3 A;  1OFI A;  1Z59 A;  3W0F A;  3U6D A;  3U6C A;  4GMQ A;  3C3D A;  1SXJ A;  4LZJ A;  1IN8 A;  4CGY B;  3RGP A;  3HHZ A;  1E32 A;  4B7F A;  3ILK A;  3ZH9 B;  2LVP C;  3GPY A;  1HQC A;  1VEK A;  1VEG A;  3IG8 A;  3U6L A;  1GKI A;  4IBG A;  4PD2 A;  3PFI A;  3EIE A;  3D8L A;  2Z8Y M;  4QHT A;  3LVV A;  1PM5 A;  4F1I A;  3E9S A;  4B08 A;  1AUA A;  1W5T A;  4DV3 M;  4XBO A;  2LVQ D;  1SG9 A;  2OO9 A;  2VQF M;  3CGW A;  4CIS A;  4JI4 M;  1QUS A;  3GLH A;  4MM3 B;  2CV1 A;  5JI2 E;  2JA2 A;  1IN7 A;  1MX0 A;  4L78 A;  2QBY B;  3LW5 F;  2MR9 A;  4FWD A;  3WHK A;  1XXH B;  1WXQ A;  3AV0 A;  2Q2E B;  4I5S A;  4DV2 M;  5ITQ A;  4NRV A;  3HU2 A;  4IBI A;  3KDS E;  1E94 E;  3KFU G;  4LGM A;  3U6O A;  3L28 A;  3JAM S;  1G8P A;  3CF0 A;  4FCT A;  3M0E A;  4B7H A;  4DR1 M;  2G5G X;  4IBF A;  2DZL A;  4MB7 A;  3T1Y M;  2F5P A;  4DR4 M;  4GHL A;  4DV6 M;  4IJF A;  3GRV A;  4I4L A;  3GP1 A;  2XGN A;  3ZCB B;  5FTN A;  4LG2 A;  4JN6 A;  1ZV1 A;  1D0M A;  4RF0 A;  2JWS A;  1RU3 A;  2J5Y A;  3FTD A;  2LXE A;  4M0D A;  1S3S A;  2LHC A;  2XFS A;  2N35 A;  3J80 S;  3SHF A;  1G4A E;  3K8Z A;  4NXN M;  3TQS A;  1N77 A;  1PJI A;  2FS1 A;  4GKK M;  2R4J A;  2L2D A;  2GQF A;  2XF3 A;  2KNZ A;  3UK6 A;  4L8R C;  1QVR A;  2EKF A;  1IY2 A;  1ZMU A;  2L4E A;  2ZTD A;  2OOB A;  3FTE A;  2Z3X A;  3GO8 A;  2KA6 B;  5FTJ A;  2XLJ A;  3DA1 A;  4IIW A;  4DR7 M;  4KHP M;  4IBD A;  1R2Z A;  1GJS A;  3LMM A;  3HGI A;  4K0K M;  4AQY M;  2F4V M;  2WSE F;  3A46 A;  3SAS A;  2EJS A;  3FUT A;  2R62 A;  2ZAO A;  3HX3 A;  1HJP A;  3AKZ A;  3U60 A;  1K3X A;  4NRW A;  4FD2 A;  2KZU A;  5ITU A;  5LMN M;  4B3R M;  1DGF A;  1SXJ D;  4ANR A;  4MGZ E;  2UUA M;  1NJG A;  1I94 M;  4KT0 F;  3VFD A;  2DAG A;  3R9X B;  1IN4 A;  2CRU A;  2Y20 A;  1IQP A;  4PCZ A;  4NXM M;  2KNA A;  1QAM A;  2KEB A;  3FYD A;  3GQ3 A;  1DO2 A;  2DHR A;  1LTM A;  2K6B A;  3NBI A;  4BB9 A;  4FVM A;  4I8O A;  2P5T A;  2VF7 A;  4LF7 M;  1HQY E;  4GEW A;  1IBL M;  3M7G A;  3KOW E;  3SAV A;  4LCB A;  2HCB A;  4QOZ C;  1MJG M;  3AFH A;  3M6A A;  5FTM A;  2C9O A;  2D7H A;  4ZPX A;  3I01 M;  2KXE A;  4B3S M;  1G41 A;  1PJT A;  2KHH A;  4KO8 A;  5F3W A;  4IJE A;  1L2B A;  3T38 A;  2AHM A;  3NBX X;  4G4Q A;  5EP1 A;  2O01 F;  1K3W A;  4G4O A;  3NWL A;  4XGI A;  3HJ8 A;  4JXJ A;  1WGL A;  1Z5A A;  2UUB M;  2QP9 X;  3SHG B;  4AW4 A;  2QZ4 A;  3I51 A;  1JB0 F;  3U5Z A;  2XFT A;  2QSF X;  3RE8 A;  2JNH A;  3KSJ A;  4P16 A;  1NVM A;  2HAK A;  2B3T A;  1R2Y A;  3T1H M;  2XSZ A;  2DAE A;  2CHV A;  5FSW A;  3SAR A;  2QPA A;  1F4I A;  3SAU A;  1IXZ A;  3VKG A;  2F5O A;  4LF9 M;  1QAQ A;  2FH0 A;  1DGH A;  1PGY A;  5C18 A;  2ERC A;  2KRK A;  1TF0 B;  3JR5 A;  4M9S A;  1KFV A;  1J5E M;  1L1Z A;  1OQY A;  3AOG A;  1NHW C;  3E46 A;  1IY0 A;  4MGY E;  1PRB A;  2L7I A;  2MJ5 B;  2R45 A;  2M60 A;  5EXS A;  3FD9 A;  5KPZ A;  3GLG E;  5E6J A;  5E26 A;  3K92 A;  3VDP A;  1Z5C A;  4W5W A;  3GLH E;  1D2N A;  3SBJ A;  5BPV A;  3QYB A;  2NQ8 C;  2G3Q A;  1X37 A;  3J27 B;  2Z4R A;  2O5R A;  2YR0 A;  2YQZ A;  3LQR A;  1G71 A;  1VG5 A;  2D7G A;  4M9Z A;  4NC6 A;  3W67 A;  4DR3 M;  3U60 B;  3C9P A;  2A5Y B;  4DR2 M;  1L8Q A;  3B89 A;  2RKO A;  1V34 A;  3U6M A;  4KOD A;  1K82 A;  1DGG A;  4LFC M;  2J7O A;  4G6Z A;  2ZTC A;  2BJV A;  4R3D A;  3GPU A;  4HEO A;  1XNR M;  5ITR A;  1R7R A;  2CV0 A;  3MHV C;  3GLG A;  2VQE M;  3PNY A;  3LCV B;  2QCU A;  3SYL A;  4JI6 M;  4GIT A;  1YE9 A;  1Q3C A;  5EXT A;  1NY6 A;  3GLF E;  3FRI A;  4OVZ A;  1PJJ A;  2OOA A;  4DV4 M;  5KPT A;  4IBJ A;  4XK8 F;  1MU5 A;  4MGK E;  4PDI A;  1J09 A;  2KRU A;  2QNJ A;  4D82 A;  4F2L A;  1XMQ M;  2WSC F;  2RRU A;  5EP4 A;  4DV1 M;  4DR5 M;  3KP1 E;  1NSF A;  4JI0 M;  2DWZ B;  3B7Z A;  2O25 A;  3GPP A;  2XZF A;  1TGU A;  4LZZ A;  5GKN A;  4NSR A;  1JQJ C;  1XWI A;  2RGH A;  3U5Z B;  3J7A S;  5ITY A;  8CAT A;  3FUU A;  2DAI A;  4HLQ A;  2BNK A;  5EQT A;  4Z6Y A;  1IBM M;  4AKG A;  2XSZ D;  2FOI C;  3CTW B;  1NV8 A;  3F92 A;  3K2L A;  4IBB A;  1NY5 A;  3THG A;  3U61 A;  3J2P B;  3GLF A;  3FKE A;  3I4Y A;  2Z4S A;  1DGH B;  1VDL A;  5KPR A;  4GH9 A;  4OU7 A;  3BBZ A;  4B7G A;  1OFH A;  3CF6 E;  1QYR A;  3TE6 A;  1KYI A;  1GO5 A;  2R65 A;  1YLA A;  1D0K A;  4AG5 A;  2XEP A;  1QZE A;  2R6F A;  1T43 A;  5FTL A;  2D7E A;  2LVO C; 
#chains in the Genus database with same CATH homology
 1DV0 A;  1XB2 B;  1TR8 A;  2JY8 A;  1BVS A;  2L4F A;  3K9O A;  2DKL A;  1G41 A;  2KHH A;  4Q7J A;  1A5T A;  2LTU A;  1EFU B;  2LBC A;  1OTR A;  2HWJ A;  1IFY A;  3E21 A;  1WGL A;  1VEJ A;  2BWE A;  3FRH A;  2LVN C;  2H5X A;  2QSF X;  2JNH A;  2JZ0 A;  3GLI E;  1R4G A;  2HAK A;  2B3T A;  1JR3 E;  2JY7 A;  1P3Q Q;  1WJ7 A;  2DHY A;  2DAE A;  1G3I A;  1V92 A;  3IEC A;  1PGY A;  2LVP C;  3MMP A;  1VEK A;  2EKK A;  1VEG A;  1XXH E;  1WR1 B;  1F4I A;  1OQY A;  3E46 A;  4F1I A;  1C7Y A;  3IHP A;  5DFL A;  2MJ5 B;  2K0B X;  1SG9 A;  2LVQ D;  2OO9 A;  3GLG E;  2CP8 A;  2BWB A;  4G3O A;  5JI2 E;  3GLH E;  1OKS A;  2QHO B;  2G3Q A;  1ZMW A;  1IM2 A;  2MR9 A;  1ZMV A;  4R71 A;  2JP7 A;  3T6P A;  1VG5 A;  2JZ1 A;  1AIP C;  1E94 E;  1UFZ A;  1VQ1 A;  2JY5 A;  3B89 A;  1HQY E;  2JUJ A;  2DZL A;  4WP2 A;  1Q02 A;  2JY6 B;  2ZTC A;  2K9D A;  4HEO A;  2WZJ A;  1ZV1 A;  2DI0 A;  1HT1 E;  3K9P A;  3LCV B;  2R0I A;  3GLF E;  3FRI A;  2DEN A;  1G4A E;  2DNA A;  2OOA A;  1OAI A;  2LVA A;  2L2D A;  2MGW A;  1MN3 A;  2QNJ A;  2KNZ A;  4F2L A;  1CUK A;  1Y8G A;  2CWB A;  2EKF A;  1T6O A;  2RRU A;  3H4J A;  1ZMU A;  2L4E A;  3LCU A;  1WHC A;  2KNV A;  2O25 A;  2OOB A;  2ZTD A;  1IXS A;  1NV9 A;  2DAI A;  2EJS A;  4UN2 B;  1HJP A;  2DAM A;  3F92 A;  1NV8 A;  4DBG B;  1HT2 E;  4GEW A;  1WIV A;  2DAG A;  1VDL A;  2KNA A;  3FE3 A;  1WGN A;  1DO2 A;  3BBZ A;  1DO0 A;  1KYI A;  2MRO B;  1GO5 A;  1TTE A;  1YLA A;  2DAK A;  1QZE A;  1T43 A;  2LVO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...