2EKFA

Solution structure of ruh-075, a human cue domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
GSSGSSGSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RUH-075, a human CUE domain
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ancient ubiquitous protein 1
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ekfA01
2LTUA 2JY5A 2JY6B 2LBCA 1BVSA 2MR9A 3IHPA 2HWJA 2L2DA 1UFZA 1XXHE 2LVAA 1WIVA 1VQ1A 2LVPC 2LVQD 1G4AE 3MMPA 1YLAA 1VEKA 2OOAA 3FRHA 2B3TA 1Q02A 2DI0A 3B89A 1WGLA 3FRIA 3GLFE 1DO0A 2MROB 1NV8A 2DENA 2BWEA 5DFLA 2JUJA 5JI2E 3K9OA 4F1IA 1ZMVA 3GLHE 2DAGA 2JZ0A 1IFYA 2G3QA 1EFUB 2LVNC 2EJSA 4G3OA 1OQYA 2DKLA 2JZ1A 2JY8A 1OAIA 1OKSA 1VEGA 2JNHA 1WGNA 1VDLA 4HEOA 2JY7A 1TTEA 1F4IA 1T43A 1Y8GA 2DAIA 2KNAA 1ZMUA 2MJ5B 1CUKA 1WR1B 1QZEA 1WHCA 2ZTDA 4UN2B 1VG5A 1JR3E 3T6PA 2OO9A 2MGWA 2DAEA 3GLGE 3E21A 1ZMWA 3IECA 2DAKA 2KNZA 1PGYA 1KYIA 2DZLA 1SG9A 2H5XA 2BWBA 2QHOB 1HJPA 2QSFX 1HT2E 1E94E 1XB2B 3F92A 2DHYA 2R0IA 1T6OA 1TR8A 2K0BX 1AIPC 4R71A 4F2LA 4Q7JA 2RRUA 1C7YA 1OTRA 1VEJA 2JP7A 2KNVA 2ZTCA 1R4GA 2KHHA 2L4EA 4DBGB 1IXSA 3LCVB 2OOBA 3H4JA 2HAKA 1G3IA 2DNAA 1DO2A 2CWBA 1GO5A 1MN3A 1P3QQ 1HQYE 1NV9A 4GEWA 2EKKA 3FE3A 2DAMA 3LCUA 1V92A 1WJ7A 1ZV1A 2EKFA 1A5TA 1IM2A 2CP8A 2QNJA 3GLIE 4WP2A 3E46A 1G41A 2LVOC 2K9DA 2O25A 3K9PA 2WZJA 1DV0A 2L4FA 1HT1E 3BBZA
chains in the Genus database with same CATH superfamily
3GLHB 2MR9A 5C18A 3GPYA 2YNMD 1QAMA 1UFZA 5FTNA 3HY5A 4YHHM 4IBBA 4II7A 2J7OA 3B7QA 2UUAM 1WIVA 3Q8GA 2Z8YM 1YLAA 3D8BA 1VEKA 2R62A 4IBKA 4DV6M 3C3EA 2FS1A 3MJ5A 1Q3BA 1Q02A 4LRSA 3GLIB 3U5ZA 2LNHC 2XSZD 3B89A 3TE6A 3U6SA 4I8OA 3DFZA 3A98B 1L2DA 1V34A 4NXNM 2DENA 5DYIA 2W82A 3OTOM 3HU1A 1WXQA 5EXSA 4B3TM 3WHKA 3K9OA 3I01M 3U6EA 2FNAA 3W67A 2LHGA 4G4QA 2JZ1A 2QZ4A 1LV7A 4JI8M 1FJGM 4JI6M 3U60B 1NSFA 4GIPA 4G4NA 3C9PA 3TWLA 4KODA 3LMMA 1VEGA 1IY2A 3FKEA 2C96A 5EP3A 4CHTB 4WURA 4DV2M 3D8LA 3BOSA 4GC5A 3M6AA 2JY7A 1TTEA 3M0EA 4LJ6A 2CEAA 2YFQA 3AOGA 4FCTA 4B7FA 1L2BA 2BNKA 3TQSA 2DAIA 3L26A 1CUKA 3HJSA 3W0FA 1AUAA 3NBXX 3V76A 1J5EM 1L1TA 4B08A 4UN2B 3VK8A 1G59A 1VG5A 1D0KA 4QHSA 4LGMA 4B3MM 3KDSE 4OW0A 4FW9A 3BXWA 4D81A 3E21A 4MB7A 1IXSB 4DR4M 1Q3CA 4AQYM 2Q2EB 2UXDM 3A46A 3I04M 2XGNA 4MGHA 4Y28F 4HLQA 5IT9S 1PJIA 1XB2B 3R9XB 4LZZA 3NWLA 3B7NA 4MGKE 2D7GA 2R0IA 4XGIA 7CATA 4AKIA 2M5ZA 1Z6TA 1IY1A 3GLGB 3KSJA 3KFUG 3HHWA 4Q7JA 4QOSA 2LH0A 4L4UA 1C7YA 3KOZE 1NJGA 1OTRA 2JP7A 4LJ5A 1GL7A 3C58A 1I94M 3HWSA 1R4GA 4AG6A 3C3DA 1NVMA 2XFSA 1IXSA 4GHLA 4GMQA 3RGSA 4GHAA 3H4JA 1NJFA 4JI1M 3TWMA 2DHRA 2UUBM 3E4RA 2R65A 1ZAEA 3K2LA 1OAOC 3B74A 2CWBA 3SFZA 2XZUA 1GO5A 3RE8A 1XXHB 4IJEA 2EKKA 2FE8A 1HQCA 1EE8A 5EP2A 3MHVC 4DR6M 2J5YA 1PJJA 3PNVA 1WJ7A 1ZV1A 4RNAA 3T1HM 3HGIA 3FTDA 2CP8A 4GRIA 2ZM6M 1SXJA 2F5OA 2CFOA 1PJTA 3SC3A 3E46A 1IBKM 4PDIA 3KVWA 1QDTA 3K9PA 2L4FA 4IBGA 3QWLA 4OVZB 2KZSA 3GRRA 1HT1E 1QVRA 2CUZA 3SMPA 3BBZA 3KW6A 5H37D 4CGYB 4G6ZA 4G4OA 5ITQA 4NRWA 2APLA 3KS8A 4NL4H 3AKZA 1DGHB 3HHXA 4AKGA 1BVSA 3HZJA 1TH2A 3FD9A 4LY6A 3FTCA 3IHPA 4PT5A 2HWJA 2L2DA 3ILKA 4KT0F 1XXHE 2C9OA 4L6V6 2EA0A 1PRBA 1TDZA 2V1UA 1QAOA 2LVPC 2O01F 1QYRA 4JI5M 2B3TA 1R2YA 3UZUA 2YQZA 2DI0A 4LJ9A 1QZMA 2UXCM 1IN8A 1N36M 3J2PB 3U5ZB 2A5YB 4DR3M 4RKUF 4NRVA 4MGYE 1WGLA 2R45A 3FRIA 5C1BA 3GLFE 1DO0A 4OU7A 3GLFB 3R8FA 5F3WA 4IBEA 3CGWA 2JUJA 3PVSA 5EP1A 3FUUA 3GLIA 4NOOB 2K47A 4DR1M 2HKJA 4F1IA 3K8ZA 1XHBA 1T3TA 3GLHE 1OFHA 4REZA 3U61A 4M9XA 2FOIC 3VK7A 1IFYA 2LVNC 3CF2A 1IY0A 2EJSA 2N35A 1S3SA 4GKJM 2ZANA 4Z8XA 2KRUA 4L15A 4IIWA 1OJLA 2QENA 1DGGA 4FCWA 1IXRC 1K82A 3AOEA 1SXJD 2XH9A 1Z5AA 2DZOB 3L28A 3HU2A 3LVWA 2R4JA 1Y8GA 5ITRA 5IWAM 2F5NA 1WHCA 5KQDA 1VDDA 3THGA 4CIZA 5A2QS 1GKIA 2HHHM 3MK6A 3A42A 1ORYB 2DXIA 3UMMA 1R6BX 2QBYA 2F4VM 1JR3E 3J7AS 4GH9A 1N33M 4MM3B 3KOXE 1R5LA 4B3SM 3GLGE 4LZJA 1E32A 3IECA 2R18A 2DAKA 2KNZA 5KPRA 2H5XA 3CF6E 3E9SA 2BWBA 2L7IA 2ZAMA 2XFTA 1HJPA 2QSFX 3I4VA 4OX9M 4LJ4A 4PDGA 1E94E 1X37A 2R44A 1MU5A 4BB9A 3SASA 4P17A 1XXHA 3HHZA 3RGPA 4MH0E 2H1RA 3SYKA 3T1YM 4LF5M 2JWSA 4F2LA 2Y0QA 4CISA 3LQQA 4K0KM 2MH8A 1UM8A 2RRUA 3U6MA 4DR2M 3SHFA 4M0WA 4JXJA 1NNUC 3EIHA 5GKNA 2Z4SA 2KHHA 4ITQA 4DBGB 1L8QA 1OFIA 4W5WA 4DUZM 3VKHA 3GLGA 5FTKA 2DWZB 2RGHA 2Z4RA 5E26A 3L27A 3U6LA 3EIEA 5EJCA 4JYAM 4AG5A 1P3QQ 1HQYE 1XMOM 2CV0A 1GJTA 1LTMA 4JI2M 3LCUA 2RKOA 4L8RC 4IBIA 2VDBB 1V92A 4X65M 1IBMM 8CATA 1A5TA 1IM2A 2QNJA 5ITYA 3LVVA 1TGUA 4JN6A 5ITTA 5EQTA 2CRUA 3CTWB 1G41A 1YUBA 1G8PA 4GC9A 2L6OA 2WSFF 1PM5A 4ZPXA 3U6QA 1SXJB 4DV1M 2UUCM 3GRVA 4PD2A 2DWNA 3SMSA 3WHLA 1DGFA 2I7NA 2JY5A 2JY6B 2LBCA 3GLHA 4I5SA 5ITXE 2EO2A 1H6UA 2XLJA 1G71A 2LVAA 3LQRA 5ITXA 3GQ3A 2LVQD 2BJVA 1G4AE 3K1JA 1IN7A 4AW4A 5FTJA 4B7HA 2OOAA 3FRHA 3TWKA 1TF0B 2EUCA 4Z6YA 3SATA 1Q39A 3FTFA 1NY6A 2R4EA 4DV7M 1L1ZA 3DA1A 3HKPA 3KXEC 3QYEA 1GVNA 1NNJA 5LMNM 3VKGA 2BWEA 5EXTA 5DFLA 1RU3A 3A45A 4LF8M 3U6DA 3U60A 2HL7A 5DYGA 5JI2E 4DR7M 3U6CA 4B3RM 4KHPM 3L2AA 1JR3A 1Z5BA 2DAGA 2ZBKB 3B7ZA 4IBDA 2JXNA 2NQ8C 1KFVA 1EFUB 3L29A 2QBYB 4LF6M 3M7GA 5EXXA 4GKKM 1OQYA 2DWLA 2C9CA 5KQ8A 5FSWA 4FWDA 3JR5A 3H4MA 1OKSA 2JNHA 2R46A 1VDLA 2K6BA 2ERCA 4FWHA 4A3VB 4M9ZA 4AZFA 1NHWC 3T38A 5KPZA 2UU9M 3GPXA 3KP0E 4RF0A 4OVZA 2VF8A 1N32M 2CE7A 1T43A 2CHGA 4LF7M 2MJ5B 4LRTA 1V33A 1QZEA 3PXGA 1YSYA 5BPVA 1N75A 1QUSA 3I4YA 4MGIE 2C5RA 1TH3A 2X4AA 4CJ6A 3FTEA 1N34M 4LJ7A 1NO1A 3CF0A 3DOAA 4XK8F 3GLFA 1E9RA 2KA6B 3HX3A 1D0LA 3UGJA 1GABA 3SYLA 4JI3M 1KYIA 2DZLA 3RFWA 4LF4M 1XMQM 1QAQA 2XEPA 3F92A 4QOZC 2YR0A 2XF3A 4IJFA 4FCVA 4NSOB 1JB0F 2DHYA 2J7NA 1T6OA 1TR8A 4GITA 4QNMA 4I4LA 3U6PA 2K0BX 4AKHA 3ZCBB 1W5TA 5FTLA 1IN6A 5EP4A 4D80A 1D0MA 2QPAA 3IG8A 5FLXS 1XWIA 3FYDA 4KO8A 4R7GA 3HJ8A 2KNVA 2X8AA 2XSZA 4FWGA 4LF9M 4LFAM 3J7BA 3T15A 2JA2A 3GO8A 1DGBA 2QCUA 3SAUA 2DVWB 4JV5M 1GLNA 2HAKA 4M0DA 1NHGC 5DNYA 1Z5CA 1G3IA 2AHMA 2LHCA 2ZAOA 1QQWA 3GQ5A 1MN3A 4YY3M 2DWMA 4DV3M 3IG5A 3SAVA 1NV9A 4GEWA 3GP1A 1SXJE 2DAMA 3LW5F 4QNRA 3JR4A 3AJIB 4X66M 1PJSA 4DV5M 2OQ4A 2R6FA 2EKFA 4G4RA 2E5LM 3VDPA 2WSCF 2WSEF 3W0LB 4JI4M 3GLIE 2KW0A 3FUVA 1QANA 3GPUA 4LFBM 2LVOC 4MGZE 3ZC7B 3AL0C 2CHQA 2VF7A 5KPTA 3K92A 2KRKA 3VLFB 4DV0M 1R2ZA 1N77A 4DR5M 2L7HA 3NBIA 2VQFM 3I51A 5IREB 2Z3XA 1ZQ9A 2LTUA 1E9SA 4R3DA 2M60A 1HR0M 3SARA 3SHGB 4X64M 2O5RA 3PNYA 1VQ1A 1GJSA 4NSRA 3MMPA 3UJNA 2P5TA 2Y21A 1IXZA 1DGHA 2G8LA 2RGOA 3HJQA 1J09A 4LJ8A 2QP9X 1K3WA 2D7EA 1OIPA 3FUXA 4PCZA 2L09A 1KSFX 1SXJC 2F5QA 4P16A 2MROB 1NV8A 5ITUA 4LG2A 1IQPA 4DV4M 3KOYE 3JAMS 3QAUA 1GL6A 1TDHA 2KEBA 2XZFA 2FFJA 4BLCA 3TL4X 1ZMVA 5L8RF 3KSXA 2JZ0A 5KO3A 2G3QA 3U61B 4NXMM 4QHTA 4IBCA 4G3OA 2DKLA 2JY8A 2KZUA 1IN5A 1OAIA 2C99A 2UXBM 4WW0A 3PFIA 3FUTA 3HHYA 1WGNA 2CV1A 1R7RA 4HEOA 4D82A 1IBLM 2GQFA 3GRYA 4RF1A 3VDUA 1N78A 5BR8M 1F4IA 2FH0A 3FUWA 2Y0TA 3QYBA 2KNAA 1ZMUA 4XBOA 1WR1B 4JI0M 2KXEA 2ZTDA 1XNRM 5JI3E 1J7KA 4HL4A 3J81S 3J80S 3ZQJA 3HU3A 1C1KA 3T6PA 4AI6A 1JQJC 4S12A 2OO9A 4EIWA 1MX0A 3KP1E 1HNZM 2OPFA 2MGWA 3U6OA 1NY5A 2D7HA 2DAEA 3AV0A 3UK6A 1ZMWA 2VQEM 1PGYA 1XNQM 2GNOA 3AFHA 1SG9A 4IBJA 1EIJA 2QHOB 3FYCA 3KOWE 1HT2E 4IBFA 4I81A 3GRUA 2HCBA 1PJQA 1JR3D 2VIIA 3KS4A 2Y20A 4L16A 1XC8A 5LMUM 3J27B 5EXPA 1AIPC 4R71A 2LWXA 1HNXM 5FTMA 1QDRA 2F5SA 1VEJA 2ZTCA 4LGYA 3SBJA 2CHVA 4M9SA 4X62M 2L4EA 1I4WA 3TPZA 3Q8XA 4KLNA 1FNNA 3LCVB 1D2NA 2QQ8A 5IZ7D 2OOBA 4BBAA 2I7PA 1K3XA 4LJAA 1QUTA 1HNWM 4TUWA 1IN4A 2DNAA 1L2CA 1DO2A 3B9PA 1W5SA 2X49A 2V1CA 4FVMA 2KDLA 3W68A 1MJGM 3FE3A 2DZNB 4NC6A 3SAWA 3VFDA 2F5PA 1YE9A 4FD2A 1OIZA 2LXEA 5E6JA 3ZH9B 3GQ4A 1Z59A 2CV2A 2V6ZM 4WP2A 4LCBA 4DUYM 4JI7M 4LFCM 4ANRA 3DZDA 4L78A 3GPPA 2K9DA 4B7GA 2Z7JA 2O25A 2WZJA 1DV0A 2BJWA 3L25A 3AOEC 2G5GX 2C98A 1TH4A
chains in the Genus database with same CATH topology
2LTUA 2JY5A 2JY6B 2LBCA 1BVSA 2MR9A 3IHPA 2HWJA 2L2DA 1UFZA 1XXHE 2LVAA 1WIVA 1VQ1A 2LVPC 2LVQD 1G4AE 3MMPA 1YLAA 1VEKA 2OOAA 3FRHA 2B3TA 1Q02A 2DI0A 3B89A 1WGLA 3FRIA 3GLFE 1DO0A 2MROB 1NV8A 2DENA 2BWEA 5DFLA 2JUJA 5JI2E 3K9OA 4F1IA 1ZMVA 3GLHE 2DAGA 2JZ0A 1IFYA 2G3QA 1EFUB 2LVNC 2EJSA 4G3OA 1OQYA 2DKLA 2JZ1A 2JY8A 1OAIA 1OKSA 1VEGA 2JNHA 1WGNA 1VDLA 4HEOA 2JY7A 1TTEA 1F4IA 1T43A 1Y8GA 2DAIA 2KNAA 1ZMUA 2MJ5B 1CUKA 1WR1B 1QZEA 1WHCA 2ZTDA 4UN2B 1VG5A 1JR3E 3T6PA 2OO9A 2MGWA 2DAEA 3GLGE 3E21A 1ZMWA 3IECA 2DAKA 2KNZA 1PGYA 1KYIA 2DZLA 1SG9A 2H5XA 2BWBA 2QHOB 1HJPA 2QSFX 1HT2E 1E94E 1XB2B 3F92A 2DHYA 2R0IA 1T6OA 1TR8A 2K0BX 1AIPC 4R71A 4F2LA 4Q7JA 2RRUA 1C7YA 1OTRA 1VEJA 2JP7A 2KNVA 2ZTCA 1R4GA 2KHHA 2L4EA 4DBGB 1IXSA 3LCVB 2OOBA 3H4JA 2HAKA 1G3IA 2DNAA 1DO2A 2CWBA 1GO5A 1MN3A 1P3QQ 1HQYE 1NV9A 4GEWA 2EKKA 3FE3A 2DAMA 3LCUA 1V92A 1WJ7A 1ZV1A 2EKFA 1A5TA 1IM2A 2CP8A 2QNJA 3GLIE 4WP2A 3E46A 1G41A 2LVOC 2K9DA 2O25A 3K9PA 2WZJA 1DV0A 2L4FA 1HT1E 3BBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTU A;  2JY5 A;  2JY6 B;  2LBC A;  1BVS A;  2MR9 A;  3IHP A;  2HWJ A;  2L2D A;  1UFZ A;  1XXH E;  2LVA A;  1WIV A;  1VQ1 A;  2LVP C;  2LVQ D;  1G4A E;  3MMP A;  1YLA A;  1VEK A;  2OOA A;  3FRH A;  2B3T A;  1Q02 A;  2DI0 A;  3B89 A;  1WGL A;  3FRI A;  3GLF E;  1DO0 A;  2MRO B;  1NV8 A;  2DEN A;  2BWE A;  5DFL A;  2JUJ A;  5JI2 E;  3K9O A;  4F1I A;  1ZMV A;  3GLH E;  2DAG A;  2JZ0 A;  1IFY A;  2G3Q A;  1EFU B;  2LVN C;  2EJS A;  4G3O A;  1OQY A;  2DKL A;  2JZ1 A;  2JY8 A;  1OAI A;  1OKS A;  1VEG A;  2JNH A;  1WGN A;  1VDL A;  4HEO A;  2JY7 A;  1TTE A;  1F4I A;  1T43 A;  1Y8G A;  2DAI A;  2KNA A;  1ZMU A;  2MJ5 B;  1CUK A;  1WR1 B;  1QZE A;  1WHC A;  2ZTD A;  4UN2 B;  1VG5 A;  1JR3 E;  3T6P A;  2OO9 A;  2MGW A;  2DAE A;  3GLG E;  3E21 A;  1ZMW A;  3IEC A;  2DAK A;  2KNZ A;  1PGY A;  1KYI A;  2DZL A;  1SG9 A;  2H5X A;  2BWB A;  2QHO B;  1HJP A;  2QSF X;  1HT2 E;  1E94 E;  1XB2 B;  3F92 A;  2DHY A;  2R0I A;  1T6O A;  1TR8 A;  2K0B X;  1AIP C;  4R71 A;  4F2L A;  4Q7J A;  2RRU A;  1C7Y A;  1OTR A;  1VEJ A;  2JP7 A;  2KNV A;  2ZTC A;  1R4G A;  2KHH A;  2L4E A;  4DBG B;  1IXS A;  3LCV B;  2OOB A;  3H4J A;  2HAK A;  1G3I A;  2DNA A;  1DO2 A;  2CWB A;  1GO5 A;  1MN3 A;  1P3Q Q;  1HQY E;  1NV9 A;  4GEW A;  2EKK A;  3FE3 A;  2DAM A;  3LCU A;  1V92 A;  1WJ7 A;  1ZV1 A;  2EKF A;  1A5T A;  1IM2 A;  2CP8 A;  2QNJ A;  3GLI E;  4WP2 A;  3E46 A;  1G41 A;  2LVO C;  2K9D A;  2O25 A;  3K9P A;  2WZJ A;  1DV0 A;  2L4F A;  1HT1 E;  3BBZ A; 
#chains in the Genus database with same CATH topology
 3GLH B;  2MR9 A;  5C18 A;  3GPY A;  2YNM D;  1QAM A;  1UFZ A;  5FTN A;  3HY5 A;  4YHH M;  4IBB A;  4II7 A;  2J7O A;  3B7Q A;  2UUA M;  1WIV A;  3Q8G A;  2Z8Y M;  1YLA A;  3D8B A;  1VEK A;  2R62 A;  4IBK A;  4DV6 M;  3C3E A;  2FS1 A;  3MJ5 A;  1Q3B A;  1Q02 A;  4LRS A;  3GLI B;  3U5Z A;  2LNH C;  2XSZ D;  3B89 A;  3TE6 A;  3U6S A;  4I8O A;  3DFZ A;  3A98 B;  1L2D A;  1V34 A;  4NXN M;  2DEN A;  5DYI A;  2W82 A;  3OTO M;  3HU1 A;  1WXQ A;  5EXS A;  4B3T M;  3WHK A;  3K9O A;  3I01 M;  3U6E A;  2FNA A;  3W67 A;  2LHG A;  4G4Q A;  2JZ1 A;  2QZ4 A;  1LV7 A;  4JI8 M;  1FJG M;  4JI6 M;  3U60 B;  1NSF A;  4GIP A;  4G4N A;  3C9P A;  3TWL A;  4KOD A;  3LMM A;  1VEG A;  1IY2 A;  3FKE A;  2C96 A;  5EP3 A;  4CHT B;  4WUR A;  4DV2 M;  3D8L A;  3BOS A;  4GC5 A;  3M6A A;  2JY7 A;  1TTE A;  3M0E A;  4LJ6 A;  2CEA A;  2YFQ A;  3AOG A;  4FCT A;  4B7F A;  1L2B A;  2BNK A;  3TQS A;  2DAI A;  3L26 A;  1CUK A;  3HJS A;  3W0F A;  1AUA A;  3NBX X;  3V76 A;  1J5E M;  1L1T A;  4B08 A;  4UN2 B;  3VK8 A;  1G59 A;  1VG5 A;  1D0K A;  4QHS A;  4LGM A;  4B3M M;  3KDS E;  4OW0 A;  4FW9 A;  3BXW A;  4D81 A;  3E21 A;  4MB7 A;  1IXS B;  4DR4 M;  1Q3C A;  4AQY M;  2Q2E B;  2UXD M;  3A46 A;  3I04 M;  2XGN A;  4MGH A;  4Y28 F;  4HLQ A;  5IT9 S;  1PJI A;  1XB2 B;  3R9X B;  4LZZ A;  3NWL A;  3B7N A;  4MGK E;  2D7G A;  2R0I A;  4XGI A;  7CAT A;  4AKI A;  2M5Z A;  1Z6T A;  1IY1 A;  3GLG B;  3KSJ A;  3KFU G;  3HHW A;  4Q7J A;  4QOS A;  2LH0 A;  4L4U A;  1C7Y A;  3KOZ E;  1NJG A;  1OTR A;  2JP7 A;  4LJ5 A;  1GL7 A;  3C58 A;  1I94 M;  3HWS A;  1R4G A;  4AG6 A;  3C3D A;  1NVM A;  2XFS A;  1IXS A;  4GHL A;  4GMQ A;  3RGS A;  4GHA A;  3H4J A;  1NJF A;  4JI1 M;  3TWM A;  2DHR A;  2UUB M;  3E4R A;  2R65 A;  1ZAE A;  3K2L A;  1OAO C;  3B74 A;  2CWB A;  3SFZ A;  2XZU A;  1GO5 A;  3RE8 A;  1XXH B;  4IJE A;  2EKK A;  2FE8 A;  1HQC A;  1EE8 A;  5EP2 A;  3MHV C;  4DR6 M;  2J5Y A;  1PJJ A;  3PNV A;  1WJ7 A;  1ZV1 A;  4RNA A;  3T1H M;  3HGI A;  3FTD A;  2CP8 A;  4GRI A;  2ZM6 M;  1SXJ A;  2F5O A;  2CFO A;  1PJT A;  3SC3 A;  3E46 A;  1IBK M;  4PDI A;  3KVW A;  1QDT A;  3K9P A;  2L4F A;  4IBG A;  3QWL A;  4OVZ B;  2KZS A;  3GRR A;  1HT1 E;  1QVR A;  2CUZ A;  3SMP A;  3BBZ A;  3KW6 A;  5H37 D;  4CGY B;  4G6Z A;  4G4O A;  5ITQ A;  4NRW A;  2APL A;  3KS8 A;  4NL4 H;  3AKZ A;  1DGH B;  3HHX A;  4AKG A;  1BVS A;  3HZJ A;  1TH2 A;  3FD9 A;  4LY6 A;  3FTC A;  3IHP A;  4PT5 A;  2HWJ A;  2L2D A;  3ILK A;  4KT0 F;  1XXH E;  2C9O A;  4L6V 6;  2EA0 A;  1PRB A;  1TDZ A;  2V1U A;  1QAO A;  2LVP C;  2O01 F;  1QYR A;  4JI5 M;  2B3T A;  1R2Y A;  3UZU A;  2YQZ A;  2DI0 A;  4LJ9 A;  1QZM A;  2UXC M;  1IN8 A;  1N36 M;  3J2P B;  3U5Z B;  2A5Y B;  4DR3 M;  4RKU F;  4NRV A;  4MGY E;  1WGL A;  2R45 A;  3FRI A;  5C1B A;  3GLF E;  1DO0 A;  4OU7 A;  3GLF B;  3R8F A;  5F3W A;  4IBE A;  3CGW A;  2JUJ A;  3PVS A;  5EP1 A;  3FUU A;  3GLI A;  4NOO B;  2K47 A;  4DR1 M;  2HKJ A;  4F1I A;  3K8Z A;  1XHB A;  1T3T A;  3GLH E;  1OFH A;  4REZ A;  3U61 A;  4M9X A;  2FOI C;  3VK7 A;  1IFY A;  2LVN C;  3CF2 A;  1IY0 A;  2EJS A;  2N35 A;  1S3S A;  4GKJ M;  2ZAN A;  4Z8X A;  2KRU A;  4L15 A;  4IIW A;  1OJL A;  2QEN A;  1DGG A;  4FCW A;  1IXR C;  1K82 A;  3AOE A;  1SXJ D;  2XH9 A;  1Z5A A;  2DZO B;  3L28 A;  3HU2 A;  3LVW A;  2R4J A;  1Y8G A;  5ITR A;  5IWA M;  2F5N A;  1WHC A;  5KQD A;  1VDD A;  3THG A;  4CIZ A;  5A2Q S;  1GKI A;  2HHH M;  3MK6 A;  3A42 A;  1ORY B;  2DXI A;  3UMM A;  1R6B X;  2QBY A;  2F4V M;  1JR3 E;  3J7A S;  4GH9 A;  1N33 M;  4MM3 B;  3KOX E;  1R5L A;  4B3S M;  3GLG E;  4LZJ A;  1E32 A;  3IEC A;  2R18 A;  2DAK A;  2KNZ A;  5KPR A;  2H5X A;  3CF6 E;  3E9S A;  2BWB A;  2L7I A;  2ZAM A;  2XFT A;  1HJP A;  2QSF X;  3I4V A;  4OX9 M;  4LJ4 A;  4PDG A;  1E94 E;  1X37 A;  2R44 A;  1MU5 A;  4BB9 A;  3SAS A;  4P17 A;  1XXH A;  3HHZ A;  3RGP A;  4MH0 E;  2H1R A;  3SYK A;  3T1Y M;  4LF5 M;  2JWS A;  4F2L A;  2Y0Q A;  4CIS A;  3LQQ A;  4K0K M;  2MH8 A;  1UM8 A;  2RRU A;  3U6M A;  4DR2 M;  3SHF A;  4M0W A;  4JXJ A;  1NNU C;  3EIH A;  5GKN A;  2Z4S A;  2KHH A;  4ITQ A;  4DBG B;  1L8Q A;  1OFI A;  4W5W A;  4DUZ M;  3VKH A;  3GLG A;  5FTK A;  2DWZ B;  2RGH A;  2Z4R A;  5E26 A;  3L27 A;  3U6L A;  3EIE A;  5EJC A;  4JYA M;  4AG5 A;  1P3Q Q;  1HQY E;  1XMO M;  2CV0 A;  1GJT A;  1LTM A;  4JI2 M;  3LCU A;  2RKO A;  4L8R C;  4IBI A;  2VDB B;  1V92 A;  4X65 M;  1IBM M;  8CAT A;  1A5T A;  1IM2 A;  2QNJ A;  5ITY A;  3LVV A;  1TGU A;  4JN6 A;  5ITT A;  5EQT A;  2CRU A;  3CTW B;  1G41 A;  1YUB A;  1G8P A;  4GC9 A;  2L6O A;  2WSF F;  1PM5 A;  4ZPX A;  3U6Q A;  1SXJ B;  4DV1 M;  2UUC M;  3GRV A;  4PD2 A;  2DWN A;  3SMS A;  3WHL A;  1DGF A;  2I7N A;  2JY5 A;  2JY6 B;  2LBC A;  3GLH A;  4I5S A;  5ITX E;  2EO2 A;  1H6U A;  2XLJ A;  1G71 A;  2LVA A;  3LQR A;  5ITX A;  3GQ3 A;  2LVQ D;  2BJV A;  1G4A E;  3K1J A;  1IN7 A;  4AW4 A;  5FTJ A;  4B7H A;  2OOA A;  3FRH A;  3TWK A;  1TF0 B;  2EUC A;  4Z6Y A;  3SAT A;  1Q39 A;  3FTF A;  1NY6 A;  2R4E A;  4DV7 M;  1L1Z A;  3DA1 A;  3HKP A;  3KXE C;  3QYE A;  1GVN A;  1NNJ A;  5LMN M;  3VKG A;  2BWE A;  5EXT A;  5DFL A;  1RU3 A;  3A45 A;  4LF8 M;  3U6D A;  3U60 A;  2HL7 A;  5DYG A;  5JI2 E;  4DR7 M;  3U6C A;  4B3R M;  4KHP M;  3L2A A;  1JR3 A;  1Z5B A;  2DAG A;  2ZBK B;  3B7Z A;  4IBD A;  2JXN A;  2NQ8 C;  1KFV A;  1EFU B;  3L29 A;  2QBY B;  4LF6 M;  3M7G A;  5EXX A;  4GKK M;  1OQY A;  2DWL A;  2C9C A;  5KQ8 A;  5FSW A;  4FWD A;  3JR5 A;  3H4M A;  1OKS A;  2JNH A;  2R46 A;  1VDL A;  2K6B A;  2ERC A;  4FWH A;  4A3V B;  4M9Z A;  4AZF A;  1NHW C;  3T38 A;  5KPZ A;  2UU9 M;  3GPX A;  3KP0 E;  4RF0 A;  4OVZ A;  2VF8 A;  1N32 M;  2CE7 A;  1T43 A;  2CHG A;  4LF7 M;  2MJ5 B;  4LRT A;  1V33 A;  1QZE A;  3PXG A;  1YSY A;  5BPV A;  1N75 A;  1QUS A;  3I4Y A;  4MGI E;  2C5R A;  1TH3 A;  2X4A A;  4CJ6 A;  3FTE A;  1N34 M;  4LJ7 A;  1NO1 A;  3CF0 A;  3DOA A;  4XK8 F;  3GLF A;  1E9R A;  2KA6 B;  3HX3 A;  1D0L A;  3UGJ A;  1GAB A;  3SYL A;  4JI3 M;  1KYI A;  2DZL A;  3RFW A;  4LF4 M;  1XMQ M;  1QAQ A;  2XEP A;  3F92 A;  4QOZ C;  2YR0 A;  2XF3 A;  4IJF A;  4FCV A;  4NSO B;  1JB0 F;  2DHY A;  2J7N A;  1T6O A;  1TR8 A;  4GIT A;  4QNM A;  4I4L A;  3U6P A;  2K0B X;  4AKH A;  3ZCB B;  1W5T A;  5FTL A;  1IN6 A;  5EP4 A;  4D80 A;  1D0M A;  2QPA A;  3IG8 A;  5FLX S;  1XWI A;  3FYD A;  4KO8 A;  4R7G A;  3HJ8 A;  2KNV A;  2X8A A;  2XSZ A;  4FWG A;  4LF9 M;  4LFA M;  3J7B A;  3T15 A;  2JA2 A;  3GO8 A;  1DGB A;  2QCU A;  3SAU A;  2DVW B;  4JV5 M;  1GLN A;  2HAK A;  4M0D A;  1NHG C;  5DNY A;  1Z5C A;  1G3I A;  2AHM A;  2LHC A;  2ZAO A;  1QQW A;  3GQ5 A;  1MN3 A;  4YY3 M;  2DWM A;  4DV3 M;  3IG5 A;  3SAV A;  1NV9 A;  4GEW A;  3GP1 A;  1SXJ E;  2DAM A;  3LW5 F;  4QNR A;  3JR4 A;  3AJI B;  4X66 M;  1PJS A;  4DV5 M;  2OQ4 A;  2R6F A;  2EKF A;  4G4R A;  2E5L M;  3VDP A;  2WSC F;  2WSE F;  3W0L B;  4JI4 M;  3GLI E;  2KW0 A;  3FUV A;  1QAN A;  3GPU A;  4LFB M;  2LVO C;  4MGZ E;  3ZC7 B;  3AL0 C;  2CHQ A;  2VF7 A;  5KPT A;  3K92 A;  2KRK A;  3VLF B;  4DV0 M;  1R2Z A;  1N77 A;  4DR5 M;  2L7H A;  3NBI A;  2VQF M;  3I51 A;  5IRE B;  2Z3X A;  1ZQ9 A;  2LTU A;  1E9S A;  4R3D A;  2M60 A;  1HR0 M;  3SAR A;  3SHG B;  4X64 M;  2O5R A;  3PNY A;  1VQ1 A;  1GJS A;  4NSR A;  3MMP A;  3UJN A;  2P5T A;  2Y21 A;  1IXZ A;  1DGH A;  2G8L A;  2RGO A;  3HJQ A;  1J09 A;  4LJ8 A;  2QP9 X;  1K3W A;  2D7E A;  1OIP A;  3FUX A;  4PCZ A;  2L09 A;  1KSF X;  1SXJ C;  2F5Q A;  4P16 A;  2MRO B;  1NV8 A;  5ITU A;  4LG2 A;  1IQP A;  4DV4 M;  3KOY E;  3JAM S;  3QAU A;  1GL6 A;  1TDH A;  2KEB A;  2XZF A;  2FFJ A;  4BLC A;  3TL4 X;  1ZMV A;  5L8R F;  3KSX A;  2JZ0 A;  5KO3 A;  2G3Q A;  3U61 B;  4NXM M;  4QHT A;  4IBC A;  4G3O A;  2DKL A;  2JY8 A;  2KZU A;  1IN5 A;  1OAI A;  2C99 A;  2UXB M;  4WW0 A;  3PFI A;  3FUT A;  3HHY A;  1WGN A;  2CV1 A;  1R7R A;  4HEO A;  4D82 A;  1IBL M;  2GQF A;  3GRY A;  4RF1 A;  3VDU A;  1N78 A;  5BR8 M;  1F4I A;  2FH0 A;  3FUW A;  2Y0T A;  3QYB A;  2KNA A;  1ZMU A;  4XBO A;  1WR1 B;  4JI0 M;  2KXE A;  2ZTD A;  1XNR M;  5JI3 E;  1J7K A;  4HL4 A;  3J81 S;  3J80 S;  3ZQJ A;  3HU3 A;  1C1K A;  3T6P A;  4AI6 A;  1JQJ C;  4S12 A;  2OO9 A;  4EIW A;  1MX0 A;  3KP1 E;  1HNZ M;  2OPF A;  2MGW A;  3U6O A;  1NY5 A;  2D7H A;  2DAE A;  3AV0 A;  3UK6 A;  1ZMW A;  2VQE M;  1PGY A;  1XNQ M;  2GNO A;  3AFH A;  1SG9 A;  4IBJ A;  1EIJ A;  2QHO B;  3FYC A;  3KOW E;  1HT2 E;  4IBF A;  4I81 A;  3GRU A;  2HCB A;  1PJQ A;  1JR3 D;  2VII A;  3KS4 A;  2Y20 A;  4L16 A;  1XC8 A;  5LMU M;  3J27 B;  5EXP A;  1AIP C;  4R71 A;  2LWX A;  1HNX M;  5FTM A;  1QDR A;  2F5S A;  1VEJ A;  2ZTC A;  4LGY A;  3SBJ A;  2CHV A;  4M9S A;  4X62 M;  2L4E A;  1I4W A;  3TPZ A;  3Q8X A;  4KLN A;  1FNN A;  3LCV B;  1D2N A;  2QQ8 A;  5IZ7 D;  2OOB A;  4BBA A;  2I7P A;  1K3X A;  4LJA A;  1QUT A;  1HNW M;  4TUW A;  1IN4 A;  2DNA A;  1L2C A;  1DO2 A;  3B9P A;  1W5S A;  2X49 A;  2V1C A;  4FVM A;  2KDL A;  3W68 A;  1MJG M;  3FE3 A;  2DZN B;  4NC6 A;  3SAW A;  3VFD A;  2F5P A;  1YE9 A;  4FD2 A;  1OIZ A;  2LXE A;  5E6J A;  3ZH9 B;  3GQ4 A;  1Z59 A;  2CV2 A;  2V6Z M;  4WP2 A;  4LCB A;  4DUY M;  4JI7 M;  4LFC M;  4ANR A;  3DZD A;  4L78 A;  3GPP A;  2K9D A;  4B7G A;  2Z7J A;  2O25 A;  2WZJ A;  1DV0 A;  2BJW A;  3L25 A;  3AOE C;  2G5G X;  2C98 A;  1TH4 A; 
#chains in the Genus database with same CATH homology
 2LTU A;  2JY5 A;  2JY6 B;  2LBC A;  1BVS A;  2MR9 A;  3IHP A;  2HWJ A;  2L2D A;  1UFZ A;  1XXH E;  2LVA A;  1WIV A;  1VQ1 A;  2LVP C;  2LVQ D;  1G4A E;  3MMP A;  1YLA A;  1VEK A;  2OOA A;  3FRH A;  2B3T A;  1Q02 A;  2DI0 A;  3B89 A;  1WGL A;  3FRI A;  3GLF E;  1DO0 A;  2MRO B;  1NV8 A;  2DEN A;  2BWE A;  5DFL A;  2JUJ A;  5JI2 E;  3K9O A;  4F1I A;  1ZMV A;  3GLH E;  2DAG A;  2JZ0 A;  1IFY A;  2G3Q A;  1EFU B;  2LVN C;  2EJS A;  4G3O A;  1OQY A;  2DKL A;  2JZ1 A;  2JY8 A;  1OAI A;  1OKS A;  1VEG A;  2JNH A;  1WGN A;  1VDL A;  4HEO A;  2JY7 A;  1TTE A;  1F4I A;  1T43 A;  1Y8G A;  2DAI A;  2KNA A;  1ZMU A;  2MJ5 B;  1CUK A;  1WR1 B;  1QZE A;  1WHC A;  2ZTD A;  4UN2 B;  1VG5 A;  1JR3 E;  3T6P A;  2OO9 A;  2MGW A;  2DAE A;  3GLG E;  3E21 A;  1ZMW A;  3IEC A;  2DAK A;  2KNZ A;  1PGY A;  1KYI A;  2DZL A;  1SG9 A;  2H5X A;  2BWB A;  2QHO B;  1HJP A;  2QSF X;  1HT2 E;  1E94 E;  1XB2 B;  3F92 A;  2DHY A;  2R0I A;  1T6O A;  1TR8 A;  2K0B X;  1AIP C;  4R71 A;  4F2L A;  4Q7J A;  2RRU A;  1C7Y A;  1OTR A;  1VEJ A;  2JP7 A;  2KNV A;  2ZTC A;  1R4G A;  2KHH A;  2L4E A;  4DBG B;  1IXS A;  3LCV B;  2OOB A;  3H4J A;  2HAK A;  1G3I A;  2DNA A;  1DO2 A;  2CWB A;  1GO5 A;  1MN3 A;  1P3Q Q;  1HQY E;  1NV9 A;  4GEW A;  2EKK A;  3FE3 A;  2DAM A;  3LCU A;  1V92 A;  1WJ7 A;  1ZV1 A;  2EKF A;  1A5T A;  1IM2 A;  2CP8 A;  2QNJ A;  3GLI E;  4WP2 A;  3E46 A;  1G41 A;  2LVO C;  2K9D A;  2O25 A;  3K9P A;  2WZJ A;  1DV0 A;  2L4F A;  1HT1 E;  3BBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...