2EKFA

Solution structure of ruh-075, a human cue domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
GSSGSSGSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ancient ubiquitous protein 1
publication title Solution structure of RUH-075, a human CUE domain
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ekfA01
3LCVB 2MR9A 1G3IA 3GLHE 4R71A 2DAMA 3LCUA 2CWBA 1A5TA 1ZMUA 2B3TA 2HAKA 1Q02A 2DKLA 2DI0A 2LBCA 2WZJA 1V92A 1WGLA 1CUKA 2MGWA 1R4GA 3F92A 2HWJA 2DAKA 2ZTCA 1OQYA 2K9DA 1GO5A 2JP7A 1JR3E 2DAGA 2JUJA 2L2DA 3FRHA 1WJ7A 1ZMVA 1DO2A 2ZTDA 1XXHE 1MN3A 2KNZA 2L4FA 1VEGA 4F1IA 1BVSA 3K9OA 2JY6B 2QSFX 2QHOB 2RRUA 1HQYE 2MJ5B 3GLGE 2JY7A 2OO9A 1ZMWA 2EKKA 2EKFA 1TTEA 1HT2E 5DFLA 2BWBA 1VEJA 1OAIA 3E46A 1Y8GA 1AIPC 1VDLA 3FRIA 4UN2B 1T6OA 3IECA 4WP2A 1DV0A 2MROB 4Q7JA 2LTUA 1UFZA 1TR8A 1C7YA 2DHYA 1VEKA 2DZLA 1IFYA 3GLFE 2OOAA 2JY8A 3E21A 1EFUB 2DNAA 2QNJA 2KNVA 1HT1E 1DO0A 2OOBA 3T6PA 2R0IA 2LVPC 2L4EA 1WGNA 2KNAA 3IHPA 2DAIA 2G3QA 1P3QQ 1VG5A 4HEOA 1F4IA 2O25A 2JY5A 4GEWA 2DAEA 4F2LA 3MMPA 3FE3A 1OTRA 2DENA 3B89A 4DBGB 2JZ1A 1OKSA 2CP8A 3K9PA 2JNHA 3GLIE 1E94E 1YLAA 1PGYA 1WR1B 2H5XA 1T43A 1QZEA 3BBZA 2K0BX 1VQ1A 1XB2B 2LVOC 1HJPA 2LVNC 1WHCA 2LVQD 1G4AE 1IXSA 1KYIA 2KHHA 1ZV1A 2EJSA 1NV8A 2LVAA 3H4JA 5JI2E 1WIVA 2JZ0A 1G41A 2BWEA 1NV9A 4G3OA 1SG9A 1IM2A
chains in the Genus database with same CATH superfamily
1HNZM 5H37D 2M5ZA 4DV0M 2X49A 4AKHA 3GLHE 1XXHB 1QUTA 1XWIA 2Z7JA 4M9SA 2YR0A 3RE8A 3EIHA 3U60A 3SMPA 1ZMUA 4AKIA 4LF8M 4AQYM 1Q02A 4L15A 4MGKE 3GLFB 3J80S 1GVNA 3U6MA 3GQ3A 4JI5M 5EQTA 1SXJD 2HWJA 1J09A 2K47A 2CV2A 2JXNA 4IIWA 2EA0A 4IJFA 2DWNA 3FD9A 1NSFA 1DGHB 2DAGA 2V6ZM 4MH0E 2N35A 2MH8A 2R44A 2JA2A 4G4RA 4LF7M 1DO2A 3AL0C 1QUSA 4B3RM 1ZAEA 2HCBA 3PXGA 4YHHM 5EXXA 5GKNA 4G6ZA 2F5SA 3B7QA 1IBKM 3SHFA 3H4MA 2KXEA 2R18A 4GKJM 5IWAM 1Z59A 2QSFX 5FTNA 3KSXA 4LJ6A 3GLGE 2OO9A 1ZMWA 3FTCA 1JQJC 3KW6A 1YUBA 3KOWE 3KXEC 2VQEM 5LMNM 1HT2E 2M60A 1S3SA 4NOOB 3SBJA 4X64M 4OVZA 2BWBA 1VEJA 4NXNM 1GJSA 4BB9A 3E46A 3SYLA 2C99A 3CF0A 3E9SA 4FCWA 2QBYB 4IBEA 2O01F 1VDLA 2FS1A 3LVWA 1JR3A 2K6BA 3Q8GA 4LJAA 4DV3M 4MB7A 1TDZA 4B7FA 2UXBM 3DOAA 1DGFA 4LJ8A 3U6PA 2LTUA 3FUTA 1TR8A 3AOGA 4I5SA 4NSOB 4LF4M 2I7PA 3VK8A 2WSCF 3RFWA 4NC6A 4LGYA 2R4EA 1QQWA 2QCUA 3SARA 3ZC7B 1PJJA 1EFUB 2DNAA 2QNJA 3B7NA 4K0KM 1HT1E 3GRUA 5IZ7D 3T1HM 3U5ZB 4L16A 3AV0A 2R0IA 3D8BA 1W5SA 4M0WA 1MJGM 2L4EA 4NRVA 1L2DA 2OQ4A 3I4YA 4HLQA 1P3QQ 4AG6A 4B7HA 2CHQA 1N78A 1Z5AA 1H6UA 4MGHA 3VKHA 2XEPA 4GKKM 2DAEA 3HJQA 3U6QA 3SAUA 4B3TM 1TH4A 1OTRA 1L2CA 4OU7A 4FD2A 4R3DA 1G8PA 1XXHA 2ZBKB 4DBGB 2BJWA 1D2NA 1Z5CA 3SAWA 4MM3B 2UUAM 2R45A 2ZANA 1FNNA 4CJ6A 3NWLA 1NHGC 1E94E 1QAMA 1YLAA 3K8ZA 5JI3E 1HNWM 2A5YB 2RGHA 3HU3A 3SASA 3L27A 2L09A 2Y21A 3FTEA 3BBZA 3KOXE 2XLJA 2G8LA 1VQ1A 3U6EA 1DGHA 1WHCA 2LVQD 3M7GA 3U61B 3SMSA 1IXSB 5KPZA 3UJNA 2EJSA 2V1UA 4LRTA 4DV6M 3W67A 1TH2A 4I4LA 3QAUA 1IY2A 1NNUC 2E5LM 2Z8YM 2F5NA 4G3OA 1W5TA 2C9OA 4FCVA 1TGUA 2QENA 3JAMS 4DV2M 5EP4A 4PT5A 2XF3A 4RNAA 2RGOA 4FCTA 1QAOA 3TE6A 3FTDA 4JI2M 1OFHA 2B3TA 1JR3D 2CFOA 4LY6A 4L78A 5FTJA 4A3VB 2WZJA 3VK7A 1V92A 4QHTA 1CUKA 2MGWA 4LJ5A 3CF2A 2KEBA 1E9RA 5EP1A 1QANA 2R4JA 4X65M 2QBYA 4DR4M 3KP0E 2K9DA 1GO5A 3I01M 2R46A 4KO8A 2XZUA 3OTOM 4JYAM 2L2DA 4DR5M 1WJ7A 3E4RA 5DYIA 2I7NA 1XXHE 3J7BA 2KRKA 3J81S 1MN3A 5ITQA 5EXPA 1BVSA 3TWKA 5ITXA 4FWGA 1IXRC 2J5YA 1HQYE 1R2YA 2MJ5B 2VF8A 1IY1A 2EKKA 2EKFA 2BJVA 4R7GA 1IN7A 3I4VA 4I81A 1GABA 2KZUA 3CTWB 2NQ8C 5ITYA 4CHTB 1Y8GA 2FNAA 1IN5A 1XHBA 4CIZA 3IECA 2CEAA 4LZZA 3VDUA 1R7RA 1V33A 3UZUA 4CGYB 1IY0A 3FUWA 4LFAM 3SFZA 4WW0A 4Q7JA 1PJIA 2KA6B 1LV7A 5KPRA 2O5RA 1SXJB 2QZ4A 1C7YA 4IBBA 5EXSA 2DHYA 2FFJA 3L28A 3J27B 1XNRM 2D7EA 3GLHB 3M6AA 4I8OA 4P16A 1GL7A 2XFSA 1DO0A 1DGBA 3FUUA 4GH9A 4LRSA 4QNRA 3MHVC 1AUAA 3K92A 1N77A 3GLIB 2CHGA 1NJGA 1D0KA 3JR4A 1X37A 2KNAA 2WSEF 3IHPA 4REZA 2G3QA 3FYDA 3U6OA 1IBLM 3W0LB 2O25A 4AG5A 5BR8M 1IBMM 2DWLA 4F2LA 2UXCM 4PDGA 4DR2M 3HU2A 4QHSA 3FE3A 1QYRA 3LW5F 4D81A 1PJSA 5ITXE 3TQSA 3GP1A 1WXQA 3K1JA 1G71A 1QDRA 3K9PA 2LHGA 1V34A 1N36M 2HKJA 2R65A 1WR1B 3HHZA 1QZEA 2L6OA 2K0BX 5DYGA 1XB2B 5KPTA 2LVOC 3KFUG 3PNVA 1HJPA 3MJ5A 2X4AA 4NL4H 4QOSA 4GC5A 1C1KA 3KVWA 7CATA 3U6SA 1KYIA 4LFCM 1ZV1A 2VF7A 2XH9A 1LTMA 2L7HA 4LCBA 3H4JA 3AKZA 3A42A 4AZFA 1L8QA 2JZ0A 3A46A 2Z4SA 1G41A 1KFVA 1YSYA 2GNOA 5DNYA 1SG9A 3FUVA 3FYCA 1IM2A 4RKUF 1I4WA 4L6V6 3WHLA 3QWLA 1EE8A 2C9CA 4QOZC 3I51A 8CATA 4M9XA 1OIZA 2DAMA 2CWBA 3U60B 5FSWA 3C9PA 2F5PA 2KZSA 1PRBA 3ILKA 3GLFA 4JXJA 3ZQJA 2XZFA 4FW9A 1J7KA 1PJTA 1R4GA 2LWXA 3F92A 2XFTA 3UMMA 2DAKA 3WHKA 5F3WA 4G4NA 5C18A 3PFIA 2UUBM 1IQPA 2JP7A 1JR3E 3SAVA 4CISA 1R2ZA 2DWMA 4OW0A 1XC8A 1L2BA 1ZMVA 1EIJA 3UGJA 3V76A 1HNXM 1IN6A 5ITUA 3LQQA 3KS8A 4GHLA 3DZDA 2L4FA 1VEGA 2DWZB 1NVMA 3L25A 4LFBM 3GLHA 2F4VM 2JY6B 3QYEA 4NSRA 4DV1M 3T15A 3FUXA 2QP9X 5KQ8A 2QHOB 2RRUA 1N75A 1FJGM 5EJCA 3GLIA 1NJFA 1GJTA 1RU3A 3GRRA 3KP1E 1G59A 1TTEA 2KRUA 4D80A 5L8RF 4X62M 2F5OA 2C98A 2KDLA 3HGIA 2BNKA 2CV1A 4PD2A 1YE9A 1E32A 2D7GA 2EO2A 4UN2B 1NY6A 4MGYE 3UK6A 4AW4A 3TWLA 4RF0A 4LJ4A 2QQ8A 4QNMA 4DR7M 1OFIA 4LF6M 4WP2A 5IT9S 3QYBA 2OPFA 3R8FA 2MROB 4WURA 2VQFM 1UFZA 4ITQA 1D0LA 3HKPA 2XGNA 2J7OA 1QAQA 3DA1A 2APLA 4HL4A 4G4QA 2AHMA 1JB0F 1VDDA 4DR6M 1IFYA 1Q3CA 3GLFE 2OOAA 2JY8A 3U6LA 3SC3A 4S12A 3E21A 4LG2A 4JV5M 4AI6A 2KNVA 3U5ZA 4IBIA 4PDIA 3U6DA 3IG5A 4FWHA 3T6PA 5ITTA 3FTFA 4JI1M 4MGIE 4GC9A 3GPUA 2ZAMA 3LQRA 1NHWC 3SYKA 3HWSA 2KW0A 3SATA 4KODA 4DV5M 4HEOA 1PJQA 2ERCA 2CUZA 4GEWA 3I04M 4M9ZA 3C3DA 2XSZD 4NXMM 2FH0A 2X8AA 4IBGA 1D0MA 1UM8A 3B89A 4B7GA 1TF0B 3JR5A 1OKSA 1QZMA 3L29A 5EXTA 2CV0A 3B74A 3HZJA 5A2QS 3GLIE 3KOZE 4GHAA 1ZQ9A 3TWMA 2FOIC 1R6BX 1T43A 3HU1A 3KOYE 1I94M 1NO1A 4AKGA 4IBFA 3L2AA 4LJ9A 4JI7M 2LVNC 3J7AS 3EIEA 3VFDA 4KLNA 3U61A 1IXSA 4ZPXA 3ZCBB 4NRWA 1Q39A 2Y0QA 5E26A 4IJEA 1NV8A 2LVAA 2Q2EB 4IBJA 5IREB 2ZM6M 3HHXA 4XK8F 3HJSA 3HHYA 1GKIA 5KQDA 4XGIA 1L1TA 3VKGA 4L4UA 3RGPA 2BWEA 1NV9A 3GPYA 2Z4RA 1E9SA 4M0DA 4PCZA 2C5RA 2P5TA 3FKEA 2V1CA 2MR9A 3LCVB 3M0EA 4IBCA 1G3IA 3GQ5A 2DXIA 4LF5M 4DV7M 4R71A 2LNHC 3PNYA 1HQCA 2HL7A 3LCUA 1A5TA 4LJ7A 4BLCA 2H1RA 3HJ8A 2HAKA 2DKLA 4KT0F 1GLNA 2DI0A 2LBCA 2LHCA 1WGLA 1IN4A 4LZJA 3W0FA 5FTMA 1Z5BA 2Y0TA 1IN8A 1OAOC 2DZOB 3TPZA 4GMQA 5KO3A 3GLGB 3SHGB 2ZTCA 1R5LA 1T3TA 4FVMA 1OQYA 5EP2A 4JI4M 4D82A 2JUJA 3FRHA 4KHPM 2VIIA 3GPXA 2UXDM 3J2PB 2VDBB 2HHHM 2LH0A 1XMOM 3DFZA 2ZTDA 4Y28F 4Z6YA 4B3MM 2CE7A 2JWSA 4DV4M 4DR3M 2KNZA 1K3XA 3W68A 4F1IA 2YNMD 2R6FA 3K2LA 3PVSA 5LMUM 3U6CA 2F5QA 3Q8XA 4L8RC 3K9OA 2QPAA 1XNQM 1Q3BA 2UU9M 3A45A 3AJIB 1K3WA 4MGZE 4IBKA 2DZNB 2XSZA 3NBIA 3T38A 2DHRA 5DFLA 1MX0A 1TDHA 1J5EM 1OAIA 2D7HA 1SXJC 3L26A 4JI8M 3ZH9B 1N34M 1N32M 1AIPC 4DUYM 3FRIA 4XBOA 1IXZA 3B9PA 1PM5A 1T6OA 3LMMA 3HHWA 2UUCM 1DV0A 1TH3A 3BOSA 1DGGA 3GPPA 3CF6E 3GO8A 1OIPA 1SXJA 2Z3XA 4B08A 2LXEA 1HR0M 3KDSE 4RF1A 4FWDA 1VEKA 2DZLA 5FTLA 4X66M 1MU5A 5BPVA 2Y20A 4EIWA 5FLXS 1NNJA 2WSFF 2OOBA 5C1BA 1KSFX 3C3EA 3GRYA 3C58A 4TUWA 1L1ZA 3THGA 2LVPC 3AFHA 3GRVA 2YFQA 1WGNA 3B7ZA 4JI0M 2DAIA 4OVZB 4GIPA 2CRUA 3D8LA 1VG5A 1F4IA 4OX9M 2JY5A 2W82A 1K82A 4P17A 1ORYB 1QDTA 4ANRA 3MMPA 1OJLA 3VLFB 4B3SM 3MK6A 3LVVA 4W5WA 3R9XB 4BBAA 2J7NA 4IBDA 2YQZA 4DUZM 2DENA 4LF9M 1Z6TA 3BXWA 2G5GX 2JZ1A 4YY3M 4DR1M 2CP8A 3VDPA 4JN6A 4G4OA 2JNHA 1QVRA 2C96A 1GL6A 3HX3A 1PGYA 4GRIA 4Z8XA 3RGSA 3T1YM 2RKOA 2H5XA 3AOEC 5EP3A 2DVWB 2EUCA 3CGWA 2CHVA 2L7IA 3A98B 4JI3M 3IG8A 3KS4A 3GLGA 5ITRA 4JI6M 3GQ4A 4GITA 3KSJA 1G4AE 2GQFA 2KHHA 3TL4X 1NY5A 2FE8A 4LGMA 3AOEA 5JI2E 1N33M 5FTKA 1WIVA 3HY5A 2R62A 1XMQM 1SXJE 2ZAOA 5E6JA 4II7A 3NBXX 2JY7A
chains in the Genus database with same CATH topology
3LCVB 2MR9A 1G3IA 3GLHE 4R71A 2DAMA 3LCUA 2CWBA 1A5TA 1ZMUA 2B3TA 2HAKA 1Q02A 2DKLA 2DI0A 2LBCA 2WZJA 1V92A 1WGLA 1CUKA 2MGWA 1R4GA 3F92A 2HWJA 2DAKA 2ZTCA 1OQYA 2K9DA 1GO5A 2JP7A 1JR3E 2DAGA 2JUJA 2L2DA 3FRHA 1WJ7A 1ZMVA 1DO2A 2ZTDA 1XXHE 1MN3A 2KNZA 2L4FA 1VEGA 4F1IA 1BVSA 3K9OA 2JY6B 2QSFX 2QHOB 2RRUA 1HQYE 2MJ5B 3GLGE 2JY7A 2OO9A 1ZMWA 2EKKA 2EKFA 1TTEA 1HT2E 5DFLA 2BWBA 1VEJA 1OAIA 3E46A 1Y8GA 1AIPC 1VDLA 3FRIA 4UN2B 1T6OA 3IECA 4WP2A 1DV0A 2MROB 4Q7JA 2LTUA 1UFZA 1TR8A 1C7YA 2DHYA 1VEKA 2DZLA 1IFYA 3GLFE 2OOAA 2JY8A 3E21A 1EFUB 2DNAA 2QNJA 2KNVA 1HT1E 1DO0A 2OOBA 3T6PA 2R0IA 2LVPC 2L4EA 1WGNA 2KNAA 3IHPA 2DAIA 2G3QA 1P3QQ 1VG5A 4HEOA 1F4IA 2O25A 2JY5A 4GEWA 2DAEA 4F2LA 3MMPA 3FE3A 1OTRA 2DENA 3B89A 4DBGB 2JZ1A 1OKSA 2CP8A 3K9PA 2JNHA 3GLIE 1E94E 1YLAA 1PGYA 1WR1B 2H5XA 1T43A 1QZEA 3BBZA 2K0BX 1VQ1A 1XB2B 2LVOC 1HJPA 2LVNC 1WHCA 2LVQD 1G4AE 1IXSA 1KYIA 2KHHA 1ZV1A 2EJSA 1NV8A 2LVAA 3H4JA 5JI2E 1WIVA 2JZ0A 1G41A 2BWEA 1NV9A 4G3OA 1SG9A 1IM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LCV B;  2MR9 A;  1G3I A;  3GLH E;  4R71 A;  2DAM A;  3LCU A;  2CWB A;  1A5T A;  1ZMU A;  2B3T A;  2HAK A;  1Q02 A;  2DKL A;  2DI0 A;  2LBC A;  2WZJ A;  1V92 A;  1WGL A;  1CUK A;  2MGW A;  1R4G A;  3F92 A;  2HWJ A;  2DAK A;  2ZTC A;  1OQY A;  2K9D A;  1GO5 A;  2JP7 A;  1JR3 E;  2DAG A;  2JUJ A;  2L2D A;  3FRH A;  1WJ7 A;  1ZMV A;  1DO2 A;  2ZTD A;  1XXH E;  1MN3 A;  2KNZ A;  2L4F A;  1VEG A;  4F1I A;  1BVS A;  3K9O A;  2JY6 B;  2QSF X;  2QHO B;  2RRU A;  1HQY E;  2MJ5 B;  3GLG E;  2JY7 A;  2OO9 A;  1ZMW A;  2EKK A;  2EKF A;  1TTE A;  1HT2 E;  5DFL A;  2BWB A;  1VEJ A;  1OAI A;  3E46 A;  1Y8G A;  1AIP C;  1VDL A;  3FRI A;  4UN2 B;  1T6O A;  3IEC A;  4WP2 A;  1DV0 A;  2MRO B;  4Q7J A;  2LTU A;  1UFZ A;  1TR8 A;  1C7Y A;  2DHY A;  1VEK A;  2DZL A;  1IFY A;  3GLF E;  2OOA A;  2JY8 A;  3E21 A;  1EFU B;  2DNA A;  2QNJ A;  2KNV A;  1HT1 E;  1DO0 A;  2OOB A;  3T6P A;  2R0I A;  2LVP C;  2L4E A;  1WGN A;  2KNA A;  3IHP A;  2DAI A;  2G3Q A;  1P3Q Q;  1VG5 A;  4HEO A;  1F4I A;  2O25 A;  2JY5 A;  4GEW A;  2DAE A;  4F2L A;  3MMP A;  3FE3 A;  1OTR A;  2DEN A;  3B89 A;  4DBG B;  2JZ1 A;  1OKS A;  2CP8 A;  3K9P A;  2JNH A;  3GLI E;  1E94 E;  1YLA A;  1PGY A;  1WR1 B;  2H5X A;  1T43 A;  1QZE A;  3BBZ A;  2K0B X;  1VQ1 A;  1XB2 B;  2LVO C;  1HJP A;  2LVN C;  1WHC A;  2LVQ D;  1G4A E;  1IXS A;  1KYI A;  2KHH A;  1ZV1 A;  2EJS A;  1NV8 A;  2LVA A;  3H4J A;  5JI2 E;  1WIV A;  2JZ0 A;  1G41 A;  2BWE A;  1NV9 A;  4G3O A;  1SG9 A;  1IM2 A; 
#chains in the Genus database with same CATH topology
 1HNZ M;  5H37 D;  2M5Z A;  4DV0 M;  2X49 A;  4AKH A;  3GLH E;  1XXH B;  1QUT A;  1XWI A;  2Z7J A;  4M9S A;  2YR0 A;  3RE8 A;  3EIH A;  3U60 A;  3SMP A;  1ZMU A;  4AKI A;  4LF8 M;  4AQY M;  1Q02 A;  4L15 A;  4MGK E;  3GLF B;  3J80 S;  1GVN A;  3U6M A;  3GQ3 A;  4JI5 M;  5EQT A;  1SXJ D;  2HWJ A;  1J09 A;  2K47 A;  2CV2 A;  2JXN A;  4IIW A;  2EA0 A;  4IJF A;  2DWN A;  3FD9 A;  1NSF A;  1DGH B;  2DAG A;  2V6Z M;  4MH0 E;  2N35 A;  2MH8 A;  2R44 A;  2JA2 A;  4G4R A;  4LF7 M;  1DO2 A;  3AL0 C;  1QUS A;  4B3R M;  1ZAE A;  2HCB A;  3PXG A;  4YHH M;  5EXX A;  5GKN A;  4G6Z A;  2F5S A;  3B7Q A;  1IBK M;  3SHF A;  3H4M A;  2KXE A;  2R18 A;  4GKJ M;  5IWA M;  1Z59 A;  2QSF X;  5FTN A;  3KSX A;  4LJ6 A;  3GLG E;  2OO9 A;  1ZMW A;  3FTC A;  1JQJ C;  3KW6 A;  1YUB A;  3KOW E;  3KXE C;  2VQE M;  5LMN M;  1HT2 E;  2M60 A;  1S3S A;  4NOO B;  3SBJ A;  4X64 M;  4OVZ A;  2BWB A;  1VEJ A;  4NXN M;  1GJS A;  4BB9 A;  3E46 A;  3SYL A;  2C99 A;  3CF0 A;  3E9S A;  4FCW A;  2QBY B;  4IBE A;  2O01 F;  1VDL A;  2FS1 A;  3LVW A;  1JR3 A;  2K6B A;  3Q8G A;  4LJA A;  4DV3 M;  4MB7 A;  1TDZ A;  4B7F A;  2UXB M;  3DOA A;  1DGF A;  4LJ8 A;  3U6P A;  2LTU A;  3FUT A;  1TR8 A;  3AOG A;  4I5S A;  4NSO B;  4LF4 M;  2I7P A;  3VK8 A;  2WSC F;  3RFW A;  4NC6 A;  4LGY A;  2R4E A;  1QQW A;  2QCU A;  3SAR A;  3ZC7 B;  1PJJ A;  1EFU B;  2DNA A;  2QNJ A;  3B7N A;  4K0K M;  1HT1 E;  3GRU A;  5IZ7 D;  3T1H M;  3U5Z B;  4L16 A;  3AV0 A;  2R0I A;  3D8B A;  1W5S A;  4M0W A;  1MJG M;  2L4E A;  4NRV A;  1L2D A;  2OQ4 A;  3I4Y A;  4HLQ A;  1P3Q Q;  4AG6 A;  4B7H A;  2CHQ A;  1N78 A;  1Z5A A;  1H6U A;  4MGH A;  3VKH A;  2XEP A;  4GKK M;  2DAE A;  3HJQ A;  3U6Q A;  3SAU A;  4B3T M;  1TH4 A;  1OTR A;  1L2C A;  4OU7 A;  4FD2 A;  4R3D A;  1G8P A;  1XXH A;  2ZBK B;  4DBG B;  2BJW A;  1D2N A;  1Z5C A;  3SAW A;  4MM3 B;  2UUA M;  2R45 A;  2ZAN A;  1FNN A;  4CJ6 A;  3NWL A;  1NHG C;  1E94 E;  1QAM A;  1YLA A;  3K8Z A;  5JI3 E;  1HNW M;  2A5Y B;  2RGH A;  3HU3 A;  3SAS A;  3L27 A;  2L09 A;  2Y21 A;  3FTE A;  3BBZ A;  3KOX E;  2XLJ A;  2G8L A;  1VQ1 A;  3U6E A;  1DGH A;  1WHC A;  2LVQ D;  3M7G A;  3U61 B;  3SMS A;  1IXS B;  5KPZ A;  3UJN A;  2EJS A;  2V1U A;  4LRT A;  4DV6 M;  3W67 A;  1TH2 A;  4I4L A;  3QAU A;  1IY2 A;  1NNU C;  2E5L M;  2Z8Y M;  2F5N A;  4G3O A;  1W5T A;  2C9O A;  4FCV A;  1TGU A;  2QEN A;  3JAM S;  4DV2 M;  5EP4 A;  4PT5 A;  2XF3 A;  4RNA A;  2RGO A;  4FCT A;  1QAO A;  3TE6 A;  3FTD A;  4JI2 M;  1OFH A;  2B3T A;  1JR3 D;  2CFO A;  4LY6 A;  4L78 A;  5FTJ A;  4A3V B;  2WZJ A;  3VK7 A;  1V92 A;  4QHT A;  1CUK A;  2MGW A;  4LJ5 A;  3CF2 A;  2KEB A;  1E9R A;  5EP1 A;  1QAN A;  2R4J A;  4X65 M;  2QBY A;  4DR4 M;  3KP0 E;  2K9D A;  1GO5 A;  3I01 M;  2R46 A;  4KO8 A;  2XZU A;  3OTO M;  4JYA M;  2L2D A;  4DR5 M;  1WJ7 A;  3E4R A;  5DYI A;  2I7N A;  1XXH E;  3J7B A;  2KRK A;  3J81 S;  1MN3 A;  5ITQ A;  5EXP A;  1BVS A;  3TWK A;  5ITX A;  4FWG A;  1IXR C;  2J5Y A;  1HQY E;  1R2Y A;  2MJ5 B;  2VF8 A;  1IY1 A;  2EKK A;  2EKF A;  2BJV A;  4R7G A;  1IN7 A;  3I4V A;  4I81 A;  1GAB A;  2KZU A;  3CTW B;  2NQ8 C;  5ITY A;  4CHT B;  1Y8G A;  2FNA A;  1IN5 A;  1XHB A;  4CIZ A;  3IEC A;  2CEA A;  4LZZ A;  3VDU A;  1R7R A;  1V33 A;  3UZU A;  4CGY B;  1IY0 A;  3FUW A;  4LFA M;  3SFZ A;  4WW0 A;  4Q7J A;  1PJI A;  2KA6 B;  1LV7 A;  5KPR A;  2O5R A;  1SXJ B;  2QZ4 A;  1C7Y A;  4IBB A;  5EXS A;  2DHY A;  2FFJ A;  3L28 A;  3J27 B;  1XNR M;  2D7E A;  3GLH B;  3M6A A;  4I8O A;  4P16 A;  1GL7 A;  2XFS A;  1DO0 A;  1DGB A;  3FUU A;  4GH9 A;  4LRS A;  4QNR A;  3MHV C;  1AUA A;  3K92 A;  1N77 A;  3GLI B;  2CHG A;  1NJG A;  1D0K A;  3JR4 A;  1X37 A;  2KNA A;  2WSE F;  3IHP A;  4REZ A;  2G3Q A;  3FYD A;  3U6O A;  1IBL M;  3W0L B;  2O25 A;  4AG5 A;  5BR8 M;  1IBM M;  2DWL A;  4F2L A;  2UXC M;  4PDG A;  4DR2 M;  3HU2 A;  4QHS A;  3FE3 A;  1QYR A;  3LW5 F;  4D81 A;  1PJS A;  5ITX E;  3TQS A;  3GP1 A;  1WXQ A;  3K1J A;  1G71 A;  1QDR A;  3K9P A;  2LHG A;  1V34 A;  1N36 M;  2HKJ A;  2R65 A;  1WR1 B;  3HHZ A;  1QZE A;  2L6O A;  2K0B X;  5DYG A;  1XB2 B;  5KPT A;  2LVO C;  3KFU G;  3PNV A;  1HJP A;  3MJ5 A;  2X4A A;  4NL4 H;  4QOS A;  4GC5 A;  1C1K A;  3KVW A;  7CAT A;  3U6S A;  1KYI A;  4LFC M;  1ZV1 A;  2VF7 A;  2XH9 A;  1LTM A;  2L7H A;  4LCB A;  3H4J A;  3AKZ A;  3A42 A;  4AZF A;  1L8Q A;  2JZ0 A;  3A46 A;  2Z4S A;  1G41 A;  1KFV A;  1YSY A;  2GNO A;  5DNY A;  1SG9 A;  3FUV A;  3FYC A;  1IM2 A;  4RKU F;  1I4W A;  4L6V 6;  3WHL A;  3QWL A;  1EE8 A;  2C9C A;  4QOZ C;  3I51 A;  8CAT A;  4M9X A;  1OIZ A;  2DAM A;  2CWB A;  3U60 B;  5FSW A;  3C9P A;  2F5P A;  2KZS A;  1PRB A;  3ILK A;  3GLF A;  4JXJ A;  3ZQJ A;  2XZF A;  4FW9 A;  1J7K A;  1PJT A;  1R4G A;  2LWX A;  3F92 A;  2XFT A;  3UMM A;  2DAK A;  3WHK A;  5F3W A;  4G4N A;  5C18 A;  3PFI A;  2UUB M;  1IQP A;  2JP7 A;  1JR3 E;  3SAV A;  4CIS A;  1R2Z A;  2DWM A;  4OW0 A;  1XC8 A;  1L2B A;  1ZMV A;  1EIJ A;  3UGJ A;  3V76 A;  1HNX M;  1IN6 A;  5ITU A;  3LQQ A;  3KS8 A;  4GHL A;  3DZD A;  2L4F A;  1VEG A;  2DWZ B;  1NVM A;  3L25 A;  4LFB M;  3GLH A;  2F4V M;  2JY6 B;  3QYE A;  4NSR A;  4DV1 M;  3T15 A;  3FUX A;  2QP9 X;  5KQ8 A;  2QHO B;  2RRU A;  1N75 A;  1FJG M;  5EJC A;  3GLI A;  1NJF A;  1GJT A;  1RU3 A;  3GRR A;  3KP1 E;  1G59 A;  1TTE A;  2KRU A;  4D80 A;  5L8R F;  4X62 M;  2F5O A;  2C98 A;  2KDL A;  3HGI A;  2BNK A;  2CV1 A;  4PD2 A;  1YE9 A;  1E32 A;  2D7G A;  2EO2 A;  4UN2 B;  1NY6 A;  4MGY E;  3UK6 A;  4AW4 A;  3TWL A;  4RF0 A;  4LJ4 A;  2QQ8 A;  4QNM A;  4DR7 M;  1OFI A;  4LF6 M;  4WP2 A;  5IT9 S;  3QYB A;  2OPF A;  3R8F A;  2MRO B;  4WUR A;  2VQF M;  1UFZ A;  4ITQ A;  1D0L A;  3HKP A;  2XGN A;  2J7O A;  1QAQ A;  3DA1 A;  2APL A;  4HL4 A;  4G4Q A;  2AHM A;  1JB0 F;  1VDD A;  4DR6 M;  1IFY A;  1Q3C A;  3GLF E;  2OOA A;  2JY8 A;  3U6L A;  3SC3 A;  4S12 A;  3E21 A;  4LG2 A;  4JV5 M;  4AI6 A;  2KNV A;  3U5Z A;  4IBI A;  4PDI A;  3U6D A;  3IG5 A;  4FWH A;  3T6P A;  5ITT A;  3FTF A;  4JI1 M;  4MGI E;  4GC9 A;  3GPU A;  2ZAM A;  3LQR A;  1NHW C;  3SYK A;  3HWS A;  2KW0 A;  3SAT A;  4KOD A;  4DV5 M;  4HEO A;  1PJQ A;  2ERC A;  2CUZ A;  4GEW A;  3I04 M;  4M9Z A;  3C3D A;  2XSZ D;  4NXM M;  2FH0 A;  2X8A A;  4IBG A;  1D0M A;  1UM8 A;  3B89 A;  4B7G A;  1TF0 B;  3JR5 A;  1OKS A;  1QZM A;  3L29 A;  5EXT A;  2CV0 A;  3B74 A;  3HZJ A;  5A2Q S;  3GLI E;  3KOZ E;  4GHA A;  1ZQ9 A;  3TWM A;  2FOI C;  1R6B X;  1T43 A;  3HU1 A;  3KOY E;  1I94 M;  1NO1 A;  4AKG A;  4IBF A;  3L2A A;  4LJ9 A;  4JI7 M;  2LVN C;  3J7A S;  3EIE A;  3VFD A;  4KLN A;  3U61 A;  1IXS A;  4ZPX A;  3ZCB B;  4NRW A;  1Q39 A;  2Y0Q A;  5E26 A;  4IJE A;  1NV8 A;  2LVA A;  2Q2E B;  4IBJ A;  5IRE B;  2ZM6 M;  3HHX A;  4XK8 F;  3HJS A;  3HHY A;  1GKI A;  5KQD A;  4XGI A;  1L1T A;  3VKG A;  4L4U A;  3RGP A;  2BWE A;  1NV9 A;  3GPY A;  2Z4R A;  1E9S A;  4M0D A;  4PCZ A;  2C5R A;  2P5T A;  3FKE A;  2V1C A;  2MR9 A;  3LCV B;  3M0E A;  4IBC A;  1G3I A;  3GQ5 A;  2DXI A;  4LF5 M;  4DV7 M;  4R71 A;  2LNH C;  3PNY A;  1HQC A;  2HL7 A;  3LCU A;  1A5T A;  4LJ7 A;  4BLC A;  2H1R A;  3HJ8 A;  2HAK A;  2DKL A;  4KT0 F;  1GLN A;  2DI0 A;  2LBC A;  2LHC A;  1WGL A;  1IN4 A;  4LZJ A;  3W0F A;  5FTM A;  1Z5B A;  2Y0T A;  1IN8 A;  1OAO C;  2DZO B;  3TPZ A;  4GMQ A;  5KO3 A;  3GLG B;  3SHG B;  2ZTC A;  1R5L A;  1T3T A;  4FVM A;  1OQY A;  5EP2 A;  4JI4 M;  4D82 A;  2JUJ A;  3FRH A;  4KHP M;  2VII A;  3GPX A;  2UXD M;  3J2P B;  2VDB B;  2HHH M;  2LH0 A;  1XMO M;  3DFZ A;  2ZTD A;  4Y28 F;  4Z6Y A;  4B3M M;  2CE7 A;  2JWS A;  4DV4 M;  4DR3 M;  2KNZ A;  1K3X A;  3W68 A;  4F1I A;  2YNM D;  2R6F A;  3K2L A;  3PVS A;  5LMU M;  3U6C A;  2F5Q A;  3Q8X A;  4L8R C;  3K9O A;  2QPA A;  1XNQ M;  1Q3B A;  2UU9 M;  3A45 A;  3AJI B;  1K3W A;  4MGZ E;  4IBK A;  2DZN B;  2XSZ A;  3NBI A;  3T38 A;  2DHR A;  5DFL A;  1MX0 A;  1TDH A;  1J5E M;  1OAI A;  2D7H A;  1SXJ C;  3L26 A;  4JI8 M;  3ZH9 B;  1N34 M;  1N32 M;  1AIP C;  4DUY M;  3FRI A;  4XBO A;  1IXZ A;  3B9P A;  1PM5 A;  1T6O A;  3LMM A;  3HHW A;  2UUC M;  1DV0 A;  1TH3 A;  3BOS A;  1DGG A;  3GPP A;  3CF6 E;  3GO8 A;  1OIP A;  1SXJ A;  2Z3X A;  4B08 A;  2LXE A;  1HR0 M;  3KDS E;  4RF1 A;  4FWD A;  1VEK A;  2DZL A;  5FTL A;  4X66 M;  1MU5 A;  5BPV A;  2Y20 A;  4EIW A;  5FLX S;  1NNJ A;  2WSF F;  2OOB A;  5C1B A;  1KSF X;  3C3E A;  3GRY A;  3C58 A;  4TUW A;  1L1Z A;  3THG A;  2LVP C;  3AFH A;  3GRV A;  2YFQ A;  1WGN A;  3B7Z A;  4JI0 M;  2DAI A;  4OVZ B;  4GIP A;  2CRU A;  3D8L A;  1VG5 A;  1F4I A;  4OX9 M;  2JY5 A;  2W82 A;  1K82 A;  4P17 A;  1ORY B;  1QDT A;  4ANR A;  3MMP A;  1OJL A;  3VLF B;  4B3S M;  3MK6 A;  3LVV A;  4W5W A;  3R9X B;  4BBA A;  2J7N A;  4IBD A;  2YQZ A;  4DUZ M;  2DEN A;  4LF9 M;  1Z6T A;  3BXW A;  2G5G X;  2JZ1 A;  4YY3 M;  4DR1 M;  2CP8 A;  3VDP A;  4JN6 A;  4G4O A;  2JNH A;  1QVR A;  2C96 A;  1GL6 A;  3HX3 A;  1PGY A;  4GRI A;  4Z8X A;  3RGS A;  3T1Y M;  2RKO A;  2H5X A;  3AOE C;  5EP3 A;  2DVW B;  2EUC A;  3CGW A;  2CHV A;  2L7I A;  3A98 B;  4JI3 M;  3IG8 A;  3KS4 A;  3GLG A;  5ITR A;  4JI6 M;  3GQ4 A;  4GIT A;  3KSJ A;  1G4A E;  2GQF A;  2KHH A;  3TL4 X;  1NY5 A;  2FE8 A;  4LGM A;  3AOE A;  5JI2 E;  1N33 M;  5FTK A;  1WIV A;  3HY5 A;  2R62 A;  1XMQ M;  1SXJ E;  2ZAO A;  5E6J A;  4II7 A;  3NBX X;  2JY7 A; 
#chains in the Genus database with same CATH homology
 3LCV B;  2MR9 A;  1G3I A;  3GLH E;  4R71 A;  2DAM A;  3LCU A;  2CWB A;  1A5T A;  1ZMU A;  2B3T A;  2HAK A;  1Q02 A;  2DKL A;  2DI0 A;  2LBC A;  2WZJ A;  1V92 A;  1WGL A;  1CUK A;  2MGW A;  1R4G A;  3F92 A;  2HWJ A;  2DAK A;  2ZTC A;  1OQY A;  2K9D A;  1GO5 A;  2JP7 A;  1JR3 E;  2DAG A;  2JUJ A;  2L2D A;  3FRH A;  1WJ7 A;  1ZMV A;  1DO2 A;  2ZTD A;  1XXH E;  1MN3 A;  2KNZ A;  2L4F A;  1VEG A;  4F1I A;  1BVS A;  3K9O A;  2JY6 B;  2QSF X;  2QHO B;  2RRU A;  1HQY E;  2MJ5 B;  3GLG E;  2JY7 A;  2OO9 A;  1ZMW A;  2EKK A;  2EKF A;  1TTE A;  1HT2 E;  5DFL A;  2BWB A;  1VEJ A;  1OAI A;  3E46 A;  1Y8G A;  1AIP C;  1VDL A;  3FRI A;  4UN2 B;  1T6O A;  3IEC A;  4WP2 A;  1DV0 A;  2MRO B;  4Q7J A;  2LTU A;  1UFZ A;  1TR8 A;  1C7Y A;  2DHY A;  1VEK A;  2DZL A;  1IFY A;  3GLF E;  2OOA A;  2JY8 A;  3E21 A;  1EFU B;  2DNA A;  2QNJ A;  2KNV A;  1HT1 E;  1DO0 A;  2OOB A;  3T6P A;  2R0I A;  2LVP C;  2L4E A;  1WGN A;  2KNA A;  3IHP A;  2DAI A;  2G3Q A;  1P3Q Q;  1VG5 A;  4HEO A;  1F4I A;  2O25 A;  2JY5 A;  4GEW A;  2DAE A;  4F2L A;  3MMP A;  3FE3 A;  1OTR A;  2DEN A;  3B89 A;  4DBG B;  2JZ1 A;  1OKS A;  2CP8 A;  3K9P A;  2JNH A;  3GLI E;  1E94 E;  1YLA A;  1PGY A;  1WR1 B;  2H5X A;  1T43 A;  1QZE A;  3BBZ A;  2K0B X;  1VQ1 A;  1XB2 B;  2LVO C;  1HJP A;  2LVN C;  1WHC A;  2LVQ D;  1G4A E;  1IXS A;  1KYI A;  2KHH A;  1ZV1 A;  2EJS A;  1NV8 A;  2LVA A;  3H4J A;  5JI2 E;  1WIV A;  2JZ0 A;  1G41 A;  2BWE A;  1NV9 A;  4G3O A;  1SG9 A;  1IM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...