2EKHA

Solution structures of the sh3 domain of human kiaa0418
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
80
structure length
80
Chain Sequence
GSSGSSGATSYMTCSAYQKVQDSEISFPAGVEVQVLEKQESGWWYVRFGELEGWAPSHYLVLDENEQPDPSGKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3 and PX domain-containing protein 2A
publication title Solution structures of the SH3 domain of human KIAA0418
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 5
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ekhA00
2LZ6B 4J9CA 1K0XA 2AKKA 1AWWA 1NEGA 1K4US 1SPKA 2RQTA 2L0AA 2I0NA 3EG3A 3EG0A 1AD5A 2RQRA 4JJDA 3M0QA 2DM1A 1WDXA 2JS0A 3QWYA 1CKBA 2W0ZA 2ROTA 4HVWA 1KSWA 1MV3A 2KT1A 1PHTA 2FRYA 2FRWA 3LH5A 2PNIA 2CUDA 1WXUA 2YUOA 2BTTA 4Z89A 1M8MA 1QCFA 1VYTA 2D8JA 3EG1A 2HDAA 2CH4A 4F16A 4OMOA 2C0IA 4RTYA 3UA6A 1UJYA 1RUWA 2D8HA 2KNBB 1Z9QA 2CT3A 2J6OA 4JZ4A 5FW9A 4FSSA 3C0CA 2JTEA 2DILA 2RMOA 1HSQA 2ECZA 3REBB 1K9AA 4E6RA 2V1RA 4J9DA 3SEMA 2OI3A 3EHQA 4J9IA 2KYMA 1KFZA 1UG1A 2L3SA 2KR3A 2L3QA 2KRNA 2JS2A 2CDTA 4JJBA 1UECA 2RQVA 4AFUC 2RNAA 4LN2A 1UHFA 1NLPC 1ARKA 2M0YA 3ZL7C 1E6HA 2OJ2A 2ROLA 2LX7A 1E6GA 2AZSA 4CC2A 3H41A 2K6DA 1YWPA 1VYVA 3TSZA 3REAB 1K0SA 4X1VA 2ED1A 2J6KA 1N5ZA 3QWXX 1JO8A 2NUZA 2FPEA 2EGCA 4Z8AA 3TVTA 4DEYA 2HSPA 1PKSA 1TUCA 1TUDA 1WYXA 2DLPA 1Y0MA 1WXBA 2KXDA 2O9VA 1WIEA 3I5SA 1SSHA 1B3QA 1GRIA 1NYGA 1JU5C 2ABLA 3UATA 2O9SA 3I5RA 2AK5A 1UE9A 4RTUA 4RTZA 2VWFA 2J6FA 4JPBW 4AG1C 4K11A 2GGRA 2FG0A 2EVRA 2LMJA 3VRYA 4ORZA 1I07A 1NYFA 2DJQA 1X2QA 2VVKA 5GJWB 1X69A 1VYUA 2DF6A 4D8KA 1RLPC 1PWTA 2YUQA 4HVVA 2GQIA 2KROA 1ZLMA 1OOTA 2FEIA 1GCPA 1WFWA 4EIKA 1MV0B 1GBQA 1PNJA 3VS0A 1LCKA 2JM8A 2YUPA 1BU1A 2ENMA 3UA7A 1UUEA 2C0OA 3THKA 4J9FA 2SRCA 2LJ1A 2W10A 1T3SA 2J06A 2EKHA 4KRTA 5IHIA 2J05A 1M30A 2NWMA 2CREA 5GJVB 1H8KA 2CSQA 1AZGB 3VS2A 2DL3A 2J7IA 3NHNA 1SHFA 1NLOC 2PZ1A 1U3OA 1G83A 1UGVA 4ZNXA 2LCSA 1ZUKA 2LP5A 1CSKA 3A98A 1AVZC 3VS1A 3H0HA 4IIOA 2RQUA 1XOVA 2RQWA 3H0IA 2O2OA 1U06A 2X3WD 2KEAA 1AEYA 2QDLA 1ZSGA 4Z88A 5ECAA 2RF0A 2LJ3A 2JMAA 2ED0A 1WX6A 2EPDA 4J9GA 4LE9A 1AWOA 2KYBA 2VKNA 2B86A 3H0FA 2O88A 1AWJA 1ZUYA 4OMLA 2EGAA 1YN8A 4OMMA 2PTKA 2JXBA 1NG2A 2DBKA 1OEBA 2DX1A 2SEMA 2H8HA 2DYBA 3RNJA 2E5KA 2RPNA 1HD3A 4J9BA 1H3HA 1EFNA 2DL5A 1NM7A 1WI7A 4LNPA 1T0JA 3PVQA 2KGTA 2RN8A 1ABQA 1SEMA 2V1QA 4RUGA 1GL5A 2EW3A 3EG2A 1X43A 3JV3A 1JEGA 1X6GA 2AKLA 2G6FX 3M0SA 3VS7A 1UDLA 1GCQC 3M0RA 1YCSB 2F2VA 4F14A 1JXOA 2KE9A 2K7AA 2DRMA 2YUNA 3UF4A 4JJCA 1PKTA 2L2PA 1UJ0A 1GCQA 1X2KA 2DNUA 2YT6A 4OMNA 4GLMA 2HCKA 2YSQA 2D1XA 2JT4A 4HVUA 2A28A 1UHCA 4WCIA 1K1ZA 1RLQC 1M3AA 1WLPB 4HCKA 3VS5A 5HCKA 4HXJA 1CKAA 4LUEA 5IH2A 2DL4A 4JZ3A 3VRZA 2XMFA 2CT4A 2LQWA 1KJWA 1GFCA 5IXBA 4RTWA 1TG0A 5IXFA 5L23A 4RTXA 1B07A 2K2MA 4RTVA 1A0NB 3EGUA 1M3CA 2LNHB 1AZEA 2P4RA 3O5ZA 1BB9A 1PRLC 2DL7A 1HJDA 2A08A 3PVLA 3RBBB 3VS3A 3R6NA 1UTIA 2GTJA 1E7OA 4AFZC 3KFVA 2KRSA 1YNZA 2X3XD 1JQQA 3PE0A 2EYXA 2EGEA 3U23A 2HEQA 2JM9A 2KT8A 1QWEA 1JXMA 2BZYA 3NGPA 4CC4B 5IHNA 2O31A 1FMKA 1KIKA 3TSWA 2FPFA 1J3TA 1SRLA 2JMCA 1SRMA 2LQNA 3NPFA 2L3PA 4IIMA 2K3BA 1NEBA 3IQLA 1PRMC 2DA9A 5I22A 2DL8A 1UFFA 4LUDA 2EYWA 2ESWA 1FYNA 4D8DA 3I35A 2GTOA 1S1NA 1BK2A 2EYZA 4RTTA 4A63B 2K9GA 2BZXA 4AFSC 2F2XA 3CQTA 2DBMA 1W70A 1ZUUA 3EHRA 2C0TA 1Z9ZA 1RI9A 2EYYA 1M3BA 2IIMA 4R0KA 1WXTA 2AZVA 1H92A 1YWOA 2MOXA 2MCNA 4ESRA 1X6BA 4Y92A 4DEXA 1QLYA 3M0UA 4M4ZA 2F2WA 1OV3A 2BZ8A 1OPKA 4OMQA 4CC3A 1BBZA 3NMZC 2DMOA 1K76A 2A36A 2CH4W 4QT7A 4GBQA 3VS6A 3M0TA 1W6XA 4F17A 4AFQC 2DVJA 1YP5A 2FPDA 3SHWA 1WA7A 1AOJA 1Y57A 2FO0A 1U5SA 1ABOA 1I0CA 2KXCA 5I11A 2OAWA 5EC7A 1VA7A 1OPLA 5FWCA 2YDLA 1GBRA 3FJ5A 2GBQA 1AWXA 2CSIA 1SHGA 4J9HA 4CC7A 1QWFA 2LJ0A 1W1FA 2M51A 2JW4A 1I1JA 2KRMA 3I9QA 2EBPA 3ULRB 4J9EA 5FWBA 2A37A 2KBTA 4AG2C 1IO6A 2DRKA 2HBWA 2K79A 3VS4A 2D0NA 1G2BA 1GFDA 4OMPA 1MUZA 1T0HA 2CUBA 1ZX6A 1QKXA 2MIOA 2EQIA 5IHKA 1QKWA 1X27A 1V1CA 2DE0X 1T3LA 1ZBJA 2GNCA 3GBQA 3M0PA 1M27C
chains in the Genus database with same CATH superfamily
2E10A 1KD1C 1K0XA 2LQKA 1AWWA 1SPKA 4KH0B 2RQTA 3EGDB 5LJ3j 2E64A 3WXMB 4E7LA 5C0MA 1I5OB 5CK9A 3M0QA 1WDXA 2QYZA 1KC8U 3I56T 1XTDA 1KSWA 5GMKj 5GAN6 1NJIC 1C0MA 2FRYA 4LDWA 2M02A 1VQMQ 2PNIA 3G4SQ 5GAMf 4P5NA 4PJJA 1WXUA 2P84A 4BACA 3NTKA 5KYYA 4KULA 2D8JA 3QSUA 2HDAA 3A8LB 2QQRA 3G1JA 5I2SA 4N4GA 5GAOn 4RTYA 3G6EQ 1UJYA 3FB9A 1Z9QA 3OYYA 5LJ3f 3V7SA 5A0DA 5FW9A 1JBMA 2CP6A 1IXDA 4QVCA 3VJPA 5DM7R 2DILA 2RMOA 1YJWA 4PFPA 4BD3A 1YITA 3DLMA 1TS9A 2ECZA 4E6RA 2A0FB 1RAGB 1K73C 4J9DA 2JZ2A 3V7CA 4C8QD 2KYMA 4M7DE 5A2QE 3ER0A 1UG1A 2L3SA 1LPLA 2KR3A 2L3QA 4QQGA 2CDTA 2RQVA 4AFUC 3VYGA 2RNAA 1YJ9T 2RH2A 1UHFA 3JB9H 8AT1B 1ARKA 1RAIB 3CMAA 2K5FA 3VUZA 2V8JA 4CC2A 1MHNA 3TSZA 3HRTA 4DBHA 3N5BB 4OGEA 1JO8A 5GAOq 4DEYA 2HSPA 1TUDA 1WYXA 1I4K1 1D0ZA 4PJOD 4MMLA 2O9VA 4XAXB 5GAOm 3PT9A 1GRIA 1NYGA 1MMDA 1JU5C 2FZCB 1Q86R 2P0PA 3L2QA 5KYYB 1V29B 4OB1B 2L3RA 2ZPHB 4C92A 4RTZA 2VWFA 4J8OA 4JPBW 2EVRA 4PKCC 2HL5C 3VRYA 4ORZA 4F7UA 2DTIA 3JCMP 5GJWB 4BE2A 4D8KA 3LWIA 3BE3A 4FM4B 3C94A 4HVVA 2GQIA 3TEEA 4NS5A 1GCPA 2FL7A 2RHXA 1D0XA 3VS0A 5GAN2 1MMGA 1WHMA 3G71A 2C0OA 4PFOA 2DAQA 2SRCA 3OYIA 1YI2Q 4RCCA 2J05A 2NWMA 4M77E 2HQXA 2CREA 4BI4A 3L2VA 3HFOA 1PD0A 4J6XA 2DL3A 1UEBA 2J7IA 1S72A 3L2WA 1JB0E 3NHNA 1SHFA 1U3OA 4ZNXA 3J7AF 2LCSA 1ZUKA 3E9FA 1RI0A 4ATOA 1OZ2A 4C92F 3H0HA 4M75C 4IIOA 4Q5WA 2RQUA 5KYWA 4DBRA 4F7UF 2RK2A 3OYGA 3HP9A 3OS2A 2EQUA 1AEYA 1G3SA 4M78D 3C12A 2VUBA 1RABB 3OYNA 2Y4YA 1Q7YC 2Y4XA 3TU4K 4VUBA 1VUBA 2RF0A 3CCSQ 2VXEA 3H0FA 4FU6A 4A4FA 3UDCA 3JCMg 2VYTA 1VQ9A 5CKFA 4C0GA 2RI2A 3CC2Q 2LRQA 2DYBA 1Y96B 3CCUA 2RPNA 2LC4A 3OBYA 1M9SA 2PVOB 1NM7A 2K5LA 2Y90A 5CKHA 4LNPA 3M56A 1T0JA 3PVQA 1VQLQ 1M5Q1 4RG2A 3FJPA 2V1QA 4QQ6A 1U8RA 1TTHB 3HKSA 3UWNA 3VS7A 2ATCB 3A8MB 1YHQA 3I56Q 1YCSB 2KE9A 1H641 4JJCA 1PKTA 3OSVA 1YJNA 4PJLA 2YT6A 4A4GA 2KQWA 3MEVA 2YSQA 1JJ2A 2D1XA 1K8AR 3CC7T 1KHCA 2PUKB 1N27A 3MP8A 4HT9A 1M1KR 1UHCA 2BE7D 1K1ZA 1IZ6A 4RCBA 5GMKi 1X75C 1VQKQ 4N0AC 4AMCA 5AYFA 1FWZA 2GQVA 2DL4A 1VQPQ 2CT4A 1OQKA 3CCLA 2KMTA 1TG0A 1G3TA 2DEUA 5CAIA 4EMKB 3OBWA 1BIAA 1A0NB 1AZEA 4PLIA 2JJ9A 1BCMA 3L2UA 2EFIA 2A08A 3PVLA 4DQ2A 3KFVA 1JQQA 3PE0A 1HXDA 1VOMA 1QWEA 1BYMA 3NGPA 2O31A 1YIJA 5KYNA 1SRMA 2CZ0B 3NFCA 2L3PA 1VQNT 3CPWP 2DA9A 2QA4Q 4KUIA 1FYNA 4XU1A 2RK1A 5FU7B 4E7HA 2QEXQ 5C6SA 2HZYA 1WGSA 2BZXA 3CCMA 1YCYA 3CQTA 3LH0A 3M57A 4A4EA 3CC4A 2X51A 6AT1B 3MP1A 1RI9A 2EYYA 3HHTB 2IIMA 3E2UA 2AZVA 5KCHA 2OTLQ 2MOXA 2MCNA 4Y92A 3LWHA 4DEXA 1YJWT 2F2WA 4DBFA 1YITT 2MWOA 1OV3A 2BZ8A 1RAHB 4OMQA 3NMZC 1D1CA 2DMOA 2CH4W 5GAN5 3LGLA 2GFAA 2GCXA 4GBQA 3V8KA 3QJ6A 3CCJA 4AFQC 2JVVA 1N6AA 3R6OA 3SHWA 1TU0B 2L8DA 1I5LA 5GAN8 3CXCA 2RJEA 1WJSA 4M7DB 1EIFA 4M75F 2KXCA 4C8QA 1OPLA 2CP7A 2CSIA 2LJ0A 1OI1A 3LGFA 2M51A 2P4TA 3EGXB 1VQOQ 4IUQA 4Z02A 3OW2S 3I9QA 2WSEE 4M75G 2EBPA 3A1PA 1WPYA 4J9EA 5FWBA 2A37A 2KBTA 3MEAA 1N9SA 2DRKA 2JUFA 2EKOA 2D0NA 4EMGA 3V7RA 3GPLA 1MUZA 1MNEA 2XDBA 2LCCA 3L42A 1OU8A 3OW2A 4HCBA 1ZX6A 4DOVA 1Q81U 2MIOA 1PG5B 5GAOl 5IHKA 1M90U 1X27A 1T3LA 3GBQA 4MZMA 4PJOA 3M0PA 2NYSA 1B7TA 2QK0A 1MMNA 1XJWB 2AKKA 1NEGA 2KI7A 2ZGWA 5HY6A 2L0AA 4JS4A 1VQ6A 3EG3A 4HCZA 2DIGA 3EG0A 4PK4A 2FHDA 3QXEB 2RQRA 2KAFA 2JS0A 2PVGB 2VXFA 1PC0A 1VQ5Q 3M4GA 1TWBA 5CVIA 1PHTA 3CD6A 2FRWA 3G71T 3LH5A 3HSBA 4N4HA 5DLOA 3PTAA 1N8RR 3OYMA 1VYTA 4RMOA 5M9OA 4BE0A 4C8QB 3JB9F 2F5TX 2CT3A 5IN1A 1Q82R 2J6OA 4FSSA 5HK0A 4O5VA 4XU3A 2JOYA 3PIOA 1KQ2A 3BW1A 2V1RA 3ZEHA 3VYHB 2H3EB 3GLXA 3JB9G 2DO3A 3SEMA 3HRSA 5CQYA 4J9IA 3EGDA 1KFZA 4JLIA 2CP3A 2KRNA 5GMKm 5LJ5e 1UECA 4XTWA 2LTOA 3OQ5A 1NLPC 3ZL7C 1E6HA 3I55T 4B9WA 4ZTJA 1E6GA 1G3WA 4M78A 2KSSA 1K0SA 3GIBA 3MKDA 2ED1A 2J6KA 1O9SA 5LJ5j 2FPEA 1MMAA 2EGCA 3CCUT 4Z8AA 1KK7A 3M58A 3A8GB 1LOJA 2YXYA 5CKBA 1SSFA 2RJDA 5GAMe 2X4YA 2KXDA 1WIEA 1VQNQ 2XHCA 2X4XA 3QG1A 1B3QA 1KQSS 2ABLA 1O75A 4OGCA 3UATA 4FSXA 1EX4A 1YHQT 2O9SA 3EG9B 3I5RA 2YWWA 2CZ6B 5GAN4 4J6YA 2E3IA 3QJYA 1G5VA 1QQJA 4E7ZA 2J6FA 1Q86C 1QMCA 2LMJA 1KQSA 5GAMj 4XU2A 2DJQA 1QW1A 1KC8R 5LJ5f 5FRMA 1X69A 2OX7A 1OX8A 1DJ7B 1SKUB 1RLPC 1PWTA 2COZA 2YLBA 1WHLA 1Y71A 2FEIA 2PQWA 4EIKA 1MV0B 1GBQA 1LCKA 3EH2A 2JM8A 4M7AG 3CCVQ 3TREA 2RHZA 3RKWA 2HBPA 3CCLT 3CCRQ 2EKHA 1KQ1A 2HMAA 4PL6A 3DB3A 4C5GA 4WTOB 4E7JA 1H8KA 4M78B 4X9DA 3GF5A 2CSQA 4ME7A 1M2VB 1PSEA 2X35A 3C4SA 1WQ7A 2MWPA 3JCMc 2LP5A 3A98A 1WZOA 1AVZC 3VS1A 2D6FA 3UPUA 1XOVA 2EYQA 1YIJT 2FZGB 2H3JA 3LX7A 1ZSGA 2OTJQ 4Z88A 4EMKC 2P0QA 2EPDA 4LE9A 2KYBA 2NLUA 4FT2A 1ZUYA 2EGAA 2XDPA 4BDYA 2VV5A 4OMMA 3CCMT 4M77D 2RI3A 1W2BS 3CC4T 3OYEA 3PNWC 1FMVA 2DX1A 2H8HA 2ZPIB 3RNJA 4J9BA 1VQMA 1EFNA 4DBQA 1WI7A 1F1BB 2ZPGB 4XK8E 3G4SA 2ZPFB 4RUGA 3QPHA 5GANd 1GL5A 2DERA 2EW3A 4V2SA 3TQ7P 1JEGA 3CCEQ 2G6FX 4MDXA 5FU7C 3G6EA 5GANg 4FIBA 1JJ2P 4F14A 4M75E 3OYAA 3UF4A 4JRPA 3CCJT 3C95A 1GCQA 3RERA 2YHTA 1AHJB 1K9MU 4GLMA 3M55A 2JT4A 2A7YA 5CKEA 2O4XB 1QP3A 2DXUA 3OYKA 2XK0A 1VQ8T 4WCIA 3QDFA 3RMSA 1K8AC 1WLPB 1VIEA 1M1KC 3M5AA 1Y96A 4HA8A 3VRZA 2LQWA 1GFCA 2DTOA 4KGXB 3RIRA 5IXFA 5L23A 4O6JA 1B07A 2K2MA 2Z0WA 3JCMh 1M3CA 1WJRA 2LNHB 2B8AA 2P4RA 3O5ZA 1TH7A 3NTIA 4FW1A 5GAN3 4M7DC 3CCQT 2PU9B 4FT4A 3RBBB 1E7OA 4AFZC 2KRSA 3CMEA 2X3XD 3I55Q 1ZQ1A 3U23A 2D9TA 5L8RE 4JJNK 1KIKA 4CC4B 1FMKA 5CO7A 3TSWA 2FPFA 3V8JA 1SRLA 1KD1U 2CZ1B 2LQNA 1HK9A 1MNDA 3NPFA 5FRNA 1VQ7T 4OB0B 2WACA 4IIMA 3DKMA 2K3BA 4ANJA 1VQ6T 3MCAB 1WHKA 5I22A 2OAUA 4MZTA 2EYWA 2ESWA 2K2VA 1OX9A 3CD6T 1S1NA 4RTTA 4M7AD 3ME9A 2DTHA 1NJIU 4IUPA 4C92G 3JCMd 1G8XA 1LJOA 4BY6B 2MK5A 4EPCA 1M4ZA 1W70A 1ZUUA 4EMKA 4F7UG 1VQ4Q 2X4WA 3NTHA 1Y7XA 4R0KA 1H92A 1XNIA 4J7IA 4ESRA 1YI2A 1QLYA 2G3RA 3M0UA 1RAFB 2R5AA 1OPKA 3FDRA 3SB2A 1QVGS 1SF9A 4FCYA 2AT1B 3BDLA 3JCMQ 1K73U 3CXCP 2DVJA 3MEWA 3VV0A 3KBGA 1RAEB 1WA7A 5D6YA 3JAME 4C8QC 4CI0C 1U5SA 1QVGA 1EZZB 1ABOA 1I0CA 3QIIA 5GMKl 3X20B 2YRDA 4BI8B 3SWNA 2GFUA 1I8FA 1VA7A 3OYJA 2HL3A 3FJ5A 1AWXA 4J9HA 1QWFA 2AIRB 2LQ8A 1G3YA 1I1JA 3CCSA 4FL6A 1UGRB 2KRMA 5FLXE 2K5IA 4BUGA 3ULRB 4AG2C 1QP2A 3OW2P 2QASA 1IO6A 2QGGA 4NOYA 3OB9A 2M0OA 1BKBA 2K57A 3CC2A 1C1AA 4M7AE 2QQAA 1G2BA 4Y28E 1GFDA 4PJOC 3FLGA 2CUBA 4IUTA 1YFNA 1VIFA 4FYVB 2LDMA 1VQLA 5DY9A 1V1CA 2DE0X 2GNCA 4FYYB 2QG9B 4BB7A 4PLLA 3OMGA 2LZ6B 1YJ9Q 3SDZA 4J9CA 5A0GA 1K4US 2IG0A 3I56A 3RKXA 4E7IA 2BE9B 2I0NA 4M7DA 4XU0A 1P92A 2EIFA 4R55A 2DM1A 3P8BB 2E6NA 3QWYA 1CKBA 2W0ZA 2NUTB 4XTYA 2KT1A 3BDUA 2MPXC 2CUDA 4GLKA 3EGXA 1ZHIA 4L6V5 3SD4A 4Z89A 1M8MA 1QCFA 4FYWB 3EG1A 4ZN1A 2CH4A 1JRIA 4IURA 4F16A 1H3ZA 3X24B 4NL2A 3SWNB 3JCMW 1VQKA 1N8RC 1RUWA 4AT1B 3O8VA 2VGNA 1VQPA 4E7KA 4JZ4A 5LL6S 9ATCB 3H8ZA 1D3BA 4R56A 2JTEA 2MF2A 3TCJA 1VQ8Q 2CS7A 3REBB 1Q82C 2OI3A 3EHQA 1NZ9A 2KY9A 1ZSZB 2RJFA 5LJ3h 4M7DF 1Q7YU 5LJ5g 4M78C 4GY5A 2DD4A 3RR6A 3L2ZA 3VKIA 4BE1A 4LN2A 2BIVA 1IB8A 2CZ7B 2OJ2A 4C5EA 2ROLA 5GMKh 2LX7A 3CCQQ 4C92D 2KVQG 3H41A 1IGQA 4OMFB 3REAB 2QA4A 5GAN7 4KBMB 3CMAT 4LXCA 2RI5A 3RUXA 1NBEB 1TUCA 3EFOA 2DLPA 1VQMT 5CR2A 2QEXA 4B6MA 3G4ST 3WVEB 2V8IA 1IREB 3D7SB 1VQ7Q 1Q81R 2RA2A 2CP2A 2M16A 3I5SA 1M90R 1SSHA 1OYXA 4OB2B 2DXBA 1AT1B 3A8OB 5GAMg 2WSFE 3PMTA 4M77A 4XTVA 3LYIA 3G6ET 3S3OA 2E1HA 1KQSP 1TUGB 5LJ3d 2OTLA 3PFSA 4LDXA 1M1FA 4RTUA 4AG1C 2LVMA 2GGRA 3J81E 3JCMf 1WNLA 5LJ3g 1I07A 2VVKA 1D3BB 2L89A 1IHWA 3OYBA 2COWA 4C5HA 1ZLMA 1OOTA 5I2MA 1KC8C 1LVKA 4PNOA 1WFWA 4PFZA 1V76A 4PJNA 1PNJA 3FC3A 4C0FA 2DZ9A 3JRZA 2L5QA 2FVUA 2RD1A 1BU1A 1D1BA 2ENMA 4QQDA 4J9FA 2HAXA 3CBOA 2LJ1A 2W10A 1T3SA 5KYUA 1QVFS 4C8QF 2J06A 1NPPA 2PVDB 4E47A 4XTUA 1RAAB 2MAMA 2CYZB 3X28B 1M30A 5GJVB 3VS2A 3RESA 4BI3A 3EG9A 1VQOA 2RHYA 3M4YA 4C92E 2PZ1A 1QVFA 3CMET 3CPWS 1Y07A 4QVDA 4C8QG 3EFOB 2QDYB 4YTLA 4F7UE 3CC7Q 1S72T 2DJZA 1U06A 1UGSB 4IUVA 5CQXA 3KUFA 3JSCA 4M77B 2COYA 3MJXA 4N4IA 2E4HA 2QDLA 3L2RA 4PJOF 5ECAA 1WHHA 2LJ3A 2JMAA 4J6WA 1WX6A 2X4JA 3L1AA 4J9GA 1AWOA 3OYCA 2QTXA 2MI6A 3QBYA 3M9QA 1YN8A 5AT1B 2EWNA 2PTKA 3Q1JA 3HRUA 1RADB 1NG2A 3DB4A 2DBKA 1BI2A 4PJOG 2SEMA 1VQ5A 1I81A 1VQ9T 2E5KA 1H3HA 2DEQA 1R77A 1M8VA 2DL5A 1M2VA 2RO0A 3OYLA 2KGTA 2RN8A 1ABQA 2E65A 1YI2T 2HKNA 4E7SA 5KYUB 1X6GA 3M0SA 1GCQC 2R57A 1PSFA 2F2VA 4Y91A 4BY6C 3M54A 2LCLA 2ZZDA 2K7AA 2YRCA 2DRMA 2YUNA 2L2PA 5IAYA 3GNFB 2DNUA 3OS1A 5CIUA 4HVUA 5KH6A 5HKCA 3LLRA 3X26B 1YJNT 2CP0A 4FYXB 1M3AA 3X25B 4A54A 3FRNA 2DVEA 4HXJA 1CKAA 3INZA 5IH2A 2DZCA 4JZ3A 3M59A 2XMFA 3CCST 1KJWA 3AHUA 4JS5A 1IRXA 4M78F 4RTXA 1YJWQ 1YITQ 4RTVA 2DD5A 4L5GA 2VASA 1GXIE 3OY9A 1BB9A 4M75D 2ZPEB 2DL7A 2V8KA 2RJCA 3R6NA 1UTIA 2DIQA 4JLGA 4ELYC 1YNZA 3PMIA 4M78G 2EYXA 1VQLT 3EFSA 2EGEA 3BY7A 2KK4A 1VQNA 2FZKB 5EG2A 4M7AB 1JXMA 2BZYA 5IHNA 2AHJB 3OYHA 4XQ3A 3CMAQ 2R5MA 2O4XA 2RM4A 3EFRA 3CBPA 4ZTFA 1NEBA 1PRMC 1BI0A 2JTMA 5GANh 3E9GA 1N9RA 2DETA 1IGUA 2NUPB 1FXXA 1ACMB 3VU3C 4DA4A 1BK2A 2QTVA 1OULA 3QHSA 3VUBA 4KGZB 3E1SA 2F2XA 2DBMA 2C0TA 1Z9ZA 2JN0A 2LX9A 1VQKT 1WXTA 3LW5E 2QQBA 3CCVA 1VQPT 1LNXA 4ZGDB 3CCRA 1X6BA 3OSSC 1BI3A 1QVPA 3QUIA 4J7FA 4M4ZA 2DKGA 2EQJA 2QAZA 3BFMA 1K9MR 4CC3A 1BBZA 1FX7A 1K76A 4EMHA 1W2BA 4F17A 2WSCE 1QVGP 1NPRA 5KYXB 2CP5A 3SWNC 5IT9E 3JB9D 3JCMX 3MP6A 3G71Q 3JB9I 2JTFA 1U1TA 2O01E 5HK3A 2EJ9A 2OAWA 5EC7A 3ZBDA 2OTJA 5FWCA 1UGQB 2QQSA 2QA4T 3CMEQ 1ZA2B 4CC7A 4OP0A 1W1FA 2F69A 1R0BG 2DYIA 4E2FB 2JW4A 1S72Q 4HCCA 3CBMA 5KCOA 1X6OA 2QEXT 2FB7A 4ZN3A 1TOVA 1ZSZC 4MMKA 2VC8A 3URGA 2E3HA 2K79A 3VS4A 3OS5A 4MDWA 3PGGA 4OMPA 5FU6B 1KD1R 2OTLT 1QKXA 4JRKA 3ASKA 2EQIA 1QKWA 1Q86U 4UC4A 2CGHA 3CCEA 2IVWA 2E6ZA 2K4YA 1VQ9Q 4KH1B 1NJIR 5FROA 4II1A 4RKUE 1AD5A 4C8QE 1R0CB 4JJDA 3OS0A 4LDUA 2XU8A 2ROTA 4HVWA 3CCUQ 1MV3A 3META 2YUOA 2BTTA 2QQ9A 1TXQA 2GF7A 4C0DB 4A4KA 2HKQB 4QKUA 3M53A 2C0IA 4OMOA 3UA6A 1YHQQ 2D8HA 2KNBB 1VQOT 1X01A 2P0KA 1K73R 4CRIA 3C0CA 1W4SA 1YJNQ 2HSEB 4PJOE 2E12A 1HSQA 2DFUA 1K9AA 3MPUB 1KHIA 4C92B 1B34A 5I21A 4OF1A 3QZ9B 2XI9A 1BCOA 4ELZC 1RL2A 4F7UB 3I55A 2JS2A 3T9NA 4JJBA 8ATCB 3GP8A 1MGQA 2NUTA 3DLLA 2M0YA 3CCLQ 3G7ZA 1ZA1B 4LD6A 3S3NA 2AZSA 2K6DA 1YWPA 1VYVA 4C0ZA 2QI2A 4X1VA 3QWXX 1N5ZA 2XICA 3FIFA 3MO8A 2NUZA 1OZ3A 1VQ5T 1ZBXA 3TVTA 1PKSA 4M77C 1JJ2S 1Y0MA 5J39A 5GANe 2X9HA 2HQEA 1WXBA 3JCMV 2ZAEA 4X9CA 4B9XA 1YIJQ 1VQ4A 3AT1B 1Q81C 2AK5A 1M90C 1UE9A 4K11A 2FG0A 5GANj 1ZSZA 5KYWB 1M1GA 1NYFA 1X2QA 4C5IA 3EH1A 1VYUA 2DF6A 1UB4A 2YUQA 3F70A 3KXTA 3CCMQ 2KROA 3PIPA 3OYDA 4M78E 1B34B 3CC4Q 2LT1A 2LT4A 2QXFA 1D1AA 2F1LA 5J3BA 4A53A 1K8AU 2ZPBB 4RG8A 2K3YA 2YUPA 3UA7A 1UUEA 1HYOA 4J5YA 3THKA 2MYSA 1M1KU 5D6WA 5LJ5h 2IPOB 1TSFA 1UGPB 4KRTA 2XD0A 2PUOB 5IHIA 5GANf 2QGFB 1QVFP 4KT0E 1IHVA 3S6WA 3V8LA 4L59A 1AZGB 2RB6A 5J26A 2XIDA 1NLOC 3CCJQ 1G83A 1UGVA 1D0YA 5KE2A 1PCXA 1CSKA 2RQWA 2DK3A 2O2OA 3H0IA 3ZFJA 1Q7YR 1FMWA 2X3WD 2XKOC 2KEAA 3JCMb 5GAMh 4M75A 5GAOp 1QCOA 3CEYA 5LJ5d 2EJFA 1YJ9A 2ED0A 3JCMe 2VKNA 2B86A 2O88A 1AWJA 4IUUA 4OMLA 3JCMJ 2E5QA 2EAYA 3CPFA 2JXBA 1KG1A 4M7AC 1OEBA 2M1HA 4WF2A 2RHIA 2JNGA 1HD3A 3SFMA 3CCVT 3S3MA 4M7DG 2M9UA 2EQMA 3CXCS 4JRIA 1SEMA 3CCRT 3MEUA 2BUDA 3EG2A 2HQHA 5GAMd 4JUVA 1X43A 3JV3A 4X34A 2AKLA 3UT1A 1UDLA 4HT8A 2RHUA 3M0RA 1VQ6Q 1JXOA 4KGVB 1NE8A 4PJMA 2HD0A 1UJ0A 1X2KA 2D0QB 4OMNA 2HCKA 1VQ8A 3GNGA 3H6ZA 4LDYA 3CD6Q 2CKKA 1RACB 3QO3A 1OU9A 3QZ5B 2EJGA 5D6XA 2A28A 4D6WA 1RLQC 4HCKA 3VS5A 5KE3A 2OTJT 5HCKA 4MZPA 5DLQE 4M75B 2EQKA 2A3LA 4BDZA 4LUEA 2DXCA 1PD1A 2VB6A 4JRQA 3MHXA 3A8HB 5IXBA 2HNIA 4RTWA 2R58A 4N0AA 3CCQA 3HPWA 3RMQA 1D09B 3EGUA 1PRLC 1HJDA 3VS3A 2XDDA 2GTJA 4J83A 2YRVA 4TVRA 2LNVA 1VQ7A 2HEQA 2JM9A 1M2OA 4M77F 2KT8A 1J3TA 3CCET 2JMCA 4LDVA 2DPPB 4HKEA 2MMPA 3IQLA 2BKDN 2DL8A 1UFFA 4LUDA 4XTZA 3P8HA 4D8DA 4M77G 4FW2A 3I35A 3QYGB 3QYHB 5CKDA 4KUDK 3CPWA 2GTOA 2FYKA 5FU6C 2EYZA 4A63B 3WVDB 3E19A 3OA6A 3QDRB 1WHGA 4ZGEB 2K9GA 4XTXA 4AFSC 1U1SA 3P8DA 5D7UA 3EHRA 3HTRA 2E41A 3FEOA 1SG5A 1WQWA 4IKFA 3HL8A 1M3BA 4DOWA 3JB9J 1BIBA 1YWOA 3H9NA 1N8RU 7AT1B 4QVZA 1R8OB 1W2BP 3RDVA 2I2LA 1QCNA 4M7AA 2F5KA 4OB3B 1Q82U 2E70A 2A36A 4QT7A 5A0LA 5GAOr 4F04B 3VS6A 3M0TA 1W6XA 2DXTA 4NL3A 4PJOB 2YLCA 1C6VX 1K9MC 4EDUA 4C0DC 1YP5A 2FPDA 2V26A 3OYFA 4LD9K 3QKJA 3J80E 1AOJA 3OMCA 3CC7A 1Y57A 2KDSA 1XQHA 2NUPA 3GOXA 2FO0A 3EAEA 1WHJA 5I11A 1GBRA 1WJQA 1PM3A 2YDLA 3A5ZB 2GBQA 1SHGA 1YBYA 1Q95G 4C92C 2ZCFB 2C06A 3HFNA 4OVAA 1BI1A 4M7DD 2K3XA 4JDSA 4QW2A 5CCAA 2HBWA 5LJ3e 2VGMA 1VQ4T 2XG8D 1T0HA 4M7AF 4A4HA 3CC2T 4ZGJB 5GMKe 1ZBJA 5KYXA 3RKYA 1M27C
chains in the Genus database with same CATH topology
2LZ6B 4J9CA 1K0XA 2AKKA 1AWWA 1NEGA 1K4US 1SPKA 2RQTA 2L0AA 2I0NA 3EG3A 3EG0A 1AD5A 2RQRA 4JJDA 3M0QA 2DM1A 1WDXA 2JS0A 3QWYA 1CKBA 2W0ZA 2ROTA 4HVWA 1KSWA 1MV3A 2KT1A 1PHTA 2FRYA 2FRWA 3LH5A 2PNIA 2CUDA 1WXUA 2YUOA 2BTTA 4Z89A 1M8MA 1QCFA 1VYTA 2D8JA 3EG1A 2HDAA 2CH4A 4F16A 4OMOA 2C0IA 4RTYA 3UA6A 1UJYA 1RUWA 2D8HA 2KNBB 1Z9QA 2CT3A 2J6OA 4JZ4A 5FW9A 4FSSA 3C0CA 2JTEA 2DILA 2RMOA 1HSQA 2ECZA 3REBB 1K9AA 4E6RA 2V1RA 4J9DA 3SEMA 2OI3A 3EHQA 4J9IA 2KYMA 1KFZA 1UG1A 2L3SA 2KR3A 2L3QA 2KRNA 2JS2A 2CDTA 4JJBA 1UECA 2RQVA 4AFUC 2RNAA 4LN2A 1UHFA 1NLPC 1ARKA 2M0YA 3ZL7C 1E6HA 2OJ2A 2ROLA 2LX7A 1E6GA 2AZSA 4CC2A 3H41A 2K6DA 1YWPA 1VYVA 3TSZA 3REAB 1K0SA 4X1VA 2ED1A 2J6KA 1N5ZA 3QWXX 1JO8A 2NUZA 2FPEA 2EGCA 4Z8AA 3TVTA 4DEYA 2HSPA 1PKSA 1TUCA 1TUDA 1WYXA 2DLPA 1Y0MA 1WXBA 2KXDA 2O9VA 1WIEA 3I5SA 1SSHA 1B3QA 1GRIA 1NYGA 1JU5C 2ABLA 3UATA 2O9SA 3I5RA 2AK5A 1UE9A 4RTUA 4RTZA 2VWFA 2J6FA 4JPBW 4AG1C 4K11A 2GGRA 2FG0A 2EVRA 2LMJA 3VRYA 4ORZA 1I07A 1NYFA 2DJQA 1X2QA 2VVKA 5GJWB 1X69A 1VYUA 2DF6A 4D8KA 1RLPC 1PWTA 2YUQA 4HVVA 2GQIA 2KROA 1ZLMA 1OOTA 2FEIA 1GCPA 1WFWA 4EIKA 1MV0B 1GBQA 1PNJA 3VS0A 1LCKA 2JM8A 2YUPA 1BU1A 2ENMA 3UA7A 1UUEA 2C0OA 3THKA 4J9FA 2SRCA 2LJ1A 2W10A 1T3SA 2J06A 2EKHA 4KRTA 5IHIA 2J05A 1M30A 2NWMA 2CREA 5GJVB 1H8KA 2CSQA 1AZGB 3VS2A 2DL3A 2J7IA 3NHNA 1SHFA 1NLOC 2PZ1A 1U3OA 1G83A 1UGVA 4ZNXA 2LCSA 1ZUKA 2LP5A 1CSKA 3A98A 1AVZC 3VS1A 3H0HA 4IIOA 2RQUA 1XOVA 2RQWA 3H0IA 2O2OA 1U06A 2X3WD 2KEAA 1AEYA 2QDLA 1ZSGA 4Z88A 5ECAA 2RF0A 2LJ3A 2JMAA 2ED0A 1WX6A 2EPDA 4J9GA 4LE9A 1AWOA 2KYBA 2VKNA 2B86A 3H0FA 2O88A 1AWJA 1ZUYA 4OMLA 2EGAA 1YN8A 4OMMA 2PTKA 2JXBA 1NG2A 2DBKA 1OEBA 2DX1A 2SEMA 2H8HA 2DYBA 3RNJA 2E5KA 2RPNA 1HD3A 4J9BA 1H3HA 1EFNA 2DL5A 1NM7A 1WI7A 4LNPA 1T0JA 3PVQA 2KGTA 2RN8A 1ABQA 1SEMA 2V1QA 4RUGA 1GL5A 2EW3A 3EG2A 1X43A 3JV3A 1JEGA 1X6GA 2AKLA 2G6FX 3M0SA 3VS7A 1UDLA 1GCQC 3M0RA 1YCSB 2F2VA 4F14A 1JXOA 2KE9A 2K7AA 2DRMA 2YUNA 3UF4A 4JJCA 1PKTA 2L2PA 1UJ0A 1GCQA 1X2KA 2DNUA 2YT6A 4OMNA 4GLMA 2HCKA 2YSQA 2D1XA 2JT4A 4HVUA 2A28A 1UHCA 4WCIA 1K1ZA 1RLQC 1M3AA 1WLPB 4HCKA 3VS5A 5HCKA 4HXJA 1CKAA 4LUEA 5IH2A 2DL4A 4JZ3A 3VRZA 2XMFA 2CT4A 2LQWA 1KJWA 1GFCA 5IXBA 4RTWA 1TG0A 5IXFA 5L23A 4RTXA 1B07A 2K2MA 4RTVA 1A0NB 3EGUA 1M3CA 2LNHB 1AZEA 2P4RA 3O5ZA 1BB9A 1PRLC 2DL7A 1HJDA 2A08A 3PVLA 3RBBB 3VS3A 3R6NA 1UTIA 2GTJA 1E7OA 4AFZC 3KFVA 2KRSA 1YNZA 2X3XD 1JQQA 3PE0A 2EYXA 2EGEA 3U23A 2HEQA 2JM9A 2KT8A 1QWEA 1JXMA 2BZYA 3NGPA 4CC4B 5IHNA 2O31A 1FMKA 1KIKA 3TSWA 2FPFA 1J3TA 1SRLA 2JMCA 1SRMA 2LQNA 3NPFA 2L3PA 4IIMA 2K3BA 1NEBA 3IQLA 1PRMC 2DA9A 5I22A 2DL8A 1UFFA 4LUDA 2EYWA 2ESWA 1FYNA 4D8DA 3I35A 2GTOA 1S1NA 1BK2A 2EYZA 4RTTA 4A63B 2K9GA 2BZXA 4AFSC 2F2XA 3CQTA 2DBMA 1W70A 1ZUUA 3EHRA 2C0TA 1Z9ZA 1RI9A 2EYYA 1M3BA 2IIMA 4R0KA 1WXTA 2AZVA 1H92A 1YWOA 2MOXA 2MCNA 4ESRA 1X6BA 4Y92A 4DEXA 1QLYA 3M0UA 4M4ZA 2F2WA 1OV3A 2BZ8A 1OPKA 4OMQA 4CC3A 1BBZA 3NMZC 2DMOA 1K76A 2A36A 2CH4W 4QT7A 4GBQA 3VS6A 3M0TA 1W6XA 4F17A 4AFQC 2DVJA 1YP5A 2FPDA 3SHWA 1WA7A 1AOJA 1Y57A 2FO0A 1U5SA 1ABOA 1I0CA 2KXCA 5I11A 2OAWA 5EC7A 1VA7A 1OPLA 5FWCA 2YDLA 1GBRA 3FJ5A 2GBQA 1AWXA 2CSIA 1SHGA 4J9HA 4CC7A 1QWFA 2LJ0A 1W1FA 2M51A 2JW4A 1I1JA 2KRMA 3I9QA 2EBPA 3ULRB 4J9EA 5FWBA 2A37A 2KBTA 4AG2C 1IO6A 2DRKA 2HBWA 2K79A 3VS4A 2D0NA 1G2BA 1GFDA 4OMPA 1MUZA 1T0HA 2CUBA 1ZX6A 1QKXA 2MIOA 2EQIA 5IHKA 1QKWA 1X27A 1V1CA 2DE0X 1T3LA 1ZBJA 2GNCA 3GBQA 3M0PA 1M27C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LZ6 B;  4J9C A;  1K0X A;  2AKK A;  1AWW A;  1NEG A;  1K4U S;  1SPK A;  2RQT A;  2L0A A;  2I0N A;  3EG3 A;  3EG0 A;  1AD5 A;  2RQR A;  4JJD A;  3M0Q A;  2DM1 A;  1WDX A;  2JS0 A;  3QWY A;  1CKB A;  2W0Z A;  2ROT A;  4HVW A;  1KSW A;  1MV3 A;  2KT1 A;  1PHT A;  2FRY A;  2FRW A;  3LH5 A;  2PNI A;  2CUD A;  1WXU A;  2YUO A;  2BTT A;  4Z89 A;  1M8M A;  1QCF A;  1VYT A;  2D8J A;  3EG1 A;  2HDA A;  2CH4 A;  4F16 A;  4OMO A;  2C0I A;  4RTY A;  3UA6 A;  1UJY A;  1RUW A;  2D8H A;  2KNB B;  1Z9Q A;  2CT3 A;  2J6O A;  4JZ4 A;  5FW9 A;  4FSS A;  3C0C A;  2JTE A;  2DIL A;  2RMO A;  1HSQ A;  2ECZ A;  3REB B;  1K9A A;  4E6R A;  2V1R A;  4J9D A;  3SEM A;  2OI3 A;  3EHQ A;  4J9I A;  2KYM A;  1KFZ A;  1UG1 A;  2L3S A;  2KR3 A;  2L3Q A;  2KRN A;  2JS2 A;  2CDT A;  4JJB A;  1UEC A;  2RQV A;  4AFU C;  2RNA A;  4LN2 A;  1UHF A;  1NLP C;  1ARK A;  2M0Y A;  3ZL7 C;  1E6H A;  2OJ2 A;  2ROL A;  2LX7 A;  1E6G A;  2AZS A;  4CC2 A;  3H41 A;  2K6D A;  1YWP A;  1VYV A;  3TSZ A;  3REA B;  1K0S A;  4X1V A;  2ED1 A;  2J6K A;  1N5Z A;  3QWX X;  1JO8 A;  2NUZ A;  2FPE A;  2EGC A;  4Z8A A;  3TVT A;  4DEY A;  2HSP A;  1PKS A;  1TUC A;  1TUD A;  1WYX A;  2DLP A;  1Y0M A;  1WXB A;  2KXD A;  2O9V A;  1WIE A;  3I5S A;  1SSH A;  1B3Q A;  1GRI A;  1NYG A;  1JU5 C;  2ABL A;  3UAT A;  2O9S A;  3I5R A;  2AK5 A;  1UE9 A;  4RTU A;  4RTZ A;  2VWF A;  2J6F A;  4JPB W;  4AG1 C;  4K11 A;  2GGR A;  2FG0 A;  2EVR A;  2LMJ A;  3VRY A;  4ORZ A;  1I07 A;  1NYF A;  2DJQ A;  1X2Q A;  2VVK A;  5GJW B;  1X69 A;  1VYU A;  2DF6 A;  4D8K A;  1RLP C;  1PWT A;  2YUQ A;  4HVV A;  2GQI A;  2KRO A;  1ZLM A;  1OOT A;  2FEI A;  1GCP A;  1WFW A;  4EIK A;  1MV0 B;  1GBQ A;  1PNJ A;  3VS0 A;  1LCK A;  2JM8 A;  2YUP A;  1BU1 A;  2ENM A;  3UA7 A;  1UUE A;  2C0O A;  3THK A;  4J9F A;  2SRC A;  2LJ1 A;  2W10 A;  1T3S A;  2J06 A;  2EKH A;  4KRT A;  5IHI A;  2J05 A;  1M30 A;  2NWM A;  2CRE A;  5GJV B;  1H8K A;  2CSQ A;  1AZG B;  3VS2 A;  2DL3 A;  2J7I A;  3NHN A;  1SHF A;  1NLO C;  2PZ1 A;  1U3O A;  1G83 A;  1UGV A;  4ZNX A;  2LCS A;  1ZUK A;  2LP5 A;  1CSK A;  3A98 A;  1AVZ C;  3VS1 A;  3H0H A;  4IIO A;  2RQU A;  1XOV A;  2RQW A;  3H0I A;  2O2O A;  1U06 A;  2X3W D;  2KEA A;  1AEY A;  2QDL A;  1ZSG A;  4Z88 A;  5ECA A;  2RF0 A;  2LJ3 A;  2JMA A;  2ED0 A;  1WX6 A;  2EPD A;  4J9G A;  4LE9 A;  1AWO A;  2KYB A;  2VKN A;  2B86 A;  3H0F A;  2O88 A;  1AWJ A;  1ZUY A;  4OML A;  2EGA A;  1YN8 A;  4OMM A;  2PTK A;  2JXB A;  1NG2 A;  2DBK A;  1OEB A;  2DX1 A;  2SEM A;  2H8H A;  2DYB A;  3RNJ A;  2E5K A;  2RPN A;  1HD3 A;  4J9B A;  1H3H A;  1EFN A;  2DL5 A;  1NM7 A;  1WI7 A;  4LNP A;  1T0J A;  3PVQ A;  2KGT A;  2RN8 A;  1ABQ A;  1SEM A;  2V1Q A;  4RUG A;  1GL5 A;  2EW3 A;  3EG2 A;  1X43 A;  3JV3 A;  1JEG A;  1X6G A;  2AKL A;  2G6F X;  3M0S A;  3VS7 A;  1UDL A;  1GCQ C;  3M0R A;  1YCS B;  2F2V A;  4F14 A;  1JXO A;  2KE9 A;  2K7A A;  2DRM A;  2YUN A;  3UF4 A;  4JJC A;  1PKT A;  2L2P A;  1UJ0 A;  1GCQ A;  1X2K A;  2DNU A;  2YT6 A;  4OMN A;  4GLM A;  2HCK A;  2YSQ A;  2D1X A;  2JT4 A;  4HVU A;  2A28 A;  1UHC A;  4WCI A;  1K1Z A;  1RLQ C;  1M3A A;  1WLP B;  4HCK A;  3VS5 A;  5HCK A;  4HXJ A;  1CKA A;  4LUE A;  5IH2 A;  2DL4 A;  4JZ3 A;  3VRZ A;  2XMF A;  2CT4 A;  2LQW A;  1KJW A;  1GFC A;  5IXB A;  4RTW A;  1TG0 A;  5IXF A;  5L23 A;  4RTX A;  1B07 A;  2K2M A;  4RTV A;  1A0N B;  3EGU A;  1M3C A;  2LNH B;  1AZE A;  2P4R A;  3O5Z A;  1BB9 A;  1PRL C;  2DL7 A;  1HJD A;  2A08 A;  3PVL A;  3RBB B;  3VS3 A;  3R6N A;  1UTI A;  2GTJ A;  1E7O A;  4AFZ C;  3KFV A;  2KRS A;  1YNZ A;  2X3X D;  1JQQ A;  3PE0 A;  2EYX A;  2EGE A;  3U23 A;  2HEQ A;  2JM9 A;  2KT8 A;  1QWE A;  1JXM A;  2BZY A;  3NGP A;  4CC4 B;  5IHN A;  2O31 A;  1FMK A;  1KIK A;  3TSW A;  2FPF A;  1J3T A;  1SRL A;  2JMC A;  1SRM A;  2LQN A;  3NPF A;  2L3P A;  4IIM A;  2K3B A;  1NEB A;  3IQL A;  1PRM C;  2DA9 A;  5I22 A;  2DL8 A;  1UFF A;  4LUD A;  2EYW A;  2ESW A;  1FYN A;  4D8D A;  3I35 A;  2GTO A;  1S1N A;  1BK2 A;  2EYZ A;  4RTT A;  4A63 B;  2K9G A;  2BZX A;  4AFS C;  2F2X A;  3CQT A;  2DBM A;  1W70 A;  1ZUU A;  3EHR A;  2C0T A;  1Z9Z A;  1RI9 A;  2EYY A;  1M3B A;  2IIM A;  4R0K A;  1WXT A;  2AZV A;  1H92 A;  1YWO A;  2MOX A;  2MCN A;  4ESR A;  1X6B A;  4Y92 A;  4DEX A;  1QLY A;  3M0U A;  4M4Z A;  2F2W A;  1OV3 A;  2BZ8 A;  1OPK A;  4OMQ A;  4CC3 A;  1BBZ A;  3NMZ C;  2DMO A;  1K76 A;  2A36 A;  2CH4 W;  4QT7 A;  4GBQ A;  3VS6 A;  3M0T A;  1W6X A;  4F17 A;  4AFQ C;  2DVJ A;  1YP5 A;  2FPD A;  3SHW A;  1WA7 A;  1AOJ A;  1Y57 A;  2FO0 A;  1U5S A;  1ABO A;  1I0C A;  2KXC A;  5I11 A;  2OAW A;  5EC7 A;  1VA7 A;  1OPL A;  5FWC A;  2YDL A;  1GBR A;  3FJ5 A;  2GBQ A;  1AWX A;  2CSI A;  1SHG A;  4J9H A;  4CC7 A;  1QWF A;  2LJ0 A;  1W1F A;  2M51 A;  2JW4 A;  1I1J A;  2KRM A;  3I9Q A;  2EBP A;  3ULR B;  4J9E A;  5FWB A;  2A37 A;  2KBT A;  4AG2 C;  1IO6 A;  2DRK A;  2HBW A;  2K79 A;  3VS4 A;  2D0N A;  1G2B A;  1GFD A;  4OMP A;  1MUZ A;  1T0H A;  2CUB A;  1ZX6 A;  1QKX A;  2MIO A;  2EQI A;  5IHK A;  1QKW A;  1X27 A;  1V1C A;  2DE0 X;  1T3L A;  1ZBJ A;  2GNC A;  3GBQ A;  3M0P A;  1M27 C; 
#chains in the Genus database with same CATH topology
 2E10 A;  1KD1 C;  1K0X A;  2LQK A;  1AWW A;  1SPK A;  4KH0 B;  2RQT A;  3EGD B;  5LJ3 j;  2E64 A;  3WXM B;  4E7L A;  5C0M A;  1I5O B;  5CK9 A;  3M0Q A;  1WDX A;  2QYZ A;  1KC8 U;  3I56 T;  1XTD A;  1KSW A;  5GMK j;  5GAN 6;  1NJI C;  1C0M A;  2FRY A;  4LDW A;  2M02 A;  1VQM Q;  2PNI A;  3G4S Q;  5GAM f;  4P5N A;  4PJJ A;  1WXU A;  2P84 A;  4BAC A;  3NTK A;  5KYY A;  4KUL A;  2D8J A;  3QSU A;  2HDA A;  3A8L B;  2QQR A;  3G1J A;  5I2S A;  4N4G A;  5GAO n;  4RTY A;  3G6E Q;  1UJY A;  3FB9 A;  1Z9Q A;  3OYY A;  5LJ3 f;  3V7S A;  5A0D A;  5FW9 A;  1JBM A;  2CP6 A;  1IXD A;  4QVC A;  3VJP A;  5DM7 R;  2DIL A;  2RMO A;  1YJW A;  4PFP A;  4BD3 A;  1YIT A;  3DLM A;  1TS9 A;  2ECZ A;  4E6R A;  2A0F B;  1RAG B;  1K73 C;  4J9D A;  2JZ2 A;  3V7C A;  4C8Q D;  2KYM A;  4M7D E;  5A2Q E;  3ER0 A;  1UG1 A;  2L3S A;  1LPL A;  2KR3 A;  2L3Q A;  4QQG A;  2CDT A;  2RQV A;  4AFU C;  3VYG A;  2RNA A;  1YJ9 T;  2RH2 A;  1UHF A;  3JB9 H;  8AT1 B;  1ARK A;  1RAI B;  3CMA A;  2K5F A;  3VUZ A;  2V8J A;  4CC2 A;  1MHN A;  3TSZ A;  3HRT A;  4DBH A;  3N5B B;  4OGE A;  1JO8 A;  5GAO q;  4DEY A;  2HSP A;  1TUD A;  1WYX A;  1I4K 1;  1D0Z A;  4PJO D;  4MML A;  2O9V A;  4XAX B;  5GAO m;  3PT9 A;  1GRI A;  1NYG A;  1MMD A;  1JU5 C;  2FZC B;  1Q86 R;  2P0P A;  3L2Q A;  5KYY B;  1V29 B;  4OB1 B;  2L3R A;  2ZPH B;  4C92 A;  4RTZ A;  2VWF A;  4J8O A;  4JPB W;  2EVR A;  4PKC C;  2HL5 C;  3VRY A;  4ORZ A;  4F7U A;  2DTI A;  3JCM P;  5GJW B;  4BE2 A;  4D8K A;  3LWI A;  3BE3 A;  4FM4 B;  3C94 A;  4HVV A;  2GQI A;  3TEE A;  4NS5 A;  1GCP A;  2FL7 A;  2RHX A;  1D0X A;  3VS0 A;  5GAN 2;  1MMG A;  1WHM A;  3G71 A;  2C0O A;  4PFO A;  2DAQ A;  2SRC A;  3OYI A;  1YI2 Q;  4RCC A;  2J05 A;  2NWM A;  4M77 E;  2HQX A;  2CRE A;  4BI4 A;  3L2V A;  3HFO A;  1PD0 A;  4J6X A;  2DL3 A;  1UEB A;  2J7I A;  1S72 A;  3L2W A;  1JB0 E;  3NHN A;  1SHF A;  1U3O A;  4ZNX A;  3J7A F;  2LCS A;  1ZUK A;  3E9F A;  1RI0 A;  4ATO A;  1OZ2 A;  4C92 F;  3H0H A;  4M75 C;  4IIO A;  4Q5W A;  2RQU A;  5KYW A;  4DBR A;  4F7U F;  2RK2 A;  3OYG A;  3HP9 A;  3OS2 A;  2EQU A;  1AEY A;  1G3S A;  4M78 D;  3C12 A;  2VUB A;  1RAB B;  3OYN A;  2Y4Y A;  1Q7Y C;  2Y4X A;  3TU4 K;  4VUB A;  1VUB A;  2RF0 A;  3CCS Q;  2VXE A;  3H0F A;  4FU6 A;  4A4F A;  3UDC A;  3JCM g;  2VYT A;  1VQ9 A;  5CKF A;  4C0G A;  2RI2 A;  3CC2 Q;  2LRQ A;  2DYB A;  1Y96 B;  3CCU A;  2RPN A;  2LC4 A;  3OBY A;  1M9S A;  2PVO B;  1NM7 A;  2K5L A;  2Y90 A;  5CKH A;  4LNP A;  3M56 A;  1T0J A;  3PVQ A;  1VQL Q;  1M5Q 1;  4RG2 A;  3FJP A;  2V1Q A;  4QQ6 A;  1U8R A;  1TTH B;  3HKS A;  3UWN A;  3VS7 A;  2ATC B;  3A8M B;  1YHQ A;  3I56 Q;  1YCS B;  2KE9 A;  1H64 1;  4JJC A;  1PKT A;  3OSV A;  1YJN A;  4PJL A;  2YT6 A;  4A4G A;  2KQW A;  3MEV A;  2YSQ A;  1JJ2 A;  2D1X A;  1K8A R;  3CC7 T;  1KHC A;  2PUK B;  1N27 A;  3MP8 A;  4HT9 A;  1M1K R;  1UHC A;  2BE7 D;  1K1Z A;  1IZ6 A;  4RCB A;  5GMK i;  1X75 C;  1VQK Q;  4N0A C;  4AMC A;  5AYF A;  1FWZ A;  2GQV A;  2DL4 A;  1VQP Q;  2CT4 A;  1OQK A;  3CCL A;  2KMT A;  1TG0 A;  1G3T A;  2DEU A;  5CAI A;  4EMK B;  3OBW A;  1BIA A;  1A0N B;  1AZE A;  4PLI A;  2JJ9 A;  1BCM A;  3L2U A;  2EFI A;  2A08 A;  3PVL A;  4DQ2 A;  3KFV A;  1JQQ A;  3PE0 A;  1HXD A;  1VOM A;  1QWE A;  1BYM A;  3NGP A;  2O31 A;  1YIJ A;  5KYN A;  1SRM A;  2CZ0 B;  3NFC A;  2L3P A;  1VQN T;  3CPW P;  2DA9 A;  2QA4 Q;  4KUI A;  1FYN A;  4XU1 A;  2RK1 A;  5FU7 B;  4E7H A;  2QEX Q;  5C6S A;  2HZY A;  1WGS A;  2BZX A;  3CCM A;  1YCY A;  3CQT A;  3LH0 A;  3M57 A;  4A4E A;  3CC4 A;  2X51 A;  6AT1 B;  3MP1 A;  1RI9 A;  2EYY A;  3HHT B;  2IIM A;  3E2U A;  2AZV A;  5KCH A;  2OTL Q;  2MOX A;  2MCN A;  4Y92 A;  3LWH A;  4DEX A;  1YJW T;  2F2W A;  4DBF A;  1YIT T;  2MWO A;  1OV3 A;  2BZ8 A;  1RAH B;  4OMQ A;  3NMZ C;  1D1C A;  2DMO A;  2CH4 W;  5GAN 5;  3LGL A;  2GFA A;  2GCX A;  4GBQ A;  3V8K A;  3QJ6 A;  3CCJ A;  4AFQ C;  2JVV A;  1N6A A;  3R6O A;  3SHW A;  1TU0 B;  2L8D A;  1I5L A;  5GAN 8;  3CXC A;  2RJE A;  1WJS A;  4M7D B;  1EIF A;  4M75 F;  2KXC A;  4C8Q A;  1OPL A;  2CP7 A;  2CSI A;  2LJ0 A;  1OI1 A;  3LGF A;  2M51 A;  2P4T A;  3EGX B;  1VQO Q;  4IUQ A;  4Z02 A;  3OW2 S;  3I9Q A;  2WSE E;  4M75 G;  2EBP A;  3A1P A;  1WPY A;  4J9E A;  5FWB A;  2A37 A;  2KBT A;  3MEA A;  1N9S A;  2DRK A;  2JUF A;  2EKO A;  2D0N A;  4EMG A;  3V7R A;  3GPL A;  1MUZ A;  1MNE A;  2XDB A;  2LCC A;  3L42 A;  1OU8 A;  3OW2 A;  4HCB A;  1ZX6 A;  4DOV A;  1Q81 U;  2MIO A;  1PG5 B;  5GAO l;  5IHK A;  1M90 U;  1X27 A;  1T3L A;  3GBQ A;  4MZM A;  4PJO A;  3M0P A;  2NYS A;  1B7T A;  2QK0 A;  1MMN A;  1XJW B;  2AKK A;  1NEG A;  2KI7 A;  2ZGW A;  5HY6 A;  2L0A A;  4JS4 A;  1VQ6 A;  3EG3 A;  4HCZ A;  2DIG A;  3EG0 A;  4PK4 A;  2FHD A;  3QXE B;  2RQR A;  2KAF A;  2JS0 A;  2PVG B;  2VXF A;  1PC0 A;  1VQ5 Q;  3M4G A;  1TWB A;  5CVI A;  1PHT A;  3CD6 A;  2FRW A;  3G71 T;  3LH5 A;  3HSB A;  4N4H A;  5DLO A;  3PTA A;  1N8R R;  3OYM A;  1VYT A;  4RMO A;  5M9O A;  4BE0 A;  4C8Q B;  3JB9 F;  2F5T X;  2CT3 A;  5IN1 A;  1Q82 R;  2J6O A;  4FSS A;  5HK0 A;  4O5V A;  4XU3 A;  2JOY A;  3PIO A;  1KQ2 A;  3BW1 A;  2V1R A;  3ZEH A;  3VYH B;  2H3E B;  3GLX A;  3JB9 G;  2DO3 A;  3SEM A;  3HRS A;  5CQY A;  4J9I A;  3EGD A;  1KFZ A;  4JLI A;  2CP3 A;  2KRN A;  5GMK m;  5LJ5 e;  1UEC A;  4XTW A;  2LTO A;  3OQ5 A;  1NLP C;  3ZL7 C;  1E6H A;  3I55 T;  4B9W A;  4ZTJ A;  1E6G A;  1G3W A;  4M78 A;  2KSS A;  1K0S A;  3GIB A;  3MKD A;  2ED1 A;  2J6K A;  1O9S A;  5LJ5 j;  2FPE A;  1MMA A;  2EGC A;  3CCU T;  4Z8A A;  1KK7 A;  3M58 A;  3A8G B;  1LOJ A;  2YXY A;  5CKB A;  1SSF A;  2RJD A;  5GAM e;  2X4Y A;  2KXD A;  1WIE A;  1VQN Q;  2XHC A;  2X4X A;  3QG1 A;  1B3Q A;  1KQS S;  2ABL A;  1O75 A;  4OGC A;  3UAT A;  4FSX A;  1EX4 A;  1YHQ T;  2O9S A;  3EG9 B;  3I5R A;  2YWW A;  2CZ6 B;  5GAN 4;  4J6Y A;  2E3I A;  3QJY A;  1G5V A;  1QQJ A;  4E7Z A;  2J6F A;  1Q86 C;  1QMC A;  2LMJ A;  1KQS A;  5GAM j;  4XU2 A;  2DJQ A;  1QW1 A;  1KC8 R;  5LJ5 f;  5FRM A;  1X69 A;  2OX7 A;  1OX8 A;  1DJ7 B;  1SKU B;  1RLP C;  1PWT A;  2COZ A;  2YLB A;  1WHL A;  1Y71 A;  2FEI A;  2PQW A;  4EIK A;  1MV0 B;  1GBQ A;  1LCK A;  3EH2 A;  2JM8 A;  4M7A G;  3CCV Q;  3TRE A;  2RHZ A;  3RKW A;  2HBP A;  3CCL T;  3CCR Q;  2EKH A;  1KQ1 A;  2HMA A;  4PL6 A;  3DB3 A;  4C5G A;  4WTO B;  4E7J A;  1H8K A;  4M78 B;  4X9D A;  3GF5 A;  2CSQ A;  4ME7 A;  1M2V B;  1PSE A;  2X35 A;  3C4S A;  1WQ7 A;  2MWP A;  3JCM c;  2LP5 A;  3A98 A;  1WZO A;  1AVZ C;  3VS1 A;  2D6F A;  3UPU A;  1XOV A;  2EYQ A;  1YIJ T;  2FZG B;  2H3J A;  3LX7 A;  1ZSG A;  2OTJ Q;  4Z88 A;  4EMK C;  2P0Q A;  2EPD A;  4LE9 A;  2KYB A;  2NLU A;  4FT2 A;  1ZUY A;  2EGA A;  2XDP A;  4BDY A;  2VV5 A;  4OMM A;  3CCM T;  4M77 D;  2RI3 A;  1W2B S;  3CC4 T;  3OYE A;  3PNW C;  1FMV A;  2DX1 A;  2H8H A;  2ZPI B;  3RNJ A;  4J9B A;  1VQM A;  1EFN A;  4DBQ A;  1WI7 A;  1F1B B;  2ZPG B;  4XK8 E;  3G4S A;  2ZPF B;  4RUG A;  3QPH A;  5GAN d;  1GL5 A;  2DER A;  2EW3 A;  4V2S A;  3TQ7 P;  1JEG A;  3CCE Q;  2G6F X;  4MDX A;  5FU7 C;  3G6E A;  5GAN g;  4FIB A;  1JJ2 P;  4F14 A;  4M75 E;  3OYA A;  3UF4 A;  4JRP A;  3CCJ T;  3C95 A;  1GCQ A;  3RER A;  2YHT A;  1AHJ B;  1K9M U;  4GLM A;  3M55 A;  2JT4 A;  2A7Y A;  5CKE A;  2O4X B;  1QP3 A;  2DXU A;  3OYK A;  2XK0 A;  1VQ8 T;  4WCI A;  3QDF A;  3RMS A;  1K8A C;  1WLP B;  1VIE A;  1M1K C;  3M5A A;  1Y96 A;  4HA8 A;  3VRZ A;  2LQW A;  1GFC A;  2DTO A;  4KGX B;  3RIR A;  5IXF A;  5L23 A;  4O6J A;  1B07 A;  2K2M A;  2Z0W A;  3JCM h;  1M3C A;  1WJR A;  2LNH B;  2B8A A;  2P4R A;  3O5Z A;  1TH7 A;  3NTI A;  4FW1 A;  5GAN 3;  4M7D C;  3CCQ T;  2PU9 B;  4FT4 A;  3RBB B;  1E7O A;  4AFZ C;  2KRS A;  3CME A;  2X3X D;  3I55 Q;  1ZQ1 A;  3U23 A;  2D9T A;  5L8R E;  4JJN K;  1KIK A;  4CC4 B;  1FMK A;  5CO7 A;  3TSW A;  2FPF A;  3V8J A;  1SRL A;  1KD1 U;  2CZ1 B;  2LQN A;  1HK9 A;  1MND A;  3NPF A;  5FRN A;  1VQ7 T;  4OB0 B;  2WAC A;  4IIM A;  3DKM A;  2K3B A;  4ANJ A;  1VQ6 T;  3MCA B;  1WHK A;  5I22 A;  2OAU A;  4MZT A;  2EYW A;  2ESW A;  2K2V A;  1OX9 A;  3CD6 T;  1S1N A;  4RTT A;  4M7A D;  3ME9 A;  2DTH A;  1NJI U;  4IUP A;  4C92 G;  3JCM d;  1G8X A;  1LJO A;  4BY6 B;  2MK5 A;  4EPC A;  1M4Z A;  1W70 A;  1ZUU A;  4EMK A;  4F7U G;  1VQ4 Q;  2X4W A;  3NTH A;  1Y7X A;  4R0K A;  1H92 A;  1XNI A;  4J7I A;  4ESR A;  1YI2 A;  1QLY A;  2G3R A;  3M0U A;  1RAF B;  2R5A A;  1OPK A;  3FDR A;  3SB2 A;  1QVG S;  1SF9 A;  4FCY A;  2AT1 B;  3BDL A;  3JCM Q;  1K73 U;  3CXC P;  2DVJ A;  3MEW A;  3VV0 A;  3KBG A;  1RAE B;  1WA7 A;  5D6Y A;  3JAM E;  4C8Q C;  4CI0 C;  1U5S A;  1QVG A;  1EZZ B;  1ABO A;  1I0C A;  3QII A;  5GMK l;  3X20 B;  2YRD A;  4BI8 B;  3SWN A;  2GFU A;  1I8F A;  1VA7 A;  3OYJ A;  2HL3 A;  3FJ5 A;  1AWX A;  4J9H A;  1QWF A;  2AIR B;  2LQ8 A;  1G3Y A;  1I1J A;  3CCS A;  4FL6 A;  1UGR B;  2KRM A;  5FLX E;  2K5I A;  4BUG A;  3ULR B;  4AG2 C;  1QP2 A;  3OW2 P;  2QAS A;  1IO6 A;  2QGG A;  4NOY A;  3OB9 A;  2M0O A;  1BKB A;  2K57 A;  3CC2 A;  1C1A A;  4M7A E;  2QQA A;  1G2B A;  4Y28 E;  1GFD A;  4PJO C;  3FLG A;  2CUB A;  4IUT A;  1YFN A;  1VIF A;  4FYV B;  2LDM A;  1VQL A;  5DY9 A;  1V1C A;  2DE0 X;  2GNC A;  4FYY B;  2QG9 B;  4BB7 A;  4PLL A;  3OMG A;  2LZ6 B;  1YJ9 Q;  3SDZ A;  4J9C A;  5A0G A;  1K4U S;  2IG0 A;  3I56 A;  3RKX A;  4E7I A;  2BE9 B;  2I0N A;  4M7D A;  4XU0 A;  1P92 A;  2EIF A;  4R55 A;  2DM1 A;  3P8B B;  2E6N A;  3QWY A;  1CKB A;  2W0Z A;  2NUT B;  4XTY A;  2KT1 A;  3BDU A;  2MPX C;  2CUD A;  4GLK A;  3EGX A;  1ZHI A;  4L6V 5;  3SD4 A;  4Z89 A;  1M8M A;  1QCF A;  4FYW B;  3EG1 A;  4ZN1 A;  2CH4 A;  1JRI A;  4IUR A;  4F16 A;  1H3Z A;  3X24 B;  4NL2 A;  3SWN B;  3JCM W;  1VQK A;  1N8R C;  1RUW A;  4AT1 B;  3O8V A;  2VGN A;  1VQP A;  4E7K A;  4JZ4 A;  5LL6 S;  9ATC B;  3H8Z A;  1D3B A;  4R56 A;  2JTE A;  2MF2 A;  3TCJ A;  1VQ8 Q;  2CS7 A;  3REB B;  1Q82 C;  2OI3 A;  3EHQ A;  1NZ9 A;  2KY9 A;  1ZSZ B;  2RJF A;  5LJ3 h;  4M7D F;  1Q7Y U;  5LJ5 g;  4M78 C;  4GY5 A;  2DD4 A;  3RR6 A;  3L2Z A;  3VKI A;  4BE1 A;  4LN2 A;  2BIV A;  1IB8 A;  2CZ7 B;  2OJ2 A;  4C5E A;  2ROL A;  5GMK h;  2LX7 A;  3CCQ Q;  4C92 D;  2KVQ G;  3H41 A;  1IGQ A;  4OMF B;  3REA B;  2QA4 A;  5GAN 7;  4KBM B;  3CMA T;  4LXC A;  2RI5 A;  3RUX A;  1NBE B;  1TUC A;  3EFO A;  2DLP A;  1VQM T;  5CR2 A;  2QEX A;  4B6M A;  3G4S T;  3WVE B;  2V8I A;  1IRE B;  3D7S B;  1VQ7 Q;  1Q81 R;  2RA2 A;  2CP2 A;  2M16 A;  3I5S A;  1M90 R;  1SSH A;  1OYX A;  4OB2 B;  2DXB A;  1AT1 B;  3A8O B;  5GAM g;  2WSF E;  3PMT A;  4M77 A;  4XTV A;  3LYI A;  3G6E T;  3S3O A;  2E1H A;  1KQS P;  1TUG B;  5LJ3 d;  2OTL A;  3PFS A;  4LDX A;  1M1F A;  4RTU A;  4AG1 C;  2LVM A;  2GGR A;  3J81 E;  3JCM f;  1WNL A;  5LJ3 g;  1I07 A;  2VVK A;  1D3B B;  2L89 A;  1IHW A;  3OYB A;  2COW A;  4C5H A;  1ZLM A;  1OOT A;  5I2M A;  1KC8 C;  1LVK A;  4PNO A;  1WFW A;  4PFZ A;  1V76 A;  4PJN A;  1PNJ A;  3FC3 A;  4C0F A;  2DZ9 A;  3JRZ A;  2L5Q A;  2FVU A;  2RD1 A;  1BU1 A;  1D1B A;  2ENM A;  4QQD A;  4J9F A;  2HAX A;  3CBO A;  2LJ1 A;  2W10 A;  1T3S A;  5KYU A;  1QVF S;  4C8Q F;  2J06 A;  1NPP A;  2PVD B;  4E47 A;  4XTU A;  1RAA B;  2MAM A;  2CYZ B;  3X28 B;  1M30 A;  5GJV B;  3VS2 A;  3RES A;  4BI3 A;  3EG9 A;  1VQO A;  2RHY A;  3M4Y A;  4C92 E;  2PZ1 A;  1QVF A;  3CME T;  3CPW S;  1Y07 A;  4QVD A;  4C8Q G;  3EFO B;  2QDY B;  4YTL A;  4F7U E;  3CC7 Q;  1S72 T;  2DJZ A;  1U06 A;  1UGS B;  4IUV A;  5CQX A;  3KUF A;  3JSC A;  4M77 B;  2COY A;  3MJX A;  4N4I A;  2E4H A;  2QDL A;  3L2R A;  4PJO F;  5ECA A;  1WHH A;  2LJ3 A;  2JMA A;  4J6W A;  1WX6 A;  2X4J A;  3L1A A;  4J9G A;  1AWO A;  3OYC A;  2QTX A;  2MI6 A;  3QBY A;  3M9Q A;  1YN8 A;  5AT1 B;  2EWN A;  2PTK A;  3Q1J A;  3HRU A;  1RAD B;  1NG2 A;  3DB4 A;  2DBK A;  1BI2 A;  4PJO G;  2SEM A;  1VQ5 A;  1I81 A;  1VQ9 T;  2E5K A;  1H3H A;  2DEQ A;  1R77 A;  1M8V A;  2DL5 A;  1M2V A;  2RO0 A;  3OYL A;  2KGT A;  2RN8 A;  1ABQ A;  2E65 A;  1YI2 T;  2HKN A;  4E7S A;  5KYU B;  1X6G A;  3M0S A;  1GCQ C;  2R57 A;  1PSF A;  2F2V A;  4Y91 A;  4BY6 C;  3M54 A;  2LCL A;  2ZZD A;  2K7A A;  2YRC A;  2DRM A;  2YUN A;  2L2P A;  5IAY A;  3GNF B;  2DNU A;  3OS1 A;  5CIU A;  4HVU A;  5KH6 A;  5HKC A;  3LLR A;  3X26 B;  1YJN T;  2CP0 A;  4FYX B;  1M3A A;  3X25 B;  4A54 A;  3FRN A;  2DVE A;  4HXJ A;  1CKA A;  3INZ A;  5IH2 A;  2DZC A;  4JZ3 A;  3M59 A;  2XMF A;  3CCS T;  1KJW A;  3AHU A;  4JS5 A;  1IRX A;  4M78 F;  4RTX A;  1YJW Q;  1YIT Q;  4RTV A;  2DD5 A;  4L5G A;  2VAS A;  1GXI E;  3OY9 A;  1BB9 A;  4M75 D;  2ZPE B;  2DL7 A;  2V8K A;  2RJC A;  3R6N A;  1UTI A;  2DIQ A;  4JLG A;  4ELY C;  1YNZ A;  3PMI A;  4M78 G;  2EYX A;  1VQL T;  3EFS A;  2EGE A;  3BY7 A;  2KK4 A;  1VQN A;  2FZK B;  5EG2 A;  4M7A B;  1JXM A;  2BZY A;  5IHN A;  2AHJ B;  3OYH A;  4XQ3 A;  3CMA Q;  2R5M A;  2O4X A;  2RM4 A;  3EFR A;  3CBP A;  4ZTF A;  1NEB A;  1PRM C;  1BI0 A;  2JTM A;  5GAN h;  3E9G A;  1N9R A;  2DET A;  1IGU A;  2NUP B;  1FXX A;  1ACM B;  3VU3 C;  4DA4 A;  1BK2 A;  2QTV A;  1OUL A;  3QHS A;  3VUB A;  4KGZ B;  3E1S A;  2F2X A;  2DBM A;  2C0T A;  1Z9Z A;  2JN0 A;  2LX9 A;  1VQK T;  1WXT A;  3LW5 E;  2QQB A;  3CCV A;  1VQP T;  1LNX A;  4ZGD B;  3CCR A;  1X6B A;  3OSS C;  1BI3 A;  1QVP A;  3QUI A;  4J7F A;  4M4Z A;  2DKG A;  2EQJ A;  2QAZ A;  3BFM A;  1K9M R;  4CC3 A;  1BBZ A;  1FX7 A;  1K76 A;  4EMH A;  1W2B A;  4F17 A;  2WSC E;  1QVG P;  1NPR A;  5KYX B;  2CP5 A;  3SWN C;  5IT9 E;  3JB9 D;  3JCM X;  3MP6 A;  3G71 Q;  3JB9 I;  2JTF A;  1U1T A;  2O01 E;  5HK3 A;  2EJ9 A;  2OAW A;  5EC7 A;  3ZBD A;  2OTJ A;  5FWC A;  1UGQ B;  2QQS A;  2QA4 T;  3CME Q;  1ZA2 B;  4CC7 A;  4OP0 A;  1W1F A;  2F69 A;  1R0B G;  2DYI A;  4E2F B;  2JW4 A;  1S72 Q;  4HCC A;  3CBM A;  5KCO A;  1X6O A;  2QEX T;  2FB7 A;  4ZN3 A;  1TOV A;  1ZSZ C;  4MMK A;  2VC8 A;  3URG A;  2E3H A;  2K79 A;  3VS4 A;  3OS5 A;  4MDW A;  3PGG A;  4OMP A;  5FU6 B;  1KD1 R;  2OTL T;  1QKX A;  4JRK A;  3ASK A;  2EQI A;  1QKW A;  1Q86 U;  4UC4 A;  2CGH A;  3CCE A;  2IVW A;  2E6Z A;  2K4Y A;  1VQ9 Q;  4KH1 B;  1NJI R;  5FRO A;  4II1 A;  4RKU E;  1AD5 A;  4C8Q E;  1R0C B;  4JJD A;  3OS0 A;  4LDU A;  2XU8 A;  2ROT A;  4HVW A;  3CCU Q;  1MV3 A;  3MET A;  2YUO A;  2BTT A;  2QQ9 A;  1TXQ A;  2GF7 A;  4C0D B;  4A4K A;  2HKQ B;  4QKU A;  3M53 A;  2C0I A;  4OMO A;  3UA6 A;  1YHQ Q;  2D8H A;  2KNB B;  1VQO T;  1X01 A;  2P0K A;  1K73 R;  4CRI A;  3C0C A;  1W4S A;  1YJN Q;  2HSE B;  4PJO E;  2E12 A;  1HSQ A;  2DFU A;  1K9A A;  3MPU B;  1KHI A;  4C92 B;  1B34 A;  5I21 A;  4OF1 A;  3QZ9 B;  2XI9 A;  1BCO A;  4ELZ C;  1RL2 A;  4F7U B;  3I55 A;  2JS2 A;  3T9N A;  4JJB A;  8ATC B;  3GP8 A;  1MGQ A;  2NUT A;  3DLL A;  2M0Y A;  3CCL Q;  3G7Z A;  1ZA1 B;  4LD6 A;  3S3N A;  2AZS A;  2K6D A;  1YWP A;  1VYV A;  4C0Z A;  2QI2 A;  4X1V A;  3QWX X;  1N5Z A;  2XIC A;  3FIF A;  3MO8 A;  2NUZ A;  1OZ3 A;  1VQ5 T;  1ZBX A;  3TVT A;  1PKS A;  4M77 C;  1JJ2 S;  1Y0M A;  5J39 A;  5GAN e;  2X9H A;  2HQE A;  1WXB A;  3JCM V;  2ZAE A;  4X9C A;  4B9X A;  1YIJ Q;  1VQ4 A;  3AT1 B;  1Q81 C;  2AK5 A;  1M90 C;  1UE9 A;  4K11 A;  2FG0 A;  5GAN j;  1ZSZ A;  5KYW B;  1M1G A;  1NYF A;  1X2Q A;  4C5I A;  3EH1 A;  1VYU A;  2DF6 A;  1UB4 A;  2YUQ A;  3F70 A;  3KXT A;  3CCM Q;  2KRO A;  3PIP A;  3OYD A;  4M78 E;  1B34 B;  3CC4 Q;  2LT1 A;  2LT4 A;  2QXF A;  1D1A A;  2F1L A;  5J3B A;  4A53 A;  1K8A U;  2ZPB B;  4RG8 A;  2K3Y A;  2YUP A;  3UA7 A;  1UUE A;  1HYO A;  4J5Y A;  3THK A;  2MYS A;  1M1K U;  5D6W A;  5LJ5 h;  2IPO B;  1TSF A;  1UGP B;  4KRT A;  2XD0 A;  2PUO B;  5IHI A;  5GAN f;  2QGF B;  1QVF P;  4KT0 E;  1IHV A;  3S6W A;  3V8L A;  4L59 A;  1AZG B;  2RB6 A;  5J26 A;  2XID A;  1NLO C;  3CCJ Q;  1G83 A;  1UGV A;  1D0Y A;  5KE2 A;  1PCX A;  1CSK A;  2RQW A;  2DK3 A;  2O2O A;  3H0I A;  3ZFJ A;  1Q7Y R;  1FMW A;  2X3W D;  2XKO C;  2KEA A;  3JCM b;  5GAM h;  4M75 A;  5GAO p;  1QCO A;  3CEY A;  5LJ5 d;  2EJF A;  1YJ9 A;  2ED0 A;  3JCM e;  2VKN A;  2B86 A;  2O88 A;  1AWJ A;  4IUU A;  4OML A;  3JCM J;  2E5Q A;  2EAY A;  3CPF A;  2JXB A;  1KG1 A;  4M7A C;  1OEB A;  2M1H A;  4WF2 A;  2RHI A;  2JNG A;  1HD3 A;  3SFM A;  3CCV T;  3S3M A;  4M7D G;  2M9U A;  2EQM A;  3CXC S;  4JRI A;  1SEM A;  3CCR T;  3MEU A;  2BUD A;  3EG2 A;  2HQH A;  5GAM d;  4JUV A;  1X43 A;  3JV3 A;  4X34 A;  2AKL A;  3UT1 A;  1UDL A;  4HT8 A;  2RHU A;  3M0R A;  1VQ6 Q;  1JXO A;  4KGV B;  1NE8 A;  4PJM A;  2HD0 A;  1UJ0 A;  1X2K A;  2D0Q B;  4OMN A;  2HCK A;  1VQ8 A;  3GNG A;  3H6Z A;  4LDY A;  3CD6 Q;  2CKK A;  1RAC B;  3QO3 A;  1OU9 A;  3QZ5 B;  2EJG A;  5D6X A;  2A28 A;  4D6W A;  1RLQ C;  4HCK A;  3VS5 A;  5KE3 A;  2OTJ T;  5HCK A;  4MZP A;  5DLQ E;  4M75 B;  2EQK A;  2A3L A;  4BDZ A;  4LUE A;  2DXC A;  1PD1 A;  2VB6 A;  4JRQ A;  3MHX A;  3A8H B;  5IXB A;  2HNI A;  4RTW A;  2R58 A;  4N0A A;  3CCQ A;  3HPW A;  3RMQ A;  1D09 B;  3EGU A;  1PRL C;  1HJD A;  3VS3 A;  2XDD A;  2GTJ A;  4J83 A;  2YRV A;  4TVR A;  2LNV A;  1VQ7 A;  2HEQ A;  2JM9 A;  1M2O A;  4M77 F;  2KT8 A;  1J3T A;  3CCE T;  2JMC A;  4LDV A;  2DPP B;  4HKE A;  2MMP A;  3IQL A;  2BKD N;  2DL8 A;  1UFF A;  4LUD A;  4XTZ A;  3P8H A;  4D8D A;  4M77 G;  4FW2 A;  3I35 A;  3QYG B;  3QYH B;  5CKD A;  4KUD K;  3CPW A;  2GTO A;  2FYK A;  5FU6 C;  2EYZ A;  4A63 B;  3WVD B;  3E19 A;  3OA6 A;  3QDR B;  1WHG A;  4ZGE B;  2K9G A;  4XTX A;  4AFS C;  1U1S A;  3P8D A;  5D7U A;  3EHR A;  3HTR A;  2E41 A;  3FEO A;  1SG5 A;  1WQW A;  4IKF A;  3HL8 A;  1M3B A;  4DOW A;  3JB9 J;  1BIB A;  1YWO A;  3H9N A;  1N8R U;  7AT1 B;  4QVZ A;  1R8O B;  1W2B P;  3RDV A;  2I2L A;  1QCN A;  4M7A A;  2F5K A;  4OB3 B;  1Q82 U;  2E70 A;  2A36 A;  4QT7 A;  5A0L A;  5GAO r;  4F04 B;  3VS6 A;  3M0T A;  1W6X A;  2DXT A;  4NL3 A;  4PJO B;  2YLC A;  1C6V X;  1K9M C;  4EDU A;  4C0D C;  1YP5 A;  2FPD A;  2V26 A;  3OYF A;  4LD9 K;  3QKJ A;  3J80 E;  1AOJ A;  3OMC A;  3CC7 A;  1Y57 A;  2KDS A;  1XQH A;  2NUP A;  3GOX A;  2FO0 A;  3EAE A;  1WHJ A;  5I11 A;  1GBR A;  1WJQ A;  1PM3 A;  2YDL A;  3A5Z B;  2GBQ A;  1SHG A;  1YBY A;  1Q95 G;  4C92 C;  2ZCF B;  2C06 A;  3HFN A;  4OVA A;  1BI1 A;  4M7D D;  2K3X A;  4JDS A;  4QW2 A;  5CCA A;  2HBW A;  5LJ3 e;  2VGM A;  1VQ4 T;  2XG8 D;  1T0H A;  4M7A F;  4A4H A;  3CC2 T;  4ZGJ B;  5GMK e;  1ZBJ A;  5KYX A;  3RKY A;  1M27 C; 
#chains in the Genus database with same CATH homology
 2LZ6 B;  4J9C A;  1K0X A;  2AKK A;  1AWW A;  1NEG A;  1K4U S;  1SPK A;  2RQT A;  2L0A A;  2I0N A;  3EG3 A;  3EG0 A;  1AD5 A;  2RQR A;  4JJD A;  3M0Q A;  2DM1 A;  1WDX A;  2JS0 A;  3QWY A;  1CKB A;  2W0Z A;  2ROT A;  4HVW A;  1KSW A;  1MV3 A;  2KT1 A;  1PHT A;  2FRY A;  2FRW A;  3LH5 A;  2PNI A;  2CUD A;  1WXU A;  2YUO A;  2BTT A;  4Z89 A;  1M8M A;  1QCF A;  1VYT A;  2D8J A;  3EG1 A;  2HDA A;  2CH4 A;  4F16 A;  4OMO A;  2C0I A;  4RTY A;  3UA6 A;  1UJY A;  1RUW A;  2D8H A;  2KNB B;  1Z9Q A;  2CT3 A;  2J6O A;  4JZ4 A;  5FW9 A;  4FSS A;  3C0C A;  2JTE A;  2DIL A;  2RMO A;  1HSQ A;  2ECZ A;  3REB B;  1K9A A;  4E6R A;  2V1R A;  4J9D A;  3SEM A;  2OI3 A;  3EHQ A;  4J9I A;  2KYM A;  1KFZ A;  1UG1 A;  2L3S A;  2KR3 A;  2L3Q A;  2KRN A;  2JS2 A;  2CDT A;  4JJB A;  1UEC A;  2RQV A;  4AFU C;  2RNA A;  4LN2 A;  1UHF A;  1NLP C;  1ARK A;  2M0Y A;  3ZL7 C;  1E6H A;  2OJ2 A;  2ROL A;  2LX7 A;  1E6G A;  2AZS A;  4CC2 A;  3H41 A;  2K6D A;  1YWP A;  1VYV A;  3TSZ A;  3REA B;  1K0S A;  4X1V A;  2ED1 A;  2J6K A;  1N5Z A;  3QWX X;  1JO8 A;  2NUZ A;  2FPE A;  2EGC A;  4Z8A A;  3TVT A;  4DEY A;  2HSP A;  1PKS A;  1TUC A;  1TUD A;  1WYX A;  2DLP A;  1Y0M A;  1WXB A;  2KXD A;  2O9V A;  1WIE A;  3I5S A;  1SSH A;  1B3Q A;  1GRI A;  1NYG A;  1JU5 C;  2ABL A;  3UAT A;  2O9S A;  3I5R A;  2AK5 A;  1UE9 A;  4RTU A;  4RTZ A;  2VWF A;  2J6F A;  4JPB W;  4AG1 C;  4K11 A;  2GGR A;  2FG0 A;  2EVR A;  2LMJ A;  3VRY A;  4ORZ A;  1I07 A;  1NYF A;  2DJQ A;  1X2Q A;  2VVK A;  5GJW B;  1X69 A;  1VYU A;  2DF6 A;  4D8K A;  1RLP C;  1PWT A;  2YUQ A;  4HVV A;  2GQI A;  2KRO A;  1ZLM A;  1OOT A;  2FEI A;  1GCP A;  1WFW A;  4EIK A;  1MV0 B;  1GBQ A;  1PNJ A;  3VS0 A;  1LCK A;  2JM8 A;  2YUP A;  1BU1 A;  2ENM A;  3UA7 A;  1UUE A;  2C0O A;  3THK A;  4J9F A;  2SRC A;  2LJ1 A;  2W10 A;  1T3S A;  2J06 A;  2EKH A;  4KRT A;  5IHI A;  2J05 A;  1M30 A;  2NWM A;  2CRE A;  5GJV B;  1H8K A;  2CSQ A;  1AZG B;  3VS2 A;  2DL3 A;  2J7I A;  3NHN A;  1SHF A;  1NLO C;  2PZ1 A;  1U3O A;  1G83 A;  1UGV A;  4ZNX A;  2LCS A;  1ZUK A;  2LP5 A;  1CSK A;  3A98 A;  1AVZ C;  3VS1 A;  3H0H A;  4IIO A;  2RQU A;  1XOV A;  2RQW A;  3H0I A;  2O2O A;  1U06 A;  2X3W D;  2KEA A;  1AEY A;  2QDL A;  1ZSG A;  4Z88 A;  5ECA A;  2RF0 A;  2LJ3 A;  2JMA A;  2ED0 A;  1WX6 A;  2EPD A;  4J9G A;  4LE9 A;  1AWO A;  2KYB A;  2VKN A;  2B86 A;  3H0F A;  2O88 A;  1AWJ A;  1ZUY A;  4OML A;  2EGA A;  1YN8 A;  4OMM A;  2PTK A;  2JXB A;  1NG2 A;  2DBK A;  1OEB A;  2DX1 A;  2SEM A;  2H8H A;  2DYB A;  3RNJ A;  2E5K A;  2RPN A;  1HD3 A;  4J9B A;  1H3H A;  1EFN A;  2DL5 A;  1NM7 A;  1WI7 A;  4LNP A;  1T0J A;  3PVQ A;  2KGT A;  2RN8 A;  1ABQ A;  1SEM A;  2V1Q A;  4RUG A;  1GL5 A;  2EW3 A;  3EG2 A;  1X43 A;  3JV3 A;  1JEG A;  1X6G A;  2AKL A;  2G6F X;  3M0S A;  3VS7 A;  1UDL A;  1GCQ C;  3M0R A;  1YCS B;  2F2V A;  4F14 A;  1JXO A;  2KE9 A;  2K7A A;  2DRM A;  2YUN A;  3UF4 A;  4JJC A;  1PKT A;  2L2P A;  1UJ0 A;  1GCQ A;  1X2K A;  2DNU A;  2YT6 A;  4OMN A;  4GLM A;  2HCK A;  2YSQ A;  2D1X A;  2JT4 A;  4HVU A;  2A28 A;  1UHC A;  4WCI A;  1K1Z A;  1RLQ C;  1M3A A;  1WLP B;  4HCK A;  3VS5 A;  5HCK A;  4HXJ A;  1CKA A;  4LUE A;  5IH2 A;  2DL4 A;  4JZ3 A;  3VRZ A;  2XMF A;  2CT4 A;  2LQW A;  1KJW A;  1GFC A;  5IXB A;  4RTW A;  1TG0 A;  5IXF A;  5L23 A;  4RTX A;  1B07 A;  2K2M A;  4RTV A;  1A0N B;  3EGU A;  1M3C A;  2LNH B;  1AZE A;  2P4R A;  3O5Z A;  1BB9 A;  1PRL C;  2DL7 A;  1HJD A;  2A08 A;  3PVL A;  3RBB B;  3VS3 A;  3R6N A;  1UTI A;  2GTJ A;  1E7O A;  4AFZ C;  3KFV A;  2KRS A;  1YNZ A;  2X3X D;  1JQQ A;  3PE0 A;  2EYX A;  2EGE A;  3U23 A;  2HEQ A;  2JM9 A;  2KT8 A;  1QWE A;  1JXM A;  2BZY A;  3NGP A;  4CC4 B;  5IHN A;  2O31 A;  1FMK A;  1KIK A;  3TSW A;  2FPF A;  1J3T A;  1SRL A;  2JMC A;  1SRM A;  2LQN A;  3NPF A;  2L3P A;  4IIM A;  2K3B A;  1NEB A;  3IQL A;  1PRM C;  2DA9 A;  5I22 A;  2DL8 A;  1UFF A;  4LUD A;  2EYW A;  2ESW A;  1FYN A;  4D8D A;  3I35 A;  2GTO A;  1S1N A;  1BK2 A;  2EYZ A;  4RTT A;  4A63 B;  2K9G A;  2BZX A;  4AFS C;  2F2X A;  3CQT A;  2DBM A;  1W70 A;  1ZUU A;  3EHR A;  2C0T A;  1Z9Z A;  1RI9 A;  2EYY A;  1M3B A;  2IIM A;  4R0K A;  1WXT A;  2AZV A;  1H92 A;  1YWO A;  2MOX A;  2MCN A;  4ESR A;  1X6B A;  4Y92 A;  4DEX A;  1QLY A;  3M0U A;  4M4Z A;  2F2W A;  1OV3 A;  2BZ8 A;  1OPK A;  4OMQ A;  4CC3 A;  1BBZ A;  3NMZ C;  2DMO A;  1K76 A;  2A36 A;  2CH4 W;  4QT7 A;  4GBQ A;  3VS6 A;  3M0T A;  1W6X A;  4F17 A;  4AFQ C;  2DVJ A;  1YP5 A;  2FPD A;  3SHW A;  1WA7 A;  1AOJ A;  1Y57 A;  2FO0 A;  1U5S A;  1ABO A;  1I0C A;  2KXC A;  5I11 A;  2OAW A;  5EC7 A;  1VA7 A;  1OPL A;  5FWC A;  2YDL A;  1GBR A;  3FJ5 A;  2GBQ A;  1AWX A;  2CSI A;  1SHG A;  4J9H A;  4CC7 A;  1QWF A;  2LJ0 A;  1W1F A;  2M51 A;  2JW4 A;  1I1J A;  2KRM A;  3I9Q A;  2EBP A;  3ULR B;  4J9E A;  5FWB A;  2A37 A;  2KBT A;  4AG2 C;  1IO6 A;  2DRK A;  2HBW A;  2K79 A;  3VS4 A;  2D0N A;  1G2B A;  1GFD A;  4OMP A;  1MUZ A;  1T0H A;  2CUB A;  1ZX6 A;  1QKX A;  2MIO A;  2EQI A;  5IHK A;  1QKW A;  1X27 A;  1V1C A;  2DE0 X;  1T3L A;  1ZBJ A;  2GNC A;  3GBQ A;  3M0P A;  1M27 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...