2EKHA

Solution structures of the sh3 domain of human kiaa0418
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
80
structure length
80
Chain Sequence
GSSGSSGATSYMTCSAYQKVQDSEISFPAGVEVQVLEKQESGWWYVRFGELEGWAPSHYLVLDENEQPDPSGKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the SH3 domain of human KIAA0418
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords SH3 and PX domain-containing protein 2A
total genus 5
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ekhA00
2H8HA 1X27A 2GGRA 1NEBA 1QCFA 2HBWA 2L3SA 4Z88A 1YP5A 1AWXA 2F2XA 4Y92A 3SEMA 1T3LA 1NYGA 2YUOA 3M0UA 2M0YA 1LCKA 2LJ1A 4CC7A 3VS1A 1OPKA 1JXMA 2DNUA 1UJYA 4ORZA 3EHQA 2PTKA 1T3SA 4OMPA 2X3XD 3O5ZA 1KIKA 2DF6A 3EG3A 1A0NB 2DBKA 4LN2A 2ECZA 2K6DA 3M0PA 1VYUA 1NM7A 1RUWA 3EGUA 4JZ4A 4AFSC 3REAB 2EW3A 1K9AA 2A08A 1H92A 1N5ZA 2G6FX 2JM8A 1X6BA 1I1JA 1TG0A 3RNJA 2EGCA 2D0NA 2EBPA 4GLMA 3H41A 2CSQA 4DEYA 2EPDA 2C0TA 2K3BA 3NGPA 2ED1A 4E6RA 3NPFA 1X2KA 2MOXA 2RMOA 2DL5A 2VWFA 2F2WA 3VRYA 2KNBB 2YT6A 3C0CA 3EHRA 1VYTA 2CDTA 2EYYA 4D8KA 4AFQC 2HCKA 1GBQA 5GJWB 1RLQC 2BZXA 1GCQC 1HJDA 2RF0A 4RUGA 4HXJA 1Z9QA 2JW4A 2CH4W 4JPBW 2CUDA 1TUCA 3EG2A 1RLPC 2KXDA 2MIOA 2W10A 1Z9ZA 3H0FA 2HSPA 1VA7A 2C0OA 3JV3A 4RTZA 4LUEA 1Y57A 1TUDA 2DL4A 2J06A 5FWCA 2EYWA 2CT4A 1FMKA 1GCPA 3CQTA 3QWXX 1OV3A 4J9HA 3LH5A 4RTVA 3H0HA 1SSHA 1RI9A 2CREA 4LE9A 2LCSA 5FW9A 2KRMA 2CSIA 2E5KA 3EG1A 1KFZA 1H3HA 1I07A 1ZSGA 2SEMA 2CT3A 1CKBA 2LNHB 1K76A 2JMCA 2OI3A 5HCKA 2LQWA 1MV0B 1MUZA 2HEQA 1W70A 1WA7A 1WFWA 2BZYA 3UF4A 1GBRA 1MV3A 1GFCA 4Z8AA 2L0AA 2KT1A 4OMOA 2K7AA 1AWJA 2LMJA 1M30A 2O2OA 5IH2A 3I5RA 2O88A 2A36A 1W6XA 4J9DA 2CUBA 3I35A 3NHNA 1Y0MA 4RTUA 1M3AA 3SHWA 1SRLA 2D1XA 2J6KA 4D8DA 2KYBA 1EFNA 3REBB 2D8HA 2A28A 2ABLA 3VS6A 1SPKA 4M4ZA 2V1RA 1UUEA 1WI7A 1WYXA 2DBMA 1ZUYA 3M0QA 4GBQA 4J9EA 2K9GA 4OMQA 1ABQA 2J7IA 1U3OA 2FG0A 3ULRB 2XMFA 1E6HA 1YNZA 2DM1A 1KSWA 2ED0A 3VS5A 3UA7A 2RQRA 2LQNA 1H8KA 2X3WD 2YDLA 3UATA 2FPEA 1CSKA 4OMNA 2EVRA 1K0SA 2GQIA 2DA9A 2AKKA 2JM9A 2FRYA 2J6OA 2KRNA 2DRMA 3ZL7C 1YWOA 2KYMA 4Z89A 5ECAA 2GTJA 4LUDA 2FRWA 4LNPA 1YWPA 2ESWA 2J05A 3U23A 1PRMC 1UFFA 1NLPC 2KT8A 2C0IA 1HSQA 1B3QA 1X69A 1NG2A 4HVVA 1BBZA 1UG1A 4J9GA 1G2BA 1PKSA 2EYXA 2LX7A 1ZX6A 3VS2A 5IHKA 2FEIA 4RTYA 4F16A 3A98A 4FSSA 1J3TA 2DL7A 2FPDA 2RNAA 5IHIA 4AFZC 4A63B 2JS0A 2KE9A 1VYVA 2KROA 1NLOC 1GL5A 1I0CA 1HD3A 1UDLA 4K11A 3THKA 2NWMA 1WX6A 4RTTA 1UTIA 1SEMA 4IIOA 4CC2A 1YCSB 1JO8A 2K2MA 4F14A 3PE0A 2EQIA 3IQLA 2W0ZA 5EC7A 2GNCA 2V1QA 1JXOA 1AEYA 1QLYA 2B86A 2VKNA 1PWTA 4J9BA 1PNJA 2GTOA 4ESRA 2QDLA 3VRZA 2LP5A 3FJ5A 1KJWA 4CC4B 1GCQA 1QKXA 2RQUA 2YSQA 3M0RA 4AG1C 2KBTA 5IXBA 2DRKA 2L3QA 2AZVA 2I0NA 2JXBA 1M3BA 5I22A 4HCKA 5I11A 3VS7A 1IO6A 2LZ6B 1XOVA 2ROTA 3VS3A 2EGAA 1WLPB 1X43A 2L3PA 3TSWA 1YN8A 1QKWA 1AOJA 2JS2A 1E6GA 2GBQA 1NYFA 4KRTA 4HVUA 2FO0A 1W1FA 1QWFA 2PNIA 1SRMA 1AZGB 3TSZA 1GRIA 2D8JA 1OPLA 2ROLA 1AWWA 2RN8A 1K0XA 1AD5A 2RPNA 3I9QA 1CKAA 1SHFA 1X6GA 1AVZC 1ZLMA 2OAWA 2EYZA 2O31A 3VS4A 4CC3A 2DJQA 3VS0A 1AZEA 3M0TA 2MCNA 2EGEA 2RQWA 4EIKA 2P4RA 4DEXA 1UHFA 3NMZC 5GJVB 2M51A 1WXTA 2LJ3A 2JMAA 2YUQA 2L2PA 2AK5A 1UE9A 3UA6A 2YUNA 2KR3A 2DVJA 2NUZA 1PRLC 4AFUC 2F2VA 1SHGA 1BK2A 2AZSA 5IHNA 4WCIA 1X2QA 1M3CA 2DLPA 2EKHA 2CH4A 2KXCA 4IIMA 5L23A 2KEAA 1K4US 1S1NA 2DMOA 1WDXA 2BTTA 1BU1A 2IIMA 4HVWA 2DE0X 2KRSA 2K79A 1QWEA 2ENMA 1FYNA 1PKTA 4OMMA 2O9VA 1PHTA 4J9CA 1UJ0A 1OOTA 2JTEA 1UHCA 2KGTA 1OEBA 1K1ZA 2OJ2A 2LJ0A 1UECA 2DX1A 1B07A 1ARKA 1AWOA 1ZBJA 3EG0A 2J6FA 1WXUA 2SRCA 2AKLA 3R6NA 1ZUUA 3GBQA 1NEGA 4J9FA 2DYBA 1WXBA 1U06A 4F17A 1ABOA 4RTXA 4ZNXA 1T0JA 4JZ3A 1GFDA 3QWYA 4QT7A 4AG2C 1UGVA 1M27C 4RTWA 4R0KA 1G83A 4JJBA 2FPFA 4OMLA 2JT4A 4JJDA 2DL8A 1U5SA 3I5SA 3KFVA 1WIEA 3PVQA 3H0IA 2DL3A 2BZ8A 5IXFA 5FWBA 2HDAA 1JEGA 1JU5C 2O9SA 2RQVA 1JQQA 2DILA 2YUPA 1T0HA 1E7OA 2A37A 2RQTA 2PZ1A 3PVLA 3M0SA 1ZUKA 1BB9A 1M8MA 2VVKA 1V1CA 4JJCA 4X1VA 3RBBB 4J9IA 3TVTA
chains in the Genus database with same CATH superfamily
1IB8A 4M7DD 4F7UG 2COYA 4QQ6A 2RHIA 2GGRA 2B8AA 2MWPA 1YP5A 1YIJA 3QBYA 4M75D 1D1BA 1NYGA 4D6WA 1HK9A 4M7AF 3EGDB 3DKMA 4R56A 3EHQA 2PTKA 4OMPA 2DF6A 3CCST 3JCMW 4X34A 1RUWA 4AFSC 2EW3A 1LVKA 1N8RU 4M7DF 3M57A 2G6FX 4OGEA 4C8QE 2X51A 2HQXA 2X4YA 1YIJQ 3MJXA 3NPFA 2RMOA 3HPWA 2DL5A 5LJ5f 5KYYB 2F2WA 3CCJQ 1KK7A 3C0CA 3EHRA 1VYTA 2OTJT 4DOWA 4XU0A 5CKDA 4R55A 2HCKA 1K8AU 1RLQC 1D3BA 1GCQC 1YJWA 4C5IA 2I2LA 2CH4W 3VYHB 5HKCA 3MEVA 3GF5A 1RLPC 2GCXA 1TXQA 3CCEQ 2VYTA 2BUDA 3A8MB 4KUDK 2HSPA 3FIFA 1VA7A 2C0OA 3PIPA 3TCJA 1S72A 4RTZA 3UWNA 4LUEA 1TUDA 5IT9E 3RUXA 2NYSA 2DL4A 4ZGEB 1B7TA 1GCPA 4J9HA 4RG8A 2HQEA 2FVUA 2CREA 1VQ8Q 4C92D 3SFMA 3JCMd 2E10A 2RHUA 4BI8B 2KRMA 3MHXA 1JB0E 2DJZA 2CP2A 1ZSGA 4MDXA 2CT3A 4M78F 1CKBA 2AT1B 4TVRA 3JB9J 3P8BB 3HSBA 2EYQA 4M75G 2WSEE 3OYIA 1MUZA 1UEBA 3T9NA 4N4IA 4C5HA 1MV3A 4M7DG 2QA4A 3OYLA 2RK1A 2WACA 3G4ST 4KULA 3I55Q 2OTLT 2LMJA 3OB9A 1VQNT 1OU8A 3ZBDA 1RAAB 1C1AA 3OMCA 3NTHA 3NHNA 1Y0MA 3RKYA 4LDVA 4RTUA 1M90R 3QHSA 8AT1B 2D1XA 3TREA 2DXBA 4M77A 2KYBA 2XU8A 3GOXA 2ABLA 4J7FA 4PJOE 2M16A 7AT1B 1WYXA 5CO7A 4JLIA 2HKNA 4NS5A 4OGCA 3M0QA 4GBQA 3G6EA 5AYFA 1EX4A 2ZAEA 2J7IA 3CBOA 5HK3A 3VS5A 3VKIA 2RQRA 1V29B 2LQNA 2X4JA 1H8KA 1R0BG 1YI2Q 3EGDA 3UATA 1YIJT 1CSKA 1TUGB 3LGLA 1N6AA 2JM9A 2DRMA 2KYMA 4V2SA 2GTJA 4LUDA 4LNPA 3CCUQ 4M75A 1C0MA 1PRMC 2XD0A 1UFFA 4J6WA 4X9CA 4BD3A 4M7DB 2V8KA 1X69A 2XI9A 3FRNA 3VU3C 2CZ0B 2LTOA 2PU9B 5HK0A 2QQBA 1BI1A 3VS2A 4KT0E 2L89A 3LYIA 4RTYA 2Y4YA 5IN1A 2XICA 2RNAA 3M58A 2CKKA 5GAOq 4MMLA 5GMKe 5CQYA 4IUUA 3FDRA 4E7LA 1VQ7Q 4EMKC 1SF9A 1WX6A 4FW2A 3LX7A 1VQOQ 5GAMj 4ZTJA 1SEMA 1U8RA 1RAHB 1VQKT 2E12A 4EPCA 5EC7A 3FLGA 5D6XA 1QVGP 4ESRA 3MPUB 4EMGA 4PFOA 1M8VA 3VRZA 4PL6A 2OTLA 1KJWA 4LDWA 2VGNA 2RQUA 1VQLQ 2KBTA 2DRKA 2K57A 5FLXE 2NUPB 3META 1M1KU 2MYSA 4HCKA 1IO6A 1XOVA 2G3RA 3LWIA 2HMAA 1YN8A 1QKWA 4E7SA 1G3YA 5GMKi 2CZ1B 2DZCA 4B6MA 1MNEA 1WGSA 1VQLA 2PNIA 2OTLQ 1SRMA 2ZPFB 1GRIA 4A53A 4E7ZA 1NZ9A 2DETA 1AWWA 2K3YA 3MO8A 2Y90A 4C0FA 3LGFA 1Q7YU 2EQMA 1QVFP 1CKAA 1OX9A 1AVZC 1ZLMA 2OAWA 4M75F 2DJQA 1AZEA 3NTKA 4NOYA 4L59A 2QEXT 4OB3B 1PC0A 2YRDA 4EIKA 3VUZA 2V8IA 1SG5A 5GJVB 2M51A 3L2QA 1D0XA 2ATCB 1YFNA 2CP7A 3BFMA 5LJ3g 1UE9A 2YUNA 1YBYA 3QXEB 1PRLC 3CCUA 1BK2A 3JB9H 1X2QA 2V26A 2KXCA 2CH4A 5LJ5h 1TTHB 4N0AC 2JVVA 1UB4A 4JS4A 2DZ9A 3CC2Q 3OBWA 2IIMA 3OYGA 2ENMA 1R8OB 3CMAA 2COZA 2O9VA 2OAUA 3SWNA 2VC8A 2IPOB 1SSFA 4QQDA 1UHCA 2KGTA 2K4YA 2CP5A 1BKBA 4BE2A 2RI2A 1AWOA 4M75E 3LLRA 2J6FA 3GPLA 1RAEB 1S72T 1OYXA 1KC8U 4MDWA 2X9HA 1QVPA 1JBMA 2ZPEB 1ZUUA 5GANh 3GBQA 2A0FB 5C6SA 1WXBA 4A4HA 2AIRB 3OBYA 2LQ8A 3SWNB 2KMTA 3OYJA 4QT7A 4E2FB 4AG2C 1OZ2A 2FZCB 1QW1A 1XQHA 1K8AC 3JCMQ 1VQOT 5AT1B 1NE8A 2HNIA 4ZGDB 4JJDA 3CPWA 4BDYA 1VQ5T 3I5SA 4C8QA 2VUBA 3PVQA 2DPPB 3X26B 5IXFA 4PLLA 4QVZA 5FWBA 2RQVA 2MI6A 1JJ2S 3OS1A 1I81A 4DOVA 1VQ4Q 4M78D 1D0ZA 4C5EA 3OW2S 1T0HA 1PCXA 2XDBA 4M7AG 2CP6A 2RO0A 4LD9K 5KYWA 2RQTA 3PVLA 2YHTA 2FHDA 3M0SA 5IAYA 2KAFA 1KHCA 1M8MA 2VVKA 1M4ZA 2QI2A 1YI2T 3ME9A 4A4KA 4J9IA 3OYNA 1IRXA 1VIEA 1NEBA 2HBWA 4AMCA 4Z88A 1AWXA 2KQWA 2RJEA 3SEMA 3CCUT 2YUOA 2M0YA 1LCKA 2LJ1A 1Q82R 1KHIA 2QQ9A 3RKWA 4CC7A 3G4SA 3O8VA 2E3IA 5KE3A 1JXMA 2O01E 3PGGA 3CMEQ 3QG1A 2E4HA 2NUTA 3M0PA 3QKJA 1FMVA 3I56T 4JZ4A 3REAB 1K9AA 4C8QB 3RNJA 1TG0A 3QDRB 2CGHA 3CC7Q 4F7UF 2EPDA 2K3BA 2RJCA 4E6RA 2WSFE 1RL2A 2HL3A 3OY9A 4XU2A 1KD1C 2VB6A 3JSCA 5C0MA 3KXTA 3MEUA 4FT4A 4AFQC 4RG2A 4XK8E 1VQKQ 5GJWB 1BI2A 2M02A 1KD1U 1Q86R 2KDSA 1IGUA 1M1GA 4DA4A 3EG9A 5DY9A 3L1AA 4XAXB 3VV0A 1Z9ZA 4FU6A 3J7AF 2MK5A 4BI3A 3CC4Q 1UGPB 2GFUA 4ZGJB 3CPWP 2M0OA 2LT1A 4OF1A 5FWCA 3C4SA 5KE2A 4HCCA 3G6EQ 2CZ7B 1VQ6A 1I8FA 4RTVA 1XNIA 4N4HA 1VQ9A 1PSFA 1SSHA 1K9MR 4LE9A 4RKUE 3H8ZA 5FW9A 1M1KC 1UGRB 2CSIA 4FYVB 1H3HA 1W4SA 1WQWA 3C95A 2OI3A 4KUIA 1KC8R 3JB9F 1MV0B 2HEQA 2P0KA 1WFWA 1WA7A 3NTIA 2BZYA 4A4FA 1Y7XA 2L5QA 2VXFA 3CCSQ 4Z8AA 1ZSZC 4BI4A 1M2VB 1PD0A 2KT1A 4OMOA 2K7AA 3CXCS 5IH2A 4ATOA 4MZPA 2O88A 3JCMb 4EDUA 1W6XA 5KYYA 3CC2T 4M78G 2C06A 4FYYB 3E19A 3SHWA 2A28A 1SPKA 4M4ZA 1WNLA 1UUEA 3QZ5B 4GY5A 4F7UB 3LH0A 1Y07A 3CC4A 2K9GA 3I56Q 2E6ZA 4HKEA 3V7SA 1VQMA 1ZQ1A 2FG0A 3ULRB 4JRQA 2EQJA 1XTDA 1E6HA 3GNGA 3QYHB 4C5GA 3CCET 5GAOl 2DD4A 5FU7B 3VJPA 4UC4A 3CXCP 3CC4T 3S3MA 2AHJB 4M77E 2PUKB 2FPEA 3LW5E 3M54A 3EFOB 2AKKA 3CMAT 3X24B 3BDLA 5CVIA 2J6OA 2KRNA 3CCVA 1YWOA 3QZ9B 5A0DA 2LX9A 2R58A 3SB2A 3N5BB 1Q82U 3M5AA 1YJWQ 2OTJA 3OW2P 5CIUA 2YXYA 1HSQA 5GANj 2RI5A 2EAYA 1YHQQ 1BBZA 1FWZA 3CPFA 5CKHA 1UG1A 2HSEB 4PJOF 4Y28E 2LNVA 2LX7A 3CBPA 2YLCA 3BY7A 5GAOp 3HP9A 3CMEA 3Q1JA 4E7KA 1J3TA 2DL7A 5GAMg 3SD4A 2NUPA 2VASA 4A63B 4KGZB 2JS0A 1NJIU 2KROA 2F69A 4C8QG 4OB2B 1KG1A 1SKUB 1UDLA 4PJJA 3THKA 1MMDA 4RTTA 2A3LA 3OYMA 1Q7YC 1VQ6T 1WHJA 4F14A 3OYKA 4PJOD 2EQIA 2K3XA 2W0ZA 1N27A 2V1QA 4M78E 1QLYA 2B86A 1PWTA 4J9BA 1PNJA 4A54A 4RCBA 2KSSA 2QDLA 2QA4T 3FJ5A 2O4XA 1GCQA 4AG1C 2LQKA 1FX7A 4ZTFA 2L3QA 3JCMP 3URGA 2MMPA 1OX8A 1B34B 5I22A 1TWBA 1VQ5A 3DB3A 2E1HA 1U1TA 1X75C 5GAN4 2JUFA 1X43A 1VQ9T 2L3PA 3TSWA 4L6V5 1JJ2P 1E6GA 2MWOA 1NYFA 2EIFA 1VQPQ 2P4TA 4PKCC 2DAQA 2DK3A 2FO0A 1QWFA 3E9FA 1K9MU 2O4XB 5LJ5g 3TSZA 4NL3A 2D8JA 3PFSA 2RN8A 3HFNA 3CC7A 1WHHA 9ATCB 2RPNA 4E7HA 2FYKA 3X25B 2ZPHB 4KH1B 3ZFJA 2EWNA 5KYUB 2O31A 1MMAA 2QG9B 3VS4A 4CC3A 4PFZA 2YRCA 3CPWS 2MCNA 2EGEA 4J6YA 3MP6A 3CCMQ 2P4RA 1YJ9T 5KYXA 1QVFS 2JTMA 4AT1B 2V8JA 2JMAA 2YUQA 2BKDN 3EGXA 1VQMT 4M77D 2RK2A 4PLIA 4XTZA 3PT9A 4AFUC 2F2VA 2AZSA 2BE7D 2EKHA 5L23A 2H3EB 1Y96B 4C8QF 3UDCA 1M9SA 1WDXA 5L8RE 5LL6S 4QVCA 2KRSA 2K79A 1VQ7T 4J6XA 4M7DC 4BACA 2X4WA 5GMKm 3EGXB 2DO3A 3M9QA 4A4GA 1K1ZA 3QYGB 4E47A 1MNDA 3P8HA 1WXUA 2PUOB 2AKLA 3R6NA 3JCMg 2WSCE 3H6ZA 5FRNA 3OSVA 1ACMB 2JJ9A 4HT9A 2RM4A 4J9FA 3OS0A 2HL5C 4KGVB 3QSUA 4F17A 1ABOA 1GFDA 4JZ3A 5FU6C 2KY9A 3FEOA 3CCLT 5CQXA 3OW2A 4RTWA 4R0KA 1VQPT 1G83A 4IUTA 4JJBA 1Q81R 2FPFA 5LJ3e 1VQNQ 4CI0C 4OMLA 4BE0A 3OQ5A 3VYGA 3UT1A 2QK0A 2BZ8A 2QQRA 1TOVA 1MHNA 2O9SA 1ZBXA 3CCRQ 3M56A 4FSXA 4M7AC 2YUPA 4HCZA 3V8KA 1E7OA 3JB9D 4J5YA 2QTVA 1YJ9Q 3A8HB 4LXCA 5I2MA 2XKOC 4C8QC 3S6WA 4DBQA 1BB9A 4JJCA 2MPXC 1AHJB 4PJNA 3L2UA 3CD6T 4QVDA 1QCFA 3BE3A 2F2XA 3OSSC 4JS5A 4FL6A 1T3LA 3FC3A 3M0UA 2XDDA 2D9TA 1YJWT 2YRVA 2DNUA 1UJYA 4ORZA 3OYAA 1T3SA 3C94A 4PJOB 2E6NA 3HTRA 3O5ZA 1A0NB 3EG3A 2ECZA 2K6DA 2XG8D 1NM7A 2DYIA 4RMOA 2P0QA 3DB4A 3L2WA 1N5ZA 2QEXA 3HRUA 4OB0B 2JM8A 1WHKA 4OP0A 2EGCA 2D0NA 2EBPA 1G3SA 1Q95G 5FU7C 3H41A 2CSQA 4XTUA 5A0LA 3L2VA 1GXIE 1OZ3A 1OQKA 3RDVA 1X2KA 3X20B 2CS7A 4LDXA 3VRYA 1D09B 2KNBB 1PM3A 4O6JA 2RA2A 2YT6A 1ZSZA 2DTOA 5I2SA 2IVWA 1GBQA 2QQAA 1YJ9A 2D6FA 3VUBA 1HJDA 1Z9QA 4XU3A 1VUBA 2DXTA 4JPBW 1IREB 2CUDA 3EG2A 5FRMA 3CCRA 1TSFA 2MIOA 1TS9A 1BCOA 3H0FA 5CKEA 3PMIA 5HY6A 1ZSZB 3EH2A 3JV3A 1WJSA 3OYYA 4GLKA 1Y57A 3JB9G 2EJ9A 2EYWA 2GQVA 2CT4A 1FMKA 3CQTA 3OYCA 1OV3A 4BB7A 2DFUA 4PJOC 1D1CA 1RI9A 3CBMA 4QQGA 5CCAA 1QCNA 4PJMA 5GAN2 4XTWA 2E5KA 2QA4Q 3G71Q 1I07A 2SEMA 1G5VA 1K76A 1Y71A 4JJNK 4QKUA 2JMCA 5HCKA 2LQWA 2QQSA 3EFOA 1H641 2DTIA 3V8LA 3JB9I 1W70A 3CCMT 2K5LA 1GBRA 2GF7A 4CRIA 1GFCA 1VQMQ 1I5OB 4OVAA 4KBMB 2L0AA 4Y91A 1W2BS 4FIBA 5GANf 3OYFA 1AWJA 1Q81U 1NJIR 3CC7T 1VQ8A 4M7AB 3M53A 1M30A 2O2OA 4WF2A 3RESA 1K73C 2FL7A 1RABB 2CP0A 2CUBA 3FB9A 4M7AE 2DXCA 5LJ5e 1M5Q1 1RAGB 4FYWB 1M3AA 4PJOA 2QXFA 2J6KA 3X28B 2JNGA 5GMKj 1S72Q 2D8HA 2RHZA 4VUBA 1KQSA 2V1RA 4A4EA 2DBMA 3PMTA 1ZUYA 2CP3A 5GAOn 3CCEA 3HKSA 4FW1A 1ABQA 1YJNT 4BUGA 1U3OA 4C92C 2XMFA 1RAFB 2DM1A 3BDUA 1N8RR 2YDLA 2IG0A 5GAMh 4M77F 4M75C 4OMNA 2EVRA 1VQ5Q 1QP2A 2GQIA 3LWHA 3CCLQ 1C6VX 2ZPBB 3M59A 2FRYA 4C8QD 3QDFA 5GANg 3ZL7C 4Z89A 5ECAA 2FRWA 1YWPA 2J05A 3U23A 5D6WA 1VQ4T 1NLPC 4FYXB 4C0ZA 2C0IA 3OYBA 2EQUA 1W2BP 5GAN6 1KQ1A 3A1PA 3JCMV 2HBPA 4J9GA 1EZZB 2PVGB 1MGQA 4DBRA 1ZX6A 4EMKB 4RCCA 1WQ7A 3ER0A 4M77G 3CCRT 3QPHA 4FSSA 2H3JA 5IHIA 4AFZC 4ME7A 2DIGA 4M77C 3MP8A 2KE9A 2QASA 1VYVA 5A0GA 2OX7A 4K11A 2NWMA 1UTIA 1QVGA 4C92E 4IIOA 5J39A 4CC2A 1YCSB 3G1JA 1XJWB 1JO8A 3PE0A 5DLOA 4DBFA 3IQLA 1RI0A 1KQSP 2GNCA 2LDMA 2K5FA 1JXOA 1AEYA 3CCJT 2VKNA 2GTOA 2HZYA 2OTJQ 1JJ2A 4PJLA 5D7UA 3G71T 2LP5A 4CC4B 2QGGA 4BY6C 5IXBA 5GAOm 3M0RA 2DD5A 5GMKl 5J26A 4F04B 2P0PA 1M3BA 3OYHA 2XIDA 4II1A 3OYDA 1KC8C 3SWNC 2LZ6B 2ROTA 3M4YA 3VS3A 3RKXA 2EGAA 4JRKA 1KQ2A 1AOJA 2JS2A 4KH0B 5LJ5j 2GBQA 1QVFA 2EFIA 2RI3A 1ZA2B 3QJ6A 1IGQA 1AD5A 1D0YA 3SDZA 2E3HA 1UGQB 1Y96A 1SHFA 2VGMA 3V7RA 3JCMX 2JZ2A 3JCMf 3VS0A 3M0TA 2L3RA 3I56A 3RMQA 2HQHA 2F5TX 2RQWA 2DERA 1HXDA 5KYNA 4E7IA 4J7IA 5CKFA 1BI0A 4FCYA 2AK5A 2KR3A 3QUIA 2DVJA 4JDSA 2DLPA 4IIMA 1K4US 1S1NA 4HCBA 3JCMc 4JUVA 4ELYC 2BTTA 3OMGA 1I5LA 2KI7A 2DE0X 4C92G 3V8JA 1IZ6A 1KD1R 1PKTA 4E7JA 1UJ0A 5LJ3f 5M9OA 2MF2A 1WZOA 1YITT 1LPLA 4N0AA 3HRSA 1UECA 2DX1A 1B07A 1W2BA 1ARKA 1D3BB 1ZBJA 5DM7R 1VIFA 3JCMe 4FM4B 1QMCA 2A7YA 1EIFA 4MZTA 1DJ7B 1X01A 5FROA 3GNFB 2DYBA 5CK9A 1BIAA 1LJOA 3JRZA 5GAN7 4RTXA 4ZNXA 4XTYA 1T0JA 1N9RA 4X9DA 3QWYA 4C0GA 8ATCB 1UGVA 1VQ9Q 2Y4XA 4EMKA 1BYMA 4IUQA 3EAEA 2NUTB 4DBHA 4BY6B 1FMWA 3G7ZA 2JT4A 5D6YA 2FZGB 4NL2A 1U5SA 3HL8A 1Q81C 3KFVA 3CMAQ 1WIEA 2E70A 3RERA 1M90U 2HDAA 2COWA 1JU5C 3CC2A 4LDUA 1JQQA 4M7DA 1WPYA 3A5ZB 3DLMA 2DILA 3GLXA 4HA8A 1P92A 2XK0A 3EH1A 3GP8A 1AT1B 2EJFA 4ZN3A 2VXEA 1F1BB 2A37A 1K73U 1RACB 2RJDA 4MZMA 4M77B 1VQKA 3C12A 3CEYA 2QTXA 4X1VA 3AT1B 3V7CA 3RBBB 4ELZC 2H8HA 5GAMe 1B34A 3G71A 1X27A 2RH2A 3L2ZA 1MMGA 1N8RC 2L3SA 4EMHA 4Y92A 4JRIA 3QIIA 1RADB 3CD6A 2HD0A 3J80E 4FT2A 4PFPA 3VS1A 1OPKA 1TU0B 2X3XD 1KIKA 2DBKA 4LN2A 1YHQT 3J81E 1VYUA 3P8DA 5A2QE 1OI1A 3EGUA 4WTOB 2A08A 1U1SA 4M78B 3L2RA 2BIVA 2P84A 1YCYA 1H92A 5KH6A 3G4SQ 1X6BA 1I1JA 2JOYA 4QW2A 3BW1A 5KYUA 1K73R 4GLMA 1YITA 4DEYA 2C0TA 3NGPA 2ED1A 1NJIC 3EFSA 3MKDA 2MOXA 2RD1A 2VWFA 4XU1A 3WXMB 3E2UA 1PD1A 2LC4A 1YJNA 1LNXA 2ZCFB 3D7SB 1VQ4A 2CDTA 2E5QA 1G3TA 2EYYA 4D8KA 2HKQB 1R77A 5KCHA 2BZXA 4XQ3A 2PQWA 2RF0A 4RUGA 4HXJA 2JW4A 5CR2A 2DTHA 5GAN5 5J3BA 1X6OA 4B9XA 1TUCA 3CCLA 1VQOA 2DKGA 2KXDA 4MMKA 2R5AA 1KQSS 2W10A 2DIQA 1O75A 2PVDB 3F70A 1OULA 2QEXQ 3AHUA 3CCQQ 3S3OA 4B9WA 3JCMJ 2J06A 3KBGA 3FJPA 3UPUA 3QWXX 1M1FA 2D0QB 3MEWA 3LH5A 2PVOB 3QO3A 3H0HA 4P5NA 1M2VA 2LCSA 2M1HA 3JCMh 3HFOA 1Q7YR 5GAMf 3EG1A 1KFZA 3RIRA 2LNHB 3A8OB 5LJ3d 1M1KR 4LDYA 1G8XA 4JLGA 3MP1A 2M9UA 2F1LA 5GANd 3PIOA 2R57A 5I21A 3UF4A 1H3ZA 1TH7A 1WJRA 1VQNA 4JRPA 2EKOA 3A8GB 1G3WA 3OA6A 4C92A 3I5RA 2A36A 5LJ3h 4J9DA 4BDZA 5KYXB 2K2VA 3I35A 1ZHIA 4M7AD 1SRLA 2RJFA 4D8DA 3E9GA 1EFNA 3REBB 3VS6A 1WI7A 2RB6A 2DEQA 4ZN1A 2CZ6B 1O9SA 2Z0WA 4J9EA 3I55A 2RHXA 4OMQA 1JRIA 2ZPIB 4ANJA 1YNZA 1KSWA 2ED0A 3UA7A 2XHCA 5GAN8 4LD6A 3CCVT 2QYZA 2X3WD 4J8OA 1K0SA 1IHVA 2DA9A 2ZGWA 3TU4K 1HYOA 2ESWA 3M4GA 5LJ3j 3HRTA 5DLQE 2QAZA 1YITQ 2KT8A 2E41A 1BIBA 1ZA1B 2ZZDA 1V76A 3CMET 1B3QA 1NG2A 1NPPA 4HVVA 1BI3A 4J83A 1PKSA 1G2BA 3ASKA 2EYXA 4IKFA 1IXDA 5IHKA 2FEIA 3TQ7P 4KGXB 4F16A 3A98A 1VQ7A 2FPDA 1R0CB 3INZA 2VV5A 5GAMd 3CD6Q 3CCQT 4O5VA 1NLOC 1GL5A 1I0CA 1HD3A 3NFCA 1M90C 4C92F 4PK4A 2K2MA 3JAME 3A8LB 2LCLA 4N4GA 4C0DB 3CCQA 3WVEB 1Q86U 1K9MC 2E64A 2QGFB 5KYWB 4OMFB 1QKXA 2YSQA 4L5GA 4M78A 3CCJA 1VOMA 2AZVA 2I0NA 2JXBA 4Z02A 4F7UA 1VQPA 2L8DA 5I11A 4YTLA 3VS7A 5FU6B 2JTFA 1WLPB 1YI2A 4IURA 3M55A 2NLUA 1YJNQ 4KRTA 4HVUA 2F5KA 1QQJA 1W1FA 3HHTB 3I55T 2LCCA 1AZGB 3KUFA 1Q86C 5CAIA 2FZKB 1OPLA 2ROLA 2RHYA 4XTXA 3DLLA 1N9SA 1K0XA 1IHWA 3EG9B 4IUPA 3I9QA 1WHLA 4M7DE 2E65A 1X6GA 2EYZA 2BE9B 2LVMA 4Q5WA 3H9NA 2KVQG 3TEEA 4DEXA 1UHFA 3NMZC 3RR6A 2ZPGB 3WVDB 1WXTA 2LJ3A 2LT4A 5GMKh 2L2PA 3MEAA 3G6ET 3UA6A 1FXXA 2NUZA 1SHGA 2R5MA 5IHNA 4WCIA 4XTVA 1M3CA 3CCVQ 2KEAA 4PJOG 2X35A 2HAXA 4F7UE 2GFAA 3OS5A 1YHQA 1Q82C 2DMOA 1BU1A 3QJYA 4HVWA 1QWEA 4M7AA 5KCOA 2QDYB 4OB1B 2EQKA 5GAN3 1FYNA 4OMMA 1PHTA 2X4XA 3RMSA 4J9CA 1OOTA 2JTEA 1WJQA 4BE1A 1OEBA 1BCMA 1WHGA 2OJ2A 2LJ0A 1UGSB 5LJ5d 4HT8A 2FB7A 3EG0A 1WHMA 3MCAB 2SRCA 3OS2A 3L42A 1OU9A 4M75B 1MMNA 3PTAA 3CXCA 1NEGA 1U06A 2LRQA 2MAMA 3GIBA 4C92B 2DXUA 1D1AA 1M27C 3CCMA 1LOJA 5GANe 3OYEA 1I4K1 2DL8A 3ZEHA 3H0IA 1K8AR 2DL3A 4IUVA 2XDPA 6AT1B 1PG5B 1JEGA 1QVGS 4C0DC 1NPRA 5CKBA 1VQLT 1RAIB 2DVEA 3R6OA 1NBEB 5GAOr 5EG2A 3CCSA 1QCOA 3E1SA 2EJGA 4DQ2A 1QP3A 2YLBA 2PZ1A 4PNOA 1PSEA 3S3NA 1ZUKA 3EFRA 4M78C 2DEUA 1M2OA 1V1CA 1VQ8T 2KK4A 3PNWC 2CYZB 2YWWA 2JN0A 1VQ6Q 3TVTA 2K5IA
chains in the Genus database with same CATH topology
2H8HA 1X27A 2GGRA 1NEBA 1QCFA 2HBWA 2L3SA 4Z88A 1YP5A 1AWXA 2F2XA 4Y92A 3SEMA 1T3LA 1NYGA 2YUOA 3M0UA 2M0YA 1LCKA 2LJ1A 4CC7A 3VS1A 1OPKA 1JXMA 2DNUA 1UJYA 4ORZA 3EHQA 2PTKA 1T3SA 4OMPA 2X3XD 3O5ZA 1KIKA 2DF6A 3EG3A 1A0NB 2DBKA 4LN2A 2ECZA 2K6DA 3M0PA 1VYUA 1NM7A 1RUWA 3EGUA 4JZ4A 4AFSC 3REAB 2EW3A 1K9AA 2A08A 1H92A 1N5ZA 2G6FX 2JM8A 1X6BA 1I1JA 1TG0A 3RNJA 2EGCA 2D0NA 2EBPA 4GLMA 3H41A 2CSQA 4DEYA 2EPDA 2C0TA 2K3BA 3NGPA 2ED1A 4E6RA 3NPFA 1X2KA 2MOXA 2RMOA 2DL5A 2VWFA 2F2WA 3VRYA 2KNBB 2YT6A 3C0CA 3EHRA 1VYTA 2CDTA 2EYYA 4D8KA 4AFQC 2HCKA 1GBQA 5GJWB 1RLQC 2BZXA 1GCQC 1HJDA 2RF0A 4RUGA 4HXJA 1Z9QA 2JW4A 2CH4W 4JPBW 2CUDA 1TUCA 3EG2A 1RLPC 2KXDA 2MIOA 2W10A 1Z9ZA 3H0FA 2HSPA 1VA7A 2C0OA 3JV3A 4RTZA 4LUEA 1Y57A 1TUDA 2DL4A 2J06A 5FWCA 2EYWA 2CT4A 1FMKA 1GCPA 3CQTA 3QWXX 1OV3A 4J9HA 3LH5A 4RTVA 3H0HA 1SSHA 1RI9A 2CREA 4LE9A 2LCSA 5FW9A 2KRMA 2CSIA 2E5KA 3EG1A 1KFZA 1H3HA 1I07A 1ZSGA 2SEMA 2CT3A 1CKBA 2LNHB 1K76A 2JMCA 2OI3A 5HCKA 2LQWA 1MV0B 1MUZA 2HEQA 1W70A 1WA7A 1WFWA 2BZYA 3UF4A 1GBRA 1MV3A 1GFCA 4Z8AA 2L0AA 2KT1A 4OMOA 2K7AA 1AWJA 2LMJA 1M30A 2O2OA 5IH2A 3I5RA 2O88A 2A36A 1W6XA 4J9DA 2CUBA 3I35A 3NHNA 1Y0MA 4RTUA 1M3AA 3SHWA 1SRLA 2D1XA 2J6KA 4D8DA 2KYBA 1EFNA 3REBB 2D8HA 2A28A 2ABLA 3VS6A 1SPKA 4M4ZA 2V1RA 1UUEA 1WI7A 1WYXA 2DBMA 1ZUYA 3M0QA 4GBQA 4J9EA 2K9GA 4OMQA 1ABQA 2J7IA 1U3OA 2FG0A 3ULRB 2XMFA 1E6HA 1YNZA 2DM1A 1KSWA 2ED0A 3VS5A 3UA7A 2RQRA 2LQNA 1H8KA 2X3WD 2YDLA 3UATA 2FPEA 1CSKA 4OMNA 2EVRA 1K0SA 2GQIA 2DA9A 2AKKA 2JM9A 2FRYA 2J6OA 2KRNA 2DRMA 3ZL7C 1YWOA 2KYMA 4Z89A 5ECAA 2GTJA 4LUDA 2FRWA 4LNPA 1YWPA 2ESWA 2J05A 3U23A 1PRMC 1UFFA 1NLPC 2KT8A 2C0IA 1HSQA 1B3QA 1X69A 1NG2A 4HVVA 1BBZA 1UG1A 4J9GA 1G2BA 1PKSA 2EYXA 2LX7A 1ZX6A 3VS2A 5IHKA 2FEIA 4RTYA 4F16A 3A98A 4FSSA 1J3TA 2DL7A 2FPDA 2RNAA 5IHIA 4AFZC 4A63B 2JS0A 2KE9A 1VYVA 2KROA 1NLOC 1GL5A 1I0CA 1HD3A 1UDLA 4K11A 3THKA 2NWMA 1WX6A 4RTTA 1UTIA 1SEMA 4IIOA 4CC2A 1YCSB 1JO8A 2K2MA 4F14A 3PE0A 2EQIA 3IQLA 2W0ZA 5EC7A 2GNCA 2V1QA 1JXOA 1AEYA 1QLYA 2B86A 2VKNA 1PWTA 4J9BA 1PNJA 2GTOA 4ESRA 2QDLA 3VRZA 2LP5A 3FJ5A 1KJWA 4CC4B 1GCQA 1QKXA 2RQUA 2YSQA 3M0RA 4AG1C 2KBTA 5IXBA 2DRKA 2L3QA 2AZVA 2I0NA 2JXBA 1M3BA 5I22A 4HCKA 5I11A 3VS7A 1IO6A 2LZ6B 1XOVA 2ROTA 3VS3A 2EGAA 1WLPB 1X43A 2L3PA 3TSWA 1YN8A 1QKWA 1AOJA 2JS2A 1E6GA 2GBQA 1NYFA 4KRTA 4HVUA 2FO0A 1W1FA 1QWFA 2PNIA 1SRMA 1AZGB 3TSZA 1GRIA 2D8JA 1OPLA 2ROLA 1AWWA 2RN8A 1K0XA 1AD5A 2RPNA 3I9QA 1CKAA 1SHFA 1X6GA 1AVZC 1ZLMA 2OAWA 2EYZA 2O31A 3VS4A 4CC3A 2DJQA 3VS0A 1AZEA 3M0TA 2MCNA 2EGEA 2RQWA 4EIKA 2P4RA 4DEXA 1UHFA 3NMZC 5GJVB 2M51A 1WXTA 2LJ3A 2JMAA 2YUQA 2L2PA 2AK5A 1UE9A 3UA6A 2YUNA 2KR3A 2DVJA 2NUZA 1PRLC 4AFUC 2F2VA 1SHGA 1BK2A 2AZSA 5IHNA 4WCIA 1X2QA 1M3CA 2DLPA 2EKHA 2CH4A 2KXCA 4IIMA 5L23A 2KEAA 1K4US 1S1NA 2DMOA 1WDXA 2BTTA 1BU1A 2IIMA 4HVWA 2DE0X 2KRSA 2K79A 1QWEA 2ENMA 1FYNA 1PKTA 4OMMA 2O9VA 1PHTA 4J9CA 1UJ0A 1OOTA 2JTEA 1UHCA 2KGTA 1OEBA 1K1ZA 2OJ2A 2LJ0A 1UECA 2DX1A 1B07A 1ARKA 1AWOA 1ZBJA 3EG0A 2J6FA 1WXUA 2SRCA 2AKLA 3R6NA 1ZUUA 3GBQA 1NEGA 4J9FA 2DYBA 1WXBA 1U06A 4F17A 1ABOA 4RTXA 4ZNXA 1T0JA 4JZ3A 1GFDA 3QWYA 4QT7A 4AG2C 1UGVA 1M27C 4RTWA 4R0KA 1G83A 4JJBA 2FPFA 4OMLA 2JT4A 4JJDA 2DL8A 1U5SA 3I5SA 3KFVA 1WIEA 3PVQA 3H0IA 2DL3A 2BZ8A 5IXFA 5FWBA 2HDAA 1JEGA 1JU5C 2O9SA 2RQVA 1JQQA 2DILA 2YUPA 1T0HA 1E7OA 2A37A 2RQTA 2PZ1A 3PVLA 3M0SA 1ZUKA 1BB9A 1M8MA 2VVKA 1V1CA 4JJCA 4X1VA 3RBBB 4J9IA 3TVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8H A;  1X27 A;  2GGR A;  1NEB A;  1QCF A;  2HBW A;  2L3S A;  4Z88 A;  1YP5 A;  1AWX A;  2F2X A;  4Y92 A;  3SEM A;  1T3L A;  1NYG A;  2YUO A;  3M0U A;  2M0Y A;  1LCK A;  2LJ1 A;  4CC7 A;  3VS1 A;  1OPK A;  1JXM A;  2DNU A;  1UJY A;  4ORZ A;  3EHQ A;  2PTK A;  1T3S A;  4OMP A;  2X3X D;  3O5Z A;  1KIK A;  2DF6 A;  3EG3 A;  1A0N B;  2DBK A;  4LN2 A;  2ECZ A;  2K6D A;  3M0P A;  1VYU A;  1NM7 A;  1RUW A;  3EGU A;  4JZ4 A;  4AFS C;  3REA B;  2EW3 A;  1K9A A;  2A08 A;  1H92 A;  1N5Z A;  2G6F X;  2JM8 A;  1X6B A;  1I1J A;  1TG0 A;  3RNJ A;  2EGC A;  2D0N A;  2EBP A;  4GLM A;  3H41 A;  2CSQ A;  4DEY A;  2EPD A;  2C0T A;  2K3B A;  3NGP A;  2ED1 A;  4E6R A;  3NPF A;  1X2K A;  2MOX A;  2RMO A;  2DL5 A;  2VWF A;  2F2W A;  3VRY A;  2KNB B;  2YT6 A;  3C0C A;  3EHR A;  1VYT A;  2CDT A;  2EYY A;  4D8K A;  4AFQ C;  2HCK A;  1GBQ A;  5GJW B;  1RLQ C;  2BZX A;  1GCQ C;  1HJD A;  2RF0 A;  4RUG A;  4HXJ A;  1Z9Q A;  2JW4 A;  2CH4 W;  4JPB W;  2CUD A;  1TUC A;  3EG2 A;  1RLP C;  2KXD A;  2MIO A;  2W10 A;  1Z9Z A;  3H0F A;  2HSP A;  1VA7 A;  2C0O A;  3JV3 A;  4RTZ A;  4LUE A;  1Y57 A;  1TUD A;  2DL4 A;  2J06 A;  5FWC A;  2EYW A;  2CT4 A;  1FMK A;  1GCP A;  3CQT A;  3QWX X;  1OV3 A;  4J9H A;  3LH5 A;  4RTV A;  3H0H A;  1SSH A;  1RI9 A;  2CRE A;  4LE9 A;  2LCS A;  5FW9 A;  2KRM A;  2CSI A;  2E5K A;  3EG1 A;  1KFZ A;  1H3H A;  1I07 A;  1ZSG A;  2SEM A;  2CT3 A;  1CKB A;  2LNH B;  1K76 A;  2JMC A;  2OI3 A;  5HCK A;  2LQW A;  1MV0 B;  1MUZ A;  2HEQ A;  1W70 A;  1WA7 A;  1WFW A;  2BZY A;  3UF4 A;  1GBR A;  1MV3 A;  1GFC A;  4Z8A A;  2L0A A;  2KT1 A;  4OMO A;  2K7A A;  1AWJ A;  2LMJ A;  1M30 A;  2O2O A;  5IH2 A;  3I5R A;  2O88 A;  2A36 A;  1W6X A;  4J9D A;  2CUB A;  3I35 A;  3NHN A;  1Y0M A;  4RTU A;  1M3A A;  3SHW A;  1SRL A;  2D1X A;  2J6K A;  4D8D A;  2KYB A;  1EFN A;  3REB B;  2D8H A;  2A28 A;  2ABL A;  3VS6 A;  1SPK A;  4M4Z A;  2V1R A;  1UUE A;  1WI7 A;  1WYX A;  2DBM A;  1ZUY A;  3M0Q A;  4GBQ A;  4J9E A;  2K9G A;  4OMQ A;  1ABQ A;  2J7I A;  1U3O A;  2FG0 A;  3ULR B;  2XMF A;  1E6H A;  1YNZ A;  2DM1 A;  1KSW A;  2ED0 A;  3VS5 A;  3UA7 A;  2RQR A;  2LQN A;  1H8K A;  2X3W D;  2YDL A;  3UAT A;  2FPE A;  1CSK A;  4OMN A;  2EVR A;  1K0S A;  2GQI A;  2DA9 A;  2AKK A;  2JM9 A;  2FRY A;  2J6O A;  2KRN A;  2DRM A;  3ZL7 C;  1YWO A;  2KYM A;  4Z89 A;  5ECA A;  2GTJ A;  4LUD A;  2FRW A;  4LNP A;  1YWP A;  2ESW A;  2J05 A;  3U23 A;  1PRM C;  1UFF A;  1NLP C;  2KT8 A;  2C0I A;  1HSQ A;  1B3Q A;  1X69 A;  1NG2 A;  4HVV A;  1BBZ A;  1UG1 A;  4J9G A;  1G2B A;  1PKS A;  2EYX A;  2LX7 A;  1ZX6 A;  3VS2 A;  5IHK A;  2FEI A;  4RTY A;  4F16 A;  3A98 A;  4FSS A;  1J3T A;  2DL7 A;  2FPD A;  2RNA A;  5IHI A;  4AFZ C;  4A63 B;  2JS0 A;  2KE9 A;  1VYV A;  2KRO A;  1NLO C;  1GL5 A;  1I0C A;  1HD3 A;  1UDL A;  4K11 A;  3THK A;  2NWM A;  1WX6 A;  4RTT A;  1UTI A;  1SEM A;  4IIO A;  4CC2 A;  1YCS B;  1JO8 A;  2K2M A;  4F14 A;  3PE0 A;  2EQI A;  3IQL A;  2W0Z A;  5EC7 A;  2GNC A;  2V1Q A;  1JXO A;  1AEY A;  1QLY A;  2B86 A;  2VKN A;  1PWT A;  4J9B A;  1PNJ A;  2GTO A;  4ESR A;  2QDL A;  3VRZ A;  2LP5 A;  3FJ5 A;  1KJW A;  4CC4 B;  1GCQ A;  1QKX A;  2RQU A;  2YSQ A;  3M0R A;  4AG1 C;  2KBT A;  5IXB A;  2DRK A;  2L3Q A;  2AZV A;  2I0N A;  2JXB A;  1M3B A;  5I22 A;  4HCK A;  5I11 A;  3VS7 A;  1IO6 A;  2LZ6 B;  1XOV A;  2ROT A;  3VS3 A;  2EGA A;  1WLP B;  1X43 A;  2L3P A;  3TSW A;  1YN8 A;  1QKW A;  1AOJ A;  2JS2 A;  1E6G A;  2GBQ A;  1NYF A;  4KRT A;  4HVU A;  2FO0 A;  1W1F A;  1QWF A;  2PNI A;  1SRM A;  1AZG B;  3TSZ A;  1GRI A;  2D8J A;  1OPL A;  2ROL A;  1AWW A;  2RN8 A;  1K0X A;  1AD5 A;  2RPN A;  3I9Q A;  1CKA A;  1SHF A;  1X6G A;  1AVZ C;  1ZLM A;  2OAW A;  2EYZ A;  2O31 A;  3VS4 A;  4CC3 A;  2DJQ A;  3VS0 A;  1AZE A;  3M0T A;  2MCN A;  2EGE A;  2RQW A;  4EIK A;  2P4R A;  4DEX A;  1UHF A;  3NMZ C;  5GJV B;  2M51 A;  1WXT A;  2LJ3 A;  2JMA A;  2YUQ A;  2L2P A;  2AK5 A;  1UE9 A;  3UA6 A;  2YUN A;  2KR3 A;  2DVJ A;  2NUZ A;  1PRL C;  4AFU C;  2F2V A;  1SHG A;  1BK2 A;  2AZS A;  5IHN A;  4WCI A;  1X2Q A;  1M3C A;  2DLP A;  2EKH A;  2CH4 A;  2KXC A;  4IIM A;  5L23 A;  2KEA A;  1K4U S;  1S1N A;  2DMO A;  1WDX A;  2BTT A;  1BU1 A;  2IIM A;  4HVW A;  2DE0 X;  2KRS A;  2K79 A;  1QWE A;  2ENM A;  1FYN A;  1PKT A;  4OMM A;  2O9V A;  1PHT A;  4J9C A;  1UJ0 A;  1OOT A;  2JTE A;  1UHC A;  2KGT A;  1OEB A;  1K1Z A;  2OJ2 A;  2LJ0 A;  1UEC A;  2DX1 A;  1B07 A;  1ARK A;  1AWO A;  1ZBJ A;  3EG0 A;  2J6F A;  1WXU A;  2SRC A;  2AKL A;  3R6N A;  1ZUU A;  3GBQ A;  1NEG A;  4J9F A;  2DYB A;  1WXB A;  1U06 A;  4F17 A;  1ABO A;  4RTX A;  4ZNX A;  1T0J A;  4JZ3 A;  1GFD A;  3QWY A;  4QT7 A;  4AG2 C;  1UGV A;  1M27 C;  4RTW A;  4R0K A;  1G83 A;  4JJB A;  2FPF A;  4OML A;  2JT4 A;  4JJD A;  2DL8 A;  1U5S A;  3I5S A;  3KFV A;  1WIE A;  3PVQ A;  3H0I A;  2DL3 A;  2BZ8 A;  5IXF A;  5FWB A;  2HDA A;  1JEG A;  1JU5 C;  2O9S A;  2RQV A;  1JQQ A;  2DIL A;  2YUP A;  1T0H A;  1E7O A;  2A37 A;  2RQT A;  2PZ1 A;  3PVL A;  3M0S A;  1ZUK A;  1BB9 A;  1M8M A;  2VVK A;  1V1C A;  4JJC A;  4X1V A;  3RBB B;  4J9I A;  3TVT A; 
#chains in the Genus database with same CATH topology
 1IB8 A;  4M7D D;  4F7U G;  2COY A;  4QQ6 A;  2RHI A;  2GGR A;  2B8A A;  2MWP A;  1YP5 A;  1YIJ A;  3QBY A;  4M75 D;  1D1B A;  1NYG A;  4D6W A;  1HK9 A;  4M7A F;  3EGD B;  3DKM A;  4R56 A;  3EHQ A;  2PTK A;  4OMP A;  2DF6 A;  3CCS T;  3JCM W;  4X34 A;  1RUW A;  4AFS C;  2EW3 A;  1LVK A;  1N8R U;  4M7D F;  3M57 A;  2G6F X;  4OGE A;  4C8Q E;  2X51 A;  2HQX A;  2X4Y A;  1YIJ Q;  3MJX A;  3NPF A;  2RMO A;  3HPW A;  2DL5 A;  5LJ5 f;  5KYY B;  2F2W A;  3CCJ Q;  1KK7 A;  3C0C A;  3EHR A;  1VYT A;  2OTJ T;  4DOW A;  4XU0 A;  5CKD A;  4R55 A;  2HCK A;  1K8A U;  1RLQ C;  1D3B A;  1GCQ C;  1YJW A;  4C5I A;  2I2L A;  2CH4 W;  3VYH B;  5HKC A;  3MEV A;  3GF5 A;  1RLP C;  2GCX A;  1TXQ A;  3CCE Q;  2VYT A;  2BUD A;  3A8M B;  4KUD K;  2HSP A;  3FIF A;  1VA7 A;  2C0O A;  3PIP A;  3TCJ A;  1S72 A;  4RTZ A;  3UWN A;  4LUE A;  1TUD A;  5IT9 E;  3RUX A;  2NYS A;  2DL4 A;  4ZGE B;  1B7T A;  1GCP A;  4J9H A;  4RG8 A;  2HQE A;  2FVU A;  2CRE A;  1VQ8 Q;  4C92 D;  3SFM A;  3JCM d;  2E10 A;  2RHU A;  4BI8 B;  2KRM A;  3MHX A;  1JB0 E;  2DJZ A;  2CP2 A;  1ZSG A;  4MDX A;  2CT3 A;  4M78 F;  1CKB A;  2AT1 B;  4TVR A;  3JB9 J;  3P8B B;  3HSB A;  2EYQ A;  4M75 G;  2WSE E;  3OYI A;  1MUZ A;  1UEB A;  3T9N A;  4N4I A;  4C5H A;  1MV3 A;  4M7D G;  2QA4 A;  3OYL A;  2RK1 A;  2WAC A;  3G4S T;  4KUL A;  3I55 Q;  2OTL T;  2LMJ A;  3OB9 A;  1VQN T;  1OU8 A;  3ZBD A;  1RAA B;  1C1A A;  3OMC A;  3NTH A;  3NHN A;  1Y0M A;  3RKY A;  4LDV A;  4RTU A;  1M90 R;  3QHS A;  8AT1 B;  2D1X A;  3TRE A;  2DXB A;  4M77 A;  2KYB A;  2XU8 A;  3GOX A;  2ABL A;  4J7F A;  4PJO E;  2M16 A;  7AT1 B;  1WYX A;  5CO7 A;  4JLI A;  2HKN A;  4NS5 A;  4OGC A;  3M0Q A;  4GBQ A;  3G6E A;  5AYF A;  1EX4 A;  2ZAE A;  2J7I A;  3CBO A;  5HK3 A;  3VS5 A;  3VKI A;  2RQR A;  1V29 B;  2LQN A;  2X4J A;  1H8K A;  1R0B G;  1YI2 Q;  3EGD A;  3UAT A;  1YIJ T;  1CSK A;  1TUG B;  3LGL A;  1N6A A;  2JM9 A;  2DRM A;  2KYM A;  4V2S A;  2GTJ A;  4LUD A;  4LNP A;  3CCU Q;  4M75 A;  1C0M A;  1PRM C;  2XD0 A;  1UFF A;  4J6W A;  4X9C A;  4BD3 A;  4M7D B;  2V8K A;  1X69 A;  2XI9 A;  3FRN A;  3VU3 C;  2CZ0 B;  2LTO A;  2PU9 B;  5HK0 A;  2QQB A;  1BI1 A;  3VS2 A;  4KT0 E;  2L89 A;  3LYI A;  4RTY A;  2Y4Y A;  5IN1 A;  2XIC A;  2RNA A;  3M58 A;  2CKK A;  5GAO q;  4MML A;  5GMK e;  5CQY A;  4IUU A;  3FDR A;  4E7L A;  1VQ7 Q;  4EMK C;  1SF9 A;  1WX6 A;  4FW2 A;  3LX7 A;  1VQO Q;  5GAM j;  4ZTJ A;  1SEM A;  1U8R A;  1RAH B;  1VQK T;  2E12 A;  4EPC A;  5EC7 A;  3FLG A;  5D6X A;  1QVG P;  4ESR A;  3MPU B;  4EMG A;  4PFO A;  1M8V A;  3VRZ A;  4PL6 A;  2OTL A;  1KJW A;  4LDW A;  2VGN A;  2RQU A;  1VQL Q;  2KBT A;  2DRK A;  2K57 A;  5FLX E;  2NUP B;  3MET A;  1M1K U;  2MYS A;  4HCK A;  1IO6 A;  1XOV A;  2G3R A;  3LWI A;  2HMA A;  1YN8 A;  1QKW A;  4E7S A;  1G3Y A;  5GMK i;  2CZ1 B;  2DZC A;  4B6M A;  1MNE A;  1WGS A;  1VQL A;  2PNI A;  2OTL Q;  1SRM A;  2ZPF B;  1GRI A;  4A53 A;  4E7Z A;  1NZ9 A;  2DET A;  1AWW A;  2K3Y A;  3MO8 A;  2Y90 A;  4C0F A;  3LGF A;  1Q7Y U;  2EQM A;  1QVF P;  1CKA A;  1OX9 A;  1AVZ C;  1ZLM A;  2OAW A;  4M75 F;  2DJQ A;  1AZE A;  3NTK A;  4NOY A;  4L59 A;  2QEX T;  4OB3 B;  1PC0 A;  2YRD A;  4EIK A;  3VUZ A;  2V8I A;  1SG5 A;  5GJV B;  2M51 A;  3L2Q A;  1D0X A;  2ATC B;  1YFN A;  2CP7 A;  3BFM A;  5LJ3 g;  1UE9 A;  2YUN A;  1YBY A;  3QXE B;  1PRL C;  3CCU A;  1BK2 A;  3JB9 H;  1X2Q A;  2V26 A;  2KXC A;  2CH4 A;  5LJ5 h;  1TTH B;  4N0A C;  2JVV A;  1UB4 A;  4JS4 A;  2DZ9 A;  3CC2 Q;  3OBW A;  2IIM A;  3OYG A;  2ENM A;  1R8O B;  3CMA A;  2COZ A;  2O9V A;  2OAU A;  3SWN A;  2VC8 A;  2IPO B;  1SSF A;  4QQD A;  1UHC A;  2KGT A;  2K4Y A;  2CP5 A;  1BKB A;  4BE2 A;  2RI2 A;  1AWO A;  4M75 E;  3LLR A;  2J6F A;  3GPL A;  1RAE B;  1S72 T;  1OYX A;  1KC8 U;  4MDW A;  2X9H A;  1QVP A;  1JBM A;  2ZPE B;  1ZUU A;  5GAN h;  3GBQ A;  2A0F B;  5C6S A;  1WXB A;  4A4H A;  2AIR B;  3OBY A;  2LQ8 A;  3SWN B;  2KMT A;  3OYJ A;  4QT7 A;  4E2F B;  4AG2 C;  1OZ2 A;  2FZC B;  1QW1 A;  1XQH A;  1K8A C;  3JCM Q;  1VQO T;  5AT1 B;  1NE8 A;  2HNI A;  4ZGD B;  4JJD A;  3CPW A;  4BDY A;  1VQ5 T;  3I5S A;  4C8Q A;  2VUB A;  3PVQ A;  2DPP B;  3X26 B;  5IXF A;  4PLL A;  4QVZ A;  5FWB A;  2RQV A;  2MI6 A;  1JJ2 S;  3OS1 A;  1I81 A;  4DOV A;  1VQ4 Q;  4M78 D;  1D0Z A;  4C5E A;  3OW2 S;  1T0H A;  1PCX A;  2XDB A;  4M7A G;  2CP6 A;  2RO0 A;  4LD9 K;  5KYW A;  2RQT A;  3PVL A;  2YHT A;  2FHD A;  3M0S A;  5IAY A;  2KAF A;  1KHC A;  1M8M A;  2VVK A;  1M4Z A;  2QI2 A;  1YI2 T;  3ME9 A;  4A4K A;  4J9I A;  3OYN A;  1IRX A;  1VIE A;  1NEB A;  2HBW A;  4AMC A;  4Z88 A;  1AWX A;  2KQW A;  2RJE A;  3SEM A;  3CCU T;  2YUO A;  2M0Y A;  1LCK A;  2LJ1 A;  1Q82 R;  1KHI A;  2QQ9 A;  3RKW A;  4CC7 A;  3G4S A;  3O8V A;  2E3I A;  5KE3 A;  1JXM A;  2O01 E;  3PGG A;  3CME Q;  3QG1 A;  2E4H A;  2NUT A;  3M0P A;  3QKJ A;  1FMV A;  3I56 T;  4JZ4 A;  3REA B;  1K9A A;  4C8Q B;  3RNJ A;  1TG0 A;  3QDR B;  2CGH A;  3CC7 Q;  4F7U F;  2EPD A;  2K3B A;  2RJC A;  4E6R A;  2WSF E;  1RL2 A;  2HL3 A;  3OY9 A;  4XU2 A;  1KD1 C;  2VB6 A;  3JSC A;  5C0M A;  3KXT A;  3MEU A;  4FT4 A;  4AFQ C;  4RG2 A;  4XK8 E;  1VQK Q;  5GJW B;  1BI2 A;  2M02 A;  1KD1 U;  1Q86 R;  2KDS A;  1IGU A;  1M1G A;  4DA4 A;  3EG9 A;  5DY9 A;  3L1A A;  4XAX B;  3VV0 A;  1Z9Z A;  4FU6 A;  3J7A F;  2MK5 A;  4BI3 A;  3CC4 Q;  1UGP B;  2GFU A;  4ZGJ B;  3CPW P;  2M0O A;  2LT1 A;  4OF1 A;  5FWC A;  3C4S A;  5KE2 A;  4HCC A;  3G6E Q;  2CZ7 B;  1VQ6 A;  1I8F A;  4RTV A;  1XNI A;  4N4H A;  1VQ9 A;  1PSF A;  1SSH A;  1K9M R;  4LE9 A;  4RKU E;  3H8Z A;  5FW9 A;  1M1K C;  1UGR B;  2CSI A;  4FYV B;  1H3H A;  1W4S A;  1WQW A;  3C95 A;  2OI3 A;  4KUI A;  1KC8 R;  3JB9 F;  1MV0 B;  2HEQ A;  2P0K A;  1WFW A;  1WA7 A;  3NTI A;  2BZY A;  4A4F A;  1Y7X A;  2L5Q A;  2VXF A;  3CCS Q;  4Z8A A;  1ZSZ C;  4BI4 A;  1M2V B;  1PD0 A;  2KT1 A;  4OMO A;  2K7A A;  3CXC S;  5IH2 A;  4ATO A;  4MZP A;  2O88 A;  3JCM b;  4EDU A;  1W6X A;  5KYY A;  3CC2 T;  4M78 G;  2C06 A;  4FYY B;  3E19 A;  3SHW A;  2A28 A;  1SPK A;  4M4Z A;  1WNL A;  1UUE A;  3QZ5 B;  4GY5 A;  4F7U B;  3LH0 A;  1Y07 A;  3CC4 A;  2K9G A;  3I56 Q;  2E6Z A;  4HKE A;  3V7S A;  1VQM A;  1ZQ1 A;  2FG0 A;  3ULR B;  4JRQ A;  2EQJ A;  1XTD A;  1E6H A;  3GNG A;  3QYH B;  4C5G A;  3CCE T;  5GAO l;  2DD4 A;  5FU7 B;  3VJP A;  4UC4 A;  3CXC P;  3CC4 T;  3S3M A;  2AHJ B;  4M77 E;  2PUK B;  2FPE A;  3LW5 E;  3M54 A;  3EFO B;  2AKK A;  3CMA T;  3X24 B;  3BDL A;  5CVI A;  2J6O A;  2KRN A;  3CCV A;  1YWO A;  3QZ9 B;  5A0D A;  2LX9 A;  2R58 A;  3SB2 A;  3N5B B;  1Q82 U;  3M5A A;  1YJW Q;  2OTJ A;  3OW2 P;  5CIU A;  2YXY A;  1HSQ A;  5GAN j;  2RI5 A;  2EAY A;  1YHQ Q;  1BBZ A;  1FWZ A;  3CPF A;  5CKH A;  1UG1 A;  2HSE B;  4PJO F;  4Y28 E;  2LNV A;  2LX7 A;  3CBP A;  2YLC A;  3BY7 A;  5GAO p;  3HP9 A;  3CME A;  3Q1J A;  4E7K A;  1J3T A;  2DL7 A;  5GAM g;  3SD4 A;  2NUP A;  2VAS A;  4A63 B;  4KGZ B;  2JS0 A;  1NJI U;  2KRO A;  2F69 A;  4C8Q G;  4OB2 B;  1KG1 A;  1SKU B;  1UDL A;  4PJJ A;  3THK A;  1MMD A;  4RTT A;  2A3L A;  3OYM A;  1Q7Y C;  1VQ6 T;  1WHJ A;  4F14 A;  3OYK A;  4PJO D;  2EQI A;  2K3X A;  2W0Z A;  1N27 A;  2V1Q A;  4M78 E;  1QLY A;  2B86 A;  1PWT A;  4J9B A;  1PNJ A;  4A54 A;  4RCB A;  2KSS A;  2QDL A;  2QA4 T;  3FJ5 A;  2O4X A;  1GCQ A;  4AG1 C;  2LQK A;  1FX7 A;  4ZTF A;  2L3Q A;  3JCM P;  3URG A;  2MMP A;  1OX8 A;  1B34 B;  5I22 A;  1TWB A;  1VQ5 A;  3DB3 A;  2E1H A;  1U1T A;  1X75 C;  5GAN 4;  2JUF A;  1X43 A;  1VQ9 T;  2L3P A;  3TSW A;  4L6V 5;  1JJ2 P;  1E6G A;  2MWO A;  1NYF A;  2EIF A;  1VQP Q;  2P4T A;  4PKC C;  2DAQ A;  2DK3 A;  2FO0 A;  1QWF A;  3E9F A;  1K9M U;  2O4X B;  5LJ5 g;  3TSZ A;  4NL3 A;  2D8J A;  3PFS A;  2RN8 A;  3HFN A;  3CC7 A;  1WHH A;  9ATC B;  2RPN A;  4E7H A;  2FYK A;  3X25 B;  2ZPH B;  4KH1 B;  3ZFJ A;  2EWN A;  5KYU B;  2O31 A;  1MMA A;  2QG9 B;  3VS4 A;  4CC3 A;  4PFZ A;  2YRC A;  3CPW S;  2MCN A;  2EGE A;  4J6Y A;  3MP6 A;  3CCM Q;  2P4R A;  1YJ9 T;  5KYX A;  1QVF S;  2JTM A;  4AT1 B;  2V8J A;  2JMA A;  2YUQ A;  2BKD N;  3EGX A;  1VQM T;  4M77 D;  2RK2 A;  4PLI A;  4XTZ A;  3PT9 A;  4AFU C;  2F2V A;  2AZS A;  2BE7 D;  2EKH A;  5L23 A;  2H3E B;  1Y96 B;  4C8Q F;  3UDC A;  1M9S A;  1WDX A;  5L8R E;  5LL6 S;  4QVC A;  2KRS A;  2K79 A;  1VQ7 T;  4J6X A;  4M7D C;  4BAC A;  2X4W A;  5GMK m;  3EGX B;  2DO3 A;  3M9Q A;  4A4G A;  1K1Z A;  3QYG B;  4E47 A;  1MND A;  3P8H A;  1WXU A;  2PUO B;  2AKL A;  3R6N A;  3JCM g;  2WSC E;  3H6Z A;  5FRN A;  3OSV A;  1ACM B;  2JJ9 A;  4HT9 A;  2RM4 A;  4J9F A;  3OS0 A;  2HL5 C;  4KGV B;  3QSU A;  4F17 A;  1ABO A;  1GFD A;  4JZ3 A;  5FU6 C;  2KY9 A;  3FEO A;  3CCL T;  5CQX A;  3OW2 A;  4RTW A;  4R0K A;  1VQP T;  1G83 A;  4IUT A;  4JJB A;  1Q81 R;  2FPF A;  5LJ3 e;  1VQN Q;  4CI0 C;  4OML A;  4BE0 A;  3OQ5 A;  3VYG A;  3UT1 A;  2QK0 A;  2BZ8 A;  2QQR A;  1TOV A;  1MHN A;  2O9S A;  1ZBX A;  3CCR Q;  3M56 A;  4FSX A;  4M7A C;  2YUP A;  4HCZ A;  3V8K A;  1E7O A;  3JB9 D;  4J5Y A;  2QTV A;  1YJ9 Q;  3A8H B;  4LXC A;  5I2M A;  2XKO C;  4C8Q C;  3S6W A;  4DBQ A;  1BB9 A;  4JJC A;  2MPX C;  1AHJ B;  4PJN A;  3L2U A;  3CD6 T;  4QVD A;  1QCF A;  3BE3 A;  2F2X A;  3OSS C;  4JS5 A;  4FL6 A;  1T3L A;  3FC3 A;  3M0U A;  2XDD A;  2D9T A;  1YJW T;  2YRV A;  2DNU A;  1UJY A;  4ORZ A;  3OYA A;  1T3S A;  3C94 A;  4PJO B;  2E6N A;  3HTR A;  3O5Z A;  1A0N B;  3EG3 A;  2ECZ A;  2K6D A;  2XG8 D;  1NM7 A;  2DYI A;  4RMO A;  2P0Q A;  3DB4 A;  3L2W A;  1N5Z A;  2QEX A;  3HRU A;  4OB0 B;  2JM8 A;  1WHK A;  4OP0 A;  2EGC A;  2D0N A;  2EBP A;  1G3S A;  1Q95 G;  5FU7 C;  3H41 A;  2CSQ A;  4XTU A;  5A0L A;  3L2V A;  1GXI E;  1OZ3 A;  1OQK A;  3RDV A;  1X2K A;  3X20 B;  2CS7 A;  4LDX A;  3VRY A;  1D09 B;  2KNB B;  1PM3 A;  4O6J A;  2RA2 A;  2YT6 A;  1ZSZ A;  2DTO A;  5I2S A;  2IVW A;  1GBQ A;  2QQA A;  1YJ9 A;  2D6F A;  3VUB A;  1HJD A;  1Z9Q A;  4XU3 A;  1VUB A;  2DXT A;  4JPB W;  1IRE B;  2CUD A;  3EG2 A;  5FRM A;  3CCR A;  1TSF A;  2MIO A;  1TS9 A;  1BCO A;  3H0F A;  5CKE A;  3PMI A;  5HY6 A;  1ZSZ B;  3EH2 A;  3JV3 A;  1WJS A;  3OYY A;  4GLK A;  1Y57 A;  3JB9 G;  2EJ9 A;  2EYW A;  2GQV A;  2CT4 A;  1FMK A;  3CQT A;  3OYC A;  1OV3 A;  4BB7 A;  2DFU A;  4PJO C;  1D1C A;  1RI9 A;  3CBM A;  4QQG A;  5CCA A;  1QCN A;  4PJM A;  5GAN 2;  4XTW A;  2E5K A;  2QA4 Q;  3G71 Q;  1I07 A;  2SEM A;  1G5V A;  1K76 A;  1Y71 A;  4JJN K;  4QKU A;  2JMC A;  5HCK A;  2LQW A;  2QQS A;  3EFO A;  1H64 1;  2DTI A;  3V8L A;  3JB9 I;  1W70 A;  3CCM T;  2K5L A;  1GBR A;  2GF7 A;  4CRI A;  1GFC A;  1VQM Q;  1I5O B;  4OVA A;  4KBM B;  2L0A A;  4Y91 A;  1W2B S;  4FIB A;  5GAN f;  3OYF A;  1AWJ A;  1Q81 U;  1NJI R;  3CC7 T;  1VQ8 A;  4M7A B;  3M53 A;  1M30 A;  2O2O A;  4WF2 A;  3RES A;  1K73 C;  2FL7 A;  1RAB B;  2CP0 A;  2CUB A;  3FB9 A;  4M7A E;  2DXC A;  5LJ5 e;  1M5Q 1;  1RAG B;  4FYW B;  1M3A A;  4PJO A;  2QXF A;  2J6K A;  3X28 B;  2JNG A;  5GMK j;  1S72 Q;  2D8H A;  2RHZ A;  4VUB A;  1KQS A;  2V1R A;  4A4E A;  2DBM A;  3PMT A;  1ZUY A;  2CP3 A;  5GAO n;  3CCE A;  3HKS A;  4FW1 A;  1ABQ A;  1YJN T;  4BUG A;  1U3O A;  4C92 C;  2XMF A;  1RAF B;  2DM1 A;  3BDU A;  1N8R R;  2YDL A;  2IG0 A;  5GAM h;  4M77 F;  4M75 C;  4OMN A;  2EVR A;  1VQ5 Q;  1QP2 A;  2GQI A;  3LWH A;  3CCL Q;  1C6V X;  2ZPB B;  3M59 A;  2FRY A;  4C8Q D;  3QDF A;  5GAN g;  3ZL7 C;  4Z89 A;  5ECA A;  2FRW A;  1YWP A;  2J05 A;  3U23 A;  5D6W A;  1VQ4 T;  1NLP C;  4FYX B;  4C0Z A;  2C0I A;  3OYB A;  2EQU A;  1W2B P;  5GAN 6;  1KQ1 A;  3A1P A;  3JCM V;  2HBP A;  4J9G A;  1EZZ B;  2PVG B;  1MGQ A;  4DBR A;  1ZX6 A;  4EMK B;  4RCC A;  1WQ7 A;  3ER0 A;  4M77 G;  3CCR T;  3QPH A;  4FSS A;  2H3J A;  5IHI A;  4AFZ C;  4ME7 A;  2DIG A;  4M77 C;  3MP8 A;  2KE9 A;  2QAS A;  1VYV A;  5A0G A;  2OX7 A;  4K11 A;  2NWM A;  1UTI A;  1QVG A;  4C92 E;  4IIO A;  5J39 A;  4CC2 A;  1YCS B;  3G1J A;  1XJW B;  1JO8 A;  3PE0 A;  5DLO A;  4DBF A;  3IQL A;  1RI0 A;  1KQS P;  2GNC A;  2LDM A;  2K5F A;  1JXO A;  1AEY A;  3CCJ T;  2VKN A;  2GTO A;  2HZY A;  2OTJ Q;  1JJ2 A;  4PJL A;  5D7U A;  3G71 T;  2LP5 A;  4CC4 B;  2QGG A;  4BY6 C;  5IXB A;  5GAO m;  3M0R A;  2DD5 A;  5GMK l;  5J26 A;  4F04 B;  2P0P A;  1M3B A;  3OYH A;  2XID A;  4II1 A;  3OYD A;  1KC8 C;  3SWN C;  2LZ6 B;  2ROT A;  3M4Y A;  3VS3 A;  3RKX A;  2EGA A;  4JRK A;  1KQ2 A;  1AOJ A;  2JS2 A;  4KH0 B;  5LJ5 j;  2GBQ A;  1QVF A;  2EFI A;  2RI3 A;  1ZA2 B;  3QJ6 A;  1IGQ A;  1AD5 A;  1D0Y A;  3SDZ A;  2E3H A;  1UGQ B;  1Y96 A;  1SHF A;  2VGM A;  3V7R A;  3JCM X;  2JZ2 A;  3JCM f;  3VS0 A;  3M0T A;  2L3R A;  3I56 A;  3RMQ A;  2HQH A;  2F5T X;  2RQW A;  2DER A;  1HXD A;  5KYN A;  4E7I A;  4J7I A;  5CKF A;  1BI0 A;  4FCY A;  2AK5 A;  2KR3 A;  3QUI A;  2DVJ A;  4JDS A;  2DLP A;  4IIM A;  1K4U S;  1S1N A;  4HCB A;  3JCM c;  4JUV A;  4ELY C;  2BTT A;  3OMG A;  1I5L A;  2KI7 A;  2DE0 X;  4C92 G;  3V8J A;  1IZ6 A;  1KD1 R;  1PKT A;  4E7J A;  1UJ0 A;  5LJ3 f;  5M9O A;  2MF2 A;  1WZO A;  1YIT T;  1LPL A;  4N0A A;  3HRS A;  1UEC A;  2DX1 A;  1B07 A;  1W2B A;  1ARK A;  1D3B B;  1ZBJ A;  5DM7 R;  1VIF A;  3JCM e;  4FM4 B;  1QMC A;  2A7Y A;  1EIF A;  4MZT A;  1DJ7 B;  1X01 A;  5FRO A;  3GNF B;  2DYB A;  5CK9 A;  1BIA A;  1LJO A;  3JRZ A;  5GAN 7;  4RTX A;  4ZNX A;  4XTY A;  1T0J A;  1N9R A;  4X9D A;  3QWY A;  4C0G A;  8ATC B;  1UGV A;  1VQ9 Q;  2Y4X A;  4EMK A;  1BYM A;  4IUQ A;  3EAE A;  2NUT B;  4DBH A;  4BY6 B;  1FMW A;  3G7Z A;  2JT4 A;  5D6Y A;  2FZG B;  4NL2 A;  1U5S A;  3HL8 A;  1Q81 C;  3KFV A;  3CMA Q;  1WIE A;  2E70 A;  3RER A;  1M90 U;  2HDA A;  2COW A;  1JU5 C;  3CC2 A;  4LDU A;  1JQQ A;  4M7D A;  1WPY A;  3A5Z B;  3DLM A;  2DIL A;  3GLX A;  4HA8 A;  1P92 A;  2XK0 A;  3EH1 A;  3GP8 A;  1AT1 B;  2EJF A;  4ZN3 A;  2VXE A;  1F1B B;  2A37 A;  1K73 U;  1RAC B;  2RJD A;  4MZM A;  4M77 B;  1VQK A;  3C12 A;  3CEY A;  2QTX A;  4X1V A;  3AT1 B;  3V7C A;  3RBB B;  4ELZ C;  2H8H A;  5GAM e;  1B34 A;  3G71 A;  1X27 A;  2RH2 A;  3L2Z A;  1MMG A;  1N8R C;  2L3S A;  4EMH A;  4Y92 A;  4JRI A;  3QII A;  1RAD B;  3CD6 A;  2HD0 A;  3J80 E;  4FT2 A;  4PFP A;  3VS1 A;  1OPK A;  1TU0 B;  2X3X D;  1KIK A;  2DBK A;  4LN2 A;  1YHQ T;  3J81 E;  1VYU A;  3P8D A;  5A2Q E;  1OI1 A;  3EGU A;  4WTO B;  2A08 A;  1U1S A;  4M78 B;  3L2R A;  2BIV A;  2P84 A;  1YCY A;  1H92 A;  5KH6 A;  3G4S Q;  1X6B A;  1I1J A;  2JOY A;  4QW2 A;  3BW1 A;  5KYU A;  1K73 R;  4GLM A;  1YIT A;  4DEY A;  2C0T A;  3NGP A;  2ED1 A;  1NJI C;  3EFS A;  3MKD A;  2MOX A;  2RD1 A;  2VWF A;  4XU1 A;  3WXM B;  3E2U A;  1PD1 A;  2LC4 A;  1YJN A;  1LNX A;  2ZCF B;  3D7S B;  1VQ4 A;  2CDT A;  2E5Q A;  1G3T A;  2EYY A;  4D8K A;  2HKQ B;  1R77 A;  5KCH A;  2BZX A;  4XQ3 A;  2PQW A;  2RF0 A;  4RUG A;  4HXJ A;  2JW4 A;  5CR2 A;  2DTH A;  5GAN 5;  5J3B A;  1X6O A;  4B9X A;  1TUC A;  3CCL A;  1VQO A;  2DKG A;  2KXD A;  4MMK A;  2R5A A;  1KQS S;  2W10 A;  2DIQ A;  1O75 A;  2PVD B;  3F70 A;  1OUL A;  2QEX Q;  3AHU A;  3CCQ Q;  3S3O A;  4B9W A;  3JCM J;  2J06 A;  3KBG A;  3FJP A;  3UPU A;  3QWX X;  1M1F A;  2D0Q B;  3MEW A;  3LH5 A;  2PVO B;  3QO3 A;  3H0H A;  4P5N A;  1M2V A;  2LCS A;  2M1H A;  3JCM h;  3HFO A;  1Q7Y R;  5GAM f;  3EG1 A;  1KFZ A;  3RIR A;  2LNH B;  3A8O B;  5LJ3 d;  1M1K R;  4LDY A;  1G8X A;  4JLG A;  3MP1 A;  2M9U A;  2F1L A;  5GAN d;  3PIO A;  2R57 A;  5I21 A;  3UF4 A;  1H3Z A;  1TH7 A;  1WJR A;  1VQN A;  4JRP A;  2EKO A;  3A8G B;  1G3W A;  3OA6 A;  4C92 A;  3I5R A;  2A36 A;  5LJ3 h;  4J9D A;  4BDZ A;  5KYX B;  2K2V A;  3I35 A;  1ZHI A;  4M7A D;  1SRL A;  2RJF A;  4D8D A;  3E9G A;  1EFN A;  3REB B;  3VS6 A;  1WI7 A;  2RB6 A;  2DEQ A;  4ZN1 A;  2CZ6 B;  1O9S A;  2Z0W A;  4J9E A;  3I55 A;  2RHX A;  4OMQ A;  1JRI A;  2ZPI B;  4ANJ A;  1YNZ A;  1KSW A;  2ED0 A;  3UA7 A;  2XHC A;  5GAN 8;  4LD6 A;  3CCV T;  2QYZ A;  2X3W D;  4J8O A;  1K0S A;  1IHV A;  2DA9 A;  2ZGW A;  3TU4 K;  1HYO A;  2ESW A;  3M4G A;  5LJ3 j;  3HRT A;  5DLQ E;  2QAZ A;  1YIT Q;  2KT8 A;  2E41 A;  1BIB A;  1ZA1 B;  2ZZD A;  1V76 A;  3CME T;  1B3Q A;  1NG2 A;  1NPP A;  4HVV A;  1BI3 A;  4J83 A;  1PKS A;  1G2B A;  3ASK A;  2EYX A;  4IKF A;  1IXD A;  5IHK A;  2FEI A;  3TQ7 P;  4KGX B;  4F16 A;  3A98 A;  1VQ7 A;  2FPD A;  1R0C B;  3INZ A;  2VV5 A;  5GAM d;  3CD6 Q;  3CCQ T;  4O5V A;  1NLO C;  1GL5 A;  1I0C A;  1HD3 A;  3NFC A;  1M90 C;  4C92 F;  4PK4 A;  2K2M A;  3JAM E;  3A8L B;  2LCL A;  4N4G A;  4C0D B;  3CCQ A;  3WVE B;  1Q86 U;  1K9M C;  2E64 A;  2QGF B;  5KYW B;  4OMF B;  1QKX A;  2YSQ A;  4L5G A;  4M78 A;  3CCJ A;  1VOM A;  2AZV A;  2I0N A;  2JXB A;  4Z02 A;  4F7U A;  1VQP A;  2L8D A;  5I11 A;  4YTL A;  3VS7 A;  5FU6 B;  2JTF A;  1WLP B;  1YI2 A;  4IUR A;  3M55 A;  2NLU A;  1YJN Q;  4KRT A;  4HVU A;  2F5K A;  1QQJ A;  1W1F A;  3HHT B;  3I55 T;  2LCC A;  1AZG B;  3KUF A;  1Q86 C;  5CAI A;  2FZK B;  1OPL A;  2ROL A;  2RHY A;  4XTX A;  3DLL A;  1N9S A;  1K0X A;  1IHW A;  3EG9 B;  4IUP A;  3I9Q A;  1WHL A;  4M7D E;  2E65 A;  1X6G A;  2EYZ A;  2BE9 B;  2LVM A;  4Q5W A;  3H9N A;  2KVQ G;  3TEE A;  4DEX A;  1UHF A;  3NMZ C;  3RR6 A;  2ZPG B;  3WVD B;  1WXT A;  2LJ3 A;  2LT4 A;  5GMK h;  2L2P A;  3MEA A;  3G6E T;  3UA6 A;  1FXX A;  2NUZ A;  1SHG A;  2R5M A;  5IHN A;  4WCI A;  4XTV A;  1M3C A;  3CCV Q;  2KEA A;  4PJO G;  2X35 A;  2HAX A;  4F7U E;  2GFA A;  3OS5 A;  1YHQ A;  1Q82 C;  2DMO A;  1BU1 A;  3QJY A;  4HVW A;  1QWE A;  4M7A A;  5KCO A;  2QDY B;  4OB1 B;  2EQK A;  5GAN 3;  1FYN A;  4OMM A;  1PHT A;  2X4X A;  3RMS A;  4J9C A;  1OOT A;  2JTE A;  1WJQ A;  4BE1 A;  1OEB A;  1BCM A;  1WHG A;  2OJ2 A;  2LJ0 A;  1UGS B;  5LJ5 d;  4HT8 A;  2FB7 A;  3EG0 A;  1WHM A;  3MCA B;  2SRC A;  3OS2 A;  3L42 A;  1OU9 A;  4M75 B;  1MMN A;  3PTA A;  3CXC A;  1NEG A;  1U06 A;  2LRQ A;  2MAM A;  3GIB A;  4C92 B;  2DXU A;  1D1A A;  1M27 C;  3CCM A;  1LOJ A;  5GAN e;  3OYE A;  1I4K 1;  2DL8 A;  3ZEH A;  3H0I A;  1K8A R;  2DL3 A;  4IUV A;  2XDP A;  6AT1 B;  1PG5 B;  1JEG A;  1QVG S;  4C0D C;  1NPR A;  5CKB A;  1VQL T;  1RAI B;  2DVE A;  3R6O A;  1NBE B;  5GAO r;  5EG2 A;  3CCS A;  1QCO A;  3E1S A;  2EJG A;  4DQ2 A;  1QP3 A;  2YLB A;  2PZ1 A;  4PNO A;  1PSE A;  3S3N A;  1ZUK A;  3EFR A;  4M78 C;  2DEU A;  1M2O A;  1V1C A;  1VQ8 T;  2KK4 A;  3PNW C;  2CYZ B;  2YWW A;  2JN0 A;  1VQ6 Q;  3TVT A;  2K5I A; 
#chains in the Genus database with same CATH homology
 2H8H A;  1X27 A;  2GGR A;  1NEB A;  1QCF A;  2HBW A;  2L3S A;  4Z88 A;  1YP5 A;  1AWX A;  2F2X A;  4Y92 A;  3SEM A;  1T3L A;  1NYG A;  2YUO A;  3M0U A;  2M0Y A;  1LCK A;  2LJ1 A;  4CC7 A;  3VS1 A;  1OPK A;  1JXM A;  2DNU A;  1UJY A;  4ORZ A;  3EHQ A;  2PTK A;  1T3S A;  4OMP A;  2X3X D;  3O5Z A;  1KIK A;  2DF6 A;  3EG3 A;  1A0N B;  2DBK A;  4LN2 A;  2ECZ A;  2K6D A;  3M0P A;  1VYU A;  1NM7 A;  1RUW A;  3EGU A;  4JZ4 A;  4AFS C;  3REA B;  2EW3 A;  1K9A A;  2A08 A;  1H92 A;  1N5Z A;  2G6F X;  2JM8 A;  1X6B A;  1I1J A;  1TG0 A;  3RNJ A;  2EGC A;  2D0N A;  2EBP A;  4GLM A;  3H41 A;  2CSQ A;  4DEY A;  2EPD A;  2C0T A;  2K3B A;  3NGP A;  2ED1 A;  4E6R A;  3NPF A;  1X2K A;  2MOX A;  2RMO A;  2DL5 A;  2VWF A;  2F2W A;  3VRY A;  2KNB B;  2YT6 A;  3C0C A;  3EHR A;  1VYT A;  2CDT A;  2EYY A;  4D8K A;  4AFQ C;  2HCK A;  1GBQ A;  5GJW B;  1RLQ C;  2BZX A;  1GCQ C;  1HJD A;  2RF0 A;  4RUG A;  4HXJ A;  1Z9Q A;  2JW4 A;  2CH4 W;  4JPB W;  2CUD A;  1TUC A;  3EG2 A;  1RLP C;  2KXD A;  2MIO A;  2W10 A;  1Z9Z A;  3H0F A;  2HSP A;  1VA7 A;  2C0O A;  3JV3 A;  4RTZ A;  4LUE A;  1Y57 A;  1TUD A;  2DL4 A;  2J06 A;  5FWC A;  2EYW A;  2CT4 A;  1FMK A;  1GCP A;  3CQT A;  3QWX X;  1OV3 A;  4J9H A;  3LH5 A;  4RTV A;  3H0H A;  1SSH A;  1RI9 A;  2CRE A;  4LE9 A;  2LCS A;  5FW9 A;  2KRM A;  2CSI A;  2E5K A;  3EG1 A;  1KFZ A;  1H3H A;  1I07 A;  1ZSG A;  2SEM A;  2CT3 A;  1CKB A;  2LNH B;  1K76 A;  2JMC A;  2OI3 A;  5HCK A;  2LQW A;  1MV0 B;  1MUZ A;  2HEQ A;  1W70 A;  1WA7 A;  1WFW A;  2BZY A;  3UF4 A;  1GBR A;  1MV3 A;  1GFC A;  4Z8A A;  2L0A A;  2KT1 A;  4OMO A;  2K7A A;  1AWJ A;  2LMJ A;  1M30 A;  2O2O A;  5IH2 A;  3I5R A;  2O88 A;  2A36 A;  1W6X A;  4J9D A;  2CUB A;  3I35 A;  3NHN A;  1Y0M A;  4RTU A;  1M3A A;  3SHW A;  1SRL A;  2D1X A;  2J6K A;  4D8D A;  2KYB A;  1EFN A;  3REB B;  2D8H A;  2A28 A;  2ABL A;  3VS6 A;  1SPK A;  4M4Z A;  2V1R A;  1UUE A;  1WI7 A;  1WYX A;  2DBM A;  1ZUY A;  3M0Q A;  4GBQ A;  4J9E A;  2K9G A;  4OMQ A;  1ABQ A;  2J7I A;  1U3O A;  2FG0 A;  3ULR B;  2XMF A;  1E6H A;  1YNZ A;  2DM1 A;  1KSW A;  2ED0 A;  3VS5 A;  3UA7 A;  2RQR A;  2LQN A;  1H8K A;  2X3W D;  2YDL A;  3UAT A;  2FPE A;  1CSK A;  4OMN A;  2EVR A;  1K0S A;  2GQI A;  2DA9 A;  2AKK A;  2JM9 A;  2FRY A;  2J6O A;  2KRN A;  2DRM A;  3ZL7 C;  1YWO A;  2KYM A;  4Z89 A;  5ECA A;  2GTJ A;  4LUD A;  2FRW A;  4LNP A;  1YWP A;  2ESW A;  2J05 A;  3U23 A;  1PRM C;  1UFF A;  1NLP C;  2KT8 A;  2C0I A;  1HSQ A;  1B3Q A;  1X69 A;  1NG2 A;  4HVV A;  1BBZ A;  1UG1 A;  4J9G A;  1G2B A;  1PKS A;  2EYX A;  2LX7 A;  1ZX6 A;  3VS2 A;  5IHK A;  2FEI A;  4RTY A;  4F16 A;  3A98 A;  4FSS A;  1J3T A;  2DL7 A;  2FPD A;  2RNA A;  5IHI A;  4AFZ C;  4A63 B;  2JS0 A;  2KE9 A;  1VYV A;  2KRO A;  1NLO C;  1GL5 A;  1I0C A;  1HD3 A;  1UDL A;  4K11 A;  3THK A;  2NWM A;  1WX6 A;  4RTT A;  1UTI A;  1SEM A;  4IIO A;  4CC2 A;  1YCS B;  1JO8 A;  2K2M A;  4F14 A;  3PE0 A;  2EQI A;  3IQL A;  2W0Z A;  5EC7 A;  2GNC A;  2V1Q A;  1JXO A;  1AEY A;  1QLY A;  2B86 A;  2VKN A;  1PWT A;  4J9B A;  1PNJ A;  2GTO A;  4ESR A;  2QDL A;  3VRZ A;  2LP5 A;  3FJ5 A;  1KJW A;  4CC4 B;  1GCQ A;  1QKX A;  2RQU A;  2YSQ A;  3M0R A;  4AG1 C;  2KBT A;  5IXB A;  2DRK A;  2L3Q A;  2AZV A;  2I0N A;  2JXB A;  1M3B A;  5I22 A;  4HCK A;  5I11 A;  3VS7 A;  1IO6 A;  2LZ6 B;  1XOV A;  2ROT A;  3VS3 A;  2EGA A;  1WLP B;  1X43 A;  2L3P A;  3TSW A;  1YN8 A;  1QKW A;  1AOJ A;  2JS2 A;  1E6G A;  2GBQ A;  1NYF A;  4KRT A;  4HVU A;  2FO0 A;  1W1F A;  1QWF A;  2PNI A;  1SRM A;  1AZG B;  3TSZ A;  1GRI A;  2D8J A;  1OPL A;  2ROL A;  1AWW A;  2RN8 A;  1K0X A;  1AD5 A;  2RPN A;  3I9Q A;  1CKA A;  1SHF A;  1X6G A;  1AVZ C;  1ZLM A;  2OAW A;  2EYZ A;  2O31 A;  3VS4 A;  4CC3 A;  2DJQ A;  3VS0 A;  1AZE A;  3M0T A;  2MCN A;  2EGE A;  2RQW A;  4EIK A;  2P4R A;  4DEX A;  1UHF A;  3NMZ C;  5GJV B;  2M51 A;  1WXT A;  2LJ3 A;  2JMA A;  2YUQ A;  2L2P A;  2AK5 A;  1UE9 A;  3UA6 A;  2YUN A;  2KR3 A;  2DVJ A;  2NUZ A;  1PRL C;  4AFU C;  2F2V A;  1SHG A;  1BK2 A;  2AZS A;  5IHN A;  4WCI A;  1X2Q A;  1M3C A;  2DLP A;  2EKH A;  2CH4 A;  2KXC A;  4IIM A;  5L23 A;  2KEA A;  1K4U S;  1S1N A;  2DMO A;  1WDX A;  2BTT A;  1BU1 A;  2IIM A;  4HVW A;  2DE0 X;  2KRS A;  2K79 A;  1QWE A;  2ENM A;  1FYN A;  1PKT A;  4OMM A;  2O9V A;  1PHT A;  4J9C A;  1UJ0 A;  1OOT A;  2JTE A;  1UHC A;  2KGT A;  1OEB A;  1K1Z A;  2OJ2 A;  2LJ0 A;  1UEC A;  2DX1 A;  1B07 A;  1ARK A;  1AWO A;  1ZBJ A;  3EG0 A;  2J6F A;  1WXU A;  2SRC A;  2AKL A;  3R6N A;  1ZUU A;  3GBQ A;  1NEG A;  4J9F A;  2DYB A;  1WXB A;  1U06 A;  4F17 A;  1ABO A;  4RTX A;  4ZNX A;  1T0J A;  4JZ3 A;  1GFD A;  3QWY A;  4QT7 A;  4AG2 C;  1UGV A;  1M27 C;  4RTW A;  4R0K A;  1G83 A;  4JJB A;  2FPF A;  4OML A;  2JT4 A;  4JJD A;  2DL8 A;  1U5S A;  3I5S A;  3KFV A;  1WIE A;  3PVQ A;  3H0I A;  2DL3 A;  2BZ8 A;  5IXF A;  5FWB A;  2HDA A;  1JEG A;  1JU5 C;  2O9S A;  2RQV A;  1JQQ A;  2DIL A;  2YUP A;  1T0H A;  1E7O A;  2A37 A;  2RQT A;  2PZ1 A;  3PVL A;  3M0S A;  1ZUK A;  1BB9 A;  1M8M A;  2VVK A;  1V1C A;  4JJC A;  4X1V A;  3RBB B;  4J9I A;  3TVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...