2EKKA

Solution structure of ruh-074, a human uba domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
47
Chain Sequence
b'GSSGSSGVNQQQLQQLMDMGFTREHAMEALLNTSTMEQATEYLLTHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBA domain from E3 ubiquitin-protein ligase HUWE1
publication title Solution structure of RUH-074, a human UBA domain
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 47
sequence length 47
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ekkA00
2QHOB 1ZMUA 2MR9A 3E46A 2CWBA 2DAEA 2ZTCA 1MN3A 2DI0A 2QNJA 3BBZA 1G3IA 1IFYA 1OKSA 1KYIA 1NV9A 1DV0A 2LVOC 2EKKA 1P3QQ 1G41A 1OAIA 1A5TA 2JUJA 1OTRA 1R4GA 2B3TA 3H4JA 1JR3E 2WZJA 3LCUA 1C7YA 2DZLA 2JY7A 1ZV1A 2O25A 1HT1E 2DNAA 2EJSA 1WIVA 2JY8A 3FRHA 4UN2B 1Y8GA 1WGNA 2BWBA 2ZTDA 2RRUA 1VDLA 2JNHA 1TTEA 1E94E 1DO2A 2EKFA 1EFUB 2L4EA 4F1IA 1G4AE 4GEWA 1XXHE 2QSFX 2R0IA 2DAKA 2L4FA 2JZ1A 1ZMVA 2LVNC 1GO5A 4G3OA 2LVPC 1VQ1A 1WR1B 2JP7A 1NV8A 1ZMWA 1T6OA 2JY5A 2HAKA 3GLGE 1PGYA 2LBCA 1VG5A 4DBGB 2DHYA 3GLHE 1TR8A 2LTUA 3IHPA 2LVQD 2DAGA 3FRIA 2MROB 1UFZA 1WGLA 2DAMA 1DO0A 1OQYA 3LCVB 2G3QA 4HEOA 2OO9A 2HWJA 1HJPA 1F4IA 2K0BX 3E21A 2L2DA 3B89A 2MGWA 1Q02A 2JY6B 5JI2E 2OOBA 1WJ7A 1VEJA 2DENA 2BWEA 3K9OA 1HQYE 2MJ5B 1HT2E 4F2LA 2JZ0A 1VEKA 2KNVA 1VEGA 1SG9A 1IXSA 3GLFE 3F92A 2DAIA 3IECA 2DKLA 1BVSA 1V92A 3T6PA 3K9PA 1IM2A 3FE3A 2KHHA 1QZEA 1AIPC 1T43A 2KNZA 4Q7JA 2K9DA 3MMPA 4WP2A 1XB2B 2KNAA 2H5XA 2OOAA 4R71A 3GLIE 5DFLA 2LVAA 1WHCA 2CP8A 1YLAA 1CUKA
chains in the Genus database with same CATH superfamily
1ZMUA 3TE6A 3TWMA 1YUBA 3GLFA 3DZDA 4G4OA 4D80A 2BJVA 2DI0A 3HU3A 4X64M 4CISA 2XSZD 2VIIA 3BBZA 5IREB 3BOSA 3VDPA 3W68A 1IN4A 4DV2M 2LVOC 1MU5A 1W5TA 1OTRA 1R4GA 2JUJA 2Z8YM 3IG8A 3THGA 2O01F 3NBIA 1R2YA 2WZJA 3LCUA 4M0DA 3U6MA 4Z8XA 3L29A 4GC9A 1N34M 2CV1A 1HT1E 4NL4H 3LQRA 4DV7M 3U61A 2CV0A 4RF0A 4REZA 2ZM6M 2RGOA 4DUYM 5BPVA 3FRHA 4UN2B 4DR3M 4LZJA 4GMQA 5KO3A 3KP0E 2DWLA 2CEAA 2F4VM 4ITQA 4II7A 4L4UA 2P5TA 3FYDA 4LGMA 1TTEA 1D0LA 3U6DA 4CIZA 3JR5A 1N36M 1GL7A 1DGHB 4F1IA 1NNJA 3T15A 4LJ5A 1XXHE 2R0IA 4JI1M 3HU2A 4LCBA 1GO5A 4YHHM 4G3OA 1ZQ9A 5EQTA 1L8QA 1OIZA 1R7RA 1WR1B 3HGIA 4X66M 4CGYB 4PCZA 3GLGB 1Q3CA 3I4VA 4MM3B 2LBCA 4DR2M 1VG5A 3PXGA 2DHYA 3KSXA 4CJ6A 4LFBM 3IHPA 1QAOA 3GRUA 3Q8XA 2QPAA 3J2PB 3OTOM 1S3SA 4DV4M 2ZBKB 4DV1M 3CGWA 4B3TM 3EIEA 3JR4A 4LJ8A 3LW5F 4XBOA 1DGFA 1TF0B 1FJGM 1MX0A 2LXEA 3ZCBB 2DZNB 2CHVA 4OVZA 1UFZA 3DFZA 1WGLA 1XXHA 2WSEF 1OFIA 3WHLA 2VDBB 3GQ5A 4DV0M 2Z4RA 4QOZC 1Z5CA 2HHHM 2G3QA 4LF9M 3KOWE 5EP3A 4GKKM 1HNZM 4QOSA 2HWJA 4KLNA 4PDIA 4ANRA 1NHGC 1IN7A 2V6ZM 2I7NA 5E26A 2L2DA 2CHGA 3B89A 1Q02A 3D8LA 5JI2E 4MGIE 4G4QA 2OOBA 1R2ZA 3I04M 3J7AS 1VEJA 2FFJA 2DENA 2BWEA 1HQYE 1NJFA 1YSYA 2MJ5B 3C9PA 2EA0A 2JZ0A 4L8RC 4B7HA 3AL0C 4R7GA 1AUAA 2KNVA 4IBIA 1VEGA 3U5ZB 4OW0A 4IBGA 2ZANA 4JI0M 3U6EA 1XC8A 5JI3E 2RKOA 3W0LB 3D8BA 4FWGA 4LY6A 1V92A 3SAUA 4LF6M 3J81S 4JXJA 1NHWC 3K9PA 3KS4A 3TWLA 2F5QA 1X37A 3AKZA 4DV3M 2K6BA 1PM5A 2CHQA 3FUUA 4L15A 2UUBM 2KXEA 4IBBA 4YY3M 1T43A 3FUXA 4Q7JA 2V1UA 4LFCM 3L27A 4WP2A 4IBKA 3RFWA 1XB2B 2KNAA 4KODA 2KEBA 5C18A 1DGGA 3AFHA 3U61B 4GKJM 4R71A 3SFZA 3I01M 4D82A 4LJ4A 5EXTA 4RNAA 1Q39A 3UK6A 1TH3A 2L7HA 2CWBA 5FSWA 2DAEA 2ZTCA 2I7PA 4QNRA 1E9RA 2DZOB 3MJ5A 3Q8GA 5DYGA 3B74A 3J27B 1SXJE 3HHWA 4NXMM 1NV9A 3PNYA 3U60B 1DV0A 3FYCA 4KT0F 1IN5A 1IY2A 4LFAM 1N75A 2B3TA 3LVVA 1JR3E 2KZSA 2KDLA 1WXQA 3J7BA 3RE8A 2O25A 2OQ4A 3SC3A 2UXBM 2DNAA 5IZ7D 3B7ZA 2EJSA 3BXWA 1NY6A 4FW9A 4IBDA 5LMUM 2Z4SA 4W5WA 4GRIA 4P17A 1XNQM 5F3WA 4DR5M 4LJ9A 1QANA 1IY0A 1C1KA 5C1BA 2RRUA 3DA1A 1VDLA 3SYLA 1HNXM 1JR3D 3M7GA 3M6AA 3J80S 1SXJA 1YE9A 3TPZA 1IXSB 3K2LA 1L1TA 5ITTA 3HWSA 2DWMA 2ERCA 4OVZB 2XZUA 1L2BA 3FUVA 1XXHB 2QSFX 5A2QS 1JR3A 2LVNC 2M5ZA 4Z6YA 4FCWA 1VQ1A 4KO8A 2JP7A 1ZMWA 3SHFA 1OIPA 3NWLA 4MB7A 4PDGA 1LV7A 1G8PA 3GLHE 1IXZA 3KS8A 2APLA 5EXXA 1TDHA 3CF0A 4LF7M 5KPZA 1QYRA 4LRSA 3FD9A 3W0FA 2G5GX 1TDZA 2X8AA 1L1ZA 1IBMM 4B3RM 2CUZA 4M9ZA 3HJQA 2LWXA 4G6ZA 3U6LA 4MGZE 3AOGA 4DR6M 3I4YA 3CF2A 2Y21A 3KOZE 1IXRC 3HJ8A 3HHZA 2QQ8A 4AKHA 1TH4A 1PJQA 1R6BX 4ZPXA 3U60A 1DO0A 2LHCA 3SATA 4BB9A 1QDTA 2X49A 2OO9A 4LF4M 2Y0QA 4B3MM 1HJPA 2W82A 2Y20A 3K8ZA 4IBCA 4Y28F 1F4IA 2K0BX 4AKIA 3GRVA 3UZUA 3FUTA 1PJSA 1GVNA 2JY6B 3GLHA 1PRBA 4AW4A 2JWSA 5FTJA 3SARA 1V33A 1GABA 4EIWA 2KW0A 3C58A 3GPXA 2LH0A 2M60A 3T1YM 2YR0A 4JI2M 2R65A 4L78A 1SG9A 2XFSA 1Z6TA 1IXSA 1Z5AA 3FTFA 3F92A 3A46A 3V76A 1IN8A 4QHSA 3IECA 3K1JA 1IN6A 3QYBA 1BVSA 2EUCA 4MGYE 2F5PA 1IM2A 2CRUA 1UM8A 2R46A 5EP4A 2HCBA 1GJTA 3HKPA 4WURA 3SMSA 3B9PA 3UJNA 1AIPC 4IIWA 2K9DA 1G71A 5ITUA 4B08A 2H5XA 2OOAA 3FKEA 4BLCA 1WHCA 3A98B 4MGHA 2MR9A 1Q3BA 2XEPA 3GQ4A 4GHAA 5KPTA 3L25A 1OFHA 3PVSA 2BNKA 1KYIA 1SXJB 1QAQA 2UUAM 2D7EA 1P3QQ 1OAIA 1PJJA 4OU7A 2GQFA 2J7OA 3ZQJA 3HHXA 1C7YA 3SHGB 2DZLA 2JY7A 3VFDA 1ZV1A 3M0EA 1PJTA 1GKIA 3TL4X 3MHVC 3B7QA 1J7KA 2A5YB 2UXDM 4QHTA 2L09A 3GPUA 1E32A 4I81A 1NJGA 2YQZA 1QAMA 1Y8GA 2XLJA 3K92A 2DHRA 4FWHA 1IY1A 2UUCM 1WGNA 2CE7A 4G4RA 3HJSA 2N35A 1SXJC 3KP1E 2CFOA 2NQ8C 1TH2A 3C3DA 4PD2A 8CATA 4S12A 1DO2A 1J09A 2EKFA 5ITYA 2FE8A 3E9SA 1G4AE 2V1CA 4JI4M 1D0MA 4GEWA 3KDSE 2MH8A 5EXSA 4NSRA 3HHYA 3RGSA 2CV2A 2DAKA 4JV5M 2JZ1A 4XK8F 2OPFA 2KRUA 1PJIA 4M9XA 4DR1M 1QVRA 5ITRA 3AJIB 1NV8A 2R45A 5EXPA 2FS1A 2JY5A 2HAKA 2QCUA 4RKUF 2BJWA 4PT5A 3UMMA 1XWIA 3L2AA 5EP2A 3GLHB 3H4MA 1EE8A 5BR8M 3ILKA 2LVQD 2DAGA 2LNHC 5FTMA 5FLXS 1J5EM 1SXJD 3MK6A 4AG6A 4LGYA 4JN6A 4GC5A 4I4LA 2DXIA 2FOIC 2FH0A 5FTNA 4X65M 3T1HM 3VK7A 2G8LA 2F5SA 7CATA 4LG2A 4FVMA 2QP9X 4JI5M 1RU3A 3KFUG 4B7FA 4AI6A 3ZC7B 1OQYA 1D2NA 5DNYA 2FNAA 2D7HA 4AKGA 3VLFB 4L6V6 3AOEA 5GKNA 3TQSA 1FNNA 1NVMA 3E21A 2MGWA 4AQYM 3CF6E 1EIJA 5FTLA 1WJ7A 4L16A 2XH9A 2LHGA 1HT2E 3GLIB 3JAMS 4BBAA 4R3DA 2XGNA 3HX3A 4FCVA 3PNVA 2QZ4A 4IBJA 1L2DA 4JI6M 2Y0TA 1XNRM 1NSFA 3I51A 3VK8A 4A3VB 3SMPA 3R8FA 1IBKM 3T38A 4IBEA 2JA2A 1H6UA 2XFTA 4FWDA 2DKLA 1K3WA 3LQQA 1DGBA 3T6PA 3QYEA 2WSFF 2YFQA 2XSZA 3FE3A 3QWLA 4GIPA 3U6CA 1GL6A 4MH0E 3DOAA 3GRYA 2KHHA 2Z3XA 3W67A 1E9SA 1QZEA 2KZUA 4LJ6A 4IJEA 4LRTA 4M9SA 3ZH9B 4WW0A 3HY5A 4LJ7A 3GQ3A 3U6OA 3MMPA 3LVWA 4HLQA 3E4RA 4B3SM 1GLNA 2J7NA 2C9CA 4GH9A 3VDUA 3GLIE 1XMQM 1KSFX 1N77A 2CP8A 2R4EA 1G3IA 1CUKA 2R44A 4HL4A 2QHOB 2C98A 4JI8M 3E46A 3IG5A 2WSCF 2AHMA 1MN3A 2QNJA 2DWNA 2L6OA 1XHBA 2J5YA 2F5NA 3SYKA 1IFYA 1OKSA 1K82A 4DV5M 2EKKA 1G41A 4QNMA 1A5TA 3HZJA 3HU1A 3GP1A 3H4JA 1IBLM 2Q2EB 5ITXE 3KSJA 3L28A 1Z5BA 4IJFA 2KRKA 1QUTA 2GNOA 4P16A 4B7GA 4NRWA 3VKGA 1IQPA 3EIHA 1I94M 2E5LM 3VKHA 2VF7A 4I8OA 3L26A 3QAUA 2KA6B 3GLIA 2L7IA 3C3EA 1WIVA 2JY8A 2C96A 4KHPM 3UGJA 3KW6A 1Z59A 3KOYE 3NBXX 3KXEC 1GJSA 2UU9M 1QZMA 3U6SA 2BWBA 2DWZB 2R6FA 2ZTDA 3KVWA 1R5LA 2JNHA 5KQDA 3GPPA 2QBYB 1E94E 4DR7M 1EFUB 2L4EA 4GITA 2XZFA 3FTEA 2QENA 4GHLA 4OX9M 4JYAM 5ITQA 4I5SA 5ITXA 1D0KA 2L4FA 4D81A 1ZMVA 2VQFM 4LF8M 1HQCA 2LVPC 3A42A 1TGUA 4NSOB 5EP1A 4IBFA 1HNWM 1N33M 1OAOC 2H1RA 3SBJA 3GLGE 1T6OA 2RGHA 3AV0A 3WHKA 1PGYA 4DBGB 1QDRA 3GO8A 1VDDA 5DYIA 1JB0F 1TR8A 2LTUA 3RGPA 4CHTB 3U6PA 1QUSA 3FRIA 1NY5A 2D7GA 4DUZM 4LZZA 4NRVA 5L8RF 2VQEM 1QQWA 3FTDA 1ORYB 2R4JA 3A45A 4LJAA 4AG5A 5FTKA 2MROB 2JXNA 3GLFB 1DGHA 1JQJC 4NOOB 1LTMA 5EJCA 3SASA 3FTCA 2DAMA 2K47A 4FCTA 2O5RA 2HL7A 2Z7JA 4FD2A 3LCVB 3GRRA 1V34A 4DV6M 2UXCM 4HEOA 3AOEC 4NXNM 5IWAM 4RF1A 2F5OA 3GLGA 1N78A 1NNUC 4LF5M 3SAVA 4NC6A 2X4AA 5LMNM 3SAWA 4TUWA 4AZFA 3GPYA 3K9OA 2DVWB 3TWKA 1HR0M 4F2LA 3B7NA 2ZAOA 1OJLA 1VEKA 5KQ8A 2HKJA 1MJGM 1ZAEA 3PFIA 5KPRA 4MGKE 2QBYA 3R9XB 2VF8A 2YNMD 3GLFE 2C9OA 2R18A 2XF3A 1XMOM 1T3TA 2DAIA 4JI7M 2EO2A 3LMMA 4K0KM 3FUWA 4M0WA 4JI3M 3KOXE 4G4NA 3U6QA 2C5RA 1KFVA 5E6JA 4DR4M 4XGIA 2ZAMA 5H37D 1G59A 2KNZA 2R62A 1K3XA 5IT9S 1W5SA 1L2CA 3CTWB 5DFLA 2LVAA 1N32M 1I4WA 4X62M 3U5ZA 1NO1A 1YLAA 2C99A
chains in the Genus database with same CATH topology
2QHOB 1ZMUA 2MR9A 3E46A 2CWBA 2DAEA 2ZTCA 1MN3A 2DI0A 2QNJA 3BBZA 1G3IA 1IFYA 1OKSA 1KYIA 1NV9A 1DV0A 2LVOC 2EKKA 1P3QQ 1G41A 1OAIA 1A5TA 2JUJA 1OTRA 1R4GA 2B3TA 3H4JA 1JR3E 2WZJA 3LCUA 1C7YA 2DZLA 2JY7A 1ZV1A 2O25A 1HT1E 2DNAA 2EJSA 1WIVA 2JY8A 3FRHA 4UN2B 1Y8GA 1WGNA 2BWBA 2ZTDA 2RRUA 1VDLA 2JNHA 1TTEA 1E94E 1DO2A 2EKFA 1EFUB 2L4EA 4F1IA 1G4AE 4GEWA 1XXHE 2QSFX 2R0IA 2DAKA 2L4FA 2JZ1A 1ZMVA 2LVNC 1GO5A 4G3OA 2LVPC 1VQ1A 1WR1B 2JP7A 1NV8A 1ZMWA 1T6OA 2JY5A 2HAKA 3GLGE 1PGYA 2LBCA 1VG5A 4DBGB 2DHYA 3GLHE 1TR8A 2LTUA 3IHPA 2LVQD 2DAGA 3FRIA 2MROB 1UFZA 1WGLA 2DAMA 1DO0A 1OQYA 3LCVB 2G3QA 4HEOA 2OO9A 2HWJA 1HJPA 1F4IA 2K0BX 3E21A 2L2DA 3B89A 2MGWA 1Q02A 2JY6B 5JI2E 2OOBA 1WJ7A 1VEJA 2DENA 2BWEA 3K9OA 1HQYE 2MJ5B 1HT2E 4F2LA 2JZ0A 1VEKA 2KNVA 1VEGA 1SG9A 1IXSA 3GLFE 3F92A 2DAIA 3IECA 2DKLA 1BVSA 1V92A 3T6PA 3K9PA 1IM2A 3FE3A 2KHHA 1QZEA 1AIPC 1T43A 2KNZA 4Q7JA 2K9DA 3MMPA 4WP2A 1XB2B 2KNAA 2H5XA 2OOAA 4R71A 3GLIE 5DFLA 2LVAA 1WHCA 2CP8A 1YLAA 1CUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QHO B;  1ZMU A;  2MR9 A;  3E46 A;  2CWB A;  2DAE A;  2ZTC A;  1MN3 A;  2DI0 A;  2QNJ A;  3BBZ A;  1G3I A;  1IFY A;  1OKS A;  1KYI A;  1NV9 A;  1DV0 A;  2LVO C;  2EKK A;  1P3Q Q;  1G41 A;  1OAI A;  1A5T A;  2JUJ A;  1OTR A;  1R4G A;  2B3T A;  3H4J A;  1JR3 E;  2WZJ A;  3LCU A;  1C7Y A;  2DZL A;  2JY7 A;  1ZV1 A;  2O25 A;  1HT1 E;  2DNA A;  2EJS A;  1WIV A;  2JY8 A;  3FRH A;  4UN2 B;  1Y8G A;  1WGN A;  2BWB A;  2ZTD A;  2RRU A;  1VDL A;  2JNH A;  1TTE A;  1E94 E;  1DO2 A;  2EKF A;  1EFU B;  2L4E A;  4F1I A;  1G4A E;  4GEW A;  1XXH E;  2QSF X;  2R0I A;  2DAK A;  2L4F A;  2JZ1 A;  1ZMV A;  2LVN C;  1GO5 A;  4G3O A;  2LVP C;  1VQ1 A;  1WR1 B;  2JP7 A;  1NV8 A;  1ZMW A;  1T6O A;  2JY5 A;  2HAK A;  3GLG E;  1PGY A;  2LBC A;  1VG5 A;  4DBG B;  2DHY A;  3GLH E;  1TR8 A;  2LTU A;  3IHP A;  2LVQ D;  2DAG A;  3FRI A;  2MRO B;  1UFZ A;  1WGL A;  2DAM A;  1DO0 A;  1OQY A;  3LCV B;  2G3Q A;  4HEO A;  2OO9 A;  2HWJ A;  1HJP A;  1F4I A;  2K0B X;  3E21 A;  2L2D A;  3B89 A;  2MGW A;  1Q02 A;  2JY6 B;  5JI2 E;  2OOB A;  1WJ7 A;  1VEJ A;  2DEN A;  2BWE A;  3K9O A;  1HQY E;  2MJ5 B;  1HT2 E;  4F2L A;  2JZ0 A;  1VEK A;  2KNV A;  1VEG A;  1SG9 A;  1IXS A;  3GLF E;  3F92 A;  2DAI A;  3IEC A;  2DKL A;  1BVS A;  1V92 A;  3T6P A;  3K9P A;  1IM2 A;  3FE3 A;  2KHH A;  1QZE A;  1AIP C;  1T43 A;  2KNZ A;  4Q7J A;  2K9D A;  3MMP A;  4WP2 A;  1XB2 B;  2KNA A;  2H5X A;  2OOA A;  4R71 A;  3GLI E;  5DFL A;  2LVA A;  1WHC A;  2CP8 A;  1YLA A;  1CUK A; 
#chains in the Genus database with same CATH topology
 1ZMU A;  3TE6 A;  3TWM A;  1YUB A;  3GLF A;  3DZD A;  4G4O A;  4D80 A;  2BJV A;  2DI0 A;  3HU3 A;  4X64 M;  4CIS A;  2XSZ D;  2VII A;  3BBZ A;  5IRE B;  3BOS A;  3VDP A;  3W68 A;  1IN4 A;  4DV2 M;  2LVO C;  1MU5 A;  1W5T A;  1OTR A;  1R4G A;  2JUJ A;  2Z8Y M;  3IG8 A;  3THG A;  2O01 F;  3NBI A;  1R2Y A;  2WZJ A;  3LCU A;  4M0D A;  3U6M A;  4Z8X A;  3L29 A;  4GC9 A;  1N34 M;  2CV1 A;  1HT1 E;  4NL4 H;  3LQR A;  4DV7 M;  3U61 A;  2CV0 A;  4RF0 A;  4REZ A;  2ZM6 M;  2RGO A;  4DUY M;  5BPV A;  3FRH A;  4UN2 B;  4DR3 M;  4LZJ A;  4GMQ A;  5KO3 A;  3KP0 E;  2DWL A;  2CEA A;  2F4V M;  4ITQ A;  4II7 A;  4L4U A;  2P5T A;  3FYD A;  4LGM A;  1TTE A;  1D0L A;  3U6D A;  4CIZ A;  3JR5 A;  1N36 M;  1GL7 A;  1DGH B;  4F1I A;  1NNJ A;  3T15 A;  4LJ5 A;  1XXH E;  2R0I A;  4JI1 M;  3HU2 A;  4LCB A;  1GO5 A;  4YHH M;  4G3O A;  1ZQ9 A;  5EQT A;  1L8Q A;  1OIZ A;  1R7R A;  1WR1 B;  3HGI A;  4X66 M;  4CGY B;  4PCZ A;  3GLG B;  1Q3C A;  3I4V A;  4MM3 B;  2LBC A;  4DR2 M;  1VG5 A;  3PXG A;  2DHY A;  3KSX A;  4CJ6 A;  4LFB M;  3IHP A;  1QAO A;  3GRU A;  3Q8X A;  2QPA A;  3J2P B;  3OTO M;  1S3S A;  4DV4 M;  2ZBK B;  4DV1 M;  3CGW A;  4B3T M;  3EIE A;  3JR4 A;  4LJ8 A;  3LW5 F;  4XBO A;  1DGF A;  1TF0 B;  1FJG M;  1MX0 A;  2LXE A;  3ZCB B;  2DZN B;  2CHV A;  4OVZ A;  1UFZ A;  3DFZ A;  1WGL A;  1XXH A;  2WSE F;  1OFI A;  3WHL A;  2VDB B;  3GQ5 A;  4DV0 M;  2Z4R A;  4QOZ C;  1Z5C A;  2HHH M;  2G3Q A;  4LF9 M;  3KOW E;  5EP3 A;  4GKK M;  1HNZ M;  4QOS A;  2HWJ A;  4KLN A;  4PDI A;  4ANR A;  1NHG C;  1IN7 A;  2V6Z M;  2I7N A;  5E26 A;  2L2D A;  2CHG A;  3B89 A;  1Q02 A;  3D8L A;  5JI2 E;  4MGI E;  4G4Q A;  2OOB A;  1R2Z A;  3I04 M;  3J7A S;  1VEJ A;  2FFJ A;  2DEN A;  2BWE A;  1HQY E;  1NJF A;  1YSY A;  2MJ5 B;  3C9P A;  2EA0 A;  2JZ0 A;  4L8R C;  4B7H A;  3AL0 C;  4R7G A;  1AUA A;  2KNV A;  4IBI A;  1VEG A;  3U5Z B;  4OW0 A;  4IBG A;  2ZAN A;  4JI0 M;  3U6E A;  1XC8 A;  5JI3 E;  2RKO A;  3W0L B;  3D8B A;  4FWG A;  4LY6 A;  1V92 A;  3SAU A;  4LF6 M;  3J81 S;  4JXJ A;  1NHW C;  3K9P A;  3KS4 A;  3TWL A;  2F5Q A;  1X37 A;  3AKZ A;  4DV3 M;  2K6B A;  1PM5 A;  2CHQ A;  3FUU A;  4L15 A;  2UUB M;  2KXE A;  4IBB A;  4YY3 M;  1T43 A;  3FUX A;  4Q7J A;  2V1U A;  4LFC M;  3L27 A;  4WP2 A;  4IBK A;  3RFW A;  1XB2 B;  2KNA A;  4KOD A;  2KEB A;  5C18 A;  1DGG A;  3AFH A;  3U61 B;  4GKJ M;  4R71 A;  3SFZ A;  3I01 M;  4D82 A;  4LJ4 A;  5EXT A;  4RNA A;  1Q39 A;  3UK6 A;  1TH3 A;  2L7H A;  2CWB A;  5FSW A;  2DAE A;  2ZTC A;  2I7P A;  4QNR A;  1E9R A;  2DZO B;  3MJ5 A;  3Q8G A;  5DYG A;  3B74 A;  3J27 B;  1SXJ E;  3HHW A;  4NXM M;  1NV9 A;  3PNY A;  3U60 B;  1DV0 A;  3FYC A;  4KT0 F;  1IN5 A;  1IY2 A;  4LFA M;  1N75 A;  2B3T A;  3LVV A;  1JR3 E;  2KZS A;  2KDL A;  1WXQ A;  3J7B A;  3RE8 A;  2O25 A;  2OQ4 A;  3SC3 A;  2UXB M;  2DNA A;  5IZ7 D;  3B7Z A;  2EJS A;  3BXW A;  1NY6 A;  4FW9 A;  4IBD A;  5LMU M;  2Z4S A;  4W5W A;  4GRI A;  4P17 A;  1XNQ M;  5F3W A;  4DR5 M;  4LJ9 A;  1QAN A;  1IY0 A;  1C1K A;  5C1B A;  2RRU A;  3DA1 A;  1VDL A;  3SYL A;  1HNX M;  1JR3 D;  3M7G A;  3M6A A;  3J80 S;  1SXJ A;  1YE9 A;  3TPZ A;  1IXS B;  3K2L A;  1L1T A;  5ITT A;  3HWS A;  2DWM A;  2ERC A;  4OVZ B;  2XZU A;  1L2B A;  3FUV A;  1XXH B;  2QSF X;  5A2Q S;  1JR3 A;  2LVN C;  2M5Z A;  4Z6Y A;  4FCW A;  1VQ1 A;  4KO8 A;  2JP7 A;  1ZMW A;  3SHF A;  1OIP A;  3NWL A;  4MB7 A;  4PDG A;  1LV7 A;  1G8P A;  3GLH E;  1IXZ A;  3KS8 A;  2APL A;  5EXX A;  1TDH A;  3CF0 A;  4LF7 M;  5KPZ A;  1QYR A;  4LRS A;  3FD9 A;  3W0F A;  2G5G X;  1TDZ A;  2X8A A;  1L1Z A;  1IBM M;  4B3R M;  2CUZ A;  4M9Z A;  3HJQ A;  2LWX A;  4G6Z A;  3U6L A;  4MGZ E;  3AOG A;  4DR6 M;  3I4Y A;  3CF2 A;  2Y21 A;  3KOZ E;  1IXR C;  3HJ8 A;  3HHZ A;  2QQ8 A;  4AKH A;  1TH4 A;  1PJQ A;  1R6B X;  4ZPX A;  3U60 A;  1DO0 A;  2LHC A;  3SAT A;  4BB9 A;  1QDT A;  2X49 A;  2OO9 A;  4LF4 M;  2Y0Q A;  4B3M M;  1HJP A;  2W82 A;  2Y20 A;  3K8Z A;  4IBC A;  4Y28 F;  1F4I A;  2K0B X;  4AKI A;  3GRV A;  3UZU A;  3FUT A;  1PJS A;  1GVN A;  2JY6 B;  3GLH A;  1PRB A;  4AW4 A;  2JWS A;  5FTJ A;  3SAR A;  1V33 A;  1GAB A;  4EIW A;  2KW0 A;  3C58 A;  3GPX A;  2LH0 A;  2M60 A;  3T1Y M;  2YR0 A;  4JI2 M;  2R65 A;  4L78 A;  1SG9 A;  2XFS A;  1Z6T A;  1IXS A;  1Z5A A;  3FTF A;  3F92 A;  3A46 A;  3V76 A;  1IN8 A;  4QHS A;  3IEC A;  3K1J A;  1IN6 A;  3QYB A;  1BVS A;  2EUC A;  4MGY E;  2F5P A;  1IM2 A;  2CRU A;  1UM8 A;  2R46 A;  5EP4 A;  2HCB A;  1GJT A;  3HKP A;  4WUR A;  3SMS A;  3B9P A;  3UJN A;  1AIP C;  4IIW A;  2K9D A;  1G71 A;  5ITU A;  4B08 A;  2H5X A;  2OOA A;  3FKE A;  4BLC A;  1WHC A;  3A98 B;  4MGH A;  2MR9 A;  1Q3B A;  2XEP A;  3GQ4 A;  4GHA A;  5KPT A;  3L25 A;  1OFH A;  3PVS A;  2BNK A;  1KYI A;  1SXJ B;  1QAQ A;  2UUA M;  2D7E A;  1P3Q Q;  1OAI A;  1PJJ A;  4OU7 A;  2GQF A;  2J7O A;  3ZQJ A;  3HHX A;  1C7Y A;  3SHG B;  2DZL A;  2JY7 A;  3VFD A;  1ZV1 A;  3M0E A;  1PJT A;  1GKI A;  3TL4 X;  3MHV C;  3B7Q A;  1J7K A;  2A5Y B;  2UXD M;  4QHT A;  2L09 A;  3GPU A;  1E32 A;  4I81 A;  1NJG A;  2YQZ A;  1QAM A;  1Y8G A;  2XLJ A;  3K92 A;  2DHR A;  4FWH A;  1IY1 A;  2UUC M;  1WGN A;  2CE7 A;  4G4R A;  3HJS A;  2N35 A;  1SXJ C;  3KP1 E;  2CFO A;  2NQ8 C;  1TH2 A;  3C3D A;  4PD2 A;  8CAT A;  4S12 A;  1DO2 A;  1J09 A;  2EKF A;  5ITY A;  2FE8 A;  3E9S A;  1G4A E;  2V1C A;  4JI4 M;  1D0M A;  4GEW A;  3KDS E;  2MH8 A;  5EXS A;  4NSR A;  3HHY A;  3RGS A;  2CV2 A;  2DAK A;  4JV5 M;  2JZ1 A;  4XK8 F;  2OPF A;  2KRU A;  1PJI A;  4M9X A;  4DR1 M;  1QVR A;  5ITR A;  3AJI B;  1NV8 A;  2R45 A;  5EXP A;  2FS1 A;  2JY5 A;  2HAK A;  2QCU A;  4RKU F;  2BJW A;  4PT5 A;  3UMM A;  1XWI A;  3L2A A;  5EP2 A;  3GLH B;  3H4M A;  1EE8 A;  5BR8 M;  3ILK A;  2LVQ D;  2DAG A;  2LNH C;  5FTM A;  5FLX S;  1J5E M;  1SXJ D;  3MK6 A;  4AG6 A;  4LGY A;  4JN6 A;  4GC5 A;  4I4L A;  2DXI A;  2FOI C;  2FH0 A;  5FTN A;  4X65 M;  3T1H M;  3VK7 A;  2G8L A;  2F5S A;  7CAT A;  4LG2 A;  4FVM A;  2QP9 X;  4JI5 M;  1RU3 A;  3KFU G;  4B7F A;  4AI6 A;  3ZC7 B;  1OQY A;  1D2N A;  5DNY A;  2FNA A;  2D7H A;  4AKG A;  3VLF B;  4L6V 6;  3AOE A;  5GKN A;  3TQS A;  1FNN A;  1NVM A;  3E21 A;  2MGW A;  4AQY M;  3CF6 E;  1EIJ A;  5FTL A;  1WJ7 A;  4L16 A;  2XH9 A;  2LHG A;  1HT2 E;  3GLI B;  3JAM S;  4BBA A;  4R3D A;  2XGN A;  3HX3 A;  4FCV A;  3PNV A;  2QZ4 A;  4IBJ A;  1L2D A;  4JI6 M;  2Y0T A;  1XNR M;  1NSF A;  3I51 A;  3VK8 A;  4A3V B;  3SMP A;  3R8F A;  1IBK M;  3T38 A;  4IBE A;  2JA2 A;  1H6U A;  2XFT A;  4FWD A;  2DKL A;  1K3W A;  3LQQ A;  1DGB A;  3T6P A;  3QYE A;  2WSF F;  2YFQ A;  2XSZ A;  3FE3 A;  3QWL A;  4GIP A;  3U6C A;  1GL6 A;  4MH0 E;  3DOA A;  3GRY A;  2KHH A;  2Z3X A;  3W67 A;  1E9S A;  1QZE A;  2KZU A;  4LJ6 A;  4IJE A;  4LRT A;  4M9S A;  3ZH9 B;  4WW0 A;  3HY5 A;  4LJ7 A;  3GQ3 A;  3U6O A;  3MMP A;  3LVW A;  4HLQ A;  3E4R A;  4B3S M;  1GLN A;  2J7N A;  2C9C A;  4GH9 A;  3VDU A;  3GLI E;  1XMQ M;  1KSF X;  1N77 A;  2CP8 A;  2R4E A;  1G3I A;  1CUK A;  2R44 A;  4HL4 A;  2QHO B;  2C98 A;  4JI8 M;  3E46 A;  3IG5 A;  2WSC F;  2AHM A;  1MN3 A;  2QNJ A;  2DWN A;  2L6O A;  1XHB A;  2J5Y A;  2F5N A;  3SYK A;  1IFY A;  1OKS A;  1K82 A;  4DV5 M;  2EKK A;  1G41 A;  4QNM A;  1A5T A;  3HZJ A;  3HU1 A;  3GP1 A;  3H4J A;  1IBL M;  2Q2E B;  5ITX E;  3KSJ A;  3L28 A;  1Z5B A;  4IJF A;  2KRK A;  1QUT A;  2GNO A;  4P16 A;  4B7G A;  4NRW A;  3VKG A;  1IQP A;  3EIH A;  1I94 M;  2E5L M;  3VKH A;  2VF7 A;  4I8O A;  3L26 A;  3QAU A;  2KA6 B;  3GLI A;  2L7I A;  3C3E A;  1WIV A;  2JY8 A;  2C96 A;  4KHP M;  3UGJ A;  3KW6 A;  1Z59 A;  3KOY E;  3NBX X;  3KXE C;  1GJS A;  2UU9 M;  1QZM A;  3U6S A;  2BWB A;  2DWZ B;  2R6F A;  2ZTD A;  3KVW A;  1R5L A;  2JNH A;  5KQD A;  3GPP A;  2QBY B;  1E94 E;  4DR7 M;  1EFU B;  2L4E A;  4GIT A;  2XZF A;  3FTE A;  2QEN A;  4GHL A;  4OX9 M;  4JYA M;  5ITQ A;  4I5S A;  5ITX A;  1D0K A;  2L4F A;  4D81 A;  1ZMV A;  2VQF M;  4LF8 M;  1HQC A;  2LVP C;  3A42 A;  1TGU A;  4NSO B;  5EP1 A;  4IBF A;  1HNW M;  1N33 M;  1OAO C;  2H1R A;  3SBJ A;  3GLG E;  1T6O A;  2RGH A;  3AV0 A;  3WHK A;  1PGY A;  4DBG B;  1QDR A;  3GO8 A;  1VDD A;  5DYI A;  1JB0 F;  1TR8 A;  2LTU A;  3RGP A;  4CHT B;  3U6P A;  1QUS A;  3FRI A;  1NY5 A;  2D7G A;  4DUZ M;  4LZZ A;  4NRV A;  5L8R F;  2VQE M;  1QQW A;  3FTD A;  1ORY B;  2R4J A;  3A45 A;  4LJA A;  4AG5 A;  5FTK A;  2MRO B;  2JXN A;  3GLF B;  1DGH A;  1JQJ C;  4NOO B;  1LTM A;  5EJC A;  3SAS A;  3FTC A;  2DAM A;  2K47 A;  4FCT A;  2O5R A;  2HL7 A;  2Z7J A;  4FD2 A;  3LCV B;  3GRR A;  1V34 A;  4DV6 M;  2UXC M;  4HEO A;  3AOE C;  4NXN M;  5IWA M;  4RF1 A;  2F5O A;  3GLG A;  1N78 A;  1NNU C;  4LF5 M;  3SAV A;  4NC6 A;  2X4A A;  5LMN M;  3SAW A;  4TUW A;  4AZF A;  3GPY A;  3K9O A;  2DVW B;  3TWK A;  1HR0 M;  4F2L A;  3B7N A;  2ZAO A;  1OJL A;  1VEK A;  5KQ8 A;  2HKJ A;  1MJG M;  1ZAE A;  3PFI A;  5KPR A;  4MGK E;  2QBY A;  3R9X B;  2VF8 A;  2YNM D;  3GLF E;  2C9O A;  2R18 A;  2XF3 A;  1XMO M;  1T3T A;  2DAI A;  4JI7 M;  2EO2 A;  3LMM A;  4K0K M;  3FUW A;  4M0W A;  4JI3 M;  3KOX E;  4G4N A;  3U6Q A;  2C5R A;  1KFV A;  5E6J A;  4DR4 M;  4XGI A;  2ZAM A;  5H37 D;  1G59 A;  2KNZ A;  2R62 A;  1K3X A;  5IT9 S;  1W5S A;  1L2C A;  3CTW B;  5DFL A;  2LVA A;  1N32 M;  1I4W A;  4X62 M;  3U5Z A;  1NO1 A;  1YLA A;  2C99 A; 
#chains in the Genus database with same CATH homology
 2QHO B;  1ZMU A;  2MR9 A;  3E46 A;  2CWB A;  2DAE A;  2ZTC A;  1MN3 A;  2DI0 A;  2QNJ A;  3BBZ A;  1G3I A;  1IFY A;  1OKS A;  1KYI A;  1NV9 A;  1DV0 A;  2LVO C;  2EKK A;  1P3Q Q;  1G41 A;  1OAI A;  1A5T A;  2JUJ A;  1OTR A;  1R4G A;  2B3T A;  3H4J A;  1JR3 E;  2WZJ A;  3LCU A;  1C7Y A;  2DZL A;  2JY7 A;  1ZV1 A;  2O25 A;  1HT1 E;  2DNA A;  2EJS A;  1WIV A;  2JY8 A;  3FRH A;  4UN2 B;  1Y8G A;  1WGN A;  2BWB A;  2ZTD A;  2RRU A;  1VDL A;  2JNH A;  1TTE A;  1E94 E;  1DO2 A;  2EKF A;  1EFU B;  2L4E A;  4F1I A;  1G4A E;  4GEW A;  1XXH E;  2QSF X;  2R0I A;  2DAK A;  2L4F A;  2JZ1 A;  1ZMV A;  2LVN C;  1GO5 A;  4G3O A;  2LVP C;  1VQ1 A;  1WR1 B;  2JP7 A;  1NV8 A;  1ZMW A;  1T6O A;  2JY5 A;  2HAK A;  3GLG E;  1PGY A;  2LBC A;  1VG5 A;  4DBG B;  2DHY A;  3GLH E;  1TR8 A;  2LTU A;  3IHP A;  2LVQ D;  2DAG A;  3FRI A;  2MRO B;  1UFZ A;  1WGL A;  2DAM A;  1DO0 A;  1OQY A;  3LCV B;  2G3Q A;  4HEO A;  2OO9 A;  2HWJ A;  1HJP A;  1F4I A;  2K0B X;  3E21 A;  2L2D A;  3B89 A;  2MGW A;  1Q02 A;  2JY6 B;  5JI2 E;  2OOB A;  1WJ7 A;  1VEJ A;  2DEN A;  2BWE A;  3K9O A;  1HQY E;  2MJ5 B;  1HT2 E;  4F2L A;  2JZ0 A;  1VEK A;  2KNV A;  1VEG A;  1SG9 A;  1IXS A;  3GLF E;  3F92 A;  2DAI A;  3IEC A;  2DKL A;  1BVS A;  1V92 A;  3T6P A;  3K9P A;  1IM2 A;  3FE3 A;  2KHH A;  1QZE A;  1AIP C;  1T43 A;  2KNZ A;  4Q7J A;  2K9D A;  3MMP A;  4WP2 A;  1XB2 B;  2KNA A;  2H5X A;  2OOA A;  4R71 A;  3GLI E;  5DFL A;  2LVA A;  1WHC A;  2CP8 A;  1YLA A;  1CUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...