2EKKA

Solution structure of ruh-074, a human uba domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
47
Chain Sequence
GSSGSSGVNQQQLQQLMDMGFTREHAMEALLNTSTMEQATEYLLTHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RUH-074, a human UBA domain
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords UBA domain from E3 ubiquitin-protein ligase HUWE1
total genus 13
structure length 47
sequence length 47
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ekkA00
1VDLA 2KNZA 1ZMVA 1VEGA 3T6PA 1P3QQ 3MMPA 2DZLA 1QZEA 3H4JA 1DO0A 1NV9A 3LCVB 1OAIA 1DO2A 2KNAA 4Q7JA 1AIPC 2DI0A 2JZ0A 2B3TA 2JZ1A 1G4AE 3GLIE 2DAIA 1YLAA 2DAMA 2L4EA 1IFYA 1TR8A 5JI2E 1WR1B 2L4FA 2OO9A 2K9DA 2RRUA 4DBGB 2DENA 2JY5A 4HEOA 1G3IA 2DAGA 3GLHE 1OTRA 2BWEA 2DAEA 1DV0A 1XXHE 1ZMWA 2LVNC 1TTEA 1A5TA 2O25A 4F1IA 1C7YA 2OOBA 2DKLA 2G3QA 1WHCA 2ZTCA 4WP2A 1WGLA 1IM2A 4G3OA 5DFLA 1HT2E 1VEJA 2CP8A 2CWBA 1VEKA 2QNJA 1WGNA 2JY7A 1UFZA 2LVOC 1PGYA 3IECA 2DNAA 1WIVA 1Y8GA 2ZTDA 2JNHA 2QHOB 3F92A 2LTUA 2K0BX 1KYIA 1MN3A 3E46A 1HQYE 3FRIA 4R71A 2R0IA 1CUKA 2LVAA 1EFUB 2BWBA 2LBCA 2EKFA 1OKSA 3K9OA 1ZV1A 2MJ5B 2JUJA 2KHHA 1HT1E 4GEWA 2JP7A 3FRHA 2MROB 1XB2B 1G41A 3BBZA 1WJ7A 1T43A 2JY8A 1Q02A 2EJSA 4F2LA 1OQYA 1HJPA 3B89A 1IXSA 2KNVA 2OOAA 1E94E 2JY6B 1R4GA 3FE3A 4UN2B 3E21A 1NV8A 2MGWA 1BVSA 2HWJA 1ZMUA 2WZJA 3LCUA 2QSFX 2EKKA 1F4IA 1VG5A 1GO5A 2HAKA 2LVQD 2DAKA 2LVPC 1T6OA 3GLGE 2MR9A 3IHPA 1JR3E 2DHYA 3GLFE 1V92A 2H5XA 2L2DA 1SG9A 1VQ1A 3K9PA
chains in the Genus database with same CATH superfamily
1VDLA 1WXQA 1ZMVA 3GLIB 4BBAA 3U5ZA 4MH0E 3VK7A 3DA1A 5KO3A 3W0FA 1R6BX 2K6BA 4S12A 5ITTA 1QZEA 1RU3A 2C98A 3E4RA 3LVWA 2OPFA 2RGOA 1DO0A 3MK6A 4MGYE 2XZUA 1R2ZA 2R4JA 4B3TM 4LFCM 1OAIA 3ILKA 4X65M 2FOIC 2FNAA 4GMQA 1GJTA 1R7RA 2CE7A 2Y0TA 1AIPC 2EO2A 2VF8A 4CGYB 3OTOM 4LFBM 3J81S 4LRTA 1D0LA 1DGGA 1YLAA 2CV2A 3ZC7B 4P17A 3PNYA 5EP1A 5KQDA 4BB9A 2VQEM 4JYAM 4GH9A 2UUAM 3THGA 1IFYA 3U6QA 2L4FA 1NVMA 4IBBA 3CF0A 3I51A 1L1ZA 2C96A 4DBGB 2KZUA 3U6EA 1G3IA 2HHHM 2F4VM 4KHPM 3VKHA 1IN7A 5DYIA 2WSEF 5DYGA 4PCZA 1XXHE 2N35A 2DHRA 2JWSA 2CHQA 1AUAA 2HCBA 1C7YA 1X37A 5IT9S 2G3QA 1K3XA 1IM2A 1ZAEA 2H1RA 3U6MA 3E9SA 3AOGA 4XK8F 2CWBA 1T3TA 3U60A 2KA6B 3AOEA 2X8AA 2JY7A 7CATA 3BXWA 3SBJA 2MH8A 3L29A 3ZQJA 3FTEA 1JB0F 4GHLA 2GNOA 2QPAA 1D0KA 1WIVA 2FS1A 3KP1E 1XNQM 2OQ4A 2CHVA 4JI0M 3E46A 4NSRA 4R71A 1XXHB 5BPVA 1OIPA 3AV0A 2Z4SA 2XFSA 4DR5M 4DR3M 4AKHA 2G5GX 4IBJA 4II7A 4QHTA 2QQ8A 3QAUA 4QNMA 2FH0A 1MX0A 2UXBM 2JP7A 4ANRA 2CFOA 3JR4A 3GLFA 4KO8A 2MROB 3KFUG 4LF6M 1IN5A 1Z6TA 1NNJA 2EJSA 1OQYA 3B89A 1V34A 2DZNB 3EIEA 3U6SA 3R8FA 5LMNM 3KS8A 2V1UA 1R4GA 3HJ8A 3GLHB 3M0EA 4I4LA 4I5SA 4P16A 3L26A 4DV6M 1ZMUA 4MGIE 1LTMA 1IBLM 1XXHA 3LCUA 5E26A 1PJTA 3GQ5A 1QANA 1XHBA 3UJNA 2DWNA 1GO5A 2K47A 1UM8A 1J09A 1SXJC 1HNXM 2LVPC 3U61A 1T6OA 1N34M 4JN6A 2MR9A 4LF8M 1QAOA 3R9XB 2DZOB 4I8OA 1IXSB 2DHYA 4LF4M 1NSFA 1VQ1A 2C9OA 3TWKA 2CUZA 2QP9X 2O5RA 2XZFA 4HLQA 2KNZA 3B7NA 1IN4A 1VEGA 1J7KA 1LV7A 4DV0M 2KEBA 3J7BA 4RF1A 2LHCA 4LF7M 1NV9A 4FCTA 3KOXE 5EQTA 2R4EA 4OVZB 4L16A 3FKEA 3J2PB 1GVNA 4FCWA 4NL4H 1OFIA 1N32M 3VLFB 3UK6A 4D81A 2Z7JA 2DI0A 4LJ5A 2B3TA 1G4AE 3GLIE 4I81A 1NY6A 1IN6A 1GL7A 2DAMA 2L4EA 1TR8A 1H6UA 3CF6E 3TWLA 1NO1A 1WR1B 1XWIA 2CHGA 4B3MM 4LFAM 2VIIA 3K92A 4JI5M 2R65A 1FJGM 1IY2A 2QENA 2O01F 3SARA 1DGBA 4MGHA 2DENA 2JY5A 4RF0A 1E9RA 1Z59A 5EXTA 4LRSA 2F5SA 3FTFA 2V1CA 1OFHA 1DV0A 2NQ8C 4RNAA 1ZMWA 3AKZA 4JI8M 2O25A 3AOEC 3D8LA 3KOWE 4F1IA 4DR1M 2RGHA 2OOBA 4JI7M 3IG8A 4WP2A 1WGLA 4X66M 4G3OA 1KFVA 4M9ZA 4FCVA 3LMMA 4L6V6 1VEKA 4G6ZA 1WGNA 1UFZA 4MM3B 2D7EA 2KW0A 4QHSA 3VFDA 1QVRA 3T1YM 2L6OA 4CIZA 2D7GA 4G4RA 1XNRM 3B9PA 4GIPA 1Y8GA 2ZTDA 2BNKA 4R3DA 3NBIA 2D7HA 5FTJA 2RKOA 1Q3BA 3U6OA 4MB7A 2LTUA 2K0BX 3UZUA 3K2LA 3U6LA 2VF7A 3SFZA 3B7QA 4ZPXA 1N78A 4DV3M 2ZBKB 4GC5A 4TUWA 4IJEA 3VDUA 4L4UA 3GRRA 3V76A 2Y20A 5EJCA 1E9SA 4PT5A 2F5OA 2LBCA 4AW4A 3J80S 3T1HM 1NJFA 1OKSA 2AHMA 3CTWB 3HX3A 3K9OA 2JUJA 3SYKA 2KHHA 3LQRA 2R62A 3L25A 3GLGA 1Z5BA 3FRHA 4FW9A 4R7GA 1G41A 1MU5A 4D82A 3GLIA 3EIHA 5FTNA 1WJ7A 3QWLA 1PJJA 4GHAA 1Q02A 4GRIA 2UU9M 2F5NA 3H4MA 3UGJA 1EIJA 3U61B 2LNHC 2QZ4A 4LGMA 3GPYA 3TWMA 2KZSA 1GABA 1IXSA 3M7GA 4IBKA 5EP4A 3PVSA 3HU2A 1L2CA 4LJ9A 5KQ8A 2E5LM 2R6FA 4KLNA 4JI3M 1NJGA 4ITQA 2JY6B 3B7ZA 2YR0A 4UN2B 2F5QA 3SAWA 2DXIA 2MGWA 3SAVA 1BVSA 4JXJA 2CV1A 4LJ4A 2HWJA 2ZM6M 1IN8A 3NBXX 1KSFX 1PJSA 3GRVA 4RKUF 5EXXA 3ZH9B 3HWSA 2HAKA 2L09A 4AQYM 4DR6M 1SXJD 1FNNA 2DAKA 4CISA 2Q2EB 3GLFE 3KP0E 3HKPA 2Y21A 4MGKE 2H5XA 3GLGB 5L8RF 3T15A 3TE6A 5A2QS 3C3EA 2KRUA 4B7FA 5LMUM 1J5EM 3FD9A 2LWXA 4B08A 2GQFA 4NOOB 3T38A 1P3QQ 5ITXA 4QOSA 2KRKA 1G71A 1W5TA 3VDPA 4FD2A 2W82A 4LJ8A 3SHFA 3A46A 4K0KM 3LCVB 1K3WA 5ITUA 4AKGA 1TDZA 4Z8XA 1DO2A 2KNAA 2X49A 4G4OA 4AI6A 2I7NA 3D8BA 1DGFA 3KXEC 1N33M 1ORYB 2UXDM 2UXCM 3PXGA 3FUVA 3FYCA 3KW6A 4YY3M 2DAIA 4Y28F 1G8PA 1PJIA 1IY0A 2KDLA 5GKNA 1ZQ9A 2OO9A 2Z8YM 1YE9A 2ZAMA 2XLJA 2K9DA 3W0LB 1L2DA 3FUTA 3HU3A 4YHHM 1NHGC 4PD2A 1N36M 4JI1M 1QYRA 3AL0C 1HQCA 1SXJB 2DVWB 4GC9A 4B7GA 5DNYA 2DAGA 4OW0A 3I04M 4G4NA 2DWLA 1OTRA 2BWEA 2DAEA 4LZZA 1IBMM 2YFQA 1HR0M 2LHGA 2BJWA 4Z6YA 1TTEA 3HHYA 3HHXA 2C9CA 4OX9M 3CF2A 3LW5F 4DR7M 5KPTA 3QYEA 4DV4M 5EP2A 3DFZA 1YUBA 4LF9M 2DWMA 5DFLA 1C1KA 2XSZD 1HT2E 2CP8A 3HU1A 3GQ4A 1Q39A 2EUCA 1Z5AA 3JAMS 2KXEA 4B3RM 5BR8M 2QNJA 3B74A 3IECA 2R45A 1PGYA 3FUXA 3HGIA 5KPRA 3KS4A 4NRWA 2G8LA 3SATA 1QUSA 2QBYA 2M60A 3U60B 5E6JA 4FVMA 2JNHA 3KOYE 3F92A 3U6PA 4IBIA 3LQQA 5FSWA 1IBKM 3MHVC 4LGYA 1G59A 2M5ZA 4CJ6A 3FRIA 4XBOA 1HQYE 1QAQA 2P5TA 2C99A 1XMOM 2R0IA 3SASA 4EIWA 3GPUA 5F3WA 2ZANA 4FWGA 4LY6A 4IBGA 4NC6A 3U5ZB 4IBDA 5IWAM 1SXJA 4WURA 2CRUA 3FUWA 1XMQM 3A42A 2XEPA 4WW0A 2LXEA 5FTMA 3I4YA 1HT1E 1Z5CA 3C9PA 4GEWA 4NRVA 2BJVA 3M6AA 1QDRA 1HNWM 1JR3A 2YNMD 4FWHA 3SHGB 5IZ7D 1DGHB 3C3DA 2LH0A 3BBZA 4NSOB 2X4AA 1TH2A 4IBCA 1XC8A 3RGPA 4PDIA 1T43A 2XF3A 4DR4M 3IG5A 4AKIA 2XSZA 1HJPA 3PNVA 1QAMA 3WHLA 2HL7A 2KNVA 1N75A 4W5WA 2CEAA 2OOAA 3GLHA 1TGUA 1GJSA 1E94E 4DV2M 3Q8GA 1L2BA 2A5YB 3JR5A 1NV8A 2UUCM 4DUYM 2WZJA 2QSFX 1F4IA 4L15A 1QZMA 3A98B 4OU7A 4NXMM 3GRUA 1TH3A 2QBYB 4X64M 1R5LA 5ITRA 3GLGE 2L7HA 1I94M 1IXZA 2ERCA 1W5SA 1V92A 3L27A 3PFIA 4DUZM 3GPXA 1OJLA 5EXSA 1JR3D 1YSYA 3K9PA 3NWLA 3GLFB 3GQ3A 2J5YA 2ZAOA 3VKGA 4LJ7A 3KSJA 3T6PA 4FWDA 3MMPA 4KT0F 4BLCA 2DZLA 5FTKA 1TH4A 3H4JA 2JXNA 3K1JA 4GKKM 1R2YA 1OAOC 1K82A 3SYLA 4LF5M 1EE8A 1NNUC 3L28A 4L8RC 1N77A 3TL4X 1GKIA 3FTDA 3I4VA 1IY1A 4Q7JA 1QUTA 2JZ0A 1IQPA 1SXJE 4LJAA 3SC3A 4AZFA 5FLXS 2JZ1A 2CV0A 3MJ5A 3AJIB 3TQSA 5C18A 4LG2A 2R44A 4LCBA 1L8QA 3FYDA 3KSXA 4QNRA 5IREB 3HHZA 4DV7M 3Q8XA 3BOSA 5JI2E 1E32A 3DZDA 1TF0B 3HJSA 2RRUA 3HY5A 2FFJA 2L7IA 4DR2M 3KDSE 4HEOA 4KODA 5FTLA 1VDDA 5ITQA 2Z4RA 4QOZC 3W67A 5C1BA 2XGNA 5ITXE 3J27B 3GLHE 3W68A 3I01M 3RE8A 3GRYA 2LVNC 3QYBA 2Y0QA 1A5TA 4IBEA 2DKLA 4IIWA 1WHCA 2VDBB 2ZTCA 4L78A 4OVZA 5ITYA 1L1TA 1HNZM 1VEJA 1Q3CA 3RGSA 3AFHA 1D2NA 4PDGA 1NY5A 3FUUA 4AG6A 2LVOC 4DV5M 4LZJA 1GLNA 4M9SA 2DNAA 1JQJC 1D0MA 3SMSA 2EA0A 1MJGM 4NXNM 4IJFA 2Z3XA 1QQWA 2QHOB 4CHTB 4MGZE 3GO8A 2F5PA 2R18A 1KYIA 1MN3A 3ZCBB 3WHKA 1V33A 1CUKA 2LVAA 5JI3E 1EFUB 4A3VB 4REZA 5KPZA 4M0DA 2QCUA 2BWBA 2YQZA 1S3SA 2EKFA 3KVWA 4X62M 1ZV1A 2J7NA 2MJ5B 1PJQA 4DV1M 2WSCF 3HHWA 3C58A 1PM5A 4B3SM 3HZJA 2HKJA 1XB2B 2VQFM 4JI6M 2WSFF 3U6CA 4IBFA 4M9XA 3GP1A 3J7AS 2JY8A 4G4QA 1I4WA 1DGHA 4M0WA 4F2LA 8CATA 3U6DA 4D80A 1QDTA 3A45A 4JV5M 1TDHA 3GPPA 2J7OA 4B7HA 4XGIA 1OIZA 2V6ZM 3L2AA 5H37D 1PRBA 4HL4A 3KOZE 2UUBM 3HJQA 5EXPA 1NHWC 4JI4M 3FE3A 3E21A 5EP3A 3DOAA 2APLA 2C5RA 1GL6A 1IXRC 3VK8A 3TPZA 2EKKA 2R46A 1VG5A 2FE8A 3FTCA 2LVQD 3RFWA 2DWZB 4GKJM 3IHPA 2XH9A 3SMPA 3UMMA 2JA2A 1JR3E 4GITA 4JI2M 2I7PA 3CGWA 3K8ZA 3SAUA 4LJ6A 2L2DA 1SG9A 2XFTA 4AG5A 3LVVA
chains in the Genus database with same CATH topology
1VDLA 2KNZA 1ZMVA 1VEGA 3T6PA 1P3QQ 3MMPA 2DZLA 1QZEA 3H4JA 1DO0A 1NV9A 3LCVB 1OAIA 1DO2A 2KNAA 4Q7JA 1AIPC 2DI0A 2JZ0A 2B3TA 2JZ1A 1G4AE 3GLIE 2DAIA 1YLAA 2DAMA 2L4EA 1IFYA 1TR8A 5JI2E 1WR1B 2L4FA 2OO9A 2K9DA 2RRUA 4DBGB 2DENA 2JY5A 4HEOA 1G3IA 2DAGA 3GLHE 1OTRA 2BWEA 2DAEA 1DV0A 1XXHE 1ZMWA 2LVNC 1TTEA 1A5TA 2O25A 4F1IA 1C7YA 2OOBA 2DKLA 2G3QA 1WHCA 2ZTCA 4WP2A 1WGLA 1IM2A 4G3OA 5DFLA 1HT2E 1VEJA 2CP8A 2CWBA 1VEKA 2QNJA 1WGNA 2JY7A 1UFZA 2LVOC 1PGYA 3IECA 2DNAA 1WIVA 1Y8GA 2ZTDA 2JNHA 2QHOB 3F92A 2LTUA 2K0BX 1KYIA 1MN3A 3E46A 1HQYE 3FRIA 4R71A 2R0IA 1CUKA 2LVAA 1EFUB 2BWBA 2LBCA 2EKFA 1OKSA 3K9OA 1ZV1A 2MJ5B 2JUJA 2KHHA 1HT1E 4GEWA 2JP7A 3FRHA 2MROB 1XB2B 1G41A 3BBZA 1WJ7A 1T43A 2JY8A 1Q02A 2EJSA 4F2LA 1OQYA 1HJPA 3B89A 1IXSA 2KNVA 2OOAA 1E94E 2JY6B 1R4GA 3FE3A 4UN2B 3E21A 1NV8A 2MGWA 1BVSA 2HWJA 1ZMUA 2WZJA 3LCUA 2QSFX 2EKKA 1F4IA 1VG5A 1GO5A 2HAKA 2LVQD 2DAKA 2LVPC 1T6OA 3GLGE 2MR9A 3IHPA 1JR3E 2DHYA 3GLFE 1V92A 2H5XA 2L2DA 1SG9A 1VQ1A 3K9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDL A;  2KNZ A;  1ZMV A;  1VEG A;  3T6P A;  1P3Q Q;  3MMP A;  2DZL A;  1QZE A;  3H4J A;  1DO0 A;  1NV9 A;  3LCV B;  1OAI A;  1DO2 A;  2KNA A;  4Q7J A;  1AIP C;  2DI0 A;  2JZ0 A;  2B3T A;  2JZ1 A;  1G4A E;  3GLI E;  2DAI A;  1YLA A;  2DAM A;  2L4E A;  1IFY A;  1TR8 A;  5JI2 E;  1WR1 B;  2L4F A;  2OO9 A;  2K9D A;  2RRU A;  4DBG B;  2DEN A;  2JY5 A;  4HEO A;  1G3I A;  2DAG A;  3GLH E;  1OTR A;  2BWE A;  2DAE A;  1DV0 A;  1XXH E;  1ZMW A;  2LVN C;  1TTE A;  1A5T A;  2O25 A;  4F1I A;  1C7Y A;  2OOB A;  2DKL A;  2G3Q A;  1WHC A;  2ZTC A;  4WP2 A;  1WGL A;  1IM2 A;  4G3O A;  5DFL A;  1HT2 E;  1VEJ A;  2CP8 A;  2CWB A;  1VEK A;  2QNJ A;  1WGN A;  2JY7 A;  1UFZ A;  2LVO C;  1PGY A;  3IEC A;  2DNA A;  1WIV A;  1Y8G A;  2ZTD A;  2JNH A;  2QHO B;  3F92 A;  2LTU A;  2K0B X;  1KYI A;  1MN3 A;  3E46 A;  1HQY E;  3FRI A;  4R71 A;  2R0I A;  1CUK A;  2LVA A;  1EFU B;  2BWB A;  2LBC A;  2EKF A;  1OKS A;  3K9O A;  1ZV1 A;  2MJ5 B;  2JUJ A;  2KHH A;  1HT1 E;  4GEW A;  2JP7 A;  3FRH A;  2MRO B;  1XB2 B;  1G41 A;  3BBZ A;  1WJ7 A;  1T43 A;  2JY8 A;  1Q02 A;  2EJS A;  4F2L A;  1OQY A;  1HJP A;  3B89 A;  1IXS A;  2KNV A;  2OOA A;  1E94 E;  2JY6 B;  1R4G A;  3FE3 A;  4UN2 B;  3E21 A;  1NV8 A;  2MGW A;  1BVS A;  2HWJ A;  1ZMU A;  2WZJ A;  3LCU A;  2QSF X;  2EKK A;  1F4I A;  1VG5 A;  1GO5 A;  2HAK A;  2LVQ D;  2DAK A;  2LVP C;  1T6O A;  3GLG E;  2MR9 A;  3IHP A;  1JR3 E;  2DHY A;  3GLF E;  1V92 A;  2H5X A;  2L2D A;  1SG9 A;  1VQ1 A;  3K9P A; 
#chains in the Genus database with same CATH topology
 1VDL A;  1WXQ A;  1ZMV A;  3GLI B;  4BBA A;  3U5Z A;  4MH0 E;  3VK7 A;  3DA1 A;  5KO3 A;  3W0F A;  1R6B X;  2K6B A;  4S12 A;  5ITT A;  1QZE A;  1RU3 A;  2C98 A;  3E4R A;  3LVW A;  2OPF A;  2RGO A;  1DO0 A;  3MK6 A;  4MGY E;  2XZU A;  1R2Z A;  2R4J A;  4B3T M;  4LFC M;  1OAI A;  3ILK A;  4X65 M;  2FOI C;  2FNA A;  4GMQ A;  1GJT A;  1R7R A;  2CE7 A;  2Y0T A;  1AIP C;  2EO2 A;  2VF8 A;  4CGY B;  3OTO M;  4LFB M;  3J81 S;  4LRT A;  1D0L A;  1DGG A;  1YLA A;  2CV2 A;  3ZC7 B;  4P17 A;  3PNY A;  5EP1 A;  5KQD A;  4BB9 A;  2VQE M;  4JYA M;  4GH9 A;  2UUA M;  3THG A;  1IFY A;  3U6Q A;  2L4F A;  1NVM A;  4IBB A;  3CF0 A;  3I51 A;  1L1Z A;  2C96 A;  4DBG B;  2KZU A;  3U6E A;  1G3I A;  2HHH M;  2F4V M;  4KHP M;  3VKH A;  1IN7 A;  5DYI A;  2WSE F;  5DYG A;  4PCZ A;  1XXH E;  2N35 A;  2DHR A;  2JWS A;  2CHQ A;  1AUA A;  2HCB A;  1C7Y A;  1X37 A;  5IT9 S;  2G3Q A;  1K3X A;  1IM2 A;  1ZAE A;  2H1R A;  3U6M A;  3E9S A;  3AOG A;  4XK8 F;  2CWB A;  1T3T A;  3U60 A;  2KA6 B;  3AOE A;  2X8A A;  2JY7 A;  7CAT A;  3BXW A;  3SBJ A;  2MH8 A;  3L29 A;  3ZQJ A;  3FTE A;  1JB0 F;  4GHL A;  2GNO A;  2QPA A;  1D0K A;  1WIV A;  2FS1 A;  3KP1 E;  1XNQ M;  2OQ4 A;  2CHV A;  4JI0 M;  3E46 A;  4NSR A;  4R71 A;  1XXH B;  5BPV A;  1OIP A;  3AV0 A;  2Z4S A;  2XFS A;  4DR5 M;  4DR3 M;  4AKH A;  2G5G X;  4IBJ A;  4II7 A;  4QHT A;  2QQ8 A;  3QAU A;  4QNM A;  2FH0 A;  1MX0 A;  2UXB M;  2JP7 A;  4ANR A;  2CFO A;  3JR4 A;  3GLF A;  4KO8 A;  2MRO B;  3KFU G;  4LF6 M;  1IN5 A;  1Z6T A;  1NNJ A;  2EJS A;  1OQY A;  3B89 A;  1V34 A;  2DZN B;  3EIE A;  3U6S A;  3R8F A;  5LMN M;  3KS8 A;  2V1U A;  1R4G A;  3HJ8 A;  3GLH B;  3M0E A;  4I4L A;  4I5S A;  4P16 A;  3L26 A;  4DV6 M;  1ZMU A;  4MGI E;  1LTM A;  1IBL M;  1XXH A;  3LCU A;  5E26 A;  1PJT A;  3GQ5 A;  1QAN A;  1XHB A;  3UJN A;  2DWN A;  1GO5 A;  2K47 A;  1UM8 A;  1J09 A;  1SXJ C;  1HNX M;  2LVP C;  3U61 A;  1T6O A;  1N34 M;  4JN6 A;  2MR9 A;  4LF8 M;  1QAO A;  3R9X B;  2DZO B;  4I8O A;  1IXS B;  2DHY A;  4LF4 M;  1NSF A;  1VQ1 A;  2C9O A;  3TWK A;  2CUZ A;  2QP9 X;  2O5R A;  2XZF A;  4HLQ A;  2KNZ A;  3B7N A;  1IN4 A;  1VEG A;  1J7K A;  1LV7 A;  4DV0 M;  2KEB A;  3J7B A;  4RF1 A;  2LHC A;  4LF7 M;  1NV9 A;  4FCT A;  3KOX E;  5EQT A;  2R4E A;  4OVZ B;  4L16 A;  3FKE A;  3J2P B;  1GVN A;  4FCW A;  4NL4 H;  1OFI A;  1N32 M;  3VLF B;  3UK6 A;  4D81 A;  2Z7J A;  2DI0 A;  4LJ5 A;  2B3T A;  1G4A E;  3GLI E;  4I81 A;  1NY6 A;  1IN6 A;  1GL7 A;  2DAM A;  2L4E A;  1TR8 A;  1H6U A;  3CF6 E;  3TWL A;  1NO1 A;  1WR1 B;  1XWI A;  2CHG A;  4B3M M;  4LFA M;  2VII A;  3K92 A;  4JI5 M;  2R65 A;  1FJG M;  1IY2 A;  2QEN A;  2O01 F;  3SAR A;  1DGB A;  4MGH A;  2DEN A;  2JY5 A;  4RF0 A;  1E9R A;  1Z59 A;  5EXT A;  4LRS A;  2F5S A;  3FTF A;  2V1C A;  1OFH A;  1DV0 A;  2NQ8 C;  4RNA A;  1ZMW A;  3AKZ A;  4JI8 M;  2O25 A;  3AOE C;  3D8L A;  3KOW E;  4F1I A;  4DR1 M;  2RGH A;  2OOB A;  4JI7 M;  3IG8 A;  4WP2 A;  1WGL A;  4X66 M;  4G3O A;  1KFV A;  4M9Z A;  4FCV A;  3LMM A;  4L6V 6;  1VEK A;  4G6Z A;  1WGN A;  1UFZ A;  4MM3 B;  2D7E A;  2KW0 A;  4QHS A;  3VFD A;  1QVR A;  3T1Y M;  2L6O A;  4CIZ A;  2D7G A;  4G4R A;  1XNR M;  3B9P A;  4GIP A;  1Y8G A;  2ZTD A;  2BNK A;  4R3D A;  3NBI A;  2D7H A;  5FTJ A;  2RKO A;  1Q3B A;  3U6O A;  4MB7 A;  2LTU A;  2K0B X;  3UZU A;  3K2L A;  3U6L A;  2VF7 A;  3SFZ A;  3B7Q A;  4ZPX A;  1N78 A;  4DV3 M;  2ZBK B;  4GC5 A;  4TUW A;  4IJE A;  3VDU A;  4L4U A;  3GRR A;  3V76 A;  2Y20 A;  5EJC A;  1E9S A;  4PT5 A;  2F5O A;  2LBC A;  4AW4 A;  3J80 S;  3T1H M;  1NJF A;  1OKS A;  2AHM A;  3CTW B;  3HX3 A;  3K9O A;  2JUJ A;  3SYK A;  2KHH A;  3LQR A;  2R62 A;  3L25 A;  3GLG A;  1Z5B A;  3FRH A;  4FW9 A;  4R7G A;  1G41 A;  1MU5 A;  4D82 A;  3GLI A;  3EIH A;  5FTN A;  1WJ7 A;  3QWL A;  1PJJ A;  4GHA A;  1Q02 A;  4GRI A;  2UU9 M;  2F5N A;  3H4M A;  3UGJ A;  1EIJ A;  3U61 B;  2LNH C;  2QZ4 A;  4LGM A;  3GPY A;  3TWM A;  2KZS A;  1GAB A;  1IXS A;  3M7G A;  4IBK A;  5EP4 A;  3PVS A;  3HU2 A;  1L2C A;  4LJ9 A;  5KQ8 A;  2E5L M;  2R6F A;  4KLN A;  4JI3 M;  1NJG A;  4ITQ A;  2JY6 B;  3B7Z A;  2YR0 A;  4UN2 B;  2F5Q A;  3SAW A;  2DXI A;  2MGW A;  3SAV A;  1BVS A;  4JXJ A;  2CV1 A;  4LJ4 A;  2HWJ A;  2ZM6 M;  1IN8 A;  3NBX X;  1KSF X;  1PJS A;  3GRV A;  4RKU F;  5EXX A;  3ZH9 B;  3HWS A;  2HAK A;  2L09 A;  4AQY M;  4DR6 M;  1SXJ D;  1FNN A;  2DAK A;  4CIS A;  2Q2E B;  3GLF E;  3KP0 E;  3HKP A;  2Y21 A;  4MGK E;  2H5X A;  3GLG B;  5L8R F;  3T15 A;  3TE6 A;  5A2Q S;  3C3E A;  2KRU A;  4B7F A;  5LMU M;  1J5E M;  3FD9 A;  2LWX A;  4B08 A;  2GQF A;  4NOO B;  3T38 A;  1P3Q Q;  5ITX A;  4QOS A;  2KRK A;  1G71 A;  1W5T A;  3VDP A;  4FD2 A;  2W82 A;  4LJ8 A;  3SHF A;  3A46 A;  4K0K M;  3LCV B;  1K3W A;  5ITU A;  4AKG A;  1TDZ A;  4Z8X A;  1DO2 A;  2KNA A;  2X49 A;  4G4O A;  4AI6 A;  2I7N A;  3D8B A;  1DGF A;  3KXE C;  1N33 M;  1ORY B;  2UXD M;  2UXC M;  3PXG A;  3FUV A;  3FYC A;  3KW6 A;  4YY3 M;  2DAI A;  4Y28 F;  1G8P A;  1PJI A;  1IY0 A;  2KDL A;  5GKN A;  1ZQ9 A;  2OO9 A;  2Z8Y M;  1YE9 A;  2ZAM A;  2XLJ A;  2K9D A;  3W0L B;  1L2D A;  3FUT A;  3HU3 A;  4YHH M;  1NHG C;  4PD2 A;  1N36 M;  4JI1 M;  1QYR A;  3AL0 C;  1HQC A;  1SXJ B;  2DVW B;  4GC9 A;  4B7G A;  5DNY A;  2DAG A;  4OW0 A;  3I04 M;  4G4N A;  2DWL A;  1OTR A;  2BWE A;  2DAE A;  4LZZ A;  1IBM M;  2YFQ A;  1HR0 M;  2LHG A;  2BJW A;  4Z6Y A;  1TTE A;  3HHY A;  3HHX A;  2C9C A;  4OX9 M;  3CF2 A;  3LW5 F;  4DR7 M;  5KPT A;  3QYE A;  4DV4 M;  5EP2 A;  3DFZ A;  1YUB A;  4LF9 M;  2DWM A;  5DFL A;  1C1K A;  2XSZ D;  1HT2 E;  2CP8 A;  3HU1 A;  3GQ4 A;  1Q39 A;  2EUC A;  1Z5A A;  3JAM S;  2KXE A;  4B3R M;  5BR8 M;  2QNJ A;  3B74 A;  3IEC A;  2R45 A;  1PGY A;  3FUX A;  3HGI A;  5KPR A;  3KS4 A;  4NRW A;  2G8L A;  3SAT A;  1QUS A;  2QBY A;  2M60 A;  3U60 B;  5E6J A;  4FVM A;  2JNH A;  3KOY E;  3F92 A;  3U6P A;  4IBI A;  3LQQ A;  5FSW A;  1IBK M;  3MHV C;  4LGY A;  1G59 A;  2M5Z A;  4CJ6 A;  3FRI A;  4XBO A;  1HQY E;  1QAQ A;  2P5T A;  2C99 A;  1XMO M;  2R0I A;  3SAS A;  4EIW A;  3GPU A;  5F3W A;  2ZAN A;  4FWG A;  4LY6 A;  4IBG A;  4NC6 A;  3U5Z B;  4IBD A;  5IWA M;  1SXJ A;  4WUR A;  2CRU A;  3FUW A;  1XMQ M;  3A42 A;  2XEP A;  4WW0 A;  2LXE A;  5FTM A;  3I4Y A;  1HT1 E;  1Z5C A;  3C9P A;  4GEW A;  4NRV A;  2BJV A;  3M6A A;  1QDR A;  1HNW M;  1JR3 A;  2YNM D;  4FWH A;  3SHG B;  5IZ7 D;  1DGH B;  3C3D A;  2LH0 A;  3BBZ A;  4NSO B;  2X4A A;  1TH2 A;  4IBC A;  1XC8 A;  3RGP A;  4PDI A;  1T43 A;  2XF3 A;  4DR4 M;  3IG5 A;  4AKI A;  2XSZ A;  1HJP A;  3PNV A;  1QAM A;  3WHL A;  2HL7 A;  2KNV A;  1N75 A;  4W5W A;  2CEA A;  2OOA A;  3GLH A;  1TGU A;  1GJS A;  1E94 E;  4DV2 M;  3Q8G A;  1L2B A;  2A5Y B;  3JR5 A;  1NV8 A;  2UUC M;  4DUY M;  2WZJ A;  2QSF X;  1F4I A;  4L15 A;  1QZM A;  3A98 B;  4OU7 A;  4NXM M;  3GRU A;  1TH3 A;  2QBY B;  4X64 M;  1R5L A;  5ITR A;  3GLG E;  2L7H A;  1I94 M;  1IXZ A;  2ERC A;  1W5S A;  1V92 A;  3L27 A;  3PFI A;  4DUZ M;  3GPX A;  1OJL A;  5EXS A;  1JR3 D;  1YSY A;  3K9P A;  3NWL A;  3GLF B;  3GQ3 A;  2J5Y A;  2ZAO A;  3VKG A;  4LJ7 A;  3KSJ A;  3T6P A;  4FWD A;  3MMP A;  4KT0 F;  4BLC A;  2DZL A;  5FTK A;  1TH4 A;  3H4J A;  2JXN A;  3K1J A;  4GKK M;  1R2Y A;  1OAO C;  1K82 A;  3SYL A;  4LF5 M;  1EE8 A;  1NNU C;  3L28 A;  4L8R C;  1N77 A;  3TL4 X;  1GKI A;  3FTD A;  3I4V A;  1IY1 A;  4Q7J A;  1QUT A;  2JZ0 A;  1IQP A;  1SXJ E;  4LJA A;  3SC3 A;  4AZF A;  5FLX S;  2JZ1 A;  2CV0 A;  3MJ5 A;  3AJI B;  3TQS A;  5C18 A;  4LG2 A;  2R44 A;  4LCB A;  1L8Q A;  3FYD A;  3KSX A;  4QNR A;  5IRE B;  3HHZ A;  4DV7 M;  3Q8X A;  3BOS A;  5JI2 E;  1E32 A;  3DZD A;  1TF0 B;  3HJS A;  2RRU A;  3HY5 A;  2FFJ A;  2L7I A;  4DR2 M;  3KDS E;  4HEO A;  4KOD A;  5FTL A;  1VDD A;  5ITQ A;  2Z4R A;  4QOZ C;  3W67 A;  5C1B A;  2XGN A;  5ITX E;  3J27 B;  3GLH E;  3W68 A;  3I01 M;  3RE8 A;  3GRY A;  2LVN C;  3QYB A;  2Y0Q A;  1A5T A;  4IBE A;  2DKL A;  4IIW A;  1WHC A;  2VDB B;  2ZTC A;  4L78 A;  4OVZ A;  5ITY A;  1L1T A;  1HNZ M;  1VEJ A;  1Q3C A;  3RGS A;  3AFH A;  1D2N A;  4PDG A;  1NY5 A;  3FUU A;  4AG6 A;  2LVO C;  4DV5 M;  4LZJ A;  1GLN A;  4M9S A;  2DNA A;  1JQJ C;  1D0M A;  3SMS A;  2EA0 A;  1MJG M;  4NXN M;  4IJF A;  2Z3X A;  1QQW A;  2QHO B;  4CHT B;  4MGZ E;  3GO8 A;  2F5P A;  2R18 A;  1KYI A;  1MN3 A;  3ZCB B;  3WHK A;  1V33 A;  1CUK A;  2LVA A;  5JI3 E;  1EFU B;  4A3V B;  4REZ A;  5KPZ A;  4M0D A;  2QCU A;  2BWB A;  2YQZ A;  1S3S A;  2EKF A;  3KVW A;  4X62 M;  1ZV1 A;  2J7N A;  2MJ5 B;  1PJQ A;  4DV1 M;  2WSC F;  3HHW A;  3C58 A;  1PM5 A;  4B3S M;  3HZJ A;  2HKJ A;  1XB2 B;  2VQF M;  4JI6 M;  2WSF F;  3U6C A;  4IBF A;  4M9X A;  3GP1 A;  3J7A S;  2JY8 A;  4G4Q A;  1I4W A;  1DGH A;  4M0W A;  4F2L A;  8CAT A;  3U6D A;  4D80 A;  1QDT A;  3A45 A;  4JV5 M;  1TDH A;  3GPP A;  2J7O A;  4B7H A;  4XGI A;  1OIZ A;  2V6Z M;  3L2A A;  5H37 D;  1PRB A;  4HL4 A;  3KOZ E;  2UUB M;  3HJQ A;  5EXP A;  1NHW C;  4JI4 M;  3FE3 A;  3E21 A;  5EP3 A;  3DOA A;  2APL A;  2C5R A;  1GL6 A;  1IXR C;  3VK8 A;  3TPZ A;  2EKK A;  2R46 A;  1VG5 A;  2FE8 A;  3FTC A;  2LVQ D;  3RFW A;  2DWZ B;  4GKJ M;  3IHP A;  2XH9 A;  3SMP A;  3UMM A;  2JA2 A;  1JR3 E;  4GIT A;  4JI2 M;  2I7P A;  3CGW A;  3K8Z A;  3SAU A;  4LJ6 A;  2L2D A;  1SG9 A;  2XFT A;  4AG5 A;  3LVV A; 
#chains in the Genus database with same CATH homology
 1VDL A;  2KNZ A;  1ZMV A;  1VEG A;  3T6P A;  1P3Q Q;  3MMP A;  2DZL A;  1QZE A;  3H4J A;  1DO0 A;  1NV9 A;  3LCV B;  1OAI A;  1DO2 A;  2KNA A;  4Q7J A;  1AIP C;  2DI0 A;  2JZ0 A;  2B3T A;  2JZ1 A;  1G4A E;  3GLI E;  2DAI A;  1YLA A;  2DAM A;  2L4E A;  1IFY A;  1TR8 A;  5JI2 E;  1WR1 B;  2L4F A;  2OO9 A;  2K9D A;  2RRU A;  4DBG B;  2DEN A;  2JY5 A;  4HEO A;  1G3I A;  2DAG A;  3GLH E;  1OTR A;  2BWE A;  2DAE A;  1DV0 A;  1XXH E;  1ZMW A;  2LVN C;  1TTE A;  1A5T A;  2O25 A;  4F1I A;  1C7Y A;  2OOB A;  2DKL A;  2G3Q A;  1WHC A;  2ZTC A;  4WP2 A;  1WGL A;  1IM2 A;  4G3O A;  5DFL A;  1HT2 E;  1VEJ A;  2CP8 A;  2CWB A;  1VEK A;  2QNJ A;  1WGN A;  2JY7 A;  1UFZ A;  2LVO C;  1PGY A;  3IEC A;  2DNA A;  1WIV A;  1Y8G A;  2ZTD A;  2JNH A;  2QHO B;  3F92 A;  2LTU A;  2K0B X;  1KYI A;  1MN3 A;  3E46 A;  1HQY E;  3FRI A;  4R71 A;  2R0I A;  1CUK A;  2LVA A;  1EFU B;  2BWB A;  2LBC A;  2EKF A;  1OKS A;  3K9O A;  1ZV1 A;  2MJ5 B;  2JUJ A;  2KHH A;  1HT1 E;  4GEW A;  2JP7 A;  3FRH A;  2MRO B;  1XB2 B;  1G41 A;  3BBZ A;  1WJ7 A;  1T43 A;  2JY8 A;  1Q02 A;  2EJS A;  4F2L A;  1OQY A;  1HJP A;  3B89 A;  1IXS A;  2KNV A;  2OOA A;  1E94 E;  2JY6 B;  1R4G A;  3FE3 A;  4UN2 B;  3E21 A;  1NV8 A;  2MGW A;  1BVS A;  2HWJ A;  1ZMU A;  2WZJ A;  3LCU A;  2QSF X;  2EKK A;  1F4I A;  1VG5 A;  1GO5 A;  2HAK A;  2LVQ D;  2DAK A;  2LVP C;  1T6O A;  3GLG E;  2MR9 A;  3IHP A;  1JR3 E;  2DHY A;  3GLF E;  1V92 A;  2H5X A;  2L2D A;  1SG9 A;  1VQ1 A;  3K9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...