2EKKA

Solution structure of ruh-074, a human uba domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
47
Chain Sequence
GSSGSSGVNQQQLQQLMDMGFTREHAMEALLNTSTMEQATEYLLTHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBA domain from E3 ubiquitin-protein ligase HUWE1
publication title Solution structure of RUH-074, a human UBA domain
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 47
sequence length 47
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ekkA00
1VG5A 1G3IA 2RRUA 2OOAA 4R71A 2LVPC 1UFZA 3E21A 1WR1B 2K9DA 2LBCA 1P3QQ 3LCUA 1OTRA 2DHYA 2JZ0A 2JY5A 1ZMUA 2L4EA 1TTEA 2EJSA 2LTUA 3IHPA 4G3OA 2JY8A 1G41A 3E46A 2DKLA 2DZLA 1HJPA 1TR8A 1OKSA 3F92A 3K9PA 1C7YA 2JY7A 1WGLA 2H5XA 2ZTDA 1F4IA 2JP7A 1MN3A 2JUJA 4F2LA 1YLAA 2HWJA 3T6PA 1E94E 2LVNC 1HQYE 2BWEA 2JNHA 4GEWA 4WP2A 2MGWA 2DAGA 1VQ1A 1HT2E 1AIPC 3IECA 2KNZA 1IM2A 2DAEA 1JR3E 1Q02A 1WJ7A 2DAKA 1WGNA 1VEKA 2LVAA 1XB2B 3LCVB 2LVOC 2DI0A 2KHHA 1BVSA 2L2DA 2K0BX 1HT1E 2R0IA 2WZJA 2EKKA 2ZTCA 3GLFE 1DO2A 2OOBA 1V92A 1VDLA 1ZMVA 1IXSA 2CP8A 5JI2E 1OAIA 1CUKA 2KNAA 2O25A 2CWBA 4HEOA 1NV8A 1DV0A 1SG9A 3H4JA 1WHCA 2QSFX 1WIVA 1Y8GA 1VEJA 1T6OA 2EKFA 1OQYA 1DO0A 4UN2B 4Q7JA 1G4AE 2QNJA 3K9OA 2LVQD 2MROB 1IFYA 2BWBA 2G3QA 3FRIA 3FRHA 1VEGA 3FE3A 1ZMWA 4F1IA 2JZ1A 1T43A 2DENA 2B3TA 2OO9A 3B89A 2DAIA 3GLHE 1KYIA 2DAMA 3GLIE 1R4GA 1A5TA 1EFUB 2L4FA 2MR9A 2QHOB 2DNAA 1QZEA 3GLGE 2KNVA 2JY6B 1XXHE 1NV9A 1PGYA 1ZV1A 2HAKA 1GO5A 4DBGB 3BBZA 5DFLA 3MMPA 2MJ5B
chains in the Genus database with same CATH superfamily
4FCWA 4LFAM 4JI3M 2RRUA 3J80S 1IN8A 2RKOA 3TL4X 4JI2M 4B3RM 1WR1B 1QANA 1PRBA 2LBCA 2Z7JA 3U6MA 4KT0F 3SAUA 2L09A 1OTRA 4FCTA 3HWSA 3IHPA 3WHKA 2KA6B 1OAOC 4QOSA 4XK8F 4DV6M 3I4VA 1Z5AA 3TE6A 1D0LA 2F4VM 2DKLA 1L2BA 1J09A 2K6BA 2C9CA 2LHCA 1TR8A 3D8BA 1N33M 4KODA 2L7IA 2FH0A 3HY5A 2RGHA 5E26A 4S12A 4LJ9A 4YHHM 4KHPM 4LFBM 1N78A 2ZTDA 3FD9A 2WSEF 3W0LB 1MN3A 4LF8M 1YLAA 3KOWE 4IJEA 3LQQA 3Q8XA 4MB7A 2DWMA 4IIWA 2UU9M 3FTDA 3HHXA 1GABA 3IG8A 1VDDA 1IY0A 4LY6A 4MH0E 4GHLA 5IWAM 2UUCM 1VQ1A 1XC8A 1C1KA 2XSZD 4JN6A 4QOZC 4AW4A 4P16A 3TWMA 3A46A 2VQEM 1HNXM 1NHGC 2LH0A 2M5ZA 4LRTA 1JR3E 4LRSA 2QENA 3TPZA 1L2CA 4IBKA 5F3WA 1WGNA 1VEKA 2XF3A 1IN5A 4K0KM 2KHHA 1D0MA 4JI5M 3UZUA 1NNUC 3HZJA 2L2DA 2R65A 2HHHM 5H37D 2UXBM 3GLFE 1DO2A 2KRKA 2F5NA 1QVRA 4X62M 1V92A 1VDLA 1ZMVA 1IXSA 2HL7A 1N75A 4GMQA 4PCZA 1CUKA 4JI7M 1V33A 5GKNA 2F5QA 4LF4M 1NV8A 3AFHA 4REZA 2G5GX 3GPUA 2D7GA 1GKIA 4LZZA 2XLJA 1KFVA 2L6OA 1IXZA 1TF0B 2OQ4A 4AI6A 2EO2A 4IBJA 1IBLM 2Z4SA 3U6DA 3HJ8A 3GRRA 1OQYA 4GC9A 4KO8A 3U6SA 1G4AE 2QNJA 3LVWA 4NXNM 3KOXE 4OU7A 1AUAA 1XMOM 2BJVA 3KOZE 2BWBA 4GH9A 2G3QA 2YR0A 4B08A 4DV5M 1VEGA 1ZMWA 4LGMA 4QNMA 1HQCA 3L26A 4R3DA 2Z4RA 2V1CA 2ZAMA 5EP4A 3E4RA 4DR2M 4G4RA 4L15A 1L2DA 2DAIA 3BXWA 3U61B 4CGYB 3U5ZA 1D2NA 2DZNB 3C9PA 3HU3A 4FCVA 4LF6M 2Y0TA 4B7HA 3VKGA 3SARA 2DVWB 1K3XA 4L16A 3U5ZB 1R4GA 1E9SA 1A5TA 2I7PA 4JI6M 4GRIA 3DA1A 4BBAA 3UJNA 1K82A 1N77A 4ZPXA 3W68A 1SXJD 1L1TA 2JY6B 2VF7A 3L29A 1ZV1A 3FUXA 1PGYA 1QZMA 2HAKA 2XFSA 4M9SA 4MGHA 2NQ8C 2X8AA 1PJQA 2J7NA 3LVVA 4NOOB 3GLIA 4M0DA 2CV2A 4GHAA 4LZJA 3HU2A 1N36M 1G59A 2A5YB 3GRUA 4NSRA 4D80A 5A2QS 3GQ4A 3KDSE 4DV1M 1IXRC 3E21A 4DR6M 2KEBA 5EP2A 4DR3M 3MHVC 4JI0M 2R62A 4AKIA 1QYRA 2DHYA 4QNRA 2KZUA 2JZ0A 2JY5A 4Z8XA 3GLGA 2L4EA 1TTEA 1XXHA 3U6QA 3ILKA 3DOAA 2JY8A 4ANRA 3GLGB 5ITXA 1G41A 1OFHA 3W67A 1UM8A 1TH2A 4MGZE 3RFWA 1YE9A 1OKSA 3AOEC 3F92A 3R8FA 1Z59A 2AHMA 3J2PB 2UXDM 4IJFA 2CUZA 3OTOM 3EIEA 4DV3M 3FUTA 2LXEA 3U60A 2JP7A 5KPRA 3C3DA 2UUBM 3SYLA 3FUUA 5FSWA 1TGUA 2HWJA 3U60B 4LG2A 3GQ5A 2CV0A 4AG6A 2GNOA 3JAMS 1HQYE 2BWEA 5E6JA 2MGWA 3FUWA 1HT2E 3PFIA 1AIPC 4IBBA 4LJAA 2KNZA 4AZFA 3U6CA 2F5SA 2VDBB 3KFUG 4LF7M 2XEPA 3KS4A 4JXJA 2O5RA 4LFCM 4IBIA 4MGYE 1LTMA 3TWLA 2LVAA 3C58A 3CF0A 4JYAM 1IY1A 1SXJA 3AOEA 2QBYA 2V6ZM 2R4EA 1OFIA 3KOYE 5KQDA 2KZSA 1NY6A 2R0IA 4NC6A 1SXJB 3HJSA 4DR5M 3B7NA 4JI1M 4IBFA 2XFTA 3HU1A 4HL4A 3GPYA 2OOBA 4NXMM 2CE7A 5JI2E 2KXEA 1QQWA 4DV4M 2O25A 4OVZA 1L8QA 1DV0A 3T38A 4ITQA 4BB9A 3B9PA 2P5TA 2DWZB 3KP1E 3L2AA 1GL6A 3NBIA 3M0EA 4RKUF 3DZDA 5EXXA 2QCUA 3SFZA 3ZC7B 1JQJC 2GQFA 3BOSA 2EKFA 3UK6A 1IY2A 1DO0A 4PT5A 4UN2B 1DGHA 3J7BA 4Q7JA 5EP3A 3K9OA 2UXCM 3SAVA 2LVQD 2MROB 3GP1A 4LF5M 1XWIA 2Z8YM 3FRIA 2QZ4A 3UGJA 4IBDA 3QWLA 2JZ1A 4F1IA 1E9RA 3C3EA 1QAQA 2B3TA 3RE8A 2OO9A 2UUAM 3B89A 3KP0E 4JV5M 1MJGM 3J27B 1KYIA 1PM5A 2DAMA 1MU5A 3FUVA 3KSXA 3GLIE 1NO1A 1IXSB 1IN4A 2R46A 3AJIB 3SHGB 1NJGA 2J5YA 4L6V6 5FTJA 2I7NA 1KSFX 4DV0M 1K3WA 2L4FA 4AQYM 4GC5A 5ITQA 2QHOB 3MJ5A 4PD2A 2HCBA 1EIJA 3PVSA 3GLGE 3JR4A 2KNVA 4DUYM 2EA0A 3GLHA 1XXHE 3SMSA 2Y21A 1PJSA 2OPFA 4DBGB 4W5WA 4CJ6A 5ITXE 1FJGM 2H1RA 2FE8A 2Y20A 4FVMA 5DFLA 4GITA 4CISA 4PDIA 1G3IA 1TH3A 4L8RC 2OOAA 4R71A 2LVPC 1V34A 3L27A 1XMQM 2ZBKB 3HX3A 3LCUA 4B3MM 1NJFA 2F5OA 1NSFA 1QDTA 3TQSA 3VK8A 1ZMUA 2EJSA 5EXSA 4YY3M 4DR1M 3GRVA 2R44A 4XBOA 3K2LA 4I8OA 3HKPA 5KPTA 4B7FA 3HHYA 2QPAA 1GVNA 2QQ8A 1H6UA 2KRUA 3B7QA 3K9PA 4FWHA 2JY7A 1WGLA 2YQZA 4NRWA 2FNAA 4CHTB 3HGIA 3QYBA 1EE8A 3W0FA 1F4IA 4F2LA 2JUJA 3LW5F 2XGNA 4I81A 5KO3A 3I01M 1HR0M 4RF1A 2KW0A 3SMPA 3T6PA 3FKEA 3GLIB 2M60A 3GQ3A 2O01F 4GEWA 1N34M 3R9XB 1SXJE 2VIIA 3GPPA 2E5LM 4G4OA 1G71A 2X49A 3A42A 5FTNA 1IBKM 1R5LA 2YNMD 3B74A 3UMMA 1QUSA 2DAEA 1J7KA 2CFOA 1XNQM 1XXHB 1Q02A 3VDPA 4PDGA 3J7AS 4G6ZA 2G8LA 1SXJC 3ZCBB 2LVOC 2BNKA 1Q39A 1QUTA 4LJ8A 1BVSA 2MH8A 3Q8GA 1HT1E 2WZJA 2ZM6M 1OIPA 2EKKA 1IBMM 2ZTCA 5IT9S 3J81S 4D82A 3NWLA 2Q2EB 3SC3A 3TWKA 4WW0A 4DR7M 3DFZA 5EP1A 2FFJA 2CWBA 4DR4M 4HEOA 3ZQJA 1SG9A 3K92A 5L8RF 2R6FA 3H4MA 3CGWA 3H4JA 1WHCA 4EIWA 3QYEA 4Y28F 4JI4M 5IZ7D 4D81A 5LMNM 3LMMA 1R2YA 3T1HM 2Y0QA 1T6OA 2C99A 3VDUA 5FTKA 3VK7A 4NRVA 4LGYA 2DWNA 1MX0A 3THGA 7CATA 1IFYA 5EQTA 4KLNA 3FTEA 3FRHA 3FE3A 1HNWM 2APLA 3I51A 2QBYB 1GJTA 3L25A 3KXEC 2W82A 1Q3BA 1XNRM 1XHBA 4HLQA 3CTWB 4BLCA 1NHWC 3GLHE 3SBJA 3AOGA 3SASA 1PJTA 4JI8M 5ITTA 4P17A 2D7HA 5FLXS 2HKJA 1N32M 2ZAOA 2CRUA 4X64M 1DGFA 4OVZB 1EFUB 3RGPA 2YFQA 1NY5A 2MR9A 4IBEA 3KS8A 1QAOA 3U6OA 2JXNA 4G4NA 3B7ZA 4X66M 4OX9M 3NBXX 4GIPA 3FTCA 1NV9A 5BR8M 3V76A 4DV2M 1GO5A 3BBZA 1G8PA 4TUWA 2ZANA 1DGHB 2RGOA 4LJ5A 3MMPA 2Z3XA 1PJJA 2ERCA 1VG5A 1Z6TA 3U6LA 3U6PA 3FTFA 2WSCF 1JB0F 1L1ZA 1TDZA 4L4UA 1UFZA 4L78A 3GPXA 1JR3D 2K9DA 2XZUA 2V1UA 1I4WA 1P3QQ 2KDLA 4QHTA 1PJIA 2JWSA 5EXPA 3M6AA 3MK6A 4LJ4A 4NSOB 2LTUA 2DWLA 4G3OA 1X37A 3T15A 3A98B 5ITYA 3E46A 4B3SM 1FNNA 2DZLA 1HJPA 1QAMA 8CATA 5EXTA 4WURA 1E32A 3KW6A 1R2ZA 1Z5BA 1C7YA 4LJ7A 5DYIA 2H5XA 4FW9A 5C1BA 1IQPA 3M7GA 4M9XA 4B7GA 3AKZA 4FWGA 4CIZA 2N35A 2FOIC 3GLHB 1NVMA 2C96A 2K47A 4I4LA 4FD2A 4GKKM 1E94E 3SHFA 2LVNC 3I04M 1R6BX 2JNHA 4B3TM 4WP2A 2CHVA 2DAGA 3RGSA 4AG5A 5IREB 5FTLA 2LHGA 3IECA 4OW0A 1YSYA 2X4AA 3HHWA 2LNHC 4LCBA 1DGGA 2C98A 1IM2A 3GO8A 2FS1A 3PNYA 4M0WA 2EUCA 2CV1A 4MGIE 1WJ7A 2BJWA 3JR5A 4G4QA 2DAKA 3PXGA 1T3TA 1XB2B 3LCVB 2CHGA 3SATA 2DI0A 3HJQA 1R7RA 1OJLA 1W5TA 5BPVA 2K0BX 2J7OA 3LQRA 5ITRA 2R45A 5C18A 2C5RA 1RU3A 3SAWA 5JI3E 3WHLA 1J5EM 3AV0A 3U61A 3U6EA 5EJCA 1Q3CA 2CP8A 1JR3A 1OAIA 2CHQA 1IN7A 2KNAA 4M9ZA 4RF0A 3KSJA 1IN6A 3PNVA 3VLFB 4AKHA 2XSZA 1ORYB 5KPZA 4X65M 4IBCA 2QSFX 1WIVA 2L7HA 1ZQ9A 2R4JA 4I5SA 4MM3B 4LF9M 3FYDA 3T1YM 1Y8GA 4LJ6A 1VEJA 3GLFA 1TH4A 1Z5CA 3VFDA 4QHSA 4DV7M 2LWXA 2R18A 4R7GA 3GLFB 4DUZM 3HHZA 3FYCA 4IBGA 2XZFA 3ZH9B 1I94M 3A45A 2D7EA 3EIHA 2QP9X 4MGKE 1T43A 2DENA 2VF8A 4Z6YA 1GJSA 3AL0C 3CF6E 3E9SA 1QDRA 3D8LA 2F5PA 1HNZM 1GL7A 1LV7A 3CF2A 2DHRA 1S3SA 3QAUA 2VQFM 4II7A 4FWDA 1W5SA 1TDHA 4GKJM 4AKGA 3SYKA 1OIZA 1ZAEA 5FTMA 4A3VB 5DNYA 4NL4H 1YUBA 2WSFF 3IG5A 2DXIA 1DGBA 1NNJA 2XH9A 3KVWA 2JA2A 1D0KA 5ITUA 2DNAA 1QZEA 2DZOB 3I4YA 2CEAA 4RNAA 3GRYA 3VKHA 3K1JA 1WXQA 2C9OA 5DYGA 5LMUM 4XGIA 3L28A 5KQ8A 1GLNA 2MJ5B 3K8ZA
chains in the Genus database with same CATH topology
1VG5A 1G3IA 2RRUA 2OOAA 4R71A 2LVPC 1UFZA 3E21A 1WR1B 2K9DA 2LBCA 1P3QQ 3LCUA 1OTRA 2DHYA 2JZ0A 2JY5A 1ZMUA 2L4EA 1TTEA 2EJSA 2LTUA 3IHPA 4G3OA 2JY8A 1G41A 3E46A 2DKLA 2DZLA 1HJPA 1TR8A 1OKSA 3F92A 3K9PA 1C7YA 2JY7A 1WGLA 2H5XA 2ZTDA 1F4IA 2JP7A 1MN3A 2JUJA 4F2LA 1YLAA 2HWJA 3T6PA 1E94E 2LVNC 1HQYE 2BWEA 2JNHA 4GEWA 4WP2A 2MGWA 2DAGA 1VQ1A 1HT2E 1AIPC 3IECA 2KNZA 1IM2A 2DAEA 1JR3E 1Q02A 1WJ7A 2DAKA 1WGNA 1VEKA 2LVAA 1XB2B 3LCVB 2LVOC 2DI0A 2KHHA 1BVSA 2L2DA 2K0BX 1HT1E 2R0IA 2WZJA 2EKKA 2ZTCA 3GLFE 1DO2A 2OOBA 1V92A 1VDLA 1ZMVA 1IXSA 2CP8A 5JI2E 1OAIA 1CUKA 2KNAA 2O25A 2CWBA 4HEOA 1NV8A 1DV0A 1SG9A 3H4JA 1WHCA 2QSFX 1WIVA 1Y8GA 1VEJA 1T6OA 2EKFA 1OQYA 1DO0A 4UN2B 4Q7JA 1G4AE 2QNJA 3K9OA 2LVQD 2MROB 1IFYA 2BWBA 2G3QA 3FRIA 3FRHA 1VEGA 3FE3A 1ZMWA 4F1IA 2JZ1A 1T43A 2DENA 2B3TA 2OO9A 3B89A 2DAIA 3GLHE 1KYIA 2DAMA 3GLIE 1R4GA 1A5TA 1EFUB 2L4FA 2MR9A 2QHOB 2DNAA 1QZEA 3GLGE 2KNVA 2JY6B 1XXHE 1NV9A 1PGYA 1ZV1A 2HAKA 1GO5A 4DBGB 3BBZA 5DFLA 3MMPA 2MJ5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VG5 A;  1G3I A;  2RRU A;  2OOA A;  4R71 A;  2LVP C;  1UFZ A;  3E21 A;  1WR1 B;  2K9D A;  2LBC A;  1P3Q Q;  3LCU A;  1OTR A;  2DHY A;  2JZ0 A;  2JY5 A;  1ZMU A;  2L4E A;  1TTE A;  2EJS A;  2LTU A;  3IHP A;  4G3O A;  2JY8 A;  1G41 A;  3E46 A;  2DKL A;  2DZL A;  1HJP A;  1TR8 A;  1OKS A;  3F92 A;  3K9P A;  1C7Y A;  2JY7 A;  1WGL A;  2H5X A;  2ZTD A;  1F4I A;  2JP7 A;  1MN3 A;  2JUJ A;  4F2L A;  1YLA A;  2HWJ A;  3T6P A;  1E94 E;  2LVN C;  1HQY E;  2BWE A;  2JNH A;  4GEW A;  4WP2 A;  2MGW A;  2DAG A;  1VQ1 A;  1HT2 E;  1AIP C;  3IEC A;  2KNZ A;  1IM2 A;  2DAE A;  1JR3 E;  1Q02 A;  1WJ7 A;  2DAK A;  1WGN A;  1VEK A;  2LVA A;  1XB2 B;  3LCV B;  2LVO C;  2DI0 A;  2KHH A;  1BVS A;  2L2D A;  2K0B X;  1HT1 E;  2R0I A;  2WZJ A;  2EKK A;  2ZTC A;  3GLF E;  1DO2 A;  2OOB A;  1V92 A;  1VDL A;  1ZMV A;  1IXS A;  2CP8 A;  5JI2 E;  1OAI A;  1CUK A;  2KNA A;  2O25 A;  2CWB A;  4HEO A;  1NV8 A;  1DV0 A;  1SG9 A;  3H4J A;  1WHC A;  2QSF X;  1WIV A;  1Y8G A;  1VEJ A;  1T6O A;  2EKF A;  1OQY A;  1DO0 A;  4UN2 B;  4Q7J A;  1G4A E;  2QNJ A;  3K9O A;  2LVQ D;  2MRO B;  1IFY A;  2BWB A;  2G3Q A;  3FRI A;  3FRH A;  1VEG A;  3FE3 A;  1ZMW A;  4F1I A;  2JZ1 A;  1T43 A;  2DEN A;  2B3T A;  2OO9 A;  3B89 A;  2DAI A;  3GLH E;  1KYI A;  2DAM A;  3GLI E;  1R4G A;  1A5T A;  1EFU B;  2L4F A;  2MR9 A;  2QHO B;  2DNA A;  1QZE A;  3GLG E;  2KNV A;  2JY6 B;  1XXH E;  1NV9 A;  1PGY A;  1ZV1 A;  2HAK A;  1GO5 A;  4DBG B;  3BBZ A;  5DFL A;  3MMP A;  2MJ5 B; 
#chains in the Genus database with same CATH topology
 4FCW A;  4LFA M;  4JI3 M;  2RRU A;  3J80 S;  1IN8 A;  2RKO A;  3TL4 X;  4JI2 M;  4B3R M;  1WR1 B;  1QAN A;  1PRB A;  2LBC A;  2Z7J A;  3U6M A;  4KT0 F;  3SAU A;  2L09 A;  1OTR A;  4FCT A;  3HWS A;  3IHP A;  3WHK A;  2KA6 B;  1OAO C;  4QOS A;  4XK8 F;  4DV6 M;  3I4V A;  1Z5A A;  3TE6 A;  1D0L A;  2F4V M;  2DKL A;  1L2B A;  1J09 A;  2K6B A;  2C9C A;  2LHC A;  1TR8 A;  3D8B A;  1N33 M;  4KOD A;  2L7I A;  2FH0 A;  3HY5 A;  2RGH A;  5E26 A;  4S12 A;  4LJ9 A;  4YHH M;  4KHP M;  4LFB M;  1N78 A;  2ZTD A;  3FD9 A;  2WSE F;  3W0L B;  1MN3 A;  4LF8 M;  1YLA A;  3KOW E;  4IJE A;  3LQQ A;  3Q8X A;  4MB7 A;  2DWM A;  4IIW A;  2UU9 M;  3FTD A;  3HHX A;  1GAB A;  3IG8 A;  1VDD A;  1IY0 A;  4LY6 A;  4MH0 E;  4GHL A;  5IWA M;  2UUC M;  1VQ1 A;  1XC8 A;  1C1K A;  2XSZ D;  4JN6 A;  4QOZ C;  4AW4 A;  4P16 A;  3TWM A;  3A46 A;  2VQE M;  1HNX M;  1NHG C;  2LH0 A;  2M5Z A;  4LRT A;  1JR3 E;  4LRS A;  2QEN A;  3TPZ A;  1L2C A;  4IBK A;  5F3W A;  1WGN A;  1VEK A;  2XF3 A;  1IN5 A;  4K0K M;  2KHH A;  1D0M A;  4JI5 M;  3UZU A;  1NNU C;  3HZJ A;  2L2D A;  2R65 A;  2HHH M;  5H37 D;  2UXB M;  3GLF E;  1DO2 A;  2KRK A;  2F5N A;  1QVR A;  4X62 M;  1V92 A;  1VDL A;  1ZMV A;  1IXS A;  2HL7 A;  1N75 A;  4GMQ A;  4PCZ A;  1CUK A;  4JI7 M;  1V33 A;  5GKN A;  2F5Q A;  4LF4 M;  1NV8 A;  3AFH A;  4REZ A;  2G5G X;  3GPU A;  2D7G A;  1GKI A;  4LZZ A;  2XLJ A;  1KFV A;  2L6O A;  1IXZ A;  1TF0 B;  2OQ4 A;  4AI6 A;  2EO2 A;  4IBJ A;  1IBL M;  2Z4S A;  3U6D A;  3HJ8 A;  3GRR A;  1OQY A;  4GC9 A;  4KO8 A;  3U6S A;  1G4A E;  2QNJ A;  3LVW A;  4NXN M;  3KOX E;  4OU7 A;  1AUA A;  1XMO M;  2BJV A;  3KOZ E;  2BWB A;  4GH9 A;  2G3Q A;  2YR0 A;  4B08 A;  4DV5 M;  1VEG A;  1ZMW A;  4LGM A;  4QNM A;  1HQC A;  3L26 A;  4R3D A;  2Z4R A;  2V1C A;  2ZAM A;  5EP4 A;  3E4R A;  4DR2 M;  4G4R A;  4L15 A;  1L2D A;  2DAI A;  3BXW A;  3U61 B;  4CGY B;  3U5Z A;  1D2N A;  2DZN B;  3C9P A;  3HU3 A;  4FCV A;  4LF6 M;  2Y0T A;  4B7H A;  3VKG A;  3SAR A;  2DVW B;  1K3X A;  4L16 A;  3U5Z B;  1R4G A;  1E9S A;  1A5T A;  2I7P A;  4JI6 M;  4GRI A;  3DA1 A;  4BBA A;  3UJN A;  1K82 A;  1N77 A;  4ZPX A;  3W68 A;  1SXJ D;  1L1T A;  2JY6 B;  2VF7 A;  3L29 A;  1ZV1 A;  3FUX A;  1PGY A;  1QZM A;  2HAK A;  2XFS A;  4M9S A;  4MGH A;  2NQ8 C;  2X8A A;  1PJQ A;  2J7N A;  3LVV A;  4NOO B;  3GLI A;  4M0D A;  2CV2 A;  4GHA A;  4LZJ A;  3HU2 A;  1N36 M;  1G59 A;  2A5Y B;  3GRU A;  4NSR A;  4D80 A;  5A2Q S;  3GQ4 A;  3KDS E;  4DV1 M;  1IXR C;  3E21 A;  4DR6 M;  2KEB A;  5EP2 A;  4DR3 M;  3MHV C;  4JI0 M;  2R62 A;  4AKI A;  1QYR A;  2DHY A;  4QNR A;  2KZU A;  2JZ0 A;  2JY5 A;  4Z8X A;  3GLG A;  2L4E A;  1TTE A;  1XXH A;  3U6Q A;  3ILK A;  3DOA A;  2JY8 A;  4ANR A;  3GLG B;  5ITX A;  1G41 A;  1OFH A;  3W67 A;  1UM8 A;  1TH2 A;  4MGZ E;  3RFW A;  1YE9 A;  1OKS A;  3AOE C;  3F92 A;  3R8F A;  1Z59 A;  2AHM A;  3J2P B;  2UXD M;  4IJF A;  2CUZ A;  3OTO M;  3EIE A;  4DV3 M;  3FUT A;  2LXE A;  3U60 A;  2JP7 A;  5KPR A;  3C3D A;  2UUB M;  3SYL A;  3FUU A;  5FSW A;  1TGU A;  2HWJ A;  3U60 B;  4LG2 A;  3GQ5 A;  2CV0 A;  4AG6 A;  2GNO A;  3JAM S;  1HQY E;  2BWE A;  5E6J A;  2MGW A;  3FUW A;  1HT2 E;  3PFI A;  1AIP C;  4IBB A;  4LJA A;  2KNZ A;  4AZF A;  3U6C A;  2F5S A;  2VDB B;  3KFU G;  4LF7 M;  2XEP A;  3KS4 A;  4JXJ A;  2O5R A;  4LFC M;  4IBI A;  4MGY E;  1LTM A;  3TWL A;  2LVA A;  3C58 A;  3CF0 A;  4JYA M;  1IY1 A;  1SXJ A;  3AOE A;  2QBY A;  2V6Z M;  2R4E A;  1OFI A;  3KOY E;  5KQD A;  2KZS A;  1NY6 A;  2R0I A;  4NC6 A;  1SXJ B;  3HJS A;  4DR5 M;  3B7N A;  4JI1 M;  4IBF A;  2XFT A;  3HU1 A;  4HL4 A;  3GPY A;  2OOB A;  4NXM M;  2CE7 A;  5JI2 E;  2KXE A;  1QQW A;  4DV4 M;  2O25 A;  4OVZ A;  1L8Q A;  1DV0 A;  3T38 A;  4ITQ A;  4BB9 A;  3B9P A;  2P5T A;  2DWZ B;  3KP1 E;  3L2A A;  1GL6 A;  3NBI A;  3M0E A;  4RKU F;  3DZD A;  5EXX A;  2QCU A;  3SFZ A;  3ZC7 B;  1JQJ C;  2GQF A;  3BOS A;  2EKF A;  3UK6 A;  1IY2 A;  1DO0 A;  4PT5 A;  4UN2 B;  1DGH A;  3J7B A;  4Q7J A;  5EP3 A;  3K9O A;  2UXC M;  3SAV A;  2LVQ D;  2MRO B;  3GP1 A;  4LF5 M;  1XWI A;  2Z8Y M;  3FRI A;  2QZ4 A;  3UGJ A;  4IBD A;  3QWL A;  2JZ1 A;  4F1I A;  1E9R A;  3C3E A;  1QAQ A;  2B3T A;  3RE8 A;  2OO9 A;  2UUA M;  3B89 A;  3KP0 E;  4JV5 M;  1MJG M;  3J27 B;  1KYI A;  1PM5 A;  2DAM A;  1MU5 A;  3FUV A;  3KSX A;  3GLI E;  1NO1 A;  1IXS B;  1IN4 A;  2R46 A;  3AJI B;  3SHG B;  1NJG A;  2J5Y A;  4L6V 6;  5FTJ A;  2I7N A;  1KSF X;  4DV0 M;  1K3W A;  2L4F A;  4AQY M;  4GC5 A;  5ITQ A;  2QHO B;  3MJ5 A;  4PD2 A;  2HCB A;  1EIJ A;  3PVS A;  3GLG E;  3JR4 A;  2KNV A;  4DUY M;  2EA0 A;  3GLH A;  1XXH E;  3SMS A;  2Y21 A;  1PJS A;  2OPF A;  4DBG B;  4W5W A;  4CJ6 A;  5ITX E;  1FJG M;  2H1R A;  2FE8 A;  2Y20 A;  4FVM A;  5DFL A;  4GIT A;  4CIS A;  4PDI A;  1G3I A;  1TH3 A;  4L8R C;  2OOA A;  4R71 A;  2LVP C;  1V34 A;  3L27 A;  1XMQ M;  2ZBK B;  3HX3 A;  3LCU A;  4B3M M;  1NJF A;  2F5O A;  1NSF A;  1QDT A;  3TQS A;  3VK8 A;  1ZMU A;  2EJS A;  5EXS A;  4YY3 M;  4DR1 M;  3GRV A;  2R44 A;  4XBO A;  3K2L A;  4I8O A;  3HKP A;  5KPT A;  4B7F A;  3HHY A;  2QPA A;  1GVN A;  2QQ8 A;  1H6U A;  2KRU A;  3B7Q A;  3K9P A;  4FWH A;  2JY7 A;  1WGL A;  2YQZ A;  4NRW A;  2FNA A;  4CHT B;  3HGI A;  3QYB A;  1EE8 A;  3W0F A;  1F4I A;  4F2L A;  2JUJ A;  3LW5 F;  2XGN A;  4I81 A;  5KO3 A;  3I01 M;  1HR0 M;  4RF1 A;  2KW0 A;  3SMP A;  3T6P A;  3FKE A;  3GLI B;  2M60 A;  3GQ3 A;  2O01 F;  4GEW A;  1N34 M;  3R9X B;  1SXJ E;  2VII A;  3GPP A;  2E5L M;  4G4O A;  1G71 A;  2X49 A;  3A42 A;  5FTN A;  1IBK M;  1R5L A;  2YNM D;  3B74 A;  3UMM A;  1QUS A;  2DAE A;  1J7K A;  2CFO A;  1XNQ M;  1XXH B;  1Q02 A;  3VDP A;  4PDG A;  3J7A S;  4G6Z A;  2G8L A;  1SXJ C;  3ZCB B;  2LVO C;  2BNK A;  1Q39 A;  1QUT A;  4LJ8 A;  1BVS A;  2MH8 A;  3Q8G A;  1HT1 E;  2WZJ A;  2ZM6 M;  1OIP A;  2EKK A;  1IBM M;  2ZTC A;  5IT9 S;  3J81 S;  4D82 A;  3NWL A;  2Q2E B;  3SC3 A;  3TWK A;  4WW0 A;  4DR7 M;  3DFZ A;  5EP1 A;  2FFJ A;  2CWB A;  4DR4 M;  4HEO A;  3ZQJ A;  1SG9 A;  3K92 A;  5L8R F;  2R6F A;  3H4M A;  3CGW A;  3H4J A;  1WHC A;  4EIW A;  3QYE A;  4Y28 F;  4JI4 M;  5IZ7 D;  4D81 A;  5LMN M;  3LMM A;  1R2Y A;  3T1H M;  2Y0Q A;  1T6O A;  2C99 A;  3VDU A;  5FTK A;  3VK7 A;  4NRV A;  4LGY A;  2DWN A;  1MX0 A;  3THG A;  7CAT A;  1IFY A;  5EQT A;  4KLN A;  3FTE A;  3FRH A;  3FE3 A;  1HNW M;  2APL A;  3I51 A;  2QBY B;  1GJT A;  3L25 A;  3KXE C;  2W82 A;  1Q3B A;  1XNR M;  1XHB A;  4HLQ A;  3CTW B;  4BLC A;  1NHW C;  3GLH E;  3SBJ A;  3AOG A;  3SAS A;  1PJT A;  4JI8 M;  5ITT A;  4P17 A;  2D7H A;  5FLX S;  2HKJ A;  1N32 M;  2ZAO A;  2CRU A;  4X64 M;  1DGF A;  4OVZ B;  1EFU B;  3RGP A;  2YFQ A;  1NY5 A;  2MR9 A;  4IBE A;  3KS8 A;  1QAO A;  3U6O A;  2JXN A;  4G4N A;  3B7Z A;  4X66 M;  4OX9 M;  3NBX X;  4GIP A;  3FTC A;  1NV9 A;  5BR8 M;  3V76 A;  4DV2 M;  1GO5 A;  3BBZ A;  1G8P A;  4TUW A;  2ZAN A;  1DGH B;  2RGO A;  4LJ5 A;  3MMP A;  2Z3X A;  1PJJ A;  2ERC A;  1VG5 A;  1Z6T A;  3U6L A;  3U6P A;  3FTF A;  2WSC F;  1JB0 F;  1L1Z A;  1TDZ A;  4L4U A;  1UFZ A;  4L78 A;  3GPX A;  1JR3 D;  2K9D A;  2XZU A;  2V1U A;  1I4W A;  1P3Q Q;  2KDL A;  4QHT A;  1PJI A;  2JWS A;  5EXP A;  3M6A A;  3MK6 A;  4LJ4 A;  4NSO B;  2LTU A;  2DWL A;  4G3O A;  1X37 A;  3T15 A;  3A98 B;  5ITY A;  3E46 A;  4B3S M;  1FNN A;  2DZL A;  1HJP A;  1QAM A;  8CAT A;  5EXT A;  4WUR A;  1E32 A;  3KW6 A;  1R2Z A;  1Z5B A;  1C7Y A;  4LJ7 A;  5DYI A;  2H5X A;  4FW9 A;  5C1B A;  1IQP A;  3M7G A;  4M9X A;  4B7G A;  3AKZ A;  4FWG A;  4CIZ A;  2N35 A;  2FOI C;  3GLH B;  1NVM A;  2C96 A;  2K47 A;  4I4L A;  4FD2 A;  4GKK M;  1E94 E;  3SHF A;  2LVN C;  3I04 M;  1R6B X;  2JNH A;  4B3T M;  4WP2 A;  2CHV A;  2DAG A;  3RGS A;  4AG5 A;  5IRE B;  5FTL A;  2LHG A;  3IEC A;  4OW0 A;  1YSY A;  2X4A A;  3HHW A;  2LNH C;  4LCB A;  1DGG A;  2C98 A;  1IM2 A;  3GO8 A;  2FS1 A;  3PNY A;  4M0W A;  2EUC A;  2CV1 A;  4MGI E;  1WJ7 A;  2BJW A;  3JR5 A;  4G4Q A;  2DAK A;  3PXG A;  1T3T A;  1XB2 B;  3LCV B;  2CHG A;  3SAT A;  2DI0 A;  3HJQ A;  1R7R A;  1OJL A;  1W5T A;  5BPV A;  2K0B X;  2J7O A;  3LQR A;  5ITR A;  2R45 A;  5C18 A;  2C5R A;  1RU3 A;  3SAW A;  5JI3 E;  3WHL A;  1J5E M;  3AV0 A;  3U61 A;  3U6E A;  5EJC A;  1Q3C A;  2CP8 A;  1JR3 A;  1OAI A;  2CHQ A;  1IN7 A;  2KNA A;  4M9Z A;  4RF0 A;  3KSJ A;  1IN6 A;  3PNV A;  3VLF B;  4AKH A;  2XSZ A;  1ORY B;  5KPZ A;  4X65 M;  4IBC A;  2QSF X;  1WIV A;  2L7H A;  1ZQ9 A;  2R4J A;  4I5S A;  4MM3 B;  4LF9 M;  3FYD A;  3T1Y M;  1Y8G A;  4LJ6 A;  1VEJ A;  3GLF A;  1TH4 A;  1Z5C A;  3VFD A;  4QHS A;  4DV7 M;  2LWX A;  2R18 A;  4R7G A;  3GLF B;  4DUZ M;  3HHZ A;  3FYC A;  4IBG A;  2XZF A;  3ZH9 B;  1I94 M;  3A45 A;  2D7E A;  3EIH A;  2QP9 X;  4MGK E;  1T43 A;  2DEN A;  2VF8 A;  4Z6Y A;  1GJS A;  3AL0 C;  3CF6 E;  3E9S A;  1QDR A;  3D8L A;  2F5P A;  1HNZ M;  1GL7 A;  1LV7 A;  3CF2 A;  2DHR A;  1S3S A;  3QAU A;  2VQF M;  4II7 A;  4FWD A;  1W5S A;  1TDH A;  4GKJ M;  4AKG A;  3SYK A;  1OIZ A;  1ZAE A;  5FTM A;  4A3V B;  5DNY A;  4NL4 H;  1YUB A;  2WSF F;  3IG5 A;  2DXI A;  1DGB A;  1NNJ A;  2XH9 A;  3KVW A;  2JA2 A;  1D0K A;  5ITU A;  2DNA A;  1QZE A;  2DZO B;  3I4Y A;  2CEA A;  4RNA A;  3GRY A;  3VKH A;  3K1J A;  1WXQ A;  2C9O A;  5DYG A;  5LMU M;  4XGI A;  3L28 A;  5KQ8 A;  1GLN A;  2MJ5 B;  3K8Z A; 
#chains in the Genus database with same CATH homology
 1VG5 A;  1G3I A;  2RRU A;  2OOA A;  4R71 A;  2LVP C;  1UFZ A;  3E21 A;  1WR1 B;  2K9D A;  2LBC A;  1P3Q Q;  3LCU A;  1OTR A;  2DHY A;  2JZ0 A;  2JY5 A;  1ZMU A;  2L4E A;  1TTE A;  2EJS A;  2LTU A;  3IHP A;  4G3O A;  2JY8 A;  1G41 A;  3E46 A;  2DKL A;  2DZL A;  1HJP A;  1TR8 A;  1OKS A;  3F92 A;  3K9P A;  1C7Y A;  2JY7 A;  1WGL A;  2H5X A;  2ZTD A;  1F4I A;  2JP7 A;  1MN3 A;  2JUJ A;  4F2L A;  1YLA A;  2HWJ A;  3T6P A;  1E94 E;  2LVN C;  1HQY E;  2BWE A;  2JNH A;  4GEW A;  4WP2 A;  2MGW A;  2DAG A;  1VQ1 A;  1HT2 E;  1AIP C;  3IEC A;  2KNZ A;  1IM2 A;  2DAE A;  1JR3 E;  1Q02 A;  1WJ7 A;  2DAK A;  1WGN A;  1VEK A;  2LVA A;  1XB2 B;  3LCV B;  2LVO C;  2DI0 A;  2KHH A;  1BVS A;  2L2D A;  2K0B X;  1HT1 E;  2R0I A;  2WZJ A;  2EKK A;  2ZTC A;  3GLF E;  1DO2 A;  2OOB A;  1V92 A;  1VDL A;  1ZMV A;  1IXS A;  2CP8 A;  5JI2 E;  1OAI A;  1CUK A;  2KNA A;  2O25 A;  2CWB A;  4HEO A;  1NV8 A;  1DV0 A;  1SG9 A;  3H4J A;  1WHC A;  2QSF X;  1WIV A;  1Y8G A;  1VEJ A;  1T6O A;  2EKF A;  1OQY A;  1DO0 A;  4UN2 B;  4Q7J A;  1G4A E;  2QNJ A;  3K9O A;  2LVQ D;  2MRO B;  1IFY A;  2BWB A;  2G3Q A;  3FRI A;  3FRH A;  1VEG A;  3FE3 A;  1ZMW A;  4F1I A;  2JZ1 A;  1T43 A;  2DEN A;  2B3T A;  2OO9 A;  3B89 A;  2DAI A;  3GLH E;  1KYI A;  2DAM A;  3GLI E;  1R4G A;  1A5T A;  1EFU B;  2L4F A;  2MR9 A;  2QHO B;  2DNA A;  1QZE A;  3GLG E;  2KNV A;  2JY6 B;  1XXH E;  1NV9 A;  1PGY A;  1ZV1 A;  2HAK A;  1GO5 A;  4DBG B;  3BBZ A;  5DFL A;  3MMP A;  2MJ5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...