2EKKA

Solution structure of ruh-074, a human uba domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
47
structure length
47
Chain Sequence
GSSGSSGVNQQQLQQLMDMGFTREHAMEALLNTSTMEQATEYLLTHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RUH-074, a human UBA domain
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords UBA domain from E3 ubiquitin-protein ligase HUWE1
total genus 13
structure length 47
sequence length 47
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2ekkA00
1CUKA 1Q02A 1XB2B 1G41A 3GLGE 2DZLA 2L4FA 5JI2E 3FRHA 1DO0A 4F1IA 2MJ5B 1AIPC 3F92A 4F2LA 2LTUA 2LVNC 2JY8A 1IXSA 1HQYE 2JZ0A 4GEWA 5DFLA 3GLFE 3E21A 2OOAA 1F4IA 2JP7A 1WGLA 1P3QQ 4G3OA 1VQ1A 1VEGA 1VEKA 2EKKA 2G3QA 2O25A 1KYIA 2K9DA 1XXHE 1G3IA 2DNAA 2B3TA 1T6OA 1ZMUA 1JR3E 1PGYA 2QHOB 1WHCA 4R71A 1IM2A 2L4EA 3K9OA 3FRIA 1OTRA 3GLIE 1UFZA 1Y8GA 1WJ7A 1QZEA 2JUJA 2BWBA 1R4GA 2L2DA 1VEJA 1ZMVA 2KNAA 1WR1B 1T43A 1TR8A 1VDLA 2LVPC 2DAKA 3H4JA 1HJPA 1A5TA 1NV8A 3MMPA 2BWEA 2EKFA 3LCUA 1OAIA 1VG5A 2JY7A 2KNVA 3LCVB 2DKLA 2LVOC 3FE3A 3E46A 3IHPA 2ZTDA 3GLHE 3T6PA 2EJSA 1SG9A 4WP2A 2JZ1A 2DAGA 2OOBA 1V92A 4DBGB 3K9PA 2LVAA 2DI0A 4UN2B 1E94E 2HAKA 1ZMWA 2MROB 1C7YA 3IECA 1DV0A 1WIVA 2JNHA 1WGNA 2MGWA 1HT1E 2CP8A 1OQYA 2KNZA 2DHYA 2JY6B 1EFUB 1TTEA 2RRUA 4Q7JA 2LBCA 2K0BX 2LVQD 2ZTCA 1IFYA 2QNJA 2QSFX 3B89A 3BBZA 2DENA 2H5XA 2MR9A 1GO5A 2OO9A 1DO2A 1MN3A 1NV9A 1G4AE 2DAMA 1YLAA 2DAEA 1ZV1A 2DAIA 1OKSA 1BVSA 2WZJA 2CWBA 2KHHA 1HT2E 2HWJA 4HEOA 2JY5A 2R0IA
chains in the Genus database with same CATH superfamily
4IBIA 1Q02A 3AV0A 3DFZA 1G41A 2XLJA 1IN5A 2K47A 2DZLA 3SHFA 4LFBM 2Z7JA 5JI2E 3HHXA 3TWMA 1QVRA 1WXQA 3Q8GA 1N77A 1MX0A 4L15A 3FUTA 4GITA 2LTUA 3NBXX 2RKOA 5C1BA 1HQYE 2G8LA 4MGKE 1IBMM 3VKHA 2YR0A 4NSRA 3HJQA 5EXPA 3UK6A 5BR8M 5DFLA 3U5ZA 3E21A 1HQCA 1HNZM 2XFTA 1J09A 5EJCA 7CATA 1HNXM 1L2DA 2F4VM 1JR3D 2NQ8C 4AW4A 3HZJA 1NY5A 4RKUF 2H1RA 1P3QQ 4BLCA 4LCBA 1YE9A 2DWZB 1VEKA 4JN6A 2DWNA 1W5SA 1KYIA 2K9DA 3AOGA 2B3TA 2JWSA 4NL4H 5A2QS 2OQ4A 3FTEA 3KVWA 2RGHA 2QHOB 4I4LA 1IN4A 1SXJA 3CF6E 3JAMS 1IM2A 3TWLA 2M5ZA 4DUYM 3U6DA 3MK6A 4Z6YA 4AG5A 3C58A 1Y8GA 3GLFB 4CISA 3AFHA 4L6V6 1WJ7A 3UGJA 3GLHB 1IBKM 2F5QA 3CGWA 2DZNB 1N75A 4MGZE 2LH0A 1OFHA 1IN8A 2L2DA 1R4GA 4PT5A 1VEJA 2G5GX 3OTOM 5ITUA 1K3XA 2KEBA 1WR1B 3DA1A 3FTDA 3FTCA 1PM5A 4IJFA 1DGGA 1TH4A 2XH9A 2LVPC 4MGYE 2DAKA 4M0DA 2QZ4A 4NRWA 5LMUM 4AZFA 3FUUA 1QUSA 1GL6A 3VLFB 3U6CA 1OAIA 2KDLA 1OJLA 3FUXA 2RGOA 2HCBA 4FCTA 4QNMA 3K1JA 1JQJC 3AKZA 2KNVA 1E32A 3VFDA 5IT9S 3KP1E 3KSJA 3DOAA 3E46A 3HU3A 2X49A 3T6PA 4LY6A 4PDIA 2XF3A 3KOYE 4DV2M 1SXJE 2K6BA 3VDPA 4A3VB 4G4QA 2JZ1A 5EP1A 3J7AS 3HJSA 1R2ZA 4XK8F 2FFJA 5H37D 4TUWA 5EP3A 5FSWA 3QAUA 3D8BA 3T38A 2Q2EB 3TWKA 1IXZA 3IECA 4MB7A 1DV0A 1WIVA 1GABA 5C18A 1DGBA 1HT1E 2O01F 2VF8A 3C3EA 4GHLA 2R62A 3GP1A 2CEAA 4PDGA 4LF5M 2JY6B 4M0WA 2C99A 3LQRA 5DNYA 1TTEA 5FLXS 2DWMA 1R6BX 3PNVA 3KOWE 3KP0E 1DGHA 1EE8A 3L26A 1IN6A 1SXJB 3BBZA 1D0MA 1AUAA 4PD2A 3LVWA 2V1UA 1N78A 3RGPA 3U6MA 2DVWB 5LMNM 4JI4M 4X66M 1MN3A 4HLQA 2Z8YM 4AG6A 1NV9A 2JA2A 4KODA 1XMQM 2CV2A 1GJTA 3I51A 5E26A 4FW9A 2EA0A 4KHPM 1BVSA 5IZ7D 3W0LB 2QCUA 5KPRA 1K82A 2KHHA 4DR1M 1D2NA 1NY6A 2HWJA 2XFSA 5KQ8A 4GRIA 3GLGE 3BXWA 4NRVA 3GLGA 2CHGA 4KO8A 2VQEM 3U6LA 4FWGA 3AOEC 5ITRA 2ZAOA 4DV3M 2MJ5B 3HKPA 4I81A 3K2LA 4F2LA 4OVZB 2C96A 4NC6A 3JR4A 2JY8A 2HL7A 1IN7A 2KZUA 3GO8A 1W5TA 5JI3E 2M60A 3TE6A 1Q3BA 3PFIA 3ZH9B 3K8ZA 4GH9A 4K0KM 4DV7M 3GLFE 1FNNA 4DR6M 1JR3A 4JV5M 2JXNA 1PJIA 1G71A 1PRBA 2KZSA 3SYKA 4LFCM 1VDDA 1ZAEA 1YUBA 2BJWA 1HNWM 5GKNA 1IXRC 1VEGA 1N34M 1TH3A 5ITTA 1KFVA 4YHHM 4IIWA 1G3IA 3PXGA 1XWIA 2CFOA 1T6OA 1TGUA 2FS1A 3KS8A 1ZMUA 1ORYB 1JR3E 1PGYA 4QOZC 2YQZA 2X4AA 4LGYA 3C9PA 2D7GA 4IBFA 3B7QA 4NSOB 5FTLA 2XZFA 4IBJA 3W68A 1YSYA 1L8QA 5EQTA 3J7BA 3VK8A 4X64M 2APLA 3EIHA 1NSFA 4LZJA 3HHYA 1PJTA 2JUJA 4LJ5A 2UUCM 1ZMVA 1X37A 2Y0TA 3HHWA 2KNAA 3KS4A 1HR0M 3SC3A 4CIZA 2CV0A 4G4RA 4DV5M 1OAOC 1TR8A 3RE8A 5KQDA 3R8FA 4B08A 2VDBB 4LJ6A 3H4JA 2Z4SA 3NBIA 4S12A 1TDHA 5ITYA 2YFQA 3A46A 3L27A 1GVNA 3LCUA 4MH0E 3A45A 1V34A 2YNMD 1KSFX 1XHBA 2F5PA 1N33M 2L7HA 3T1YM 2FH0A 3HWSA 4OW0A 3T1HM 3KOXE 4D80A 3SHGB 2OPFA 3B7ZA 2XEPA 2ZTDA 3I4YA 3HU1A 2EJSA 3BOSA 1XC8A 4OVZA 4WP2A 4IBBA 2V1CA 1LTMA 3I4VA 2Y20A 4W5WA 1NNJA 4GKJM 2OOBA 1H6UA 3E4RA 3SYLA 3K9PA 3M7GA 4AKHA 1E94E 2HAKA 5ITXA 2MROB 1NJFA 2ZBKB 3CTWB 4FCWA 2WSCF 4GC5A 3U61A 1I94M 2JNHA 4DV0M 1WGNA 2MGWA 3ZC7B 4FVMA 3U61B 2N35A 1Z5CA 2KNZA 3LQQA 1OFIA 3GQ3A 5EXSA 3AJIB 4OX9M 2WSFF 4AI6A 3THGA 2UXBM 3GRUA 4M9SA 3FUWA 3U6EA 4B7FA 4DV6M 2K0BX 3GLHA 3HU2A 3FD9A 2XGNA 3HJ8A 2DENA 4NXMM 1GO5A 2OO9A 1DO2A 4RF1A 5FTJA 4FD2A 3SATA 1G4AE 4X65M 3WHLA 4ANRA 1YLAA 3U6PA 3UJNA 4LJ7A 4DV1M 4KT0F 2I7PA 1XNQM 4I5SA 1OIPA 2J7OA 4AQYM 1IBLM 1OIZA 2C9OA 3H4MA 4DR3M 5IWAM 1N36M 1DO0A 4LFAM 2BNKA 1AIPC 3F92A 3L28A 2DZOB 2GQFA 1IXSA 4XGIA 2LHCA 4LRTA 3ZQJA 3SARA 4KLNA 4GEWA 1IXSB 3UMMA 4Z8XA 4B7GA 3SFZA 4G4NA 4B3TM 3LVVA 4JI0M 1XXHA 1IY2A 3AOEA 1Q39A 1IQPA 1SXJC 3U6QA 3CF0A 3U6OA 2XSZD 3FYCA 4LRSA 4BB9A 4B3SM 4LJAA 3RFWA 3JR5A 2DNAA 1NVMA 2HKJA 1NHGC 2VIIA 1G59A 2J7NA 3D8LA 4R71A 3QYEA 4GKKM 4QNRA 3U60B 1UM8A 3IG8A 3K9OA 4GIPA 3PVSA 1Q3CA 2DHRA 2QQ8A 1QZMA 3FRIA 4HL4A 1UFZA 3J80S 2AHMA 3TL4X 2ERCA 3GLIE 1IY1A 2EO2A 1Z5BA 4AKGA 1QZEA 5FTNA 4RF0A 2HHHM 2I7NA 2KW0A 2MH8A 1QAOA 3K92A 5L8RF 2VF7A 3FUVA 1K3WA 4IBGA 4QHSA 4DV4M 4LJ9A 3IG5A 4M9ZA 4WURA 1VDLA 1QANA 2XSZA 3B7NA 4WW0A 2A5YB 1HJPA 4IBKA 4L78A 1A5TA 1NV8A 4ITQA 2BWEA 2V6ZM 4P17A 2EKFA 5KO3A 1G8PA 2P5TA 1QAMA 4GC9A 4NXNM 1GLNA 1VG5A 4L16A 3TQSA 1QAQA 2BJVA 2UUAM 4II7A 2QBYB 3GRYA 3LCVB 1PJJA 2DKLA 3U5ZB 4P16A 2QBYA 4JYAM 2J5YA 4XBOA 3PNYA 2E5LM 3GLHE 2LXEA 1QDTA 4L4UA 2CUZA 4LJ4A 4MGIE 1TH2A 1XMOM 4DR4M 2R46A 3AL0C 2CHQA 3J2PB 4UN2B 2DI0A 5E6JA 4DR7M 1TDZA 1ZMWA 3FYDA 4IJEA 1RU3A 4G4OA 1EIJA 2Y0QA 2R4EA 4LG2A 3VK7A 1FJGM 3UZUA 2CP8A 2CRUA 3GRVA 1L2CA 2X8AA 2R6FA 4AKIA 1EFUB 3SMSA 1T3TA 4LF4M 4D81A 3GLFA 2LBCA 2ZANA 4CHTB 3KFUG 1QYRA 5KPZA 1MU5A 5EXXA 4LF8M 2QENA 2KRKA 3GLGB 4GMQA 1JB0F 4B3RM 2W82A 3HGIA 3W67A 2DXIA 1NHWC 4LF6M 2DAMA 3KOZE 3FTFA 2L7IA 2DAIA 1OKSA 2C9CA 2ZAMA 3SASA 1L2BA 2WZJA 3HHZA 1J7KA 4PCZA 2JY5A 3I01M 2R0IA 5DYGA 4JI1M 4JI2M 1CUKA 1Z59A 5KPTA 1XB2B 2LNHC 2QP9X 3KW6A 3MHVC 4LF9M 5ITQA 1GJSA 2L4FA 4G6ZA 2FNAA 3QWLA 2VQFM 3B74A 1MJGM 3FRHA 4F1IA 2KA6B 3WHKA 2LVNC 5FTKA 4YY3M 3SBJA 2LWXA 1L1ZA 1N32M 2JZ0A 3LW5F 3GPXA 4ZPXA 5ITXE 2XZUA 3E9SA 4IBDA 2OOAA 3GQ4A 4BBAA 2Z4RA 1F4IA 2JP7A 3SAVA 1WGLA 3M0EA 1PJQA 2DWLA 4JI8M 4L8RC 2KRUA 1VQ1A 1E9SA 1QDRA 1ZQ9A 3HX3A 4G3OA 4B7HA 2EKKA 2FE8A 2G3QA 2O25A 3B9PA 4OU7A 1XXHE 1E9RA 4LGMA 5BPVA 2C5RA 3R9XB 2EUCA 2LHGA 3NWLA 2L6OA 3VKGA 1GKIA 1TF0B 1LV7A 1WHCA 4JXJA 2L4EA 4JI3M 4DUZM 3J27B 4JI5M 1SXJD 4FCVA 1OTRA 2UXCM 3A98B 3SAWA 1J5EM 3QYBA 3A42A 3Q8XA 1DGHB 3SAUA 5FTMA 2CE7A 3L2AA 4MGHA 3FKEA 1D0LA 2Z3XA 2CV1A 4B3MM 1PJSA 1D0KA 3V76A 2BWBA 2L09A 1Z5AA 3GPYA 2F5SA 4JI6M 2UU9M 3SMPA 2KXEA 1R5LA 1T43A 5DYIA 2UXDM 3RGSA 2ZM6M 3W0FA 4D82A 3MMPA 4NOOB 3GPPA 4IBCA 3MJ5A 3L29A 2O5RA 3VDUA 4RNAA 4M9XA 5EP4A 3U60A 1GL7A 2JY7A 4DR2M 2LVOC 2FOIC 4CJ6A 8CATA 3FE3A 1XNRM 1DGFA 3IHPA 3U6SA 3ZCBB 4X62M 1SG9A 5F3WA 2D7HA 4FWDA 1R7RA 2DAGA 1V92A 3M6AA 4LZZA 4DBGB 3GPUA 1NO1A 2F5OA 1IY0A 2LVAA 4REZA 3GRRA 1C7YA 4IBEA 1L1TA 3KDSE 3GLIA 2F5NA 3C3DA 1NNUC 1XXHB 2R44A 4CGYB 3ILKA 3DZDA 3GLIB 3L25A 3EIEA 4LJ8A 3KXEC 1OQYA 2DHYA 2R4JA 4DR5M 3T15A 4MM3B 2WSEF 2QPAA 2RRUA 4I8OA 4Q7JA 2R45A 4FWHA 4LF7M 3GQ5A 2GNOA 2LVQD 2C98A 2ZTCA 5EXTA 1IFYA 2QNJA 1S3SA 2UUBM 2QSFX 3B89A 5EP2A 3KSXA 3I04M 1NJGA 2H5XA 1V33A 4Y28F 4R7GA 2MR9A 1QUTA 4R3DA 2Y21A 3LMMA 3CF2A 1QQWA 4QHTA 2DAEA 2R18A 4EIWA 1ZV1A 5IREB 1Z6TA 3TPZA 2R65A 2CHVA 4JI7M 2CWBA 2D7EA 1R2YA 4GHAA 3HY5A 1HT2E 3J81S 4HEOA 1I4WA 4QOSA 1C1KA
chains in the Genus database with same CATH topology
1CUKA 1Q02A 1XB2B 1G41A 3GLGE 2DZLA 2L4FA 5JI2E 3FRHA 1DO0A 4F1IA 2MJ5B 1AIPC 3F92A 4F2LA 2LTUA 2LVNC 2JY8A 1IXSA 1HQYE 2JZ0A 4GEWA 5DFLA 3GLFE 3E21A 2OOAA 1F4IA 2JP7A 1WGLA 1P3QQ 4G3OA 1VQ1A 1VEGA 1VEKA 2EKKA 2G3QA 2O25A 1KYIA 2K9DA 1XXHE 1G3IA 2DNAA 2B3TA 1T6OA 1ZMUA 1JR3E 1PGYA 2QHOB 1WHCA 4R71A 1IM2A 2L4EA 3K9OA 3FRIA 1OTRA 3GLIE 1UFZA 1Y8GA 1WJ7A 1QZEA 2JUJA 2BWBA 1R4GA 2L2DA 1VEJA 1ZMVA 2KNAA 1WR1B 1T43A 1TR8A 1VDLA 2LVPC 2DAKA 3H4JA 1HJPA 1A5TA 1NV8A 3MMPA 2BWEA 2EKFA 3LCUA 1OAIA 1VG5A 2JY7A 2KNVA 3LCVB 2DKLA 2LVOC 3FE3A 3E46A 3IHPA 2ZTDA 3GLHE 3T6PA 2EJSA 1SG9A 4WP2A 2JZ1A 2DAGA 2OOBA 1V92A 4DBGB 3K9PA 2LVAA 2DI0A 4UN2B 1E94E 2HAKA 1ZMWA 2MROB 1C7YA 3IECA 1DV0A 1WIVA 2JNHA 1WGNA 2MGWA 1HT1E 2CP8A 1OQYA 2KNZA 2DHYA 2JY6B 1EFUB 1TTEA 2RRUA 4Q7JA 2LBCA 2K0BX 2LVQD 2ZTCA 1IFYA 2QNJA 2QSFX 3B89A 3BBZA 2DENA 2H5XA 2MR9A 1GO5A 2OO9A 1DO2A 1MN3A 1NV9A 1G4AE 2DAMA 1YLAA 2DAEA 1ZV1A 2DAIA 1OKSA 1BVSA 2WZJA 2CWBA 2KHHA 1HT2E 2HWJA 4HEOA 2JY5A 2R0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CUK A;  1Q02 A;  1XB2 B;  1G41 A;  3GLG E;  2DZL A;  2L4F A;  5JI2 E;  3FRH A;  1DO0 A;  4F1I A;  2MJ5 B;  1AIP C;  3F92 A;  4F2L A;  2LTU A;  2LVN C;  2JY8 A;  1IXS A;  1HQY E;  2JZ0 A;  4GEW A;  5DFL A;  3GLF E;  3E21 A;  2OOA A;  1F4I A;  2JP7 A;  1WGL A;  1P3Q Q;  4G3O A;  1VQ1 A;  1VEG A;  1VEK A;  2EKK A;  2G3Q A;  2O25 A;  1KYI A;  2K9D A;  1XXH E;  1G3I A;  2DNA A;  2B3T A;  1T6O A;  1ZMU A;  1JR3 E;  1PGY A;  2QHO B;  1WHC A;  4R71 A;  1IM2 A;  2L4E A;  3K9O A;  3FRI A;  1OTR A;  3GLI E;  1UFZ A;  1Y8G A;  1WJ7 A;  1QZE A;  2JUJ A;  2BWB A;  1R4G A;  2L2D A;  1VEJ A;  1ZMV A;  2KNA A;  1WR1 B;  1T43 A;  1TR8 A;  1VDL A;  2LVP C;  2DAK A;  3H4J A;  1HJP A;  1A5T A;  1NV8 A;  3MMP A;  2BWE A;  2EKF A;  3LCU A;  1OAI A;  1VG5 A;  2JY7 A;  2KNV A;  3LCV B;  2DKL A;  2LVO C;  3FE3 A;  3E46 A;  3IHP A;  2ZTD A;  3GLH E;  3T6P A;  2EJS A;  1SG9 A;  4WP2 A;  2JZ1 A;  2DAG A;  2OOB A;  1V92 A;  4DBG B;  3K9P A;  2LVA A;  2DI0 A;  4UN2 B;  1E94 E;  2HAK A;  1ZMW A;  2MRO B;  1C7Y A;  3IEC A;  1DV0 A;  1WIV A;  2JNH A;  1WGN A;  2MGW A;  1HT1 E;  2CP8 A;  1OQY A;  2KNZ A;  2DHY A;  2JY6 B;  1EFU B;  1TTE A;  2RRU A;  4Q7J A;  2LBC A;  2K0B X;  2LVQ D;  2ZTC A;  1IFY A;  2QNJ A;  2QSF X;  3B89 A;  3BBZ A;  2DEN A;  2H5X A;  2MR9 A;  1GO5 A;  2OO9 A;  1DO2 A;  1MN3 A;  1NV9 A;  1G4A E;  2DAM A;  1YLA A;  2DAE A;  1ZV1 A;  2DAI A;  1OKS A;  1BVS A;  2WZJ A;  2CWB A;  2KHH A;  1HT2 E;  2HWJ A;  4HEO A;  2JY5 A;  2R0I A; 
#chains in the Genus database with same CATH topology
 4IBI A;  1Q02 A;  3AV0 A;  3DFZ A;  1G41 A;  2XLJ A;  1IN5 A;  2K47 A;  2DZL A;  3SHF A;  4LFB M;  2Z7J A;  5JI2 E;  3HHX A;  3TWM A;  1QVR A;  1WXQ A;  3Q8G A;  1N77 A;  1MX0 A;  4L15 A;  3FUT A;  4GIT A;  2LTU A;  3NBX X;  2RKO A;  5C1B A;  1HQY E;  2G8L A;  4MGK E;  1IBM M;  3VKH A;  2YR0 A;  4NSR A;  3HJQ A;  5EXP A;  3UK6 A;  5BR8 M;  5DFL A;  3U5Z A;  3E21 A;  1HQC A;  1HNZ M;  2XFT A;  1J09 A;  5EJC A;  7CAT A;  1HNX M;  1L2D A;  2F4V M;  1JR3 D;  2NQ8 C;  4AW4 A;  3HZJ A;  1NY5 A;  4RKU F;  2H1R A;  1P3Q Q;  4BLC A;  4LCB A;  1YE9 A;  2DWZ B;  1VEK A;  4JN6 A;  2DWN A;  1W5S A;  1KYI A;  2K9D A;  3AOG A;  2B3T A;  2JWS A;  4NL4 H;  5A2Q S;  2OQ4 A;  3FTE A;  3KVW A;  2RGH A;  2QHO B;  4I4L A;  1IN4 A;  1SXJ A;  3CF6 E;  3JAM S;  1IM2 A;  3TWL A;  2M5Z A;  4DUY M;  3U6D A;  3MK6 A;  4Z6Y A;  4AG5 A;  3C58 A;  1Y8G A;  3GLF B;  4CIS A;  3AFH A;  4L6V 6;  1WJ7 A;  3UGJ A;  3GLH B;  1IBK M;  2F5Q A;  3CGW A;  2DZN B;  1N75 A;  4MGZ E;  2LH0 A;  1OFH A;  1IN8 A;  2L2D A;  1R4G A;  4PT5 A;  1VEJ A;  2G5G X;  3OTO M;  5ITU A;  1K3X A;  2KEB A;  1WR1 B;  3DA1 A;  3FTD A;  3FTC A;  1PM5 A;  4IJF A;  1DGG A;  1TH4 A;  2XH9 A;  2LVP C;  4MGY E;  2DAK A;  4M0D A;  2QZ4 A;  4NRW A;  5LMU M;  4AZF A;  3FUU A;  1QUS A;  1GL6 A;  3VLF B;  3U6C A;  1OAI A;  2KDL A;  1OJL A;  3FUX A;  2RGO A;  2HCB A;  4FCT A;  4QNM A;  3K1J A;  1JQJ C;  3AKZ A;  2KNV A;  1E32 A;  3VFD A;  5IT9 S;  3KP1 E;  3KSJ A;  3DOA A;  3E46 A;  3HU3 A;  2X49 A;  3T6P A;  4LY6 A;  4PDI A;  2XF3 A;  3KOY E;  4DV2 M;  1SXJ E;  2K6B A;  3VDP A;  4A3V B;  4G4Q A;  2JZ1 A;  5EP1 A;  3J7A S;  3HJS A;  1R2Z A;  4XK8 F;  2FFJ A;  5H37 D;  4TUW A;  5EP3 A;  5FSW A;  3QAU A;  3D8B A;  3T38 A;  2Q2E B;  3TWK A;  1IXZ A;  3IEC A;  4MB7 A;  1DV0 A;  1WIV A;  1GAB A;  5C18 A;  1DGB A;  1HT1 E;  2O01 F;  2VF8 A;  3C3E A;  4GHL A;  2R62 A;  3GP1 A;  2CEA A;  4PDG A;  4LF5 M;  2JY6 B;  4M0W A;  2C99 A;  3LQR A;  5DNY A;  1TTE A;  5FLX S;  2DWM A;  1R6B X;  3PNV A;  3KOW E;  3KP0 E;  1DGH A;  1EE8 A;  3L26 A;  1IN6 A;  1SXJ B;  3BBZ A;  1D0M A;  1AUA A;  4PD2 A;  3LVW A;  2V1U A;  1N78 A;  3RGP A;  3U6M A;  2DVW B;  5LMN M;  4JI4 M;  4X66 M;  1MN3 A;  4HLQ A;  2Z8Y M;  4AG6 A;  1NV9 A;  2JA2 A;  4KOD A;  1XMQ M;  2CV2 A;  1GJT A;  3I51 A;  5E26 A;  4FW9 A;  2EA0 A;  4KHP M;  1BVS A;  5IZ7 D;  3W0L B;  2QCU A;  5KPR A;  1K82 A;  2KHH A;  4DR1 M;  1D2N A;  1NY6 A;  2HWJ A;  2XFS A;  5KQ8 A;  4GRI A;  3GLG E;  3BXW A;  4NRV A;  3GLG A;  2CHG A;  4KO8 A;  2VQE M;  3U6L A;  4FWG A;  3AOE C;  5ITR A;  2ZAO A;  4DV3 M;  2MJ5 B;  3HKP A;  4I81 A;  3K2L A;  4F2L A;  4OVZ B;  2C96 A;  4NC6 A;  3JR4 A;  2JY8 A;  2HL7 A;  1IN7 A;  2KZU A;  3GO8 A;  1W5T A;  5JI3 E;  2M60 A;  3TE6 A;  1Q3B A;  3PFI A;  3ZH9 B;  3K8Z A;  4GH9 A;  4K0K M;  4DV7 M;  3GLF E;  1FNN A;  4DR6 M;  1JR3 A;  4JV5 M;  2JXN A;  1PJI A;  1G71 A;  1PRB A;  2KZS A;  3SYK A;  4LFC M;  1VDD A;  1ZAE A;  1YUB A;  2BJW A;  1HNW M;  5GKN A;  1IXR C;  1VEG A;  1N34 M;  1TH3 A;  5ITT A;  1KFV A;  4YHH M;  4IIW A;  1G3I A;  3PXG A;  1XWI A;  2CFO A;  1T6O A;  1TGU A;  2FS1 A;  3KS8 A;  1ZMU A;  1ORY B;  1JR3 E;  1PGY A;  4QOZ C;  2YQZ A;  2X4A A;  4LGY A;  3C9P A;  2D7G A;  4IBF A;  3B7Q A;  4NSO B;  5FTL A;  2XZF A;  4IBJ A;  3W68 A;  1YSY A;  1L8Q A;  5EQT A;  3J7B A;  3VK8 A;  4X64 M;  2APL A;  3EIH A;  1NSF A;  4LZJ A;  3HHY A;  1PJT A;  2JUJ A;  4LJ5 A;  2UUC M;  1ZMV A;  1X37 A;  2Y0T A;  3HHW A;  2KNA A;  3KS4 A;  1HR0 M;  3SC3 A;  4CIZ A;  2CV0 A;  4G4R A;  4DV5 M;  1OAO C;  1TR8 A;  3RE8 A;  5KQD A;  3R8F A;  4B08 A;  2VDB B;  4LJ6 A;  3H4J A;  2Z4S A;  3NBI A;  4S12 A;  1TDH A;  5ITY A;  2YFQ A;  3A46 A;  3L27 A;  1GVN A;  3LCU A;  4MH0 E;  3A45 A;  1V34 A;  2YNM D;  1KSF X;  1XHB A;  2F5P A;  1N33 M;  2L7H A;  3T1Y M;  2FH0 A;  3HWS A;  4OW0 A;  3T1H M;  3KOX E;  4D80 A;  3SHG B;  2OPF A;  3B7Z A;  2XEP A;  2ZTD A;  3I4Y A;  3HU1 A;  2EJS A;  3BOS A;  1XC8 A;  4OVZ A;  4WP2 A;  4IBB A;  2V1C A;  1LTM A;  3I4V A;  2Y20 A;  4W5W A;  1NNJ A;  4GKJ M;  2OOB A;  1H6U A;  3E4R A;  3SYL A;  3K9P A;  3M7G A;  4AKH A;  1E94 E;  2HAK A;  5ITX A;  2MRO B;  1NJF A;  2ZBK B;  3CTW B;  4FCW A;  2WSC F;  4GC5 A;  3U61 A;  1I94 M;  2JNH A;  4DV0 M;  1WGN A;  2MGW A;  3ZC7 B;  4FVM A;  3U61 B;  2N35 A;  1Z5C A;  2KNZ A;  3LQQ A;  1OFI A;  3GQ3 A;  5EXS A;  3AJI B;  4OX9 M;  2WSF F;  4AI6 A;  3THG A;  2UXB M;  3GRU A;  4M9S A;  3FUW A;  3U6E A;  4B7F A;  4DV6 M;  2K0B X;  3GLH A;  3HU2 A;  3FD9 A;  2XGN A;  3HJ8 A;  2DEN A;  4NXM M;  1GO5 A;  2OO9 A;  1DO2 A;  4RF1 A;  5FTJ A;  4FD2 A;  3SAT A;  1G4A E;  4X65 M;  3WHL A;  4ANR A;  1YLA A;  3U6P A;  3UJN A;  4LJ7 A;  4DV1 M;  4KT0 F;  2I7P A;  1XNQ M;  4I5S A;  1OIP A;  2J7O A;  4AQY M;  1IBL M;  1OIZ A;  2C9O A;  3H4M A;  4DR3 M;  5IWA M;  1N36 M;  1DO0 A;  4LFA M;  2BNK A;  1AIP C;  3F92 A;  3L28 A;  2DZO B;  2GQF A;  1IXS A;  4XGI A;  2LHC A;  4LRT A;  3ZQJ A;  3SAR A;  4KLN A;  4GEW A;  1IXS B;  3UMM A;  4Z8X A;  4B7G A;  3SFZ A;  4G4N A;  4B3T M;  3LVV A;  4JI0 M;  1XXH A;  1IY2 A;  3AOE A;  1Q39 A;  1IQP A;  1SXJ C;  3U6Q A;  3CF0 A;  3U6O A;  2XSZ D;  3FYC A;  4LRS A;  4BB9 A;  4B3S M;  4LJA A;  3RFW A;  3JR5 A;  2DNA A;  1NVM A;  2HKJ A;  1NHG C;  2VII A;  1G59 A;  2J7N A;  3D8L A;  4R71 A;  3QYE A;  4GKK M;  4QNR A;  3U60 B;  1UM8 A;  3IG8 A;  3K9O A;  4GIP A;  3PVS A;  1Q3C A;  2DHR A;  2QQ8 A;  1QZM A;  3FRI A;  4HL4 A;  1UFZ A;  3J80 S;  2AHM A;  3TL4 X;  2ERC A;  3GLI E;  1IY1 A;  2EO2 A;  1Z5B A;  4AKG A;  1QZE A;  5FTN A;  4RF0 A;  2HHH M;  2I7N A;  2KW0 A;  2MH8 A;  1QAO A;  3K92 A;  5L8R F;  2VF7 A;  3FUV A;  1K3W A;  4IBG A;  4QHS A;  4DV4 M;  4LJ9 A;  3IG5 A;  4M9Z A;  4WUR A;  1VDL A;  1QAN A;  2XSZ A;  3B7N A;  4WW0 A;  2A5Y B;  1HJP A;  4IBK A;  4L78 A;  1A5T A;  1NV8 A;  4ITQ A;  2BWE A;  2V6Z M;  4P17 A;  2EKF A;  5KO3 A;  1G8P A;  2P5T A;  1QAM A;  4GC9 A;  4NXN M;  1GLN A;  1VG5 A;  4L16 A;  3TQS A;  1QAQ A;  2BJV A;  2UUA M;  4II7 A;  2QBY B;  3GRY A;  3LCV B;  1PJJ A;  2DKL A;  3U5Z B;  4P16 A;  2QBY A;  4JYA M;  2J5Y A;  4XBO A;  3PNY A;  2E5L M;  3GLH E;  2LXE A;  1QDT A;  4L4U A;  2CUZ A;  4LJ4 A;  4MGI E;  1TH2 A;  1XMO M;  4DR4 M;  2R46 A;  3AL0 C;  2CHQ A;  3J2P B;  4UN2 B;  2DI0 A;  5E6J A;  4DR7 M;  1TDZ A;  1ZMW A;  3FYD A;  4IJE A;  1RU3 A;  4G4O A;  1EIJ A;  2Y0Q A;  2R4E A;  4LG2 A;  3VK7 A;  1FJG M;  3UZU A;  2CP8 A;  2CRU A;  3GRV A;  1L2C A;  2X8A A;  2R6F A;  4AKI A;  1EFU B;  3SMS A;  1T3T A;  4LF4 M;  4D81 A;  3GLF A;  2LBC A;  2ZAN A;  4CHT B;  3KFU G;  1QYR A;  5KPZ A;  1MU5 A;  5EXX A;  4LF8 M;  2QEN A;  2KRK A;  3GLG B;  4GMQ A;  1JB0 F;  4B3R M;  2W82 A;  3HGI A;  3W67 A;  2DXI A;  1NHW C;  4LF6 M;  2DAM A;  3KOZ E;  3FTF A;  2L7I A;  2DAI A;  1OKS A;  2C9C A;  2ZAM A;  3SAS A;  1L2B A;  2WZJ A;  3HHZ A;  1J7K A;  4PCZ A;  2JY5 A;  3I01 M;  2R0I A;  5DYG A;  4JI1 M;  4JI2 M;  1CUK A;  1Z59 A;  5KPT A;  1XB2 B;  2LNH C;  2QP9 X;  3KW6 A;  3MHV C;  4LF9 M;  5ITQ A;  1GJS A;  2L4F A;  4G6Z A;  2FNA A;  3QWL A;  2VQF M;  3B74 A;  1MJG M;  3FRH A;  4F1I A;  2KA6 B;  3WHK A;  2LVN C;  5FTK A;  4YY3 M;  3SBJ A;  2LWX A;  1L1Z A;  1N32 M;  2JZ0 A;  3LW5 F;  3GPX A;  4ZPX A;  5ITX E;  2XZU A;  3E9S A;  4IBD A;  2OOA A;  3GQ4 A;  4BBA A;  2Z4R A;  1F4I A;  2JP7 A;  3SAV A;  1WGL A;  3M0E A;  1PJQ A;  2DWL A;  4JI8 M;  4L8R C;  2KRU A;  1VQ1 A;  1E9S A;  1QDR A;  1ZQ9 A;  3HX3 A;  4G3O A;  4B7H A;  2EKK A;  2FE8 A;  2G3Q A;  2O25 A;  3B9P A;  4OU7 A;  1XXH E;  1E9R A;  4LGM A;  5BPV A;  2C5R A;  3R9X B;  2EUC A;  2LHG A;  3NWL A;  2L6O A;  3VKG A;  1GKI A;  1TF0 B;  1LV7 A;  1WHC A;  4JXJ A;  2L4E A;  4JI3 M;  4DUZ M;  3J27 B;  4JI5 M;  1SXJ D;  4FCV A;  1OTR A;  2UXC M;  3A98 B;  3SAW A;  1J5E M;  3QYB A;  3A42 A;  3Q8X A;  1DGH B;  3SAU A;  5FTM A;  2CE7 A;  3L2A A;  4MGH A;  3FKE A;  1D0L A;  2Z3X A;  2CV1 A;  4B3M M;  1PJS A;  1D0K A;  3V76 A;  2BWB A;  2L09 A;  1Z5A A;  3GPY A;  2F5S A;  4JI6 M;  2UU9 M;  3SMP A;  2KXE A;  1R5L A;  1T43 A;  5DYI A;  2UXD M;  3RGS A;  2ZM6 M;  3W0F A;  4D82 A;  3MMP A;  4NOO B;  3GPP A;  4IBC A;  3MJ5 A;  3L29 A;  2O5R A;  3VDU A;  4RNA A;  4M9X A;  5EP4 A;  3U60 A;  1GL7 A;  2JY7 A;  4DR2 M;  2LVO C;  2FOI C;  4CJ6 A;  8CAT A;  3FE3 A;  1XNR M;  1DGF A;  3IHP A;  3U6S A;  3ZCB B;  4X62 M;  1SG9 A;  5F3W A;  2D7H A;  4FWD A;  1R7R A;  2DAG A;  1V92 A;  3M6A A;  4LZZ A;  4DBG B;  3GPU A;  1NO1 A;  2F5O A;  1IY0 A;  2LVA A;  4REZ A;  3GRR A;  1C7Y A;  4IBE A;  1L1T A;  3KDS E;  3GLI A;  2F5N A;  3C3D A;  1NNU C;  1XXH B;  2R44 A;  4CGY B;  3ILK A;  3DZD A;  3GLI B;  3L25 A;  3EIE A;  4LJ8 A;  3KXE C;  1OQY A;  2DHY A;  2R4J A;  4DR5 M;  3T15 A;  4MM3 B;  2WSE F;  2QPA A;  2RRU A;  4I8O A;  4Q7J A;  2R45 A;  4FWH A;  4LF7 M;  3GQ5 A;  2GNO A;  2LVQ D;  2C98 A;  2ZTC A;  5EXT A;  1IFY A;  2QNJ A;  1S3S A;  2UUB M;  2QSF X;  3B89 A;  5EP2 A;  3KSX A;  3I04 M;  1NJG A;  2H5X A;  1V33 A;  4Y28 F;  4R7G A;  2MR9 A;  1QUT A;  4R3D A;  2Y21 A;  3LMM A;  3CF2 A;  1QQW A;  4QHT A;  2DAE A;  2R18 A;  4EIW A;  1ZV1 A;  5IRE B;  1Z6T A;  3TPZ A;  2R65 A;  2CHV A;  4JI7 M;  2CWB A;  2D7E A;  1R2Y A;  4GHA A;  3HY5 A;  1HT2 E;  3J81 S;  4HEO A;  1I4W A;  4QOS A;  1C1K A; 
#chains in the Genus database with same CATH homology
 1CUK A;  1Q02 A;  1XB2 B;  1G41 A;  3GLG E;  2DZL A;  2L4F A;  5JI2 E;  3FRH A;  1DO0 A;  4F1I A;  2MJ5 B;  1AIP C;  3F92 A;  4F2L A;  2LTU A;  2LVN C;  2JY8 A;  1IXS A;  1HQY E;  2JZ0 A;  4GEW A;  5DFL A;  3GLF E;  3E21 A;  2OOA A;  1F4I A;  2JP7 A;  1WGL A;  1P3Q Q;  4G3O A;  1VQ1 A;  1VEG A;  1VEK A;  2EKK A;  2G3Q A;  2O25 A;  1KYI A;  2K9D A;  1XXH E;  1G3I A;  2DNA A;  2B3T A;  1T6O A;  1ZMU A;  1JR3 E;  1PGY A;  2QHO B;  1WHC A;  4R71 A;  1IM2 A;  2L4E A;  3K9O A;  3FRI A;  1OTR A;  3GLI E;  1UFZ A;  1Y8G A;  1WJ7 A;  1QZE A;  2JUJ A;  2BWB A;  1R4G A;  2L2D A;  1VEJ A;  1ZMV A;  2KNA A;  1WR1 B;  1T43 A;  1TR8 A;  1VDL A;  2LVP C;  2DAK A;  3H4J A;  1HJP A;  1A5T A;  1NV8 A;  3MMP A;  2BWE A;  2EKF A;  3LCU A;  1OAI A;  1VG5 A;  2JY7 A;  2KNV A;  3LCV B;  2DKL A;  2LVO C;  3FE3 A;  3E46 A;  3IHP A;  2ZTD A;  3GLH E;  3T6P A;  2EJS A;  1SG9 A;  4WP2 A;  2JZ1 A;  2DAG A;  2OOB A;  1V92 A;  4DBG B;  3K9P A;  2LVA A;  2DI0 A;  4UN2 B;  1E94 E;  2HAK A;  1ZMW A;  2MRO B;  1C7Y A;  3IEC A;  1DV0 A;  1WIV A;  2JNH A;  1WGN A;  2MGW A;  1HT1 E;  2CP8 A;  1OQY A;  2KNZ A;  2DHY A;  2JY6 B;  1EFU B;  1TTE A;  2RRU A;  4Q7J A;  2LBC A;  2K0B X;  2LVQ D;  2ZTC A;  1IFY A;  2QNJ A;  2QSF X;  3B89 A;  3BBZ A;  2DEN A;  2H5X A;  2MR9 A;  1GO5 A;  2OO9 A;  1DO2 A;  1MN3 A;  1NV9 A;  1G4A E;  2DAM A;  1YLA A;  2DAE A;  1ZV1 A;  2DAI A;  1OKS A;  1BVS A;  2WZJ A;  2CWB A;  2KHH A;  1HT2 E;  2HWJ A;  4HEO A;  2JY5 A;  2R0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...