2EKNA

Structure of ph1811 protein from pyrococcus horikoshii
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
145
structure length
145
Chain Sequence
b'GVKMVEIGYKDVVFRKAVAKGRIKLKPETVKLIKEGKIEKGNVLATAQIAGILAVKRTPELIPLCHPIPITGVDITFDFGEDYIEVTCEVRAYYKTGVEMEALTGVTVALLAIWDMVKAVEKDEKGQYPYTRIENVHVVEKVKTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable molybdenum cofactor biosynthesis protein C
publication title Structure of PH1811 protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Biosynthetic protein
total genus 41
structure length 145
sequence length 145
chains with identical sequence B, C
ec nomenclature ec 4.6.1.17: Cyclic pyranopterin monophosphate synthase.
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 2eknA00
4PYAA 2EEYA 1EKRA 1EKSA 3JQKA 3JQJA 2IIHA 4PYDA 2EKNA 3JQMA 4FDFA 2IDEA 2OHDA
chains in the Genus database with same CATH superfamily
4FS1A 2AWZA 2CDRB 2WRMA 5C25A 1HFEL 4LF8J 3SV4A 4ZCLA 2HMIB 4M5KA 1PKUA 1WC6A 1XR5A 3JXOA 2YWKA 2VG5A 1U6FA 4RNMA 5J2QB 2RD5C 1YJVA 1U1QA 1F60B 4ER8A 1EARA 4FYYB 4YY3F 1YZ6A 1YQHA 4DHVA 2V8VA 1M1KT 2DGQA 4CLKA 3V81A 2NYIA 4JI4J 2D3ZA 2D3O1 3MEDB 5IV3A 3CB4A 2QL5B 4YB1P 3HVRA 4MK8A 2IM2A 3NAHA 1V3SA 3EVWA 2EPIA 3M7VA 2IJNA 2ROPA 1OIAA 1GEHA 2A2DA 1NO8A 4ZVFA 4RUAA 1SJ4P 3KLFA 2E5JA 2GW8A 4DXLA 3H2VE 1JXEA 1VQSA 5FIIA 1S57A 3EZOA 3CJ4A 1U1KA 1WTFA 1NRKA 1UWBA 2XLJA 4WWSA 1X4AA 4ID8A 1H2UX 4AQYF 1RT1B 1JLEA 2DXDA 1NSQA 2VKZG 3AH6A 1RQ0A 3MMBB 1GX6A 1TKDA 4TU7A 3H4BA 2FVRA 1LWCA 4XTTA 1UA1A 3E51A 3R3TA 1E6VB 2ZD1B 2W1BA 2RDJA 3MM7B 3OXGA 2NXCA 1AFJA 3AOAA 4RJVA 3DOMA 1T05A 3QGGA 5T14A 4A8YA 5IOLA 4NLGA 1RU2A 4JV5F 4CH7A 4A48A 2FVPA 1HPZA 2HVDA 2QTWA 3KK3B 3LPYA 5J2NB 4LBPA 1N88A 3BQ2A 4DV5F 2BKOA 2DPIA 4M5IA 1VQYA 4YQWA 2HHHF 5FDLA 3U1NA 5AT1B 4IUFA 4ETXA 1UTAA 3MMAB 4UQTA 1VK8A 5LXYA 4K4UA 3QSIA 4PXEA 5GAGI 3LP2A 2HSEB 2CQ1A 2K1RA 3O1LA 4KHPJ 4ANDA 5HVGA 3PJ9A 4DLEA 4WK3A 2HHSA 4CTAB 3MPYA 1BY9A 2UXDJ 2CPFA 1HARA 3MGJA 2UUWA 5KFWA 4J9VA 2LQ5A 3NBPA 5D3GA 4DFJA 4Y3CA 2HS3A 1U1PA 5KT4A 4Z2XA 4AYBD 2DY1A 1X60A 5IQQA 5KG7A 1RT2A 1JJ4A 5HQMA 4IO9Q 2YKMA 2RMLA 3LQVA 4KB7A 2HNZA 4OYZA 4DZ6A 4M5DB 1U26A 5L39A 4I0WA 4DX5A 4I6WA 2VB6A 1OWXA 2BJ8A 2JWNA 3OT9A 1OYDA 1N52B 1LQ9A 2N82B 3H5UA 1RAGB 2QN6B 4LRFA 4KO0A 5KFMA 1WELA 4PEOA 2XMVA 3HHDA 2KM8B 4Q2LA 3G71S 1RAEB 4J9UE 2VG6A 3ZZ0A 2Z2ZA 2GV1A 4FF2A 3OL6A 1IBMJ 4ZN3A 3KLGB 2MJNA 1UL3A 1XMOF 2DNQA 1WKLA 1WWHA 4R5PB 3NNAA 1JKHB 1U0HB 2DNRA 2CPYA 3V6DA 2FVSA 3J80U 1KQGB 5C5JA 5SZTA 3S8SA 4LMZA 2R7VA 4I67A 4WTYA 4XDDA 5DS7A 3TVYA 4DL5A 3CMES 3H7HB 2H51B 2OTLS 4LF4J 2OELA 2RDDA 3G6ES 1S9GB 3FEXB 3VWSA 4ZLPA 2W9BA 4D3HA 3OFFA 3ENWA 1EKSA 1UJ4A 3QT5A 2V67A 2NLWA 9ATCB 1HI1A 2LYVA 1YI2S 2YWEA 4QIWD 1ZETA 5HQ8A 4OHYA 1FDBA 2X1AA 2OTJS 2W2PP 3VCDA 1F1BB 4YP3A 2KYXA 1Y0HA 1RHKB 2PI4A 4YY3J 4CO5A 5CYQB 4O0NA 5I3UA 3A3PB 2DGSA 4TN2A 3EMTA 1FDDA 2XY5A 1QTNB 4A8FA 3MM8B 3ZFVA 2IA6A 4PG5A 1ACMB 2OPSA 2J0WA 4IYQA 3GFHA 2DNHA 3B4DA 2E1CA 4R8UB 1TL7A 5DO2A 1VJWA 2IBOA 1AA1B 2CZ4A 3LAKA 3HMJG 3SMZA 1XK8A 2CXEA 2V69A 5AE1A 1ICEB 1J5EF 1RWUA 4EBCA 4AQYJ 3CDUA 1F9HA 2V8HA 1N36F 4DV1F 2FC8A 2OEKA 3FFIB 2ROEA 2HFNA 1S99A 3VAGA 2XZTB 3G82B 2C2OB 3SCIE 1QM9A 2J0XA 2M70A 1UJ6A 1LWFB 4NPOA 6FDRA 4C3LA 3AD7C 3PEJA 2PC6A 3BYRA 4JV5J 5ETKA 4WFNQ 1NJXA 3BGLA 2WAQD 4JI6F 3IM9A 4UF4A 1X9MA 2PT0A 4DV5J 2HLUA 1TR0A 1LW2B 2LA6A 1VQ9S 1JXVA 1U02A 2CDQA 2DHSA 2HHHJ 1C1CA 3DNCA 3MAAB 1ZPVA 4I1TA 2MLYA 2HIQA 1SCJB 1WC0A 1TAQA 1NEEA 1P1LA 3TEGA 4EO8A 2QLJB 5A2QY 1J27A 5HO4A 1JJHA 2CJYB 3FSIA 1HWKA 2GO8A 4LFBF 3KHGA 1IR1A 2AMCB 5HLFA 2CG8A 4F02A 3GILA 5K9FA 1Q53A 2BJ3A 1FFSB 3BH6B 5G0RB 2F4VF 4K4YA 3IR7B 5B0BA 4KSEB 3SYZA 3CEDA 3I96A 4XAKA 4AE5A 1BQMB 2CFXA 1UZHA 2B6AA 3BO4A 4DQQA 1KC8T 5KFDA 3KHHA 1XQIA 3RBDA 1FEHA 4FBUA 2E9RX 4ZKAA 4FVMA 5HBMB 3G9CA 3BGRB 1SH2A 2L3MA 5B0AA 1Q5YA 3HSJA 1UJ5A 4LF1A 1M90T 4IQMA 2RU3A 3DM2B 1U1OA 3IWLA 5B0DA 1EQ0A 4TLRA 1X9SA 1YKWA 1SXLA 2B5JB 2ASDA 4URGA 2XZDB 2XMAA 2NXUA 4MKYA 2VBZA 2Y9HA 5LJ3Y 1SH0A 1XMOJ 2CADA 3ET6A 3MM5B 4TYAA 3CD0A 5AXNA 4QWCA 4USHA 3BKTA 1BQNA 3DRRB 3EGZA 2DH9A 1CULA 4RPFA 2OP5A 1U2CA 3D0IE 2E7XA 3I4PA 3NL0A 3BGOP 3MUMP 3QRRA 2X1GA 2XSJA 2XI3A 2ADBA 3D4JA 2MKKA 2KXHA 3T9NA 4O3NA 2VPZB 1SKWA 2LU2A 5AXLA 2JDJA 3HLUA 2H54B 4OYXA 2DT9A 3JYTA 4OZ2A 4QYZK 2KTQA 2XGQA 3LO3A 3N5FA 2EKNA 3NP5A 4DSFA 1XERA 4U7UK 3TA2A 1WUUA 2HFSA 1C0UA 2IJRA 3TJ9A 2QFIA 5B09A 2BA9A 1DRZA 4HI1A 4B17A 4WKRA 1NSAA 2JFDA 4QR0A 5EGYA 2C2KB 1HBUB 4LRAA 4DPWA 1YJ9S 3L9ZA 3KLIB 1WSRA 5DDQC 2BJ1A 4V1Ak 3ETMA 1H6KX 3KK2A 2GVZA 1Z4UA 4PRFA 4XPEA 3K8WA 3JTPA 1QVGR 2NSCA 1HBNA 2C3OA 3UCUP 2YKQA 3ZZZA 1TKTA 4P52A 1RI7A 3AQPA 2VKRA 3S1TA 4EEYA 2ABYA 2RAQA 1J5EJ 2CQDA 3SDEA 1LKZA 2CQ2A 1W26A 2E1RA 5EWFA 1UVMA 4ICLA 1T02A 4CLTA 1N36J 3QT8A 2VJUA 1WF0A 1KOHA 1QAJA 1UZDA 3VGTA 2VFUA 5DZ7A 1NDLA 3Q8YA 5KFBA 1DURA 3DU5A 2N4CA 1U48A 2CRLA 4KGXB 3PM9A 1HBMA 5F0WA 2BE2A 3IGNA 4A8KA 3ILJA 1RWNB 1D1UA 5DM6Q 4ZHRA 3F56A 4HHHA 3M9NB 3QJPA 2BM0A 2WK4A 4JI6J 2YKNA 3R5GA 4FNHA 4TXSA 4XK8C 4C3MA 1Q16B 3J80Y 4U8VA 4EZ6A 3CJ0A 1YWXA 2COLA 4QBUA 5E2QA 3OW2R 3JTNA 1FA0A 3Q2SC 1HYSB 2OPQA 3OL8A 5KFNA 5CCMA 3AJ2A 3G8SA 3FK4A 3S7RA 3JAMU 3ZTPA 4F2RA 2MQMA 2XNRA 1ZA1B 3GR0A 2EFNA 2HFUA 4LFBJ 1CC8A 2DCLA 2PEBA 3MAHA 1Q81T 2MLZA 2R8IA 2EG1A 2VASA 3JSRA 4FN5A 1G4CA 1T3NA 3OXLA 5KFHA 2N7YA 2YQ3A 1CBKA 4KH0B 1O51A 5HVFA 3WHIA 3TP2A 2F4VJ 1RT5A 1X31C 5KFAA 1JWWA 4ZK7M 2XQCA 4FXVA 2B9EA 3E2EA 1HW9A 2PD1A 3AHPA 1T9VA 4ECVA 3KJVA 3DFEA 4PXBA 2HBRB 5KT2A 4F4YA 2OEMA 2YNGA 2ASJA 3M8PA 4X66F 5L1JA 1CJKB 1M5SA 3HZGA 2WTFA 1S6QA 4J9LA 4DR7F 3V4MA 4RW8B 4QPXA 2DNGA 2GJFA 1X8DA 4HT7A 4RBTA 1KLMB 2PN6A 3IRWP 1QY7A 1H0HB 2A0FB 1SVDA 4N76A 1K1QA 4ES1A 2HHUA 3M30A 3NOCA 4ZCKA 5CA5A 2CQPA 4DN9A 3ADAC 4X4PA 1LXJA 5AJ3F 3GP9A 4DN0A 3GJQB 4X4NA 1YK9A 3UDCA 4LF6F 3UWTA 2ZKUA 3CJTA 1TAUA 4IFYA 3PACA 3TAPA 1GMVA 1T8EA 2FVQA 4RWWA 4MMOA 5IT4A 2ROGA 3VQSA 1NJWA 3CDEA 1CQMA 1HHSA 4A8XA 5K14A 3HHLD 2BRLA 3EZ5A 3EDRB 2R7QA 4URQU 2EFQA 2MZSA 1KQSR 3JQKA 4CIOA 1CJVA 2D74B 1BLUA 2DHXA 3HVWA 2XNQA 4OX6A 3DRSB 3NNCA 1CEZA 3PYFA 2CJKA 1HNXF 2AJ0A 1FI4A 1JQGA 3DLJA 3SFGA 3SSRA 2CVEA 2MQPA 2YY3A 2W2QP 3LA0A 2QV6A 3BR9A 1SV5B 4C8LA 5IT9U 4OJGA 3TANA 2AX0A 2FDNA 2HLTA 2YQ1A 4QYRA 3C6UB 4ED6A 2WOMA 2YNHA 4RW6A 4P2XA 3BM7A 1CS4A 4XDCA 3I0SA 2KRRA 4DQPA 1JIHA 3Q2TC 4JI2F 3X3UA 4ED2A 5C2CA 2Q43A 2ZJPQ 2KKHA 4N41A 4Y00A 5F0UA 3HO1A 3BBCA 4YEAA 2NR0A 1HQUA 1RTIB 4I4BA 2XS7A 4KFBA 2XCPA 2DCUB 1G6BA 4ZCIA 2R7RA 1L3KA 3WC0A 4WYWA 3SCKE 2VJVA 3K17A 4NXNF 5GAGU 4HT5A 2BANB 3AODA 4LT6A 2ZVIA 3FQKA 4QOTA 4ELTA 1SKRA 3ILOA 1RWVB 3IR6B 4RW7B 3G86A 1D3WA 2BJEA 3DLGA 2BR0A 5E3PA 2R8GA 3R5CA 2NYHA 3D1OA 3E3XA 2XMJA 4O3OA 2JLFA 2OSRA 2EC0A 3KLVA 4ALZA 1PIEA 4ZITA 1S6UA 1AUSL 4L6V3 1ZPWX 2M9KA 5HMZA 1ELOA 4X65F 2LP4A 4TQRA 1XR6A 3ZXWA 4CH1A 2FJXA 3VAIA 3GV8B 2P6TA 3JQJA 1I51B 3OSPA 2I5JB 1O0PA 5DLFA 3IBCB 5HATA 3DYAB 2E7WA 3RAMA 1WC1A 4DS5A 1UCNA 1ZM9A 4MK9A 1P8GA 2Z2MA 4DI6A 5J1PA 1UFKA 4FP9A 3BBFA 4UW2A 2WW4A 4P2MA 3NMRA 1NUEA 1R6YA 5EN1A 4O0IA 3MEEB 1VHIA 2BACA 1P9QC 4ID5A 2H4WB 2UVWA 3IN5A 1RT7B 4C8OA 4OHZA 3FSYA 4IRCA 4O23A 2NSBA 1DLOB 1OSDA 4LJMA 2FPHX 5IV4A 1NH8A 1SL2A 2IVMA 3U27A 3KOAA 4X4SA 4IOAQ 1M1HA 4LR9A 2QMXA 1DY3A 1A6LA 1HNWF 4OHWA 1PJ7A 1GMWD 4DR7J 4KGKA 3VAHA 2QFJA 3TI0A 5KOXA 3C66A 5HQLA 2HW3A 1VC6A 4J9RA 4ZJQA 4OYOA 4JI1F 3MPUB 4TY8A 3SBMA 3KNAA 2V34A 1FKPA 3C2PA 4F8RA 3BN4A 2H3EB 5I3PA 2MQOA 5KAKA 2AW0A 3LW5C 2HK2A 3OJUA 3SQGB 2PIIA 2KG1A 1MU2A 5AJ3J 4PQUA 4LSZB 1RT3A 4LF6J 3G87A 5EDWA 1REVA 3SCJE 2XLIA 1T95A 4OLOA 2XYPB 2DH8A 5C24A 2YNFA 3GYGA 3I5BA 1S9FA 5A8WB 3IG1B 1JJ2R 4FBTA 2F9DA 4OYWA 1HHQA 2W25A 1YJTA 2W2OP 2ZH2A 2OLWA 3F41A 3FUYA 2V63A 4IG3B 2ZBPA 1SL0A 3VZIA 5A8RA 4GKJF 3DCAA 1HNXJ 3E01B 2HQIA 1C0TB 4ECZA 3TUJC 4P6QA 4YR0A 2DY9A 3CDBA 4A8WA 2KZMA 2ZH4A 3J7YI 1WOSA 2VU5A 4F2SA 3JAMY 2CQ0A 4DZDA 4GC6A 2ZH9A 1QE1A 4J9QA 1DHMA 3QIPB 3QPIA 2QLXA 2KT5A 5L8RC 1QUPA 4LBIA 3OUYA 2YX4A 1ZA2B 1RADB 4IFVB 2LDIA 4LR8A 4E2FB 1CJUB 2CNKB 4B3OB 3Q89A 4JI2J 1UPMB 3FC9A 3BKUA 3DRXA 4ZVUB 2LKZA 3HI9A 4C8NA 4BLGA 1V5IB 3UDEA 3NWRA 2IY5B 2GIFA 1BXNA 4CI0B 2R9LA 2OPPB 3RGIA 1U1RA 2R8KA 5J1NA 2HMIA 4ZLLA 3OLBA 4FPRA 1J2VA 4NXNJ 3V4IB 1WSVA 4M5JA 2MZQA 1S1VB 3H8YA 4K4SA 5J2QA 3MPVA 3CF5Q 4EU0A 4WFYA 1QJHA 3PVXA 1RDRA 2VQFF 4OLPA 3CCSS 5FLXY 2ZH7A 1SH3A 3UD4P 1NKEA 2EVZA 1YG0A 1UVKA 2J6SA 1O5JA 1C2PA 2VZ9A 1SC4B 2JLGA 4M95A 3BGFA 2J6UA 4K4ZA 5KFZA 1OY8A 4X65J 4MH8A 3OR1A 4ED5A 1VRTA 4ECYA 2ZUGA 4PCQA 4DQSA 3GSDA 3MEGB 1MLAA 3OSNA 1IKVB 2K8GA 2MQNA 4W92B 5J2PB 1HWUA 1EETB 1VQLS 2Y1IA 3GYNA 3PZPA 2KM8C 3LPEA 1RT1A 4ECRA 4DUTA 1FE4A 4MFBB 3K0JA 1CLFA 4ZVTB 4C11B 5JUMA 3MMCB 1YBAA 3BS9A 2HFZA 1ZYQA 1YRXA 4PUOA 3PX0A 4QWBA 8RUCA 3ZZPA 4DPXA 3MM7A 2AEFA 4Q7AA 3PDNA 4I2QA 2VPWB 4WFZA 1IKYB 4NXMF 4L75A 2Y0SD 3MUTP 2DR8A 3R5AA 2NUHA 2G9OA 1VRQC 2FLOA 1XC9A 1FXLA 1HBOB 5ETPA 4MKVA 5J2NA 1FTCA 1ZAXA 2VQEF 3PEHA 1RA7A 3TAMB 1NJYA 2XYGB 3LALA 1LW0A 1HNZF 2VICA 1HNWJ 1N6QA 5AXMA 3B6BA 1S4EA 1WEXA 1NK7A 1GK8A 3W60A 5I4MA 2AV5A 2VBYA 4JV1A 5GADI 3Q22A 2CQGA 3R7SB 1F3FA 1GFWB 2MHNA 3THPA 4JI1J 1FO1A 4X84A 1S0MA 2AYEA 2F40A 1L3UA 2I6WA 1TL1A 4CTAA 3NXZA 1I6JA 4IG0A 1VLOA 4GVBB 4N7TA 2YX1A 1FRXA 2BX6A 3S6EA 1SKSA 1K44A 1K1SA 3M6WA 2EBEA 2XULA 3U02A 4TQSA 2E9ZA 4ZA1A 3I82A 3BO3A 2EFVA 1R31A 1GQEA 3MR2A 2ILYA 1B64A 2WSCC 5H9FK 3VVTA 2PFDA 4KKOA 3VGUA 4KYZA 2FD2A 3DLLQ 1M1GA 3R1LA 4DU7A 1VI7A 2CJQA 2O3DA 4WKYA 1PJ5A 2RVJA 2OMOA 1KFSA 3MR5A 3D6HB 2JOQA 4J37A 4XIUA 2ZHOA 4DV7F 3W9JA 4KTQA 1Z2ZA 4DR5F 4U8YA 3C46A 1YJNS 3HHLB 2ZDPA 1B0VA 5HMWA 2X3GA 3KLGA 2W7OA 4GKJJ 4NLPA 4ZVRB 1FEEA 3C6TA 4ZJOA 5A76A 1U0HA 3R97A 2HQGA 2GJIA 2DEIA 1IQTA 3KG0A 2IYIA 2J6TA 3TJ8A 2EFOA 1A9NB 2UP1A 3BH7B 2WSEC 4GMKA 2ZNYA 3L3CA 2FHJD 2LECA 2ZBIA 3KUGA 3ZZUA 3MXHP 2PE8A 2HNYB 3GIJA 3FQLA 4LSNB 1RTJB 4ELVA 2H48B 2AZ3A 5C42B 3TUIC 3I9V9 2JEFA 1UVLA 1VDHA 2ALZA 3QGPA 5D6GA 1ITPA 1KNZA 3RRGA 1Q78A 5IT0A 1AYEA 2G0IA 1J5OA 4CH0S 4MYUA 4HEA9 3TX0A 3IAS9 2GAHC 3KLHB 3US5A 4R0EA 1F9FA 4IDKB 4F3QA 4J9PA 1GMUA 1FWPA 3UFCX 5CZVA 4MKBA 1SBRA 2VQFJ 5JVGQ 2GFFA 4LBHA 4RZRA 1RYSA 2VG7B 2G1DA 5F9NA 4F50A 1SQGA 3BR8A 2DR9A 3W3SA 2XY7A 3D3BJ 3QAEA 3BQ1A 2OUGA 2V0NA 2NCKL 3FCHA 2B7BB 1I1GA 3PO5A 1MROB 4NX9A 4QW8A 4CQ1A 4R8UA 1KVIA 3QO9B 1OJ4A 3CJSA 5CD4H 4NMXA 3P6YC 2C28A 4CM2A 2H5EA 4OX8A 1UEKA 4FKYA 2CPZA 5KG1A 1RACB 4B9VA 4DPTA 5KG3A 5D4LA 2CZVC 2Q1LA 4J9MA 4Y2CA 1BD6A 5KFTA 2W8LA 2JRSA 2C2EA 4USMA 1K73T 1WDTA 2BABA 5D0EA 5CD4A 3FFIA 5E7OB 4K5SA 1S6PB 1PCAA 5ETSA 3GIRA 2VF3A 5CYMB 3G82A 4ZCMA 4WIIA 2QX0A 2RIJA 1LOUA 4EFAC 4RUBA 2JL9A 4F36A 1F6TA 2KT2A 3C15B 1BE4A 5J2MB 4NXMJ 4FF1A 4ES2A 4HH0A 4DFMA 1FK9A 4ZLJA 1PG5B 2J76E 3OVAA 1HQEB 5IM0A 4NCGB 2FZCB 2R8JA 3P4UB 4RWXA 2VQEJ 3MEKA 2RRBA 1HNZJ 2HGLA 5JXSA 1CPZA 5CQGA 4DF8A 3DOLA 2KH9A 4HDHA 1U24A 3W5XA 3T5JA 5LJ5Y 2B8QA 2GIRA 5KFKA 5L9XA 1OY6A 4WP9A 3PR4A 2HZAA 3TW0A 1JJCB 3NGKA 5LM7E 1HNVA 1C1BB 3NCPA 4I56A 2DRBA 2NPIA 3CJRA 3OTOF 4NMLA 4DX6A 1KTVA 5IXUA 2ZH8A 3M8QA 3J81U 5ETQA 1DQAA 4A8SA 1MSWD 4OZLA 1S7IA 5I42A 1S5ZA 2IVFB 1S9EB 4F0HA 3K8VA 1ZH5A 2XEXA 5KFIA 3TUPA 4NLTA 3N6NA 2OJ3A 4B08A 1FERA 1D8YA 4NWBA 3FRYA 2HNDB 3HJVA 3MTJA 1IVZA 4ILLA 2YBVA 4ZMMA 3DM2A 4NLOA 5HROA 1RAAB 2QLFB 4DV7J 2B5JA 2UV8G 3O5TB 5C25B 4QIVA 5GAHI 2RRNA 2HQDA 4N8NA 2M8HA 1NPRA 4ZDNA 2VG5B 3EZUA 1X5OA 4L72B 4WJBA 1VBKA 1OPIA 5EX0A 1UEVA 3H20A 4OI0A 4IH6A 2H5JB 1YBTA 1SC3B 2BVZA 3V81B 5F8HA 4KGMA 3FNNA 3PX4A 1L5UA 5F8GA 5HP1A 4PWDA 1NHUA 3RW7A 4CO4A 1RHUB 3M6XA 2YPZA 3DDKA 5FJ4A 1WACA 2Z0GA 4BBYA 2F63A 1CC7A 2KB2A 3GE9A 2HWTA 3NGTA 4RL1A 3M32A 1NHVA 3KLFB 4ZP7A 1TMJA 3PFEA 5F8MA 2QSFA 3QT6A 4A8OA 3MTKA 4JOUA 4LF9F 3R6GB 4CP5A 4DR6F 2ZHBA 3C16A 2IRUA 3HVAA 4B9LA 4Y6IA 1UWBB 3T1AA 3MZIA 3K5OA 1RAFB 2KFNA 2AYMA 3JSMA 3QNWB 1X4FA 1S0OA 3KK1A 4FZVA 2BQRA 3VV2B 1WF2A 3A12A 1DTQA 4DV3F 4NLRA 1D0EA 4NLYA 4ATNA 2MXYA 4LRCA 2BUNA 2L48A 3BGUA 1LWCB 2HRUA 5DG8A 1E6YB 5L9NA 1MWYA 3QFHA 3HP6A 2B3TB 2YTCA 1FX4A 2HQ3A 5L1KA 1T05B 3N9UC 3OTBA 4J9SA 1U45A 1FTRA 1HPZB 2HFVA 2AYGA 2OKQA 4WTOB 5SUHA 5HL7Q 3N79A 2MZ1A 4Y28C 3KTQA 4UZCA 3L7OA 2C2ZB 2C3MA 5LSRA 1NJIT 5FDLB 2IDEA 1RHRB 3B8HA 4K2XA 4UOGA 3FEZA 2UV8A 4ETZA 1KTQA 1D09B 3TO8A 2K3KA 1HMVA 2ASLA 2RF2A 2DGUA 3P3DA 2HHVA 1RJJA 2W24A 3LP2B 5BR8F 3B54A 3R9LA 2F5GA 2LEAA 2K1RB 1IKWA 2R7UA 3HCXA 4NYPA 1D9AA 1IR2A 4CNZA 4LFAF 4OZ0A 2KN4A 4KV8B 2LEBA 3X1LB 1RHQB 1UWAA 4TYBA 4DFPA 4OYMA 2KJVA 5DDRC 1FKOB 3E8OA 4NZ0A 4F4WA 3FBFA 4KPYA 4XO0A 4CLLA 5D3GB 2BBEA 3GIKA 4WE1A 4M5NA 2NPFA 1N33F 4K4WA 2Z2LA 1TK8A 1APSA 1KD1T 2AEMA 3D6TB 1BMQB 4L3KA 2YKMB 3VAJA 3BYPA 1FRJA 3Q0AA 1YVFA 5LOQA 3VZHA 3PHEA 3V6JA 1NK8A 2B9XA 2HHPA 1UP1A 5E3RA 1WC3A 1Q8LA 2X7IA 3MFHA 3ICLA 2XTJP 3R5BA 2JJ4D 2ATLA 2F65A 2HBQB 2OFHX 4IQXA 1KR4A 4DUZF 1DQ8A 3KJQB 2UUAF 2VG6B 4DX8H 2AHOB 3O6QA 5D0HA 5H9EJ 2PFFB 3M05A 3W8PA 4B9SA 1W2BR 1NU4A 3AB4B 4DL3A 1TL5A 4DWIA 3J7YU 2RHQB 3NLCA 2FGCA 3VQTA 3TA0A 1HWLA 3QQCD 3V6DB 3OTOJ 4DV4F 1UPPA 3TARA 1T03B 1NDPA 3KG4A 4YB5A 2DIVA 2ZC3A 1GTHA 3Q8UA 5A0YA 1EIYB 2ZH5A 1CJKA 4J90A 2LA4A 1U25A 4DR1F 2IC3A 4CO3A 4LF2A 4RNHA 3RB3A 1KS2A 5HK4A 3MM9A 1ZS6A 5EUHA 3FBBA 4U7UD 2J7UA 2ZE2A 2VOPA 2QG9B 2V2VA 3DU6A 2W9BB 1H7XA 3ITHA 2DH7A 3CJ8A 2Y8YA 2KL8A 2AF6A 3HJFA 4ED0A 3QZ8A 4OFZA 2OPRA 4KT0C 3EJMA 1XBWA 1RU1A 3LWLA 4O4RA 4OZ3A 4ED4A 1YHQS 5DLGA 2OD6A 5D0RA 3P5TL 1ZTWA 3PW5A 5L38A 4EBEA 4OYAA 3CJKB 2EKYA 1T0TV 4CLPA 2E66A 4CDIA 3IBFB 5A6WA 1VBYA 1T11A 1TK5A 4DL7A 2WONA 1T9YA 2B9WA 2J0SD 1RAIB 2P9CA 5T7LA 2P9GA 4KGVB 2RB7A 3GSIA 2RQCA 3CO0P 4WP8A 4H4MA 1RWKB 5D0GA 2K7KA 3DRSA 3UCZP 2MB0B 4LF9J 3AXMA 4IRDA 2HGNA 4DR6J 2C2NA 5HAOA 3SIPB 4DSKA 4LREA 1RLDA 4Y65A 2ZFHA 3KLEA 1YJ7A 2WHOA 4O4GA 1JX4A 1O8BA 2KXFA 2MY7A 4DV3J 5J1EA 3IBWA 3MD1A 1R0BG 2E5HA 3M2RA 4DPUA 1VQMS 4Z7YA 1DQ9A 4EI2A 4L73A 1EP4A 4QR2A 1S72S 4N5SA 1B7FA 3HX9A 4EZ9A 2BM1A 4CM0A 1WEZA 3EYZA 3EX7B 3OL7A 2R7SA 3J81Y 1RTIA 1RT4A 3D28A 5HJXA 3T1HF 3GR1A 3OR2A 2CNNB 3K5NA 1C1CB 5IWAF 5E41A 3EPGA 4G3IA 2M8DB 5GADU 1TL4A 2VPYB 4A8QA 3TVKA 4ECQA 1I94F 3D1HA 2P2CB 4RO0A 4ZP9A 2E5LJ 4RR5A 4G6VB 5BR8J 2XYHB 4MK7A 2DEJA 1IWAA 1QD1A 4GVLA 3VHQA 5HLFB 2XWYA 1EKRA 3NOGA 4LFAJ 3UPFA 4Z37A 4LIWA 3SSSA 2ZC4A 3W5ZA 3T41A 3A8KA 1AZSA 1HR0F 1RTZA 4HHUA 3ENQA 1TV6B 4P2SA 1JLCA 1N33J 1UVJA 3D54A 1T7PA 3OTDA 3GB0A 1ZM2A 1A7GE 2DBBA 1REGX 3NMAA 3D68A 2B6AB 1YRUA 1YZ7A 1B0TA 2VH7A 1RHJB 4AL5A 2ALYB 2B4PA 1RE1B 2KJWA 2Z56B 2IIHA 3DYAA 1UETA 1LWEB 3QGIA 4MIBA 2F7VA 2CQIA 4QJVA 2MEWA 3NEKA 4CO1A 4UTGA 1LXNA 1X4GA 2BJ9A 4F4KA 3I5AA 1YIJS 3OHAA 3MR3A 3CMQA 4OZ5A 4DUZJ 3VTIA 3HDSA 3JQMA 1GH8A 2HS4A 2UUAJ 2EBGA 2FZGB 2E1MC 2MQLA 2UVRA 1U7LA 3ET6B 4DL4A 2FHKA 3O8WA 1BQNB 1Y9OA 1NKBA 1CULB 4C3KA 4DV4J 5ETVA 5CYJA 3DDNA 4RUCA 4K4TA 4P75A 5JMNA 2FHOB 3MHYA 4LF5F 3M2VA 4QIEA 2N7CA 2GGPB 1AROP 2MTLA 3GLJA 2NUUG 4DR1J 2IVYA 2EK1A 2KG0A 2XSJB 3AJDA 1XNQF 1YDLA 2HPUA 4MIAA 4M63A 1WORA 1VQ6S 3UVJA 4F4XA 3LWMA 3DMJA 5KFLA 3U1MA 3Q8RB 2B8PA 4EMDA 2DNPA 3HVTA 3UN2A 2I1RA 3BSAA 2MZRA 4USVA 1LV5A 3BEGB 3WIVA 2DK2A 2WCXA 4TU9A 1HD0A 3M6VA 2C2RA 5BYQA 1WI8A 1SJFA 1CSJA 1C0UB 3CCVS 3JB9k 4OI4A 3Q24A 4DX7A 1RP5A 2IYGA 5M2PA 2L9WA 2V9KA 3RRHA 3IG1A 4RUHA 1T9WA 2ZJRQ 3GWCA 4J7CA 3CW2C 1TUWA 4MKAA 4DCJB 2YKPA 1Y5IB 3SQOP 3L7PA 4JI5F 3KK2B 1S4FA 1NAQA 4RBUA 3N28A 4OQJA 2IRYA 1HBNB 2FJEB 2I8EA 4ZS6A 2CYYA 1TKTB 1HHTP 3IRXA 3VAKA 2CPXA 2AT1B 3M1VA 1X5PA 3MR6A 4OI3A 1U1NA 3E01A 4NEZA 1PILA 4QWDA 3IR5B 3EM1A 3AXKA 4OJ3A 3SDEB 3POTA 1SB6A 1TVRB 3CVKA 4ICLB 2W01A 5KG6A 3I0RB 1IQZA 1VS3A 3UD3P 3QMQA 5KT7A 2IA0A 1BUXA 3BPSP 2M7SA 5DQIA 1GX5A 1S1WA 1RWMB 1X4EA 3RAXA 2PO4A 2L41A 2V94A 3PRVA 4B3OA 3FZ2A 4NLXA 1NHKL 1HBMB 2H9ZA 2WZ1A 2BE2B 5DGBA 4RKUC 4ZPDA 5F8LA 4P7VA 4ZHRB 4CNYA 2GC8A 3EGNA 3LAMA 2GVDB 4E98A 2GMHA 2MDAA 2QMWA 2HKEA 2Z58B 5GMKa 1LK7A 3J7AN 2ZEJA 2J7WA 4DCOB 1YGYA 5LMNF 1VCTA 2OPQB 3FKBA 5IWAJ 2GHWA 5K20B 5GAEI 3BZQA 1NNDA 1I94J 4P7TA 2CG4A 3KYLA 1S1VA 4P10A 4FF3A 1FNMA 1WHVA 4G1QB 2UU9F 5F41A 1TP7A 2CA9A 3OXFA 3Q83A 1HL6A 2GHVC 2RHSB 2WVFA 4MJKA 1MMNA 4HLBA 2ZWPA 2CQ4A 2C3YA 3AFGA 4HTIA 4NI2B 2HVIA 2BQUA 1HR0J 2AX1A 4AT1B 2JEGA 4QIGA 4OX9F 4B9TA 4DF4A 1HQ2A 2VOOA 2BMBA 1FRMA 2ZHAA 4V19X 2WB4A 4IH7A 4B3TF 4MT1A 3D9BA 3M8PB 5KG0A 2XO6A 1S6QB 4P2FA 3QFWA 3D0GE 2RKIA 4TLQA 2EFPA 4KY3A 4W4MA 1EETA 1NPKA 4F0MA 1N54B 2OI2A 4RNNA 5E3QA 1TKZA 3G6XA 4C11A 4OYPA 4P73A 3HHLC 4PG4A 3MMCA 4DPOA 3I56S 1Q7YT 3G6YA 3CCQS 5GAHU 3MOZA 2LCWA 3PIOQ 1UW4A 3M30B 2V50A 4NZ7A 2MZTA 4L3NA 3ISNC 4CT8A 4CYUB 5F3TA 2BEFA 1SUQA 1IKYA 2ZM6F 2A18A 2RS2A 1HBOA 3NWGA 2J9DA 2QA1A 2G0CA 2IRXA 5AE3A 1FF2A 4K5RA 2B4VA 3WX8A 3DKDA 4LF5J 3TAMA 1Y3JA 2CPEA 2VL1A 3AAWB 3N4WA 1YBUA 4DFKA 4WF9Q 2WW8A 4J91A 2V4QA 4PG8A 5IFMA 1RUSA 1XNRF 3OTCA 1D8ZA 1XNQJ 1QDUB 1B4SA 4C8MA 4DG1A 1U09A 4U9RA 3CD7A 1CJVB 1X5TA 4LVNP 2HGMA 2A2CA 1FT8A 2H65B 1ZTTA 2IHR1 1NH7A 4OI2A 4F4AA 4DSIA 4EGLA 4ES3A 1U49A 1N5YA 3IC1A 4ZPBA 2HVEA 3W9IA 1BQXA 4I6YA 5MLCV 1VIOA 2W4DA 3I32A 2UUBF 3PRBA 2GO9A 1L3VA 2Z4PA 3R5DA 4NCBA 3QLHA 4C8ZA 4GKKF 2BKNA 3HFVA 3PW7A 1RWXB 2WOMB 2WVDA 2MGZA 2YNHB 3SSQA 2XB2D 2RE1A 1VQNS 1CS4B 4K2JA 3I0SB 4OZ1A 4B9UA 1FD8A 4JI3F 2R42A 2XCAA 4JI5J 5MAOA 1QLNA 4E8UA 2P9EA 1P27B 1HQUB 3KUHA 1R27B 4YR2A 2QGFB 4KFBB 3A4TA 2E5IA 2QYGA 1AXQA 2G1HA 2DRAA 4BDPA 3W5YA 3HHLA 3A3NB 1JLQA 5ETLA 4MTPA 4DV2F 4F3OA 1GXTA 3G8TA 2L08A 2CQHA 3LTOA 2GNKA 3PXGa 3CPWR 3GTYX 4CRJA 4X4RA 4G65A 3DLGB 3NGSA 2SXLA 3R2DJ 1KVJA 4F4ZA 4Y34A 2RSQA 2CNLB 2G0JA 1QSYA 4ZPVR 3THTA 2G13A 1PAEX 2ILZA 3V6KA 2V8GA 1S1TA 1N32F 2XLKA 3H98A 3NCQA 4ZPCA 3GJTB 3W64A 2ADCA 2RRAA 2AJFE 2C1EB 4L74A 4L76A 3ZTOA 2AJQA 3T1YF 2ZH1A 5RUBA 1JLGA 2DNNA 1BC6A 4PPZA 5LMNJ 4LSLA 1RCXB 1G1XA 1HI8A 3GJRB 2KHCA 2HYIB 2K7JA 1FNXH 3K89A 3KLHA 4JB8B 2GMJA 4OL8A 2FY1A 1RT6A 5D8HB 2UU9J 2EWHA 4EK2A 2RUGA 3Q8QB 3THVA 3LP0A 1W7WA 5LMUF 5BYRA 5DZ6A 5CCLA 2R2RA 4Q43A 1OS5A 2KU7A 3NS5A 1RWPB 3DRPB 5DG9A 3GMGA 1IKXA 1NSPA 4CO0A 4OX9J 2XC9A 4UOFA 1MROA 7FD1A 4WP3A 4PPDA 4DV1J 4FPIA 3QO9A 1S1UA 2GAGC 2D9PA 2MHEA 4QQBA 2ZOMA 1R89A 4B3TJ 5JVHQ 4M5MA 1WF1A 3OLAA 2KRBA 2FVCA 3DLKA 2AP6A 4DV0F 1R43A 1IWGA 3HF5A 3HSDA 2H1YA 4IO1A 1XWLA 4Q45A 2F8EX 2DGWA 3O3LA 3HPOA 4TY8B 3TJAA 3PHTA 3L95X 1H98A 2V4JA 1ZAVA 5KFOA 2MPUA 3GPAA 3PJWA 2Y1LB 2W9CA 3QIDA 2XM3A 3EICA 3HHKA 2J0QD 2DNMA 1MU2B 4WFXA 3IA0A 4PQUB 4RW4A 4KC5A 1XN9A 3JTOA 2Z2YB 1OMSA 1RT3B 2ZM6J 3EVOA 5IC6B 3PX6A 4JYAF 1REVB 3FMBA 2RH3A 3W2VB 4J9OA 2LVWA 1VOMA 5C24B 2YNFB 5H9FJ 2CJAA 1HNIA 5L1IA 2IAJA 5F3ZA 4NA2A 1Q1KA 2YQ0A 1XNRJ 4J9NA 4WXOA 3LUYA 4Q2MA 2C3UA 1SQFA 1C4AA 1OO0B 5CHCB 1JLFA 1RWOB 1GMWA 2CVIA 2B43A 5HN0A 3RBZA 3GQCA 4TKTA 4O3PA 5A8RB 3MM6B 2A10A 4PYDA 4V19J 4G1PA 4C97A 1N5VA 1RAJA 1VJQA 4ANEA 1C1BA 4U67Q 2EI5A 2FLNA 3KUEA 1FXDA 3DGPA 5C2GA 1URRA 2OFGX 5HVHA 3RAQA 1VK3A 1JNZB 1SPBP 4ITSA 2UUBJ 3OFGA 2GA7A 4H4KC 3M2UA 1EAYC 4GO7X 4OMFG 2XHWA 2XGPA 4GKKJ 1FCAA 1EJ7L 1VYAA 3PFOA 3ULHA 3DI6A 4I7FA 4R25A 1HI0P 2ZDOA 2XHCA 3AQOA 4PG7A 4ZVOB 2YWHA 3K5PA 4QIFA 1YLXA 1S0NA 4JI3J 1CG2A 1NB2A 2MSTA 1MMLA 3M6UA 3D6FB 1V3ZA 3CCWA 3R8YA 1NK5A 3MI7X 4YR3A 1VRUA 2C42A 2QE5A 3MECA 3R2CJ 1WD6A 4PQAA 1WC5A 3RRKA 1OQ3A 3D2WA 4DV2J 1F5BA 1FRIA 2WBRA 1R6VA 5T41A 1TKXB 1IJFB 2F9JA 1QAIA 5F8NA 1YTYA 2Y8WA 1Y4ZB 2N4DA 4ECSA 3ELHA 5D77A 2QZ8A 3R5JB 4RNFA 4B3RF 2D3UA 1QSLA 3PYEA 5H1SV 4ZVSB 1CJTA 2VIHA 3HXMA 1EHWA 2Y1RI 3J81j 1AUDA 4CLSA 3DXBA 3OR1B 1N32J 1R3NA 1VRTB 2DO4A 3PKYA 2MMYA 2Q66A 4JBCA 2BE9B 2CWKA 3W9HA 2FIUA 2HZVA 2J8AA 4LVOP 3H42A 4ZLNA 1M5OC 3H59A 3T1YJ 3BSCA 1VQOS 2QJ3A 3NS7B 2W2MP 1PBUA 3T6JA 3PIPQ 4LF7F 3B78A 1R7IA 2X1FA 2WSFC 4CZCA 4G1IA 3UW1A 1WG1A 3D3CJ 4DCPB 3PKMA 2DHHA 3OD2A 4PUOB 4DLGA 4FVCA 1E6YA 4TNOA 1NK6A 3KHLA 5LMUJ 4WK1A 1WDDA 4H4KA 4DUYF 1Y11A 1WI6A 2P8IA 2WVCA 4I2QB 5A8KB 3MUVP 3BPDA 1XMBA 2DIUA 2DNKA 4ZIWA 4ZVHA 1PAUB 2U2FA 3GU0A 1LW0B 3HFZB 4ERDA 2EXUA 1N6QB 1S59A 3MURP 1Q7LB 2FJWA 1UFWA 2JX2A 4FYXB 4FXWA 2VBWA 4DV0J 2B9YA 2YWGA 2QYCA 3M8SA 1HIYA 1FKAF 4Y0FA 5LL6d 2YH1A 3DOKA 1MG7A 1TL1B 4USTA 4KV8A 3CCJS 1S12A 4IG0B 4Y2AA 2QO3A 2HIYA 4GRSA 2DB1A 1NK9A 1FKOA 1M5HA 2PI5A 2LU1A 1IN0A 1RTHA 3FVYA 4DOZA 4PXCA 4KQZA 1NZ8A 2PDAA 3CC2S 1TUVA 1WHYA 4YB6A 1S79A 1VBXA 4JYAJ 3VGSA 4ZPWR 1U0SA 3EVMA 4JI8F 1P9YA 2ZZTA 4ECXA 2LQ8A 1TUGB 3ZZTA 4Q0BA 2G2OA 1RLCL 3HKZD 2G2YA 4KKOB 1KQFB 3RBXA 4QCLA 2VBXA 2M52A 7AT1B 4FF4A 2AZ1A 3T5HA 4WZQA 3QWUA 2F1FA 2AGPA 1S10A 2QA2A 2CPJA 2KO1A 4CLUA 4IRKA 3V2UC 3R6LB 3ONQA 1TFYA 2E5GA 1N48A 2A1BA 2MYFA 3TZXA 5LXRA 3RYLA 4BC9A 3AD8C 2NS1B 2HHTA 3CMAS 1QAYA 4X66J 3EDQB 5B0GA 5KG4A 5AXKA 2LXUA 3C6TB 2HHWA 3H40A 3HHEA 4USUA 4P9SA 2J9CA 4PR6A 4HACA 2YKAA 4LQ9A 2BOAA 4NL5A 1T03A 2NQPA 4YMEA 2YVSA 1JXLA 2GMLA 1DBDA 3QYYA 1Q5VA 1FJCA 5IS2A 1UA0A 4DEZA 3ISZA 3ZZYA 4B9NA 4OIXA 1YJUA 2RQ4A 1DZ5A 4ZP6A 2XS2A 4ILRA 2D69A 3CCZA 2VDIA 3HSZA 4M1KA 1VC0A 2ZBQA 3P5BP 2BQ3A 2VHGA 2V5HG 4B3SF 2IM1A 2V2ZA 1J5OB 5GAEU 2W7PA 3RW6A 2FB0A 3C8YA 3GYXB 3UE2A 4NE9C 4O44B 1VQKS 3EUNA 3K2YA 1PSDA 1X4DA 2XZWA 4LUBA 4J5OA 4OJ1A 1RHMB 1I5OB 3VGVA 1HA1A 1OSCA 4TVAB 3G96A 1N4LA 3CSKA 3M8YA 1U1MA 3MR7A 3OQ2A 2KVQE 3VR1A 4B3RJ 3TQ1A 3CJKA 3I4HX 4N8OA 1VQ7S 5CAAA 3WC2A 4JI7F 2ZZNA 3R1HA 4R0JA 4IKAA 3CC7S 3DLEB 2ZOFA 4KHRA 3IS9A 4RW9A 1U8SA 2C22A 2FHJA 3KDOA 1ROFA 5FD1A 3W61A 3T5KA 2IDLA 4I2PB 3UDLA 2BV3A 2YNIB 1Q0NA 3BBBA 3MCNA 1JLBB 4H54A 2FTRA 5K5MA 2DHAA 3IFEA 4PWUA 4U6PA 4LF7J 4K50A 3FMWA 2M0GB 5K8PA 1RAOA 3UI3A 3L09A 1N5SA 1KSPA 2DNZA 2KFYA 1FJGF 3N5BA 3AOBA 4IOBA 3DLHA 2KZZA 4AXJA 1SJQA 4QU6A 4DUYJ 5E0OA 2ATCB 2IM3A 1Q79A 3W62A 2XBPA 3VALA 5DG7A 2CJXB 3AB2B 2YX7A 1TL3B 1FK9B 4HTJA 3CD6S 2GCFA 1S7HA 4W90B 5IM0B 5DQHA 1XR7A 3H25A 5ETOA 1ZZFA 1UKUA 5KTQA 3MEDA 1DJ0A 1NK0A 2MKYA 3DOLB 3UN5A 2VDHA 5KFEA 3ZC4A 2NZCA 2ERRA 3OVSA 1RTDB 2HWIA 2I9SA 1NJZA 2B4UA 2HEKA 3GFXA 1GXLA 4CT9A 4K4VA 5KFGA 3H2UB 3SZ2A 3SCLE 2F3JA 5KFSA 1HNVB 2V8PA 4ZPTR 3H5XA 2B56A 4NRUA 1RKIA 1QUVA 3GV5B 5EHHA 1TV6A 3M8QB 3UDVA 4CO2A 3MMBA 3SFUA 1VGYA 2PSZA 3RG6A 2MZJA 4JI8J 5I42B 1TMMA 2MY8A 1KFDA 4X64F 1E6VA 2ZD1A 4OZJA 3FBEA 4PZVA 2B4OA 2D41A 1RXOB 2LLZA 3TAQA 5DETA 5F8IA 4M5GA 2W2NP 5KG5A 1LWEA 2O1PA 2RQKA 2FC9A 1K0TA 1RBOB 3KK3A 4A46A 2O5DA 5HROB 5IT9Y 2N3OA 3UNYA 3GZ7A 1FXRA 1O6XA 3RR8A 3MFIA 5C7PA 5KFFA 3EXCX 5H9EK 1SC6A 2AJ1A 1H2VZ 5KT5A 4IOCQ 2DTJA 5HI7A 4JV0A 2QA4S 3DN9A 2Q6BA 1KEKA 3MMAA 2ZVSA 3I55S 5I3QA 4YDXA 1FRHA 2RJZA 3CJ5A 1X4CA 4UQGA 3CCMS 2RDIA 3T19A 4NCAA 2VUGA 3DC2A 1U2RA 4PYAA 3KXDA 5HP1B 2PA8D 2GGPA 4PWDB 2AJ4A 3ILIA 5KFYA 1X9WA 3D5MA 1IJEB 1KBRA 3PW0A 4YUDA 4X4VA 3I9ZA 2JSXA 1JLAB 4H4OB 5DDOC 2R2SA 3M32B 3BREA 1T3OA 3I31A 4ZJLA 1UFLA 3Q8PB 1SL1A 2UUTA 5HJYA 3OVBA 2AU0A 3PCOB 4RU9A 4B3SJ 4UY8T 3C16B 4M5DA 4X62F 3T9ZA 2JEJA 1R8HA 2V2QA 1RBAA 3MF5A 3CT9A 2E7VA 3JSMB 2DGVA 3KK1B 3AJ1A 1DTQB 5IZHA 1Y00A 2FJDB 2FYXA 1Y5LB 1CQNA 2YXLA 2E44A 4HH1A 2V4RA 2GX8A 1VBZA 1H2TZ 4NRTA 1FJEB 2KDOA 1GNKA 3BN7A 3W65A 5AE2A 4R5PA 1JKHA 4FS2A 3MCSA 1NKCA 4JI7J 2JFKA 3D1QA 4E0DA 5HSPA 3J7A1 1LFWA 2H4YB 3WZ0A 3EGVA 2KHDA 2CWXA 3VVUA 4K0KF 1BHNA 4QPTA 2DISA 2K06A 6FD1A 4ZP8A 1HMVB 5M2UA 2RF2B 4AFFA 1G2EA 1TVRA 3SV3A 5CZXA 4DV6F 1S49A 1IKWB 1S9GA 1JB0C 3ZNJ1 2CZ9A 1NLKL 4BHQA 3I0RA 4NLVA 4ENOA 3PTWA 3LGHA 4OI6A 4OZNA 3GIIA 1FJGJ 4LIRA 2BKPA 3ETOA 1Z2LA 3EPIA 4A8MP 1WG5A 3I87A 3M9OB 4WE1B 1S97A 5D4PA 1WC4A 2UUCF 1VR6A 1OPZA 2VC0A 3NAIA 2Z30B 3GJSB 2W8KA 3BKFA 2GVDA 3OJSA 3MD3A 2FJVA 1Y3KA 5CYQA 2EG2A 2E9TA 4Y2IA 3EE3A 3OBIA 4JP8A 3RZAA 1IM6A 1PYTA 5L46A 2AQ4A 3LP1B 3V6HA 1ZBTA 4DL0C 5KT3A 3MM8A 2POKA 3SI8A 2PA3A 2IBKA 2DR6A 2MQ8A 4G1QA 2HWHA 3O2IA 3PYGA 4RU2A 2HVZA 2GQ2A 2EEYA 2KFZA 2WVBA 2M4MA 1FDNA 5HMYA 1EX8A 4NI2A 1T9TA 3HM9A 5JJBA 1R0AB 4HI2A 4KHMA 1T9XA 3UR3C 2FLLA 3MCOA 1TU0B 3FCWA 1TELA 1VQ5S 3RJMB 1GT8A 1QVFR 5A0YB 3AT1B 2C2MB 2DGOA 4UY85 4X64J 4K4XA 2IC3B 4UOCA 2ZH6A 1IUJA 3FGVA 3MM9B 1LWFA 2W9AA 3HHNB 1X5SA 1YX2A 1WG4A 2BZ2A 3FEYB 2BDPA 3TNVA 4WBFA 1HD1A 2CKWA 1HKAA 5LT5A 1PGZA 4HKQA 1Q86T 2ZE2B 4F67A 3WDOA 3C14B 4QZVB 2NREA 1KONA 3ITHB 3RB6A 5FLXU 4YHHF 2V6AA 1DARA 4OJHA 1DTTB 2MKHA 2BE7D 1LW2A 2YKOA 4C0HA 2E1AA 2XSFA 2LXIA 2OPRB 4F3MA 5KT6A 2QSWA 3MAAA 3P8BB 3ZTSA 4CYUA 1N0UA 1LFPA 2MLXA 1RGVA 3TEHB 4JV2A 2LXFA 1LWXA 3B4MA 4F7VA 1S1XB 1XJWB 2Q79A 2HAIA 3NKYA 1WNEA 1IBLF 4NEYA 3AD9C 4DR3F 3V5RA 4U7CA 3QJLA 4AXIA 1WTBA 1DFDA 5G0RA 3ZZRA 4KH1B 2WONB 4FYDA 1Q8BA 4M5HA 3DDIA 3W2WB 1IR0A 5T7LB 4AD6A 1WKKA 3HD2A 4EBDA 4X2BA 1R8BA 1BQMA 4H4MB 3ISND 2B0GA 5L1LA 4KAIA 4N47A 3IP0A 3DLBA 4QW9A 1H74A 4ECWA 3D66A 3NGDA 1XMQF 4X62J 2JLEA 2CQ3A 4YOEA 2V2KA 3NG8A 5HBMA 5KFXA 3BGRA 1B99A 1SIWB 3KLEB 4BWJA 1YRTA 4USWA 4O4GB 1VIXA 3TYTA 2XMMA 3W1YC 4DSLA 2NXNA 3IM8A 2R2UA 1YJWS 1EB0A 5J1EB 2LQJA 3M2RB 3P45B 1SJ1A 3IXQA 4DR5J 4LRDA 3Q8SB 1EP4B 2BJDA 2NXJA 1EZZB 3MM5A 1LK5A 2YH0A 2HK3A 2HS0A 2ZWOA 2HURA 3DRRA 4Y2MA 2IM0A 1RT4B 4BCAA 3CWJA 4JI0F 3OR2B 1JK9B 2KXNB 2LFVA 1FFGB 1Y5NB 4K0KJ 2XMWA 1VQPS 5IQ6A 2BXJA 1H72C 4BC7A 2CUYA 2LEPA 4DV6J 3MCMA 3QT7A 4K7QA 2KI2A 4FYVB 2DRDA 4N77A 3W63A 3HT3A 2UXBF 4O3SA 4P72A 1H3DA 3R7NB 2PMWA 3G6VA 2DD8S 1GTEA 1AZSB 4MYTA 1UEUA 3QJJA 1FFWB 4YFUA 1X4BA 2FQQB 3PW2A 4M94A 1BWEA 1JLEB 1JLCB 4DJBA 2UUCJ 2GS8A 4QU7A 4ILMA 3OFEA 3O44A 2OO4A 2BRKA 3H0PA 3ZTQA 1P1TA 4CLYA 3K59A 1RWWB 4M5LA 1S48A 1K47A 2O67A 3G4SS 2FUG9 2MKJA 1PC4A 2QA4G 4ZVPB 3DOMB 4K8RA 5BXIA 1HBUA 1Q8IA 3KLIA 5IC4B 1A0OB 4NASA 5THWA 1TQLA 2CPHA 2DHGA 2XG8A 2DXFA 1XTZA 3UQSA 2UZAA 3I5CA 2OSQA 4BS2A 4C0OC 5K8MA 1Q8KA 3GV7B 5D15A 2QIFA 4S0MA 3DRPA 2FY8A 3RR7A 5F8JA 3AA8A 3A8EA 1RCOB 4NLUA 5DM7Q 3TZWA 2CNOB 1C4CA 3NNHA 4WU3A 3MAQA 2HZCA 3M2VB 5DDPC 1L3SA 2HQFA 4LQ3A 3A3OB 3K7RA 3FRZA 2O66A 4IR1A 4ECTA 2VA2A 1PYOB 2L9NA 2EW9A 3W7BA 3NBPB 2CPDA 3ZZOA 4XPCA 4OV6A 3CC4S 1FWKA 2F8HA 3UVJB 1RT2B 3QWPA 3KWMA 3CCLS 2YPYA 1F2HA 3DMJB 1KQKA 4YHHJ 1U6BA 2FLPA 2HNZB 1YSJA 3CCUS 5LSOA 3IAM9 3HVTB 4FKXA 2OMLA 5CXTA 1HYSA 5ETNA 2OHDA 4DQRA 2IJFA 5K8OA 4KO0B 1KOOA 3A1YG 1U47A 1H73A 3TOQA 1AFIA 3CULA 3P96A 1KHWA 3W2VA 2F4FA 1IBLJ 5EWGA 2HRYA 4J9KA 1X0PA 4DR3J 2GIQA 1WEYA 3BB5A 1BGXT 2MJUA 2I38A 4F26A 4HVZA 4AL6A 4EO6A 3UD5A 3CJQA 4ELUA 2M2BA 1NSKL 3H5YA 4F0KA 3GFYA 1NB7A 3VAFA 5E3CA 2OGUA 3VAMA 1NK4A 5E33A 3PV8A 3PNIA 1KN6A 3CIZA 3IGVA 1G7CB 3IRXB 1AT1B 3QAUA 2E1PA 1FESA 3PYDA 3M1VB 1M5VC 4C48A 4DSEA 3MM6A 1MN9A 1XMQJ 1VISA 1FD2A 4RW8A 1KHVA 2ZZMA 3LF0A 2Q6CA 3POTB 2MQQA 1LNQA 5KFVA 3ZTRA 2XY6A 4HR2A 4DDFA 3KMSA 3N0VA 4DSJA 2HG4A 1KLMA 8AT1B 3NCRA 1RYRA 5D78A 1HWIA 4UOHA 1CVJA 1S1WB 3MPWA 1RZMA 1V9OA 4ED7A 4ED3A 3CUNA 3TX8A 5GVQA 3W66A 1L3TA 4QYZJ 3TZZA 4ZIVA 4ZVEA 1FNOA 3C3LA 4U96A 2R7WA 1KLNA 3WX4A 1RB0A 2CIMA 5ADZA 2HHQA 2CJBA 4NOHA 4X4QA 4JI0J 9RUBA 4CCHA 1IM4A 5HMXA 5I3UB 1FDAA 2ACMA 4HYKA 1KWMA 4IR9A 2PGCA 1D9DA 2RILA 1TKXA 1RAHB 3NGRA 3BJYA 2OPSB 2FZKB 2BYCA 3UR0A 1TL7B 3GCXP 2DR7A 1NDKA 1Q95G 3N6MA 2CQBA 2UXBJ 2CPIA 2V9WA 3ENAA 2QMUB 5B7WA 4FYWB 1UVNA 2WBMA 3RB4A 3DHWC 3HD1A 2R4FA 1G3OA 4AUKA 3U1LA 4I6AA 3D0HE 1X7VA 2F8MA 2JVOA 2DPJA 1Y7PA 3D6MB 1SV5A 2A3JA 1PBAA 1PC5A 2W4CA 3TVZA 2PMHA 3WBZA 3C6UA 3BO2A 4WFBQ 2RKIB 4A4JA 3T5LA 2VFRA 2IPOB 4ZN1A 3QRPA 2HRTA 1WHXA 5KFCA 1SJRA 1WJ9A 1RSCA 1U6ZA 3B82A 1B3TA 1TKZB 5CABA 4NYZA 1S77D 2DKOB 4YN3B 1T9UA 5KFQA 5M2RA 3DGVA 4YB7A 3CDAA 3Q23A 2YWWA 2MSSA 4O3RA 2P6SA 1RBLA 2MKIA 1R0CB 4LR7A 4DR2F 2AJ2A 1SUQB 3JSBA 2FJBB 3CJ2A 3IMQJ 1NBEB 3BDEA 4GC7A 4NLDA 2BANA 5B0FA 1TK0A 2JVRA 5A8KA 2V8DA 4FDFA 1LEOA 4WYLA 2DR5A 4RW7A 1MMDA 3CCES 4CLFA 3OV7A 4WIQA 3GFZA 1OY9A 2WB1D 2X51A 5EWEA 3QGHA 1XEZA 2DGXA 2H5IB 3KG1A 3PG9A 4HHJA 3QZ7A 2A6OA 2QLBB 3QRQA 4NLQA 3K5LA 1N5QA 4IH5A 4DG1B 4QR1A 1Q4RA 5DRKA 4DBQA 3TWZA 3OL9A 2HHXA 2CJ9A 2HAFA 1HW8A 2DGTA 2IMOA 2JC1A 3LGNA 2DXEA 4K59A 2FHMA 2DO0A 2I5JA 3F0NA 5ETMA 3SEOA 5E3AA 4DR4F 3PJXA 2VFSA 3MWBA 1N5YB 4MAKA 3A13A 4B3MF 1U2FA 4EUVA 1NXIA 2XWXA 1K8AT 1F9EB 2M5YA 2R3VA 3QLHB 3KJNB 5ETRA 2CQCA 4Q44A 3MEEA 5K8NA 5GMDA 2MGZB 3NGUA 3S01A 1RT7A 2XI2A 3GG1A 4C8KA 3CDWA 1KP6A 2GZOA 3CGIA 2QT7A 4D3GA 2R8HA 4U95A 4LFCF 5DGAA 1IBKF 1DLOA 1WHWA 2ZBRA 1M5PC 2RNEA 1WOPA 1JNRB 2QRRA 3H4DA 3SXLA 1VQ8S 4PAAA 1X4HA 2QLWA 1JLQB 5BYSA 3GONA 4KR0B 2HQCA 4QWAA 4WU2A 2GHPA 3MDFA 1KRPA 2XMTA 3ENVA 3WQPA 1AW0A 1TTHB 3RU0A 1FE0A 2VFTA 1FX2A 1N34F 3Q86A 2XO7A 3RBEA 3JYTB 2B51A 4X4UA 4WPAA 3SQGA 1VHFA 2KT3A 1S1TB 4RLEA 3HZEA 1QAXA 2D9OA 3LANA 1EQMA 3H2LA 2FJAB 3KMQA 1KDNA 2VD3A 4DU8A 4N56A 1JLGB 1PO6A 2NXEA 2KVIA 3Q8VA 1V5VA 4UUWA 4LSLB 5A8WA 4DMZA 2VC1A 4ECUA 2G2ZA 4C98A 2AGOA 1N5TA 4O44A 3QBCA 5D4NA 4UUXA 1R8CA 2GVZB 1OYEA 2IMWP 1SJ3P 3BSOA 1RT6B 4DQIA 3QSYB 2GJ2A 2UVVA 3LGMA 2OAUA 2PEHA 3LP0B 4AL7A 4IG3A 1TFWA 2R7OA 1WOOA 2UVUA 1OQ6A 1RK8A 4DPYA 1C0TA 2UXCF 3CIMA 1IKXB 3NS6A 1JMTA 5A6PA 2A6MA 4FNIA 3DLEA 2HVHA 4USKA 3W8GA 2G4BA 1S1UB 3M8ZA 4EWTA 3BV8A 3QIPA 3T6BA 5LSLA 8ATCB 4DL6A 1UW9A 2BW2A 2W4PA 5BJRA 4I2PA 4IFVA 3DLKB 1KVKA 4NYOA 2YNIA 4C0BA 2VFVA 1SIZA 2ZUAA 2VV5A 1JLBA 1CJUA 2JHEA 3L7UA 4NZ6A 4Y2KA 3EWGA 3TRGA 2JEIA 1DAXA 4Q8EA 1M5KC 2XS5A 4PKDB 4TU8A 2JZ5A 1RABB 2V4JB 4OYBA 2YKNB 2J9EA 3GIMA 5F9LA 2AGQA 3JSYA 2ZITA 3T1HJ 2W9CB 2RUSA 4USIA 3OTEA 3WIUA 1W25A 2OPPA 2ZOGA 4ZVGA 2XMUA 5KFJA 4URSA 4DR2J 4RW4B 5DQGA 3V4IA 4OI1A 2R7XA 1TL3A 5E5NA 4ZPAA 3DRYA 1V3RA 1FVQA 2Z57B 3K5MA 1NPPA 1ZM3A 2BOPA 3HK2A 2DJWA 2BW7A 1VFJA 1HNIB 2OD4A 3H5SA 2IAJB 1QSSA 2DVIA 2L9DA 2N3LA 1F5AA 3KJFB 3KHRA 4HDGA 2FGOA 3H90A 1U8WA 5ETTA 1SKUB 1RT5B 3M4XA 1GXUA 1RTDA 1FHTA 1UMJA 3TZYA 1JLFB 2JNJA 1K9MT 4Q5VA 2RU9A 3KJVB 4ED1A 3PY8A 2Y1JA 2YNGB 3F73A 3MEGA 2I2YA 4C8YA 1IKVA 5KFUA 1D9FA 5J2PA 4TY9A 1S76D 2MKSA 4QWEA 3BF4A 4DR4J 3DGPB 1R8PA 1FJ7A 3I6PA 4B3MJ 2J9DE 2E29A 4C6AA 3ILLA 4MFBA 3CTRA 1NMEB 3PRDA 3M2UB 3KDNA 2PMZD 2M88A 2U1AA 3MOJB 6AT1B 2JH3A 1UVIA 1F3VA 4Q8FA 1N0VC 1FRKA 3DI6B 4I7FB 3RUBL 1H7WA 3R7BB 4X4OA 3U7JA 2J5AA 2HBZB 5ITHA 4LFCJ 1IBKJ 3CJ3A 2OIHA 2DNYA 1FWLA 3CE8A 5B0EA 4IFYB 3D7SB 2VONA 3G8QA 2DYAA 3VF0B 2QL7B 4I69A 1VRUB 3OFHA 1Y10A 2D7SA 2CAJA 4WCEQ 1PYSB 3MECB 2R7TA 1YITS 5EX3A 4WZMA 1IBCB 2YWFA 3MPDA 3CO9A 4M8LA 3PW4A 5K14B 5D4OA 3FJ2A 1S0VA 5U47A 4KIAA 1M0SA 4OX7A 4B02A 1X0FA 3C19A 1S6OA 2OH2A 3DXSX 4PABA 4GVBA 1N34J 4JUZA 1CJTB 1MN7A 1H38A 5KG2A 1JLAA 4H4OA 4KJIA 4RNOA 4KE5A 2K3IA 4PWWA 4CWBA 1ZZNA 1K0VA 2RT3A 2ASYA 1W2IA 4UT4A 2Q3PA 4RW6B 4UZBA 1RISA 3HULA 3BQ0A 2ZH3A 4C9DA 3F44A 2NZ4A 1KKHA 1U4BA 1VQ4S 3N6LA 3CNQP 2J7KA 3FBCA 4KGZB 4RBVA 1MWZA 1MWQA 1NM2A 1GAOA 1BWVA 2ZJQQ 4LF8F 2IFXA 1SI9A 3M9MB 3HKWA 1R8AA 2LDYA 1SQEA 2Y3YA 2QEXS 3DHXA 1PJ6A 4DS4A 4CLZA 2LQBA 2UXCJ 3MMJA 1F0XA 1TZ0A 1XIQA 1FRLA 3QATA 2QL9B 2GQCA 2MKCA 4FXDA 3TQEA 5B08A 2KYZA 3ZO7A 7FDRA 3K57A 4OHXA 3D67A 1RA6A 4KBIA 4JI4F 4EYHB 3T3FA 3IWNC 4C2MA 2O01C 5G4DA 4NLSA 2HNYA 3LOUA 4LSNA 1RTJA 4NA3A 4DL2A 2B7CB 2J8SA 2E5LF 5CH7B 2K2PA 2GQQA 4KPCA 4P74A 5C42A 4W98A 1IXKA 3DOKB 4KRWA 4ZOSA 4GO5X 3P49B 1VC5A 2Z8QA 2ZKTA 3TR5A 2VA3A 1ZOTA 1RTHB 4P71A 1HLWA 1NZAA 1QTMA 3J7ZT 2XMKA 4IDKA 3AOCA 3TA1A 4A47A 2D3OR 3FCVA 2ZBCA 3LH2S 5KFRA 4F04B 4ID5B 4Q0BB 4WXWA 3R27A 1FVSA 2ZNZA 2LMIA 3HSGA 2VG7A 3CCTA 1I3OB 1ZAWA 1YJRA 4F25A 1T94A 2RS8A 2I0XA 3CXCR 3LP1A 4LRBA 3AY0A 3IO1A 1Z1ZA 4USJC 2LQ9A 4CLWA 5KFPA 2RQMA 2D1CA 3PO4A 3GG0A 3UN3A 1WKJA 1URNA 3PR5B 4PXDA 3CD5A 1U1LA 1B70B 2VPXB 1MW7A 3K58A 3IWXA 3BDPA 1R0AA 1P6TA 3FSXA 1NDCA 4NLWA 2C3PA 4HACB 5GMEA 1HWJA 3EXYA 3ZNUA 3AA9A 4KHPF 1AB8A 1B0PA 4OHVA 1FKPB 2Y0BB 4YDDB 2EK6A 2UXDF 3FZBA 2R2TA 2AEJA 4ZVQB 1S6PA 4YS2A 2AD9A 5KOWA 5CYMA 3HT0A 3KNGA 2OEJA 2HBYB 3M8WA 3JS9A 4BWMA 2EFGA 5HANA 2JC0A 2WVEA 3C15A 3CCRS 2EC2A 4MIWA 5J2MA 2AKWB 4O3QA 3C14A 2APOA 3KFWX 4Z7CA 2QC3A 1HQEA 1VLYA 1V6HA 4NCGA 3OHBA 1DTTA 3FDSA 4OV1A 2BJ7A 3L4BC 2M3DA 4RX6A 1RKJA 1MNEA 3A8JA 3HFKA 2AYBA 1ZM4A 3RB0A 1NCLA 1ULRA 1Q82T 1S1XA 1VMBA 4ED8A 2X1BA 3UNGC 2V68A 2HFOA 2W7AA 4OYIA 2ACYA 1N8RT 1IBMF 4B9MA 1F5CA 3NY0A 1N56A 3BSNA 1UAWA 1B7YB 3NRBA 3OPKA 3M8RA 4EYIB 3UCGA 4NA1A 1F2GA 3IS9B 4I68A 3W2WA 2DNLA 4RW9B 1QE1B 2X3DA 4WFAQ 3OUYB 3GCWP 3TUZC 3G2XA 5B0CA 3RTVA 4I64A 2P5VA 3UO0A 2C2DA 3N01A 5DJBA 1S9EA 4X4TA 4LF4F 5A2QU 2AIRB 1SC1B 4PG6A 4HL9A 3J7Z5 4C7QA 4C4WA 2HNDA 2VODA 2DITA 3A8IA 4ANCA 3KKFA 2DNOA 3EGWB
chains in the Genus database with same CATH topology
4PYAA 2EEYA 1EKRA 1EKSA 3JQKA 3JQJA 2IIHA 4PYDA 2EKNA 3JQMA 4FDFA 2IDEA 2OHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PYA A;  2EEY A;  1EKR A;  1EKS A;  3JQK A;  3JQJ A;  2IIH A;  4PYD A;  2EKN A;  3JQM A;  4FDF A;  2IDE A;  2OHD A; 
#chains in the Genus database with same CATH topology
 4FS1 A;  2AWZ A;  2CDR B;  2WRM A;  5C25 A;  1HFE L;  4LF8 J;  3SV4 A;  4ZCL A;  2HMI B;  4M5K A;  1PKU A;  1WC6 A;  1XR5 A;  3JXO A;  2YWK A;  2VG5 A;  1U6F A;  4RNM A;  5J2Q B;  2RD5 C;  1YJV A;  1U1Q A;  1F60 B;  4ER8 A;  1EAR A;  4FYY B;  4YY3 F;  1YZ6 A;  1YQH A;  4DHV A;  2V8V A;  1M1K T;  2DGQ A;  4CLK A;  3V81 A;  2NYI A;  4JI4 J;  2D3Z A;  2D3O 1;  3MED B;  5IV3 A;  3CB4 A;  2QL5 B;  4YB1 P;  3HVR A;  4MK8 A;  2IM2 A;  3NAH A;  1V3S A;  3EVW A;  2EPI A;  3M7V A;  2IJN A;  2ROP A;  1OIA A;  1GEH A;  2A2D A;  1NO8 A;  4ZVF A;  4RUA A;  1SJ4 P;  3KLF A;  2E5J A;  2GW8 A;  4DXL A;  3H2V E;  1JXE A;  1VQS A;  5FII A;  1S57 A;  3EZO A;  3CJ4 A;  1U1K A;  1WTF A;  1NRK A;  1UWB A;  2XLJ A;  4WWS A;  1X4A A;  4ID8 A;  1H2U X;  4AQY F;  1RT1 B;  1JLE A;  2DXD A;  1NSQ A;  2VKZ G;  3AH6 A;  1RQ0 A;  3MMB B;  1GX6 A;  1TKD A;  4TU7 A;  3H4B A;  2FVR A;  1LWC A;  4XTT A;  1UA1 A;  3E51 A;  3R3T A;  1E6V B;  2ZD1 B;  2W1B A;  2RDJ A;  3MM7 B;  3OXG A;  2NXC A;  1AFJ A;  3AOA A;  4RJV A;  3DOM A;  1T05 A;  3QGG A;  5T14 A;  4A8Y A;  5IOL A;  4NLG A;  1RU2 A;  4JV5 F;  4CH7 A;  4A48 A;  2FVP A;  1HPZ A;  2HVD A;  2QTW A;  3KK3 B;  3LPY A;  5J2N B;  4LBP A;  1N88 A;  3BQ2 A;  4DV5 F;  2BKO A;  2DPI A;  4M5I A;  1VQY A;  4YQW A;  2HHH F;  5FDL A;  3U1N A;  5AT1 B;  4IUF A;  4ETX A;  1UTA A;  3MMA B;  4UQT A;  1VK8 A;  5LXY A;  4K4U A;  3QSI A;  4PXE A;  5GAG I;  3LP2 A;  2HSE B;  2CQ1 A;  2K1R A;  3O1L A;  4KHP J;  4AND A;  5HVG A;  3PJ9 A;  4DLE A;  4WK3 A;  2HHS A;  4CTA B;  3MPY A;  1BY9 A;  2UXD J;  2CPF A;  1HAR A;  3MGJ A;  2UUW A;  5KFW A;  4J9V A;  2LQ5 A;  3NBP A;  5D3G A;  4DFJ A;  4Y3C A;  2HS3 A;  1U1P A;  5KT4 A;  4Z2X A;  4AYB D;  2DY1 A;  1X60 A;  5IQQ A;  5KG7 A;  1RT2 A;  1JJ4 A;  5HQM A;  4IO9 Q;  2YKM A;  2RML A;  3LQV A;  4KB7 A;  2HNZ A;  4OYZ A;  4DZ6 A;  4M5D B;  1U26 A;  5L39 A;  4I0W A;  4DX5 A;  4I6W A;  2VB6 A;  1OWX A;  2BJ8 A;  2JWN A;  3OT9 A;  1OYD A;  1N52 B;  1LQ9 A;  2N82 B;  3H5U A;  1RAG B;  2QN6 B;  4LRF A;  4KO0 A;  5KFM A;  1WEL A;  4PEO A;  2XMV A;  3HHD A;  2KM8 B;  4Q2L A;  3G71 S;  1RAE B;  4J9U E;  2VG6 A;  3ZZ0 A;  2Z2Z A;  2GV1 A;  4FF2 A;  3OL6 A;  1IBM J;  4ZN3 A;  3KLG B;  2MJN A;  1UL3 A;  1XMO F;  2DNQ A;  1WKL A;  1WWH A;  4R5P B;  3NNA A;  1JKH B;  1U0H B;  2DNR A;  2CPY A;  3V6D A;  2FVS A;  3J80 U;  1KQG B;  5C5J A;  5SZT A;  3S8S A;  4LMZ A;  2R7V A;  4I67 A;  4WTY A;  4XDD A;  5DS7 A;  3TVY A;  4DL5 A;  3CME S;  3H7H B;  2H51 B;  2OTL S;  4LF4 J;  2OEL A;  2RDD A;  3G6E S;  1S9G B;  3FEX B;  3VWS A;  4ZLP A;  2W9B A;  4D3H A;  3OFF A;  3ENW A;  1EKS A;  1UJ4 A;  3QT5 A;  2V67 A;  2NLW A;  9ATC B;  1HI1 A;  2LYV A;  1YI2 S;  2YWE A;  4QIW D;  1ZET A;  5HQ8 A;  4OHY A;  1FDB A;  2X1A A;  2OTJ S;  2W2P P;  3VCD A;  1F1B B;  4YP3 A;  2KYX A;  1Y0H A;  1RHK B;  2PI4 A;  4YY3 J;  4CO5 A;  5CYQ B;  4O0N A;  5I3U A;  3A3P B;  2DGS A;  4TN2 A;  3EMT A;  1FDD A;  2XY5 A;  1QTN B;  4A8F A;  3MM8 B;  3ZFV A;  2IA6 A;  4PG5 A;  1ACM B;  2OPS A;  2J0W A;  4IYQ A;  3GFH A;  2DNH A;  3B4D A;  2E1C A;  4R8U B;  1TL7 A;  5DO2 A;  1VJW A;  2IBO A;  1AA1 B;  2CZ4 A;  3LAK A;  3HMJ G;  3SMZ A;  1XK8 A;  2CXE A;  2V69 A;  5AE1 A;  1ICE B;  1J5E F;  1RWU A;  4EBC A;  4AQY J;  3CDU A;  1F9H A;  2V8H A;  1N36 F;  4DV1 F;  2FC8 A;  2OEK A;  3FFI B;  2ROE A;  2HFN A;  1S99 A;  3VAG A;  2XZT B;  3G82 B;  2C2O B;  3SCI E;  1QM9 A;  2J0X A;  2M70 A;  1UJ6 A;  1LWF B;  4NPO A;  6FDR A;  4C3L A;  3AD7 C;  3PEJ A;  2PC6 A;  3BYR A;  4JV5 J;  5ETK A;  4WFN Q;  1NJX A;  3BGL A;  2WAQ D;  4JI6 F;  3IM9 A;  4UF4 A;  1X9M A;  2PT0 A;  4DV5 J;  2HLU A;  1TR0 A;  1LW2 B;  2LA6 A;  1VQ9 S;  1JXV A;  1U02 A;  2CDQ A;  2DHS A;  2HHH J;  1C1C A;  3DNC A;  3MAA B;  1ZPV A;  4I1T A;  2MLY A;  2HIQ A;  1SCJ B;  1WC0 A;  1TAQ A;  1NEE A;  1P1L A;  3TEG A;  4EO8 A;  2QLJ B;  5A2Q Y;  1J27 A;  5HO4 A;  1JJH A;  2CJY B;  3FSI A;  1HWK A;  2GO8 A;  4LFB F;  3KHG A;  1IR1 A;  2AMC B;  5HLF A;  2CG8 A;  4F02 A;  3GIL A;  5K9F A;  1Q53 A;  2BJ3 A;  1FFS B;  3BH6 B;  5G0R B;  2F4V F;  4K4Y A;  3IR7 B;  5B0B A;  4KSE B;  3SYZ A;  3CED A;  3I96 A;  4XAK A;  4AE5 A;  1BQM B;  2CFX A;  1UZH A;  2B6A A;  3BO4 A;  4DQQ A;  1KC8 T;  5KFD A;  3KHH A;  1XQI A;  3RBD A;  1FEH A;  4FBU A;  2E9R X;  4ZKA A;  4FVM A;  5HBM B;  3G9C A;  3BGR B;  1SH2 A;  2L3M A;  5B0A A;  1Q5Y A;  3HSJ A;  1UJ5 A;  4LF1 A;  1M90 T;  4IQM A;  2RU3 A;  3DM2 B;  1U1O A;  3IWL A;  5B0D A;  1EQ0 A;  4TLR A;  1X9S A;  1YKW A;  1SXL A;  2B5J B;  2ASD A;  4URG A;  2XZD B;  2XMA A;  2NXU A;  4MKY A;  2VBZ A;  2Y9H A;  5LJ3 Y;  1SH0 A;  1XMO J;  2CAD A;  3ET6 A;  3MM5 B;  4TYA A;  3CD0 A;  5AXN A;  4QWC A;  4USH A;  3BKT A;  1BQN A;  3DRR B;  3EGZ A;  2DH9 A;  1CUL A;  4RPF A;  2OP5 A;  1U2C A;  3D0I E;  2E7X A;  3I4P A;  3NL0 A;  3BGO P;  3MUM P;  3QRR A;  2X1G A;  2XSJ A;  2XI3 A;  2ADB A;  3D4J A;  2MKK A;  2KXH A;  3T9N A;  4O3N A;  2VPZ B;  1SKW A;  2LU2 A;  5AXL A;  2JDJ A;  3HLU A;  2H54 B;  4OYX A;  2DT9 A;  3JYT A;  4OZ2 A;  4QYZ K;  2KTQ A;  2XGQ A;  3LO3 A;  3N5F A;  2EKN A;  3NP5 A;  4DSF A;  1XER A;  4U7U K;  3TA2 A;  1WUU A;  2HFS A;  1C0U A;  2IJR A;  3TJ9 A;  2QFI A;  5B09 A;  2BA9 A;  1DRZ A;  4HI1 A;  4B17 A;  4WKR A;  1NSA A;  2JFD A;  4QR0 A;  5EGY A;  2C2K B;  1HBU B;  4LRA A;  4DPW A;  1YJ9 S;  3L9Z A;  3KLI B;  1WSR A;  5DDQ C;  2BJ1 A;  4V1A k;  3ETM A;  1H6K X;  3KK2 A;  2GVZ A;  1Z4U A;  4PRF A;  4XPE A;  3K8W A;  3JTP A;  1QVG R;  2NSC A;  1HBN A;  2C3O A;  3UCU P;  2YKQ A;  3ZZZ A;  1TKT A;  4P52 A;  1RI7 A;  3AQP A;  2VKR A;  3S1T A;  4EEY A;  2ABY A;  2RAQ A;  1J5E J;  2CQD A;  3SDE A;  1LKZ A;  2CQ2 A;  1W26 A;  2E1R A;  5EWF A;  1UVM A;  4ICL A;  1T02 A;  4CLT A;  1N36 J;  3QT8 A;  2VJU A;  1WF0 A;  1KOH A;  1QAJ A;  1UZD A;  3VGT A;  2VFU A;  5DZ7 A;  1NDL A;  3Q8Y A;  5KFB A;  1DUR A;  3DU5 A;  2N4C A;  1U48 A;  2CRL A;  4KGX B;  3PM9 A;  1HBM A;  5F0W A;  2BE2 A;  3IGN A;  4A8K A;  3ILJ A;  1RWN B;  1D1U A;  5DM6 Q;  4ZHR A;  3F56 A;  4HHH A;  3M9N B;  3QJP A;  2BM0 A;  2WK4 A;  4JI6 J;  2YKN A;  3R5G A;  4FNH A;  4TXS A;  4XK8 C;  4C3M A;  1Q16 B;  3J80 Y;  4U8V A;  4EZ6 A;  3CJ0 A;  1YWX A;  2COL A;  4QBU A;  5E2Q A;  3OW2 R;  3JTN A;  1FA0 A;  3Q2S C;  1HYS B;  2OPQ A;  3OL8 A;  5KFN A;  5CCM A;  3AJ2 A;  3G8S A;  3FK4 A;  3S7R A;  3JAM U;  3ZTP A;  4F2R A;  2MQM A;  2XNR A;  1ZA1 B;  3GR0 A;  2EFN A;  2HFU A;  4LFB J;  1CC8 A;  2DCL A;  2PEB A;  3MAH A;  1Q81 T;  2MLZ A;  2R8I A;  2EG1 A;  2VAS A;  3JSR A;  4FN5 A;  1G4C A;  1T3N A;  3OXL A;  5KFH A;  2N7Y A;  2YQ3 A;  1CBK A;  4KH0 B;  1O51 A;  5HVF A;  3WHI A;  3TP2 A;  2F4V J;  1RT5 A;  1X31 C;  5KFA A;  1JWW A;  4ZK7 M;  2XQC A;  4FXV A;  2B9E A;  3E2E A;  1HW9 A;  2PD1 A;  3AHP A;  1T9V A;  4ECV A;  3KJV A;  3DFE A;  4PXB A;  2HBR B;  5KT2 A;  4F4Y A;  2OEM A;  2YNG A;  2ASJ A;  3M8P A;  4X66 F;  5L1J A;  1CJK B;  1M5S A;  3HZG A;  2WTF A;  1S6Q A;  4J9L A;  4DR7 F;  3V4M A;  4RW8 B;  4QPX A;  2DNG A;  2GJF A;  1X8D A;  4HT7 A;  4RBT A;  1KLM B;  2PN6 A;  3IRW P;  1QY7 A;  1H0H B;  2A0F B;  1SVD A;  4N76 A;  1K1Q A;  4ES1 A;  2HHU A;  3M30 A;  3NOC A;  4ZCK A;  5CA5 A;  2CQP A;  4DN9 A;  3ADA C;  4X4P A;  1LXJ A;  5AJ3 F;  3GP9 A;  4DN0 A;  3GJQ B;  4X4N A;  1YK9 A;  3UDC A;  4LF6 F;  3UWT A;  2ZKU A;  3CJT A;  1TAU A;  4IFY A;  3PAC A;  3TAP A;  1GMV A;  1T8E A;  2FVQ A;  4RWW A;  4MMO A;  5IT4 A;  2ROG A;  3VQS A;  1NJW A;  3CDE A;  1CQM A;  1HHS A;  4A8X A;  5K14 A;  3HHL D;  2BRL A;  3EZ5 A;  3EDR B;  2R7Q A;  4URQ U;  2EFQ A;  2MZS A;  1KQS R;  3JQK A;  4CIO A;  1CJV A;  2D74 B;  1BLU A;  2DHX A;  3HVW A;  2XNQ A;  4OX6 A;  3DRS B;  3NNC A;  1CEZ A;  3PYF A;  2CJK A;  1HNX F;  2AJ0 A;  1FI4 A;  1JQG A;  3DLJ A;  3SFG A;  3SSR A;  2CVE A;  2MQP A;  2YY3 A;  2W2Q P;  3LA0 A;  2QV6 A;  3BR9 A;  1SV5 B;  4C8L A;  5IT9 U;  4OJG A;  3TAN A;  2AX0 A;  2FDN A;  2HLT A;  2YQ1 A;  4QYR A;  3C6U B;  4ED6 A;  2WOM A;  2YNH A;  4RW6 A;  4P2X A;  3BM7 A;  1CS4 A;  4XDC A;  3I0S A;  2KRR A;  4DQP A;  1JIH A;  3Q2T C;  4JI2 F;  3X3U A;  4ED2 A;  5C2C A;  2Q43 A;  2ZJP Q;  2KKH A;  4N41 A;  4Y00 A;  5F0U A;  3HO1 A;  3BBC A;  4YEA A;  2NR0 A;  1HQU A;  1RTI B;  4I4B A;  2XS7 A;  4KFB A;  2XCP A;  2DCU B;  1G6B A;  4ZCI A;  2R7R A;  1L3K A;  3WC0 A;  4WYW A;  3SCK E;  2VJV A;  3K17 A;  4NXN F;  5GAG U;  4HT5 A;  2BAN B;  3AOD A;  4LT6 A;  2ZVI A;  3FQK A;  4QOT A;  4ELT A;  1SKR A;  3ILO A;  1RWV B;  3IR6 B;  4RW7 B;  3G86 A;  1D3W A;  2BJE A;  3DLG A;  2BR0 A;  5E3P A;  2R8G A;  3R5C A;  2NYH A;  3D1O A;  3E3X A;  2XMJ A;  4O3O A;  2JLF A;  2OSR A;  2EC0 A;  3KLV A;  4ALZ A;  1PIE A;  4ZIT A;  1S6U A;  1AUS L;  4L6V 3;  1ZPW X;  2M9K A;  5HMZ A;  1ELO A;  4X65 F;  2LP4 A;  4TQR A;  1XR6 A;  3ZXW A;  4CH1 A;  2FJX A;  3VAI A;  3GV8 B;  2P6T A;  3JQJ A;  1I51 B;  3OSP A;  2I5J B;  1O0P A;  5DLF A;  3IBC B;  5HAT A;  3DYA B;  2E7W A;  3RAM A;  1WC1 A;  4DS5 A;  1UCN A;  1ZM9 A;  4MK9 A;  1P8G A;  2Z2M A;  4DI6 A;  5J1P A;  1UFK A;  4FP9 A;  3BBF A;  4UW2 A;  2WW4 A;  4P2M A;  3NMR A;  1NUE A;  1R6Y A;  5EN1 A;  4O0I A;  3MEE B;  1VHI A;  2BAC A;  1P9Q C;  4ID5 A;  2H4W B;  2UVW A;  3IN5 A;  1RT7 B;  4C8O A;  4OHZ A;  3FSY A;  4IRC A;  4O23 A;  2NSB A;  1DLO B;  1OSD A;  4LJM A;  2FPH X;  5IV4 A;  1NH8 A;  1SL2 A;  2IVM A;  3U27 A;  3KOA A;  4X4S A;  4IOA Q;  1M1H A;  4LR9 A;  2QMX A;  1DY3 A;  1A6L A;  1HNW F;  4OHW A;  1PJ7 A;  1GMW D;  4DR7 J;  4KGK A;  3VAH A;  2QFJ A;  3TI0 A;  5KOX A;  3C66 A;  5HQL A;  2HW3 A;  1VC6 A;  4J9R A;  4ZJQ A;  4OYO A;  4JI1 F;  3MPU B;  4TY8 A;  3SBM A;  3KNA A;  2V34 A;  1FKP A;  3C2P A;  4F8R A;  3BN4 A;  2H3E B;  5I3P A;  2MQO A;  5KAK A;  2AW0 A;  3LW5 C;  2HK2 A;  3OJU A;  3SQG B;  2PII A;  2KG1 A;  1MU2 A;  5AJ3 J;  4PQU A;  4LSZ B;  1RT3 A;  4LF6 J;  3G87 A;  5EDW A;  1REV A;  3SCJ E;  2XLI A;  1T95 A;  4OLO A;  2XYP B;  2DH8 A;  5C24 A;  2YNF A;  3GYG A;  3I5B A;  1S9F A;  5A8W B;  3IG1 B;  1JJ2 R;  4FBT A;  2F9D A;  4OYW A;  1HHQ A;  2W25 A;  1YJT A;  2W2O P;  2ZH2 A;  2OLW A;  3F41 A;  3FUY A;  2V63 A;  4IG3 B;  2ZBP A;  1SL0 A;  3VZI A;  5A8R A;  4GKJ F;  3DCA A;  1HNX J;  3E01 B;  2HQI A;  1C0T B;  4ECZ A;  3TUJ C;  4P6Q A;  4YR0 A;  2DY9 A;  3CDB A;  4A8W A;  2KZM A;  2ZH4 A;  3J7Y I;  1WOS A;  2VU5 A;  4F2S A;  3JAM Y;  2CQ0 A;  4DZD A;  4GC6 A;  2ZH9 A;  1QE1 A;  4J9Q A;  1DHM A;  3QIP B;  3QPI A;  2QLX A;  2KT5 A;  5L8R C;  1QUP A;  4LBI A;  3OUY A;  2YX4 A;  1ZA2 B;  1RAD B;  4IFV B;  2LDI A;  4LR8 A;  4E2F B;  1CJU B;  2CNK B;  4B3O B;  3Q89 A;  4JI2 J;  1UPM B;  3FC9 A;  3BKU A;  3DRX A;  4ZVU B;  2LKZ A;  3HI9 A;  4C8N A;  4BLG A;  1V5I B;  3UDE A;  3NWR A;  2IY5 B;  2GIF A;  1BXN A;  4CI0 B;  2R9L A;  2OPP B;  3RGI A;  1U1R A;  2R8K A;  5J1N A;  2HMI A;  4ZLL A;  3OLB A;  4FPR A;  1J2V A;  4NXN J;  3V4I B;  1WSV A;  4M5J A;  2MZQ A;  1S1V B;  3H8Y A;  4K4S A;  5J2Q A;  3MPV A;  3CF5 Q;  4EU0 A;  4WFY A;  1QJH A;  3PVX A;  1RDR A;  2VQF F;  4OLP A;  3CCS S;  5FLX Y;  2ZH7 A;  1SH3 A;  3UD4 P;  1NKE A;  2EVZ A;  1YG0 A;  1UVK A;  2J6S A;  1O5J A;  1C2P A;  2VZ9 A;  1SC4 B;  2JLG A;  4M95 A;  3BGF A;  2J6U A;  4K4Z A;  5KFZ A;  1OY8 A;  4X65 J;  4MH8 A;  3OR1 A;  4ED5 A;  1VRT A;  4ECY A;  2ZUG A;  4PCQ A;  4DQS A;  3GSD A;  3MEG B;  1MLA A;  3OSN A;  1IKV B;  2K8G A;  2MQN A;  4W92 B;  5J2P B;  1HWU A;  1EET B;  1VQL S;  2Y1I A;  3GYN A;  3PZP A;  2KM8 C;  3LPE A;  1RT1 A;  4ECR A;  4DUT A;  1FE4 A;  4MFB B;  3K0J A;  1CLF A;  4ZVT B;  4C11 B;  5JUM A;  3MMC B;  1YBA A;  3BS9 A;  2HFZ A;  1ZYQ A;  1YRX A;  4PUO A;  3PX0 A;  4QWB A;  8RUC A;  3ZZP A;  4DPX A;  3MM7 A;  2AEF A;  4Q7A A;  3PDN A;  4I2Q A;  2VPW B;  4WFZ A;  1IKY B;  4NXM F;  4L75 A;  2Y0S D;  3MUT P;  2DR8 A;  3R5A A;  2NUH A;  2G9O A;  1VRQ C;  2FLO A;  1XC9 A;  1FXL A;  1HBO B;  5ETP A;  4MKV A;  5J2N A;  1FTC A;  1ZAX A;  2VQE F;  3PEH A;  1RA7 A;  3TAM B;  1NJY A;  2XYG B;  3LAL A;  1LW0 A;  1HNZ F;  2VIC A;  1HNW J;  1N6Q A;  5AXM A;  3B6B A;  1S4E A;  1WEX A;  1NK7 A;  1GK8 A;  3W60 A;  5I4M A;  2AV5 A;  2VBY A;  4JV1 A;  5GAD I;  3Q22 A;  2CQG A;  3R7S B;  1F3F A;  1GFW B;  2MHN A;  3THP A;  4JI1 J;  1FO1 A;  4X84 A;  1S0M A;  2AYE A;  2F40 A;  1L3U A;  2I6W A;  1TL1 A;  4CTA A;  3NXZ A;  1I6J A;  4IG0 A;  1VLO A;  4GVB B;  4N7T A;  2YX1 A;  1FRX A;  2BX6 A;  3S6E A;  1SKS A;  1K44 A;  1K1S A;  3M6W A;  2EBE A;  2XUL A;  3U02 A;  4TQS A;  2E9Z A;  4ZA1 A;  3I82 A;  3BO3 A;  2EFV A;  1R31 A;  1GQE A;  3MR2 A;  2ILY A;  1B64 A;  2WSC C;  5H9F K;  3VVT A;  2PFD A;  4KKO A;  3VGU A;  4KYZ A;  2FD2 A;  3DLL Q;  1M1G A;  3R1L A;  4DU7 A;  1VI7 A;  2CJQ A;  2O3D A;  4WKY A;  1PJ5 A;  2RVJ A;  2OMO A;  1KFS A;  3MR5 A;  3D6H B;  2JOQ A;  4J37 A;  4XIU A;  2ZHO A;  4DV7 F;  3W9J A;  4KTQ A;  1Z2Z A;  4DR5 F;  4U8Y A;  3C46 A;  1YJN S;  3HHL B;  2ZDP A;  1B0V A;  5HMW A;  2X3G A;  3KLG A;  2W7O A;  4GKJ J;  4NLP A;  4ZVR B;  1FEE A;  3C6T A;  4ZJO A;  5A76 A;  1U0H A;  3R97 A;  2HQG A;  2GJI A;  2DEI A;  1IQT A;  3KG0 A;  2IYI A;  2J6T A;  3TJ8 A;  2EFO A;  1A9N B;  2UP1 A;  3BH7 B;  2WSE C;  4GMK A;  2ZNY A;  3L3C A;  2FHJ D;  2LEC A;  2ZBI A;  3KUG A;  3ZZU A;  3MXH P;  2PE8 A;  2HNY B;  3GIJ A;  3FQL A;  4LSN B;  1RTJ B;  4ELV A;  2H48 B;  2AZ3 A;  5C42 B;  3TUI C;  3I9V 9;  2JEF A;  1UVL A;  1VDH A;  2ALZ A;  3QGP A;  5D6G A;  1ITP A;  1KNZ A;  3RRG A;  1Q78 A;  5IT0 A;  1AYE A;  2G0I A;  1J5O A;  4CH0 S;  4MYU A;  4HEA 9;  3TX0 A;  3IAS 9;  2GAH C;  3KLH B;  3US5 A;  4R0E A;  1F9F A;  4IDK B;  4F3Q A;  4J9P A;  1GMU A;  1FWP A;  3UFC X;  5CZV A;  4MKB A;  1SBR A;  2VQF J;  5JVG Q;  2GFF A;  4LBH A;  4RZR A;  1RYS A;  2VG7 B;  2G1D A;  5F9N A;  4F50 A;  1SQG A;  3BR8 A;  2DR9 A;  3W3S A;  2XY7 A;  3D3B J;  3QAE A;  3BQ1 A;  2OUG A;  2V0N A;  2NCK L;  3FCH A;  2B7B B;  1I1G A;  3PO5 A;  1MRO B;  4NX9 A;  4QW8 A;  4CQ1 A;  4R8U A;  1KVI A;  3QO9 B;  1OJ4 A;  3CJS A;  5CD4 H;  4NMX A;  3P6Y C;  2C28 A;  4CM2 A;  2H5E A;  4OX8 A;  1UEK A;  4FKY A;  2CPZ A;  5KG1 A;  1RAC B;  4B9V A;  4DPT A;  5KG3 A;  5D4L A;  2CZV C;  2Q1L A;  4J9M A;  4Y2C A;  1BD6 A;  5KFT A;  2W8L A;  2JRS A;  2C2E A;  4USM A;  1K73 T;  1WDT A;  2BAB A;  5D0E A;  5CD4 A;  3FFI A;  5E7O B;  4K5S A;  1S6P B;  1PCA A;  5ETS A;  3GIR A;  2VF3 A;  5CYM B;  3G82 A;  4ZCM A;  4WII A;  2QX0 A;  2RIJ A;  1LOU A;  4EFA C;  4RUB A;  2JL9 A;  4F36 A;  1F6T A;  2KT2 A;  3C15 B;  1BE4 A;  5J2M B;  4NXM J;  4FF1 A;  4ES2 A;  4HH0 A;  4DFM A;  1FK9 A;  4ZLJ A;  1PG5 B;  2J76 E;  3OVA A;  1HQE B;  5IM0 A;  4NCG B;  2FZC B;  2R8J A;  3P4U B;  4RWX A;  2VQE J;  3MEK A;  2RRB A;  1HNZ J;  2HGL A;  5JXS A;  1CPZ A;  5CQG A;  4DF8 A;  3DOL A;  2KH9 A;  4HDH A;  1U24 A;  3W5X A;  3T5J A;  5LJ5 Y;  2B8Q A;  2GIR A;  5KFK A;  5L9X A;  1OY6 A;  4WP9 A;  3PR4 A;  2HZA A;  3TW0 A;  1JJC B;  3NGK A;  5LM7 E;  1HNV A;  1C1B B;  3NCP A;  4I56 A;  2DRB A;  2NPI A;  3CJR A;  3OTO F;  4NML A;  4DX6 A;  1KTV A;  5IXU A;  2ZH8 A;  3M8Q A;  3J81 U;  5ETQ A;  1DQA A;  4A8S A;  1MSW D;  4OZL A;  1S7I A;  5I42 A;  1S5Z A;  2IVF B;  1S9E B;  4F0H A;  3K8V A;  1ZH5 A;  2XEX A;  5KFI A;  3TUP A;  4NLT A;  3N6N A;  2OJ3 A;  4B08 A;  1FER A;  1D8Y A;  4NWB A;  3FRY A;  2HND B;  3HJV A;  3MTJ A;  1IVZ A;  4ILL A;  2YBV A;  4ZMM A;  3DM2 A;  4NLO A;  5HRO A;  1RAA B;  2QLF B;  4DV7 J;  2B5J A;  2UV8 G;  3O5T B;  5C25 B;  4QIV A;  5GAH I;  2RRN A;  2HQD A;  4N8N A;  2M8H A;  1NPR A;  4ZDN A;  2VG5 B;  3EZU A;  1X5O A;  4L72 B;  4WJB A;  1VBK A;  1OPI A;  5EX0 A;  1UEV A;  3H20 A;  4OI0 A;  4IH6 A;  2H5J B;  1YBT A;  1SC3 B;  2BVZ A;  3V81 B;  5F8H A;  4KGM A;  3FNN A;  3PX4 A;  1L5U A;  5F8G A;  5HP1 A;  4PWD A;  1NHU A;  3RW7 A;  4CO4 A;  1RHU B;  3M6X A;  2YPZ A;  3DDK A;  5FJ4 A;  1WAC A;  2Z0G A;  4BBY A;  2F63 A;  1CC7 A;  2KB2 A;  3GE9 A;  2HWT A;  3NGT A;  4RL1 A;  3M32 A;  1NHV A;  3KLF B;  4ZP7 A;  1TMJ A;  3PFE A;  5F8M A;  2QSF A;  3QT6 A;  4A8O A;  3MTK A;  4JOU A;  4LF9 F;  3R6G B;  4CP5 A;  4DR6 F;  2ZHB A;  3C16 A;  2IRU A;  3HVA A;  4B9L A;  4Y6I A;  1UWB B;  3T1A A;  3MZI A;  3K5O A;  1RAF B;  2KFN A;  2AYM A;  3JSM A;  3QNW B;  1X4F A;  1S0O A;  3KK1 A;  4FZV A;  2BQR A;  3VV2 B;  1WF2 A;  3A12 A;  1DTQ A;  4DV3 F;  4NLR A;  1D0E A;  4NLY A;  4ATN A;  2MXY A;  4LRC A;  2BUN A;  2L48 A;  3BGU A;  1LWC B;  2HRU A;  5DG8 A;  1E6Y B;  5L9N A;  1MWY A;  3QFH A;  3HP6 A;  2B3T B;  2YTC A;  1FX4 A;  2HQ3 A;  5L1K A;  1T05 B;  3N9U C;  3OTB A;  4J9S A;  1U45 A;  1FTR A;  1HPZ B;  2HFV A;  2AYG A;  2OKQ A;  4WTO B;  5SUH A;  5HL7 Q;  3N79 A;  2MZ1 A;  4Y28 C;  3KTQ A;  4UZC A;  3L7O A;  2C2Z B;  2C3M A;  5LSR A;  1NJI T;  5FDL B;  2IDE A;  1RHR B;  3B8H A;  4K2X A;  4UOG A;  3FEZ A;  2UV8 A;  4ETZ A;  1KTQ A;  1D09 B;  3TO8 A;  2K3K A;  1HMV A;  2ASL A;  2RF2 A;  2DGU A;  3P3D A;  2HHV A;  1RJJ A;  2W24 A;  3LP2 B;  5BR8 F;  3B54 A;  3R9L A;  2F5G A;  2LEA A;  2K1R B;  1IKW A;  2R7U A;  3HCX A;  4NYP A;  1D9A A;  1IR2 A;  4CNZ A;  4LFA F;  4OZ0 A;  2KN4 A;  4KV8 B;  2LEB A;  3X1L B;  1RHQ B;  1UWA A;  4TYB A;  4DFP A;  4OYM A;  2KJV A;  5DDR C;  1FKO B;  3E8O A;  4NZ0 A;  4F4W A;  3FBF A;  4KPY A;  4XO0 A;  4CLL A;  5D3G B;  2BBE A;  3GIK A;  4WE1 A;  4M5N A;  2NPF A;  1N33 F;  4K4W A;  2Z2L A;  1TK8 A;  1APS A;  1KD1 T;  2AEM A;  3D6T B;  1BMQ B;  4L3K A;  2YKM B;  3VAJ A;  3BYP A;  1FRJ A;  3Q0A A;  1YVF A;  5LOQ A;  3VZH A;  3PHE A;  3V6J A;  1NK8 A;  2B9X A;  2HHP A;  1UP1 A;  5E3R A;  1WC3 A;  1Q8L A;  2X7I A;  3MFH A;  3ICL A;  2XTJ P;  3R5B A;  2JJ4 D;  2ATL A;  2F65 A;  2HBQ B;  2OFH X;  4IQX A;  1KR4 A;  4DUZ F;  1DQ8 A;  3KJQ B;  2UUA F;  2VG6 B;  4DX8 H;  2AHO B;  3O6Q A;  5D0H A;  5H9E J;  2PFF B;  3M05 A;  3W8P A;  4B9S A;  1W2B R;  1NU4 A;  3AB4 B;  4DL3 A;  1TL5 A;  4DWI A;  3J7Y U;  2RHQ B;  3NLC A;  2FGC A;  3VQT A;  3TA0 A;  1HWL A;  3QQC D;  3V6D B;  3OTO J;  4DV4 F;  1UPP A;  3TAR A;  1T03 B;  1NDP A;  3KG4 A;  4YB5 A;  2DIV A;  2ZC3 A;  1GTH A;  3Q8U A;  5A0Y A;  1EIY B;  2ZH5 A;  1CJK A;  4J90 A;  2LA4 A;  1U25 A;  4DR1 F;  2IC3 A;  4CO3 A;  4LF2 A;  4RNH A;  3RB3 A;  1KS2 A;  5HK4 A;  3MM9 A;  1ZS6 A;  5EUH A;  3FBB A;  4U7U D;  2J7U A;  2ZE2 A;  2VOP A;  2QG9 B;  2V2V A;  3DU6 A;  2W9B B;  1H7X A;  3ITH A;  2DH7 A;  3CJ8 A;  2Y8Y A;  2KL8 A;  2AF6 A;  3HJF A;  4ED0 A;  3QZ8 A;  4OFZ A;  2OPR A;  4KT0 C;  3EJM A;  1XBW A;  1RU1 A;  3LWL A;  4O4R A;  4OZ3 A;  4ED4 A;  1YHQ S;  5DLG A;  2OD6 A;  5D0R A;  3P5T L;  1ZTW A;  3PW5 A;  5L38 A;  4EBE A;  4OYA A;  3CJK B;  2EKY A;  1T0T V;  4CLP A;  2E66 A;  4CDI A;  3IBF B;  5A6W A;  1VBY A;  1T11 A;  1TK5 A;  4DL7 A;  2WON A;  1T9Y A;  2B9W A;  2J0S D;  1RAI B;  2P9C A;  5T7L A;  2P9G A;  4KGV B;  2RB7 A;  3GSI A;  2RQC A;  3CO0 P;  4WP8 A;  4H4M A;  1RWK B;  5D0G A;  2K7K A;  3DRS A;  3UCZ P;  2MB0 B;  4LF9 J;  3AXM A;  4IRD A;  2HGN A;  4DR6 J;  2C2N A;  5HAO A;  3SIP B;  4DSK A;  4LRE A;  1RLD A;  4Y65 A;  2ZFH A;  3KLE A;  1YJ7 A;  2WHO A;  4O4G A;  1JX4 A;  1O8B A;  2KXF A;  2MY7 A;  4DV3 J;  5J1E A;  3IBW A;  3MD1 A;  1R0B G;  2E5H A;  3M2R A;  4DPU A;  1VQM S;  4Z7Y A;  1DQ9 A;  4EI2 A;  4L73 A;  1EP4 A;  4QR2 A;  1S72 S;  4N5S A;  1B7F A;  3HX9 A;  4EZ9 A;  2BM1 A;  4CM0 A;  1WEZ A;  3EYZ A;  3EX7 B;  3OL7 A;  2R7S A;  3J81 Y;  1RTI A;  1RT4 A;  3D28 A;  5HJX A;  3T1H F;  3GR1 A;  3OR2 A;  2CNN B;  3K5N A;  1C1C B;  5IWA F;  5E41 A;  3EPG A;  4G3I A;  2M8D B;  5GAD U;  1TL4 A;  2VPY B;  4A8Q A;  3TVK A;  4ECQ A;  1I94 F;  3D1H A;  2P2C B;  4RO0 A;  4ZP9 A;  2E5L J;  4RR5 A;  4G6V B;  5BR8 J;  2XYH B;  4MK7 A;  2DEJ A;  1IWA A;  1QD1 A;  4GVL A;  3VHQ A;  5HLF B;  2XWY A;  1EKR A;  3NOG A;  4LFA J;  3UPF A;  4Z37 A;  4LIW A;  3SSS A;  2ZC4 A;  3W5Z A;  3T41 A;  3A8K A;  1AZS A;  1HR0 F;  1RTZ A;  4HHU A;  3ENQ A;  1TV6 B;  4P2S A;  1JLC A;  1N33 J;  1UVJ A;  3D54 A;  1T7P A;  3OTD A;  3GB0 A;  1ZM2 A;  1A7G E;  2DBB A;  1REG X;  3NMA A;  3D68 A;  2B6A B;  1YRU A;  1YZ7 A;  1B0T A;  2VH7 A;  1RHJ B;  4AL5 A;  2ALY B;  2B4P A;  1RE1 B;  2KJW A;  2Z56 B;  2IIH A;  3DYA A;  1UET A;  1LWE B;  3QGI A;  4MIB A;  2F7V A;  2CQI A;  4QJV A;  2MEW A;  3NEK A;  4CO1 A;  4UTG A;  1LXN A;  1X4G A;  2BJ9 A;  4F4K A;  3I5A A;  1YIJ S;  3OHA A;  3MR3 A;  3CMQ A;  4OZ5 A;  4DUZ J;  3VTI A;  3HDS A;  3JQM A;  1GH8 A;  2HS4 A;  2UUA J;  2EBG A;  2FZG B;  2E1M C;  2MQL A;  2UVR A;  1U7L A;  3ET6 B;  4DL4 A;  2FHK A;  3O8W A;  1BQN B;  1Y9O A;  1NKB A;  1CUL B;  4C3K A;  4DV4 J;  5ETV A;  5CYJ A;  3DDN A;  4RUC A;  4K4T A;  4P75 A;  5JMN A;  2FHO B;  3MHY A;  4LF5 F;  3M2V A;  4QIE A;  2N7C A;  2GGP B;  1ARO P;  2MTL A;  3GLJ A;  2NUU G;  4DR1 J;  2IVY A;  2EK1 A;  2KG0 A;  2XSJ B;  3AJD A;  1XNQ F;  1YDL A;  2HPU A;  4MIA A;  4M63 A;  1WOR A;  1VQ6 S;  3UVJ A;  4F4X A;  3LWM A;  3DMJ A;  5KFL A;  3U1M A;  3Q8R B;  2B8P A;  4EMD A;  2DNP A;  3HVT A;  3UN2 A;  2I1R A;  3BSA A;  2MZR A;  4USV A;  1LV5 A;  3BEG B;  3WIV A;  2DK2 A;  2WCX A;  4TU9 A;  1HD0 A;  3M6V A;  2C2R A;  5BYQ A;  1WI8 A;  1SJF A;  1CSJ A;  1C0U B;  3CCV S;  3JB9 k;  4OI4 A;  3Q24 A;  4DX7 A;  1RP5 A;  2IYG A;  5M2P A;  2L9W A;  2V9K A;  3RRH A;  3IG1 A;  4RUH A;  1T9W A;  2ZJR Q;  3GWC A;  4J7C A;  3CW2 C;  1TUW A;  4MKA A;  4DCJ B;  2YKP A;  1Y5I B;  3SQO P;  3L7P A;  4JI5 F;  3KK2 B;  1S4F A;  1NAQ A;  4RBU A;  3N28 A;  4OQJ A;  2IRY A;  1HBN B;  2FJE B;  2I8E A;  4ZS6 A;  2CYY A;  1TKT B;  1HHT P;  3IRX A;  3VAK A;  2CPX A;  2AT1 B;  3M1V A;  1X5P A;  3MR6 A;  4OI3 A;  1U1N A;  3E01 A;  4NEZ A;  1PIL A;  4QWD A;  3IR5 B;  3EM1 A;  3AXK A;  4OJ3 A;  3SDE B;  3POT A;  1SB6 A;  1TVR B;  3CVK A;  4ICL B;  2W01 A;  5KG6 A;  3I0R B;  1IQZ A;  1VS3 A;  3UD3 P;  3QMQ A;  5KT7 A;  2IA0 A;  1BUX A;  3BPS P;  2M7S A;  5DQI A;  1GX5 A;  1S1W A;  1RWM B;  1X4E A;  3RAX A;  2PO4 A;  2L41 A;  2V94 A;  3PRV A;  4B3O A;  3FZ2 A;  4NLX A;  1NHK L;  1HBM B;  2H9Z A;  2WZ1 A;  2BE2 B;  5DGB A;  4RKU C;  4ZPD A;  5F8L A;  4P7V A;  4ZHR B;  4CNY A;  2GC8 A;  3EGN A;  3LAM A;  2GVD B;  4E98 A;  2GMH A;  2MDA A;  2QMW A;  2HKE A;  2Z58 B;  5GMK a;  1LK7 A;  3J7A N;  2ZEJ A;  2J7W A;  4DCO B;  1YGY A;  5LMN F;  1VCT A;  2OPQ B;  3FKB A;  5IWA J;  2GHW A;  5K20 B;  5GAE I;  3BZQ A;  1NND A;  1I94 J;  4P7T A;  2CG4 A;  3KYL A;  1S1V A;  4P10 A;  4FF3 A;  1FNM A;  1WHV A;  4G1Q B;  2UU9 F;  5F41 A;  1TP7 A;  2CA9 A;  3OXF A;  3Q83 A;  1HL6 A;  2GHV C;  2RHS B;  2WVF A;  4MJK A;  1MMN A;  4HLB A;  2ZWP A;  2CQ4 A;  2C3Y A;  3AFG A;  4HTI A;  4NI2 B;  2HVI A;  2BQU A;  1HR0 J;  2AX1 A;  4AT1 B;  2JEG A;  4QIG A;  4OX9 F;  4B9T A;  4DF4 A;  1HQ2 A;  2VOO A;  2BMB A;  1FRM A;  2ZHA A;  4V19 X;  2WB4 A;  4IH7 A;  4B3T F;  4MT1 A;  3D9B A;  3M8P B;  5KG0 A;  2XO6 A;  1S6Q B;  4P2F A;  3QFW A;  3D0G E;  2RKI A;  4TLQ A;  2EFP A;  4KY3 A;  4W4M A;  1EET A;  1NPK A;  4F0M A;  1N54 B;  2OI2 A;  4RNN A;  5E3Q A;  1TKZ A;  3G6X A;  4C11 A;  4OYP A;  4P73 A;  3HHL C;  4PG4 A;  3MMC A;  4DPO A;  3I56 S;  1Q7Y T;  3G6Y A;  3CCQ S;  5GAH U;  3MOZ A;  2LCW A;  3PIO Q;  1UW4 A;  3M30 B;  2V50 A;  4NZ7 A;  2MZT A;  4L3N A;  3ISN C;  4CT8 A;  4CYU B;  5F3T A;  2BEF A;  1SUQ A;  1IKY A;  2ZM6 F;  2A18 A;  2RS2 A;  1HBO A;  3NWG A;  2J9D A;  2QA1 A;  2G0C A;  2IRX A;  5AE3 A;  1FF2 A;  4K5R A;  2B4V A;  3WX8 A;  3DKD A;  4LF5 J;  3TAM A;  1Y3J A;  2CPE A;  2VL1 A;  3AAW B;  3N4W A;  1YBU A;  4DFK A;  4WF9 Q;  2WW8 A;  4J91 A;  2V4Q A;  4PG8 A;  5IFM A;  1RUS A;  1XNR F;  3OTC A;  1D8Z A;  1XNQ J;  1QDU B;  1B4S A;  4C8M A;  4DG1 A;  1U09 A;  4U9R A;  3CD7 A;  1CJV B;  1X5T A;  4LVN P;  2HGM A;  2A2C A;  1FT8 A;  2H65 B;  1ZTT A;  2IHR 1;  1NH7 A;  4OI2 A;  4F4A A;  4DSI A;  4EGL A;  4ES3 A;  1U49 A;  1N5Y A;  3IC1 A;  4ZPB A;  2HVE A;  3W9I A;  1BQX A;  4I6Y A;  5MLC V;  1VIO A;  2W4D A;  3I32 A;  2UUB F;  3PRB A;  2GO9 A;  1L3V A;  2Z4P A;  3R5D A;  4NCB A;  3QLH A;  4C8Z A;  4GKK F;  2BKN A;  3HFV A;  3PW7 A;  1RWX B;  2WOM B;  2WVD A;  2MGZ A;  2YNH B;  3SSQ A;  2XB2 D;  2RE1 A;  1VQN S;  1CS4 B;  4K2J A;  3I0S B;  4OZ1 A;  4B9U A;  1FD8 A;  4JI3 F;  2R42 A;  2XCA A;  4JI5 J;  5MAO A;  1QLN A;  4E8U A;  2P9E A;  1P27 B;  1HQU B;  3KUH A;  1R27 B;  4YR2 A;  2QGF B;  4KFB B;  3A4T A;  2E5I A;  2QYG A;  1AXQ A;  2G1H A;  2DRA A;  4BDP A;  3W5Y A;  3HHL A;  3A3N B;  1JLQ A;  5ETL A;  4MTP A;  4DV2 F;  4F3O A;  1GXT A;  3G8T A;  2L08 A;  2CQH A;  3LTO A;  2GNK A;  3PXG a;  3CPW R;  3GTY X;  4CRJ A;  4X4R A;  4G65 A;  3DLG B;  3NGS A;  2SXL A;  3R2D J;  1KVJ A;  4F4Z A;  4Y34 A;  2RSQ A;  2CNL B;  2G0J A;  1QSY A;  4ZPV R;  3THT A;  2G13 A;  1PAE X;  2ILZ A;  3V6K A;  2V8G A;  1S1T A;  1N32 F;  2XLK A;  3H98 A;  3NCQ A;  4ZPC A;  3GJT B;  3W64 A;  2ADC A;  2RRA A;  2AJF E;  2C1E B;  4L74 A;  4L76 A;  3ZTO A;  2AJQ A;  3T1Y F;  2ZH1 A;  5RUB A;  1JLG A;  2DNN A;  1BC6 A;  4PPZ A;  5LMN J;  4LSL A;  1RCX B;  1G1X A;  1HI8 A;  3GJR B;  2KHC A;  2HYI B;  2K7J A;  1FNX H;  3K89 A;  3KLH A;  4JB8 B;  2GMJ A;  4OL8 A;  2FY1 A;  1RT6 A;  5D8H B;  2UU9 J;  2EWH A;  4EK2 A;  2RUG A;  3Q8Q B;  3THV A;  3LP0 A;  1W7W A;  5LMU F;  5BYR A;  5DZ6 A;  5CCL A;  2R2R A;  4Q43 A;  1OS5 A;  2KU7 A;  3NS5 A;  1RWP B;  3DRP B;  5DG9 A;  3GMG A;  1IKX A;  1NSP A;  4CO0 A;  4OX9 J;  2XC9 A;  4UOF A;  1MRO A;  7FD1 A;  4WP3 A;  4PPD A;  4DV1 J;  4FPI A;  3QO9 A;  1S1U A;  2GAG C;  2D9P A;  2MHE A;  4QQB A;  2ZOM A;  1R89 A;  4B3T J;  5JVH Q;  4M5M A;  1WF1 A;  3OLA A;  2KRB A;  2FVC A;  3DLK A;  2AP6 A;  4DV0 F;  1R43 A;  1IWG A;  3HF5 A;  3HSD A;  2H1Y A;  4IO1 A;  1XWL A;  4Q45 A;  2F8E X;  2DGW A;  3O3L A;  3HPO A;  4TY8 B;  3TJA A;  3PHT A;  3L95 X;  1H98 A;  2V4J A;  1ZAV A;  5KFO A;  2MPU A;  3GPA A;  3PJW A;  2Y1L B;  2W9C A;  3QID A;  2XM3 A;  3EIC A;  3HHK A;  2J0Q D;  2DNM A;  1MU2 B;  4WFX A;  3IA0 A;  4PQU B;  4RW4 A;  4KC5 A;  1XN9 A;  3JTO A;  2Z2Y B;  1OMS A;  1RT3 B;  2ZM6 J;  3EVO A;  5IC6 B;  3PX6 A;  4JYA F;  1REV B;  3FMB A;  2RH3 A;  3W2V B;  4J9O A;  2LVW A;  1VOM A;  5C24 B;  2YNF B;  5H9F J;  2CJA A;  1HNI A;  5L1I A;  2IAJ A;  5F3Z A;  4NA2 A;  1Q1K A;  2YQ0 A;  1XNR J;  4J9N A;  4WXO A;  3LUY A;  4Q2M A;  2C3U A;  1SQF A;  1C4A A;  1OO0 B;  5CHC B;  1JLF A;  1RWO B;  1GMW A;  2CVI A;  2B43 A;  5HN0 A;  3RBZ A;  3GQC A;  4TKT A;  4O3P A;  5A8R B;  3MM6 B;  2A10 A;  4PYD A;  4V19 J;  4G1P A;  4C97 A;  1N5V A;  1RAJ A;  1VJQ A;  4ANE A;  1C1B A;  4U67 Q;  2EI5 A;  2FLN A;  3KUE A;  1FXD A;  3DGP A;  5C2G A;  1URR A;  2OFG X;  5HVH A;  3RAQ A;  1VK3 A;  1JNZ B;  1SPB P;  4ITS A;  2UUB J;  3OFG A;  2GA7 A;  4H4K C;  3M2U A;  1EAY C;  4GO7 X;  4OMF G;  2XHW A;  2XGP A;  4GKK J;  1FCA A;  1EJ7 L;  1VYA A;  3PFO A;  3ULH A;  3DI6 A;  4I7F A;  4R25 A;  1HI0 P;  2ZDO A;  2XHC A;  3AQO A;  4PG7 A;  4ZVO B;  2YWH A;  3K5P A;  4QIF A;  1YLX A;  1S0N A;  4JI3 J;  1CG2 A;  1NB2 A;  2MST A;  1MML A;  3M6U A;  3D6F B;  1V3Z A;  3CCW A;  3R8Y A;  1NK5 A;  3MI7 X;  4YR3 A;  1VRU A;  2C42 A;  2QE5 A;  3MEC A;  3R2C J;  1WD6 A;  4PQA A;  1WC5 A;  3RRK A;  1OQ3 A;  3D2W A;  4DV2 J;  1F5B A;  1FRI A;  2WBR A;  1R6V A;  5T41 A;  1TKX B;  1IJF B;  2F9J A;  1QAI A;  5F8N A;  1YTY A;  2Y8W A;  1Y4Z B;  2N4D A;  4ECS A;  3ELH A;  5D77 A;  2QZ8 A;  3R5J B;  4RNF A;  4B3R F;  2D3U A;  1QSL A;  3PYE A;  5H1S V;  4ZVS B;  1CJT A;  2VIH A;  3HXM A;  1EHW A;  2Y1R I;  3J81 j;  1AUD A;  4CLS A;  3DXB A;  3OR1 B;  1N32 J;  1R3N A;  1VRT B;  2DO4 A;  3PKY A;  2MMY A;  2Q66 A;  4JBC A;  2BE9 B;  2CWK A;  3W9H A;  2FIU A;  2HZV A;  2J8A A;  4LVO P;  3H42 A;  4ZLN A;  1M5O C;  3H59 A;  3T1Y J;  3BSC A;  1VQO S;  2QJ3 A;  3NS7 B;  2W2M P;  1PBU A;  3T6J A;  3PIP Q;  4LF7 F;  3B78 A;  1R7I A;  2X1F A;  2WSF C;  4CZC A;  4G1I A;  3UW1 A;  1WG1 A;  3D3C J;  4DCP B;  3PKM A;  2DHH A;  3OD2 A;  4PUO B;  4DLG A;  4FVC A;  1E6Y A;  4TNO A;  1NK6 A;  3KHL A;  5LMU J;  4WK1 A;  1WDD A;  4H4K A;  4DUY F;  1Y11 A;  1WI6 A;  2P8I A;  2WVC A;  4I2Q B;  5A8K B;  3MUV P;  3BPD A;  1XMB A;  2DIU A;  2DNK A;  4ZIW A;  4ZVH A;  1PAU B;  2U2F A;  3GU0 A;  1LW0 B;  3HFZ B;  4ERD A;  2EXU A;  1N6Q B;  1S59 A;  3MUR P;  1Q7L B;  2FJW A;  1UFW A;  2JX2 A;  4FYX B;  4FXW A;  2VBW A;  4DV0 J;  2B9Y A;  2YWG A;  2QYC A;  3M8S A;  1HIY A;  1FKA F;  4Y0F A;  5LL6 d;  2YH1 A;  3DOK A;  1MG7 A;  1TL1 B;  4UST A;  4KV8 A;  3CCJ S;  1S12 A;  4IG0 B;  4Y2A A;  2QO3 A;  2HIY A;  4GRS A;  2DB1 A;  1NK9 A;  1FKO A;  1M5H A;  2PI5 A;  2LU1 A;  1IN0 A;  1RTH A;  3FVY A;  4DOZ A;  4PXC A;  4KQZ A;  1NZ8 A;  2PDA A;  3CC2 S;  1TUV A;  1WHY A;  4YB6 A;  1S79 A;  1VBX A;  4JYA J;  3VGS A;  4ZPW R;  1U0S A;  3EVM A;  4JI8 F;  1P9Y A;  2ZZT A;  4ECX A;  2LQ8 A;  1TUG B;  3ZZT A;  4Q0B A;  2G2O A;  1RLC L;  3HKZ D;  2G2Y A;  4KKO B;  1KQF B;  3RBX A;  4QCL A;  2VBX A;  2M52 A;  7AT1 B;  4FF4 A;  2AZ1 A;  3T5H A;  4WZQ A;  3QWU A;  2F1F A;  2AGP A;  1S10 A;  2QA2 A;  2CPJ A;  2KO1 A;  4CLU A;  4IRK A;  3V2U C;  3R6L B;  3ONQ A;  1TFY A;  2E5G A;  1N48 A;  2A1B A;  2MYF A;  3TZX A;  5LXR A;  3RYL A;  4BC9 A;  3AD8 C;  2NS1 B;  2HHT A;  3CMA S;  1QAY A;  4X66 J;  3EDQ B;  5B0G A;  5KG4 A;  5AXK A;  2LXU A;  3C6T B;  2HHW A;  3H40 A;  3HHE A;  4USU A;  4P9S A;  2J9C A;  4PR6 A;  4HAC A;  2YKA A;  4LQ9 A;  2BOA A;  4NL5 A;  1T03 A;  2NQP A;  4YME A;  2YVS A;  1JXL A;  2GML A;  1DBD A;  3QYY A;  1Q5V A;  1FJC A;  5IS2 A;  1UA0 A;  4DEZ A;  3ISZ A;  3ZZY A;  4B9N A;  4OIX A;  1YJU A;  2RQ4 A;  1DZ5 A;  4ZP6 A;  2XS2 A;  4ILR A;  2D69 A;  3CCZ A;  2VDI A;  3HSZ A;  4M1K A;  1VC0 A;  2ZBQ A;  3P5B P;  2BQ3 A;  2VHG A;  2V5H G;  4B3S F;  2IM1 A;  2V2Z A;  1J5O B;  5GAE U;  2W7P A;  3RW6 A;  2FB0 A;  3C8Y A;  3GYX B;  3UE2 A;  4NE9 C;  4O44 B;  1VQK S;  3EUN A;  3K2Y A;  1PSD A;  1X4D A;  2XZW A;  4LUB A;  4J5O A;  4OJ1 A;  1RHM B;  1I5O B;  3VGV A;  1HA1 A;  1OSC A;  4TVA B;  3G96 A;  1N4L A;  3CSK A;  3M8Y A;  1U1M A;  3MR7 A;  3OQ2 A;  2KVQ E;  3VR1 A;  4B3R J;  3TQ1 A;  3CJK A;  3I4H X;  4N8O A;  1VQ7 S;  5CAA A;  3WC2 A;  4JI7 F;  2ZZN A;  3R1H A;  4R0J A;  4IKA A;  3CC7 S;  3DLE B;  2ZOF A;  4KHR A;  3IS9 A;  4RW9 A;  1U8S A;  2C22 A;  2FHJ A;  3KDO A;  1ROF A;  5FD1 A;  3W61 A;  3T5K A;  2IDL A;  4I2P B;  3UDL A;  2BV3 A;  2YNI B;  1Q0N A;  3BBB A;  3MCN A;  1JLB B;  4H54 A;  2FTR A;  5K5M A;  2DHA A;  3IFE A;  4PWU A;  4U6P A;  4LF7 J;  4K50 A;  3FMW A;  2M0G B;  5K8P A;  1RAO A;  3UI3 A;  3L09 A;  1N5S A;  1KSP A;  2DNZ A;  2KFY A;  1FJG F;  3N5B A;  3AOB A;  4IOB A;  3DLH A;  2KZZ A;  4AXJ A;  1SJQ A;  4QU6 A;  4DUY J;  5E0O A;  2ATC B;  2IM3 A;  1Q79 A;  3W62 A;  2XBP A;  3VAL A;  5DG7 A;  2CJX B;  3AB2 B;  2YX7 A;  1TL3 B;  1FK9 B;  4HTJ A;  3CD6 S;  2GCF A;  1S7H A;  4W90 B;  5IM0 B;  5DQH A;  1XR7 A;  3H25 A;  5ETO A;  1ZZF A;  1UKU A;  5KTQ A;  3MED A;  1DJ0 A;  1NK0 A;  2MKY A;  3DOL B;  3UN5 A;  2VDH A;  5KFE A;  3ZC4 A;  2NZC A;  2ERR A;  3OVS A;  1RTD B;  2HWI A;  2I9S A;  1NJZ A;  2B4U A;  2HEK A;  3GFX A;  1GXL A;  4CT9 A;  4K4V A;  5KFG A;  3H2U B;  3SZ2 A;  3SCL E;  2F3J A;  5KFS A;  1HNV B;  2V8P A;  4ZPT R;  3H5X A;  2B56 A;  4NRU A;  1RKI A;  1QUV A;  3GV5 B;  5EHH A;  1TV6 A;  3M8Q B;  3UDV A;  4CO2 A;  3MMB A;  3SFU A;  1VGY A;  2PSZ A;  3RG6 A;  2MZJ A;  4JI8 J;  5I42 B;  1TMM A;  2MY8 A;  1KFD A;  4X64 F;  1E6V A;  2ZD1 A;  4OZJ A;  3FBE A;  4PZV A;  2B4O A;  2D41 A;  1RXO B;  2LLZ A;  3TAQ A;  5DET A;  5F8I A;  4M5G A;  2W2N P;  5KG5 A;  1LWE A;  2O1P A;  2RQK A;  2FC9 A;  1K0T A;  1RBO B;  3KK3 A;  4A46 A;  2O5D A;  5HRO B;  5IT9 Y;  2N3O A;  3UNY A;  3GZ7 A;  1FXR A;  1O6X A;  3RR8 A;  3MFI A;  5C7P A;  5KFF A;  3EXC X;  5H9E K;  1SC6 A;  2AJ1 A;  1H2V Z;  5KT5 A;  4IOC Q;  2DTJ A;  5HI7 A;  4JV0 A;  2QA4 S;  3DN9 A;  2Q6B A;  1KEK A;  3MMA A;  2ZVS A;  3I55 S;  5I3Q A;  4YDX A;  1FRH A;  2RJZ A;  3CJ5 A;  1X4C A;  4UQG A;  3CCM S;  2RDI A;  3T19 A;  4NCA A;  2VUG A;  3DC2 A;  1U2R A;  4PYA A;  3KXD A;  5HP1 B;  2PA8 D;  2GGP A;  4PWD B;  2AJ4 A;  3ILI A;  5KFY A;  1X9W A;  3D5M A;  1IJE B;  1KBR A;  3PW0 A;  4YUD A;  4X4V A;  3I9Z A;  2JSX A;  1JLA B;  4H4O B;  5DDO C;  2R2S A;  3M32 B;  3BRE A;  1T3O A;  3I31 A;  4ZJL A;  1UFL A;  3Q8P B;  1SL1 A;  2UUT A;  5HJY A;  3OVB A;  2AU0 A;  3PCO B;  4RU9 A;  4B3S J;  4UY8 T;  3C16 B;  4M5D A;  4X62 F;  3T9Z A;  2JEJ A;  1R8H A;  2V2Q A;  1RBA A;  3MF5 A;  3CT9 A;  2E7V A;  3JSM B;  2DGV A;  3KK1 B;  3AJ1 A;  1DTQ B;  5IZH A;  1Y00 A;  2FJD B;  2FYX A;  1Y5L B;  1CQN A;  2YXL A;  2E44 A;  4HH1 A;  2V4R A;  2GX8 A;  1VBZ A;  1H2T Z;  4NRT A;  1FJE B;  2KDO A;  1GNK A;  3BN7 A;  3W65 A;  5AE2 A;  4R5P A;  1JKH A;  4FS2 A;  3MCS A;  1NKC A;  4JI7 J;  2JFK A;  3D1Q A;  4E0D A;  5HSP A;  3J7A 1;  1LFW A;  2H4Y B;  3WZ0 A;  3EGV A;  2KHD A;  2CWX A;  3VVU A;  4K0K F;  1BHN A;  4QPT A;  2DIS A;  2K06 A;  6FD1 A;  4ZP8 A;  1HMV B;  5M2U A;  2RF2 B;  4AFF A;  1G2E A;  1TVR A;  3SV3 A;  5CZX A;  4DV6 F;  1S49 A;  1IKW B;  1S9G A;  1JB0 C;  3ZNJ 1;  2CZ9 A;  1NLK L;  4BHQ A;  3I0R A;  4NLV A;  4ENO A;  3PTW A;  3LGH A;  4OI6 A;  4OZN A;  3GII A;  1FJG J;  4LIR A;  2BKP A;  3ETO A;  1Z2L A;  3EPI A;  4A8M P;  1WG5 A;  3I87 A;  3M9O B;  4WE1 B;  1S97 A;  5D4P A;  1WC4 A;  2UUC F;  1VR6 A;  1OPZ A;  2VC0 A;  3NAI A;  2Z30 B;  3GJS B;  2W8K A;  3BKF A;  2GVD A;  3OJS A;  3MD3 A;  2FJV A;  1Y3K A;  5CYQ A;  2EG2 A;  2E9T A;  4Y2I A;  3EE3 A;  3OBI A;  4JP8 A;  3RZA A;  1IM6 A;  1PYT A;  5L46 A;  2AQ4 A;  3LP1 B;  3V6H A;  1ZBT A;  4DL0 C;  5KT3 A;  3MM8 A;  2POK A;  3SI8 A;  2PA3 A;  2IBK A;  2DR6 A;  2MQ8 A;  4G1Q A;  2HWH A;  3O2I A;  3PYG A;  4RU2 A;  2HVZ A;  2GQ2 A;  2EEY A;  2KFZ A;  2WVB A;  2M4M A;  1FDN A;  5HMY A;  1EX8 A;  4NI2 A;  1T9T A;  3HM9 A;  5JJB A;  1R0A B;  4HI2 A;  4KHM A;  1T9X A;  3UR3 C;  2FLL A;  3MCO A;  1TU0 B;  3FCW A;  1TEL A;  1VQ5 S;  3RJM B;  1GT8 A;  1QVF R;  5A0Y B;  3AT1 B;  2C2M B;  2DGO A;  4UY8 5;  4X64 J;  4K4X A;  2IC3 B;  4UOC A;  2ZH6 A;  1IUJ A;  3FGV A;  3MM9 B;  1LWF A;  2W9A A;  3HHN B;  1X5S A;  1YX2 A;  1WG4 A;  2BZ2 A;  3FEY B;  2BDP A;  3TNV A;  4WBF A;  1HD1 A;  2CKW A;  1HKA A;  5LT5 A;  1PGZ A;  4HKQ A;  1Q86 T;  2ZE2 B;  4F67 A;  3WDO A;  3C14 B;  4QZV B;  2NRE A;  1KON A;  3ITH B;  3RB6 A;  5FLX U;  4YHH F;  2V6A A;  1DAR A;  4OJH A;  1DTT B;  2MKH A;  2BE7 D;  1LW2 A;  2YKO A;  4C0H A;  2E1A A;  2XSF A;  2LXI A;  2OPR B;  4F3M A;  5KT6 A;  2QSW A;  3MAA A;  3P8B B;  3ZTS A;  4CYU A;  1N0U A;  1LFP A;  2MLX A;  1RGV A;  3TEH B;  4JV2 A;  2LXF A;  1LWX A;  3B4M A;  4F7V A;  1S1X B;  1XJW B;  2Q79 A;  2HAI A;  3NKY A;  1WNE A;  1IBL F;  4NEY A;  3AD9 C;  4DR3 F;  3V5R A;  4U7C A;  3QJL A;  4AXI A;  1WTB A;  1DFD A;  5G0R A;  3ZZR A;  4KH1 B;  2WON B;  4FYD A;  1Q8B A;  4M5H A;  3DDI A;  3W2W B;  1IR0 A;  5T7L B;  4AD6 A;  1WKK A;  3HD2 A;  4EBD A;  4X2B A;  1R8B A;  1BQM A;  4H4M B;  3ISN D;  2B0G A;  5L1L A;  4KAI A;  4N47 A;  3IP0 A;  3DLB A;  4QW9 A;  1H74 A;  4ECW A;  3D66 A;  3NGD A;  1XMQ F;  4X62 J;  2JLE A;  2CQ3 A;  4YOE A;  2V2K A;  3NG8 A;  5HBM A;  5KFX A;  3BGR A;  1B99 A;  1SIW B;  3KLE B;  4BWJ A;  1YRT A;  4USW A;  4O4G B;  1VIX A;  3TYT A;  2XMM A;  3W1Y C;  4DSL A;  2NXN A;  3IM8 A;  2R2U A;  1YJW S;  1EB0 A;  5J1E B;  2LQJ A;  3M2R B;  3P45 B;  1SJ1 A;  3IXQ A;  4DR5 J;  4LRD A;  3Q8S B;  1EP4 B;  2BJD A;  2NXJ A;  1EZZ B;  3MM5 A;  1LK5 A;  2YH0 A;  2HK3 A;  2HS0 A;  2ZWO A;  2HUR A;  3DRR A;  4Y2M A;  2IM0 A;  1RT4 B;  4BCA A;  3CWJ A;  4JI0 F;  3OR2 B;  1JK9 B;  2KXN B;  2LFV A;  1FFG B;  1Y5N B;  4K0K J;  2XMW A;  1VQP S;  5IQ6 A;  2BXJ A;  1H72 C;  4BC7 A;  2CUY A;  2LEP A;  4DV6 J;  3MCM A;  3QT7 A;  4K7Q A;  2KI2 A;  4FYV B;  2DRD A;  4N77 A;  3W63 A;  3HT3 A;  2UXB F;  4O3S A;  4P72 A;  1H3D A;  3R7N B;  2PMW A;  3G6V A;  2DD8 S;  1GTE A;  1AZS B;  4MYT A;  1UEU A;  3QJJ A;  1FFW B;  4YFU A;  1X4B A;  2FQQ B;  3PW2 A;  4M94 A;  1BWE A;  1JLE B;  1JLC B;  4DJB A;  2UUC J;  2GS8 A;  4QU7 A;  4ILM A;  3OFE A;  3O44 A;  2OO4 A;  2BRK A;  3H0P A;  3ZTQ A;  1P1T A;  4CLY A;  3K59 A;  1RWW B;  4M5L A;  1S48 A;  1K47 A;  2O67 A;  3G4S S;  2FUG 9;  2MKJ A;  1PC4 A;  2QA4 G;  4ZVP B;  3DOM B;  4K8R A;  5BXI A;  1HBU A;  1Q8I A;  3KLI A;  5IC4 B;  1A0O B;  4NAS A;  5THW A;  1TQL A;  2CPH A;  2DHG A;  2XG8 A;  2DXF A;  1XTZ A;  3UQS A;  2UZA A;  3I5C A;  2OSQ A;  4BS2 A;  4C0O C;  5K8M A;  1Q8K A;  3GV7 B;  5D15 A;  2QIF A;  4S0M A;  3DRP A;  2FY8 A;  3RR7 A;  5F8J A;  3AA8 A;  3A8E A;  1RCO B;  4NLU A;  5DM7 Q;  3TZW A;  2CNO B;  1C4C A;  3NNH A;  4WU3 A;  3MAQ A;  2HZC A;  3M2V B;  5DDP C;  1L3S A;  2HQF A;  4LQ3 A;  3A3O B;  3K7R A;  3FRZ A;  2O66 A;  4IR1 A;  4ECT A;  2VA2 A;  1PYO B;  2L9N A;  2EW9 A;  3W7B A;  3NBP B;  2CPD A;  3ZZO A;  4XPC A;  4OV6 A;  3CC4 S;  1FWK A;  2F8H A;  3UVJ B;  1RT2 B;  3QWP A;  3KWM A;  3CCL S;  2YPY A;  1F2H A;  3DMJ B;  1KQK A;  4YHH J;  1U6B A;  2FLP A;  2HNZ B;  1YSJ A;  3CCU S;  5LSO A;  3IAM 9;  3HVT B;  4FKX A;  2OML A;  5CXT A;  1HYS A;  5ETN A;  2OHD A;  4DQR A;  2IJF A;  5K8O A;  4KO0 B;  1KOO A;  3A1Y G;  1U47 A;  1H73 A;  3TOQ A;  1AFI A;  3CUL A;  3P96 A;  1KHW A;  3W2V A;  2F4F A;  1IBL J;  5EWG A;  2HRY A;  4J9K A;  1X0P A;  4DR3 J;  2GIQ A;  1WEY A;  3BB5 A;  1BGX T;  2MJU A;  2I38 A;  4F26 A;  4HVZ A;  4AL6 A;  4EO6 A;  3UD5 A;  3CJQ A;  4ELU A;  2M2B A;  1NSK L;  3H5Y A;  4F0K A;  3GFY A;  1NB7 A;  3VAF A;  5E3C A;  2OGU A;  3VAM A;  1NK4 A;  5E33 A;  3PV8 A;  3PNI A;  1KN6 A;  3CIZ A;  3IGV A;  1G7C B;  3IRX B;  1AT1 B;  3QAU A;  2E1P A;  1FES A;  3PYD A;  3M1V B;  1M5V C;  4C48 A;  4DSE A;  3MM6 A;  1MN9 A;  1XMQ J;  1VIS A;  1FD2 A;  4RW8 A;  1KHV A;  2ZZM A;  3LF0 A;  2Q6C A;  3POT B;  2MQQ A;  1LNQ A;  5KFV A;  3ZTR A;  2XY6 A;  4HR2 A;  4DDF A;  3KMS A;  3N0V A;  4DSJ A;  2HG4 A;  1KLM A;  8AT1 B;  3NCR A;  1RYR A;  5D78 A;  1HWI A;  4UOH A;  1CVJ A;  1S1W B;  3MPW A;  1RZM A;  1V9O A;  4ED7 A;  4ED3 A;  3CUN A;  3TX8 A;  5GVQ A;  3W66 A;  1L3T A;  4QYZ J;  3TZZ A;  4ZIV A;  4ZVE A;  1FNO A;  3C3L A;  4U96 A;  2R7W A;  1KLN A;  3WX4 A;  1RB0 A;  2CIM A;  5ADZ A;  2HHQ A;  2CJB A;  4NOH A;  4X4Q A;  4JI0 J;  9RUB A;  4CCH A;  1IM4 A;  5HMX A;  5I3U B;  1FDA A;  2ACM A;  4HYK A;  1KWM A;  4IR9 A;  2PGC A;  1D9D A;  2RIL A;  1TKX A;  1RAH B;  3NGR A;  3BJY A;  2OPS B;  2FZK B;  2BYC A;  3UR0 A;  1TL7 B;  3GCX P;  2DR7 A;  1NDK A;  1Q95 G;  3N6M A;  2CQB A;  2UXB J;  2CPI A;  2V9W A;  3ENA A;  2QMU B;  5B7W A;  4FYW B;  1UVN A;  2WBM A;  3RB4 A;  3DHW C;  3HD1 A;  2R4F A;  1G3O A;  4AUK A;  3U1L A;  4I6A A;  3D0H E;  1X7V A;  2F8M A;  2JVO A;  2DPJ A;  1Y7P A;  3D6M B;  1SV5 A;  2A3J A;  1PBA A;  1PC5 A;  2W4C A;  3TVZ A;  2PMH A;  3WBZ A;  3C6U A;  3BO2 A;  4WFB Q;  2RKI B;  4A4J A;  3T5L A;  2VFR A;  2IPO B;  4ZN1 A;  3QRP A;  2HRT A;  1WHX A;  5KFC A;  1SJR A;  1WJ9 A;  1RSC A;  1U6Z A;  3B82 A;  1B3T A;  1TKZ B;  5CAB A;  4NYZ A;  1S77 D;  2DKO B;  4YN3 B;  1T9U A;  5KFQ A;  5M2R A;  3DGV A;  4YB7 A;  3CDA A;  3Q23 A;  2YWW A;  2MSS A;  4O3R A;  2P6S A;  1RBL A;  2MKI A;  1R0C B;  4LR7 A;  4DR2 F;  2AJ2 A;  1SUQ B;  3JSB A;  2FJB B;  3CJ2 A;  3IMQ J;  1NBE B;  3BDE A;  4GC7 A;  4NLD A;  2BAN A;  5B0F A;  1TK0 A;  2JVR A;  5A8K A;  2V8D A;  4FDF A;  1LEO A;  4WYL A;  2DR5 A;  4RW7 A;  1MMD A;  3CCE S;  4CLF A;  3OV7 A;  4WIQ A;  3GFZ A;  1OY9 A;  2WB1 D;  2X51 A;  5EWE A;  3QGH A;  1XEZ A;  2DGX A;  2H5I B;  3KG1 A;  3PG9 A;  4HHJ A;  3QZ7 A;  2A6O A;  2QLB B;  3QRQ A;  4NLQ A;  3K5L A;  1N5Q A;  4IH5 A;  4DG1 B;  4QR1 A;  1Q4R A;  5DRK A;  4DBQ A;  3TWZ A;  3OL9 A;  2HHX A;  2CJ9 A;  2HAF A;  1HW8 A;  2DGT A;  2IMO A;  2JC1 A;  3LGN A;  2DXE A;  4K59 A;  2FHM A;  2DO0 A;  2I5J A;  3F0N A;  5ETM A;  3SEO A;  5E3A A;  4DR4 F;  3PJX A;  2VFS A;  3MWB A;  1N5Y B;  4MAK A;  3A13 A;  4B3M F;  1U2F A;  4EUV A;  1NXI A;  2XWX A;  1K8A T;  1F9E B;  2M5Y A;  2R3V A;  3QLH B;  3KJN B;  5ETR A;  2CQC A;  4Q44 A;  3MEE A;  5K8N A;  5GMD A;  2MGZ B;  3NGU A;  3S01 A;  1RT7 A;  2XI2 A;  3GG1 A;  4C8K A;  3CDW A;  1KP6 A;  2GZO A;  3CGI A;  2QT7 A;  4D3G A;  2R8H A;  4U95 A;  4LFC F;  5DGA A;  1IBK F;  1DLO A;  1WHW A;  2ZBR A;  1M5P C;  2RNE A;  1WOP A;  1JNR B;  2QRR A;  3H4D A;  3SXL A;  1VQ8 S;  4PAA A;  1X4H A;  2QLW A;  1JLQ B;  5BYS A;  3GON A;  4KR0 B;  2HQC A;  4QWA A;  4WU2 A;  2GHP A;  3MDF A;  1KRP A;  2XMT A;  3ENV A;  3WQP A;  1AW0 A;  1TTH B;  3RU0 A;  1FE0 A;  2VFT A;  1FX2 A;  1N34 F;  3Q86 A;  2XO7 A;  3RBE A;  3JYT B;  2B51 A;  4X4U A;  4WPA A;  3SQG A;  1VHF A;  2KT3 A;  1S1T B;  4RLE A;  3HZE A;  1QAX A;  2D9O A;  3LAN A;  1EQM A;  3H2L A;  2FJA B;  3KMQ A;  1KDN A;  2VD3 A;  4DU8 A;  4N56 A;  1JLG B;  1PO6 A;  2NXE A;  2KVI A;  3Q8V A;  1V5V A;  4UUW A;  4LSL B;  5A8W A;  4DMZ A;  2VC1 A;  4ECU A;  2G2Z A;  4C98 A;  2AGO A;  1N5T A;  4O44 A;  3QBC A;  5D4N A;  4UUX A;  1R8C A;  2GVZ B;  1OYE A;  2IMW P;  1SJ3 P;  3BSO A;  1RT6 B;  4DQI A;  3QSY B;  2GJ2 A;  2UVV A;  3LGM A;  2OAU A;  2PEH A;  3LP0 B;  4AL7 A;  4IG3 A;  1TFW A;  2R7O A;  1WOO A;  2UVU A;  1OQ6 A;  1RK8 A;  4DPY A;  1C0T A;  2UXC F;  3CIM A;  1IKX B;  3NS6 A;  1JMT A;  5A6P A;  2A6M A;  4FNI A;  3DLE A;  2HVH A;  4USK A;  3W8G A;  2G4B A;  1S1U B;  3M8Z A;  4EWT A;  3BV8 A;  3QIP A;  3T6B A;  5LSL A;  8ATC B;  4DL6 A;  1UW9 A;  2BW2 A;  2W4P A;  5BJR A;  4I2P A;  4IFV A;  3DLK B;  1KVK A;  4NYO A;  2YNI A;  4C0B A;  2VFV A;  1SIZ A;  2ZUA A;  2VV5 A;  1JLB A;  1CJU A;  2JHE A;  3L7U A;  4NZ6 A;  4Y2K A;  3EWG A;  3TRG A;  2JEI A;  1DAX A;  4Q8E A;  1M5K C;  2XS5 A;  4PKD B;  4TU8 A;  2JZ5 A;  1RAB B;  2V4J B;  4OYB A;  2YKN B;  2J9E A;  3GIM A;  5F9L A;  2AGQ A;  3JSY A;  2ZIT A;  3T1H J;  2W9C B;  2RUS A;  4USI A;  3OTE A;  3WIU A;  1W25 A;  2OPP A;  2ZOG A;  4ZVG A;  2XMU A;  5KFJ A;  4URS A;  4DR2 J;  4RW4 B;  5DQG A;  3V4I A;  4OI1 A;  2R7X A;  1TL3 A;  5E5N A;  4ZPA A;  3DRY A;  1V3R A;  1FVQ A;  2Z57 B;  3K5M A;  1NPP A;  1ZM3 A;  2BOP A;  3HK2 A;  2DJW A;  2BW7 A;  1VFJ A;  1HNI B;  2OD4 A;  3H5S A;  2IAJ B;  1QSS A;  2DVI A;  2L9D A;  2N3L A;  1F5A A;  3KJF B;  3KHR A;  4HDG A;  2FGO A;  3H90 A;  1U8W A;  5ETT A;  1SKU B;  1RT5 B;  3M4X A;  1GXU A;  1RTD A;  1FHT A;  1UMJ A;  3TZY A;  1JLF B;  2JNJ A;  1K9M T;  4Q5V A;  2RU9 A;  3KJV B;  4ED1 A;  3PY8 A;  2Y1J A;  2YNG B;  3F73 A;  3MEG A;  2I2Y A;  4C8Y A;  1IKV A;  5KFU A;  1D9F A;  5J2P A;  4TY9 A;  1S76 D;  2MKS A;  4QWE A;  3BF4 A;  4DR4 J;  3DGP B;  1R8P A;  1FJ7 A;  3I6P A;  4B3M J;  2J9D E;  2E29 A;  4C6A A;  3ILL A;  4MFB A;  3CTR A;  1NME B;  3PRD A;  3M2U B;  3KDN A;  2PMZ D;  2M88 A;  2U1A A;  3MOJ B;  6AT1 B;  2JH3 A;  1UVI A;  1F3V A;  4Q8F A;  1N0V C;  1FRK A;  3DI6 B;  4I7F B;  3RUB L;  1H7W A;  3R7B B;  4X4O A;  3U7J A;  2J5A A;  2HBZ B;  5ITH A;  4LFC J;  1IBK J;  3CJ3 A;  2OIH A;  2DNY A;  1FWL A;  3CE8 A;  5B0E A;  4IFY B;  3D7S B;  2VON A;  3G8Q A;  2DYA A;  3VF0 B;  2QL7 B;  4I69 A;  1VRU B;  3OFH A;  1Y10 A;  2D7S A;  2CAJ A;  4WCE Q;  1PYS B;  3MEC B;  2R7T A;  1YIT S;  5EX3 A;  4WZM A;  1IBC B;  2YWF A;  3MPD A;  3CO9 A;  4M8L A;  3PW4 A;  5K14 B;  5D4O A;  3FJ2 A;  1S0V A;  5U47 A;  4KIA A;  1M0S A;  4OX7 A;  4B02 A;  1X0F A;  3C19 A;  1S6O A;  2OH2 A;  3DXS X;  4PAB A;  4GVB A;  1N34 J;  4JUZ A;  1CJT B;  1MN7 A;  1H38 A;  5KG2 A;  1JLA A;  4H4O A;  4KJI A;  4RNO A;  4KE5 A;  2K3I A;  4PWW A;  4CWB A;  1ZZN A;  1K0V A;  2RT3 A;  2ASY A;  1W2I A;  4UT4 A;  2Q3P A;  4RW6 B;  4UZB A;  1RIS A;  3HUL A;  3BQ0 A;  2ZH3 A;  4C9D A;  3F44 A;  2NZ4 A;  1KKH A;  1U4B A;  1VQ4 S;  3N6L A;  3CNQ P;  2J7K A;  3FBC A;  4KGZ B;  4RBV A;  1MWZ A;  1MWQ A;  1NM2 A;  1GAO A;  1BWV A;  2ZJQ Q;  4LF8 F;  2IFX A;  1SI9 A;  3M9M B;  3HKW A;  1R8A A;  2LDY A;  1SQE A;  2Y3Y A;  2QEX S;  3DHX A;  1PJ6 A;  4DS4 A;  4CLZ A;  2LQB A;  2UXC J;  3MMJ A;  1F0X A;  1TZ0 A;  1XIQ A;  1FRL A;  3QAT A;  2QL9 B;  2GQC A;  2MKC A;  4FXD A;  3TQE A;  5B08 A;  2KYZ A;  3ZO7 A;  7FDR A;  3K57 A;  4OHX A;  3D67 A;  1RA6 A;  4KBI A;  4JI4 F;  4EYH B;  3T3F A;  3IWN C;  4C2M A;  2O01 C;  5G4D A;  4NLS A;  2HNY A;  3LOU A;  4LSN A;  1RTJ A;  4NA3 A;  4DL2 A;  2B7C B;  2J8S A;  2E5L F;  5CH7 B;  2K2P A;  2GQQ A;  4KPC A;  4P74 A;  5C42 A;  4W98 A;  1IXK A;  3DOK B;  4KRW A;  4ZOS A;  4GO5 X;  3P49 B;  1VC5 A;  2Z8Q A;  2ZKT A;  3TR5 A;  2VA3 A;  1ZOT A;  1RTH B;  4P71 A;  1HLW A;  1NZA A;  1QTM A;  3J7Z T;  2XMK A;  4IDK A;  3AOC A;  3TA1 A;  4A47 A;  2D3O R;  3FCV A;  2ZBC A;  3LH2 S;  5KFR A;  4F04 B;  4ID5 B;  4Q0B B;  4WXW A;  3R27 A;  1FVS A;  2ZNZ A;  2LMI A;  3HSG A;  2VG7 A;  3CCT A;  1I3O B;  1ZAW A;  1YJR A;  4F25 A;  1T94 A;  2RS8 A;  2I0X A;  3CXC R;  3LP1 A;  4LRB A;  3AY0 A;  3IO1 A;  1Z1Z A;  4USJ C;  2LQ9 A;  4CLW A;  5KFP A;  2RQM A;  2D1C A;  3PO4 A;  3GG0 A;  3UN3 A;  1WKJ A;  1URN A;  3PR5 B;  4PXD A;  3CD5 A;  1U1L A;  1B70 B;  2VPX B;  1MW7 A;  3K58 A;  3IWX A;  3BDP A;  1R0A A;  1P6T A;  3FSX A;  1NDC A;  4NLW A;  2C3P A;  4HAC B;  5GME A;  1HWJ A;  3EXY A;  3ZNU A;  3AA9 A;  4KHP F;  1AB8 A;  1B0P A;  4OHV A;  1FKP B;  2Y0B B;  4YDD B;  2EK6 A;  2UXD F;  3FZB A;  2R2T A;  2AEJ A;  4ZVQ B;  1S6P A;  4YS2 A;  2AD9 A;  5KOW A;  5CYM A;  3HT0 A;  3KNG A;  2OEJ A;  2HBY B;  3M8W A;  3JS9 A;  4BWM A;  2EFG A;  5HAN A;  2JC0 A;  2WVE A;  3C15 A;  3CCR S;  2EC2 A;  4MIW A;  5J2M A;  2AKW B;  4O3Q A;  3C14 A;  2APO A;  3KFW X;  4Z7C A;  2QC3 A;  1HQE A;  1VLY A;  1V6H A;  4NCG A;  3OHB A;  1DTT A;  3FDS A;  4OV1 A;  2BJ7 A;  3L4B C;  2M3D A;  4RX6 A;  1RKJ A;  1MNE A;  3A8J A;  3HFK A;  2AYB A;  1ZM4 A;  3RB0 A;  1NCL A;  1ULR A;  1Q82 T;  1S1X A;  1VMB A;  4ED8 A;  2X1B A;  3UNG C;  2V68 A;  2HFO A;  2W7A A;  4OYI A;  2ACY A;  1N8R T;  1IBM F;  4B9M A;  1F5C A;  3NY0 A;  1N56 A;  3BSN A;  1UAW A;  1B7Y B;  3NRB A;  3OPK A;  3M8R A;  4EYI B;  3UCG A;  4NA1 A;  1F2G A;  3IS9 B;  4I68 A;  3W2W A;  2DNL A;  4RW9 B;  1QE1 B;  2X3D A;  4WFA Q;  3OUY B;  3GCW P;  3TUZ C;  3G2X A;  5B0C A;  3RTV A;  4I64 A;  2P5V A;  3UO0 A;  2C2D A;  3N01 A;  5DJB A;  1S9E A;  4X4T A;  4LF4 F;  5A2Q U;  2AIR B;  1SC1 B;  4PG6 A;  4HL9 A;  3J7Z 5;  4C7Q A;  4C4W A;  2HND A;  2VOD A;  2DIT A;  3A8I A;  4ANC A;  3KKF A;  2DNO A;  3EGW B; 
#chains in the Genus database with same CATH homology
 4PYA A;  2EEY A;  1EKR A;  1EKS A;  3JQK A;  3JQJ A;  2IIH A;  4PYD A;  2EKN A;  3JQM A;  4FDF A;  2IDE A;  2OHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...