2EKQA

Structure of tt0495 protein from thermus thermophilus
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
238
structure length
238
Chain Sequence
b'ERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQSLGAVPLPTDLEKDDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
publication title The first crystal structure of NAD-dependent 3-dehydro-2-deoxy-D-gluconate dehydrogenase from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 82
structure length 238
sequence length 238
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.125: 2-deoxy-D-gluconate 3-dehydrogenase.
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ekqA00
5L3ZA 4CLHA 3VZRA 1WLYA 3F9IA 1F17A 1ADBA 3VC7A 1K2WA 3GGOA 4CLEA 3CZRA 2BGMA 3QWHA 1WNTA 5KVVA 2Z5LA 1U7HA 5K9ZA 1HYGA 2JD1A 3C24A 5C7LO 4FS3A 4MVJP 3JD4A 2HU2A 4AJNA 4RLHA 5JCJA 4WPGA 4L0QA 2O50A 1U2DA 2VCYA 4XA8A 4NQZA 4FFLA 5F1KA 4BO2A 1DIGA 4BO8A 4LW8A 4L75A 4BO9A 3ANMA 1DIBA 4RJTA 5JO9A 4DIBA 3VPSA 4Q3CA 1YL7A 2PWZA 4KDEA 1F8FA 3CXRA 1DOHA 1DLJA 3EGOA 3O38A 4JN6B 1IHXA 1GU7A 3ANNA 4YT4A 1NPTO 1YWGO 2X9NA 2YDXA 3AUTA 4Z9XA 1K6JA 4YTEA 3UH1A 3K9QO 5BQFA 3DOJA 5CHEA 4G2NA 2I3AA 1A27A 3U49A 3A14A 3I6IA 3RFVA 3RU9A 1CYDA 4BO3A 4CV2A 4NG5A 2DFVA 3IKVA 5HTOA 1X1TA 5JY1A 1FDVA 4BOYA 4J90A 2HDHA 2C29D 4BNXA 4KP7A 4PLHA 2QG4A 2X1HA 2JCXA 4LGVA 2B35A 2LDXA 4BNYA 4ROSA 3TZ6A 3K30A 2AG8A 4LN1A 3RAJA 1D8AA 3KLMX 4WNCA 1NTOA 1P9LA 2DTXA 3AOEA 1Y5MA 4F46A 3DO5A 2CVQA 3FR8A 3WB9A 5CAEA 3TJRA 3IUPA 3ETEA 3GHHA 1UZLA 2IRWA 1I01A 3JV7A 1WAMA 1M6HA 2OBNA 2ZB4A 4NK4A 4OXNA 3ZH2A 2BFPA 3ASUA 3LZ6A 3SLKA 3WGHA 1QSGA 2DUUA 4YJGB 4YJFA 4QEDA 2ZK7A 4QUKA 1JLLA 2NNLD 1DRWA 3TL2A 2FP4A 1Y9EA 3O8QA 4ZICA 1QR6A 1M76A 1ZXLA 3B20A 1ONOA 2GN4A 2DPGA 1KVTA 1R0KA 1JTVA 3EAGA 3HUDA 5GZ6A 1IOLA 1AE1A 1SOVA 2C54A 2J5RA 2Y66A 4AJIA 5HWSA 5EN4A 3RD5A 5JXWA 1YE3A 2X22A 4ND2A 1LSOA 5A3JA 1ZEJA 3KXDA 2IZ1A 4XX0A 4CM4A 4IQ8A 3VPGA 4Q3EA 3WQSB 4FFOA 1VL6A 5IG2A 3E9NA 3IDSA 2D4AA 4N5LA 1SB8A 4NZ9A 2NU8A 1GL3A 3PJDA 2ZCUA 5CEJA 2EW2A 4XJSA 2DFDA 1RYDA 4R54A 2H63A 3KOUA 1KEPA 3OQ6A 1I3LA 3GT0A 4OKNA 2B5WA 3C7DB 1KC1A 2W4QA 2GLXA 2YZ7A 3JQDA 5IDWA 1TT5A 4PLFA 7ADHA 4JBIA 1T25A 2YHIA 4E2ZA 1Y1PA 9LDTA 4ZRMA 1HETA 2QYSA 2Y1FA 3F46A 4DVJA 4WLUA 2BFAA 4IJVA 5IZCC 4UEKA 3FF4A 1E1NA 4P38A 5ILGA 2PKQO 1LJ8A 3S2EA 2VUTA 1MLDA 1YRLA 1E3WA 3TOZA 1ISHA 4UVHA 1CJCA 4F6CA 3NTQA 5DCWA 4ND4A 3FHLA 3FBTA 2E82A 4UEOA 4R16A 3AY7A 4NNJA 4KZPA 1NPDA 3H9JA 4DQUA 5IXSA 3TFOA 3GGPA 2D0IA 3WGOA 5KVQA 1EVZA 4Y98A 1P1HA 4YRBA 1VC2A 2BGKA 3EMKA 4GLOA 3RUFA 1EVJA 3DAGA 4GWKA 2BFMA 3B1FA 1C0PA 2Q1UA 5THKA 5IXYA 3RWBA 3QSGA 3QP9A 5KOIA 3BTUA 3RC2A 4E0BA 1EQUA 2EKPA 3PHLA 1DAOA 3D3EA 1ZMOA 3KYCB 2VT2A 3G17A 1MFZA 4WK6A 5JNLA 4YVFA 2WMDA 3H5RA 1GEEA 2C07A 1WP4A 3ZU2A 5L51A 3I9NA 1R4NB 5TT0A 4MIYA 4FFMA 2V6FA 5B37A 3Q9NA 4U5QA 3JD1A 3VAZA 4MKZA 4CM7A 4YXFA 3T7EA 4HP8A 4IXWA 4NBWA 1T1RA 4S3MA 2FY8A 1SCUA 3PYLA 5L7TA 4OMUA 1FDUA 4RPLA 3IJPA 4Z9FA 3MCVA 4I8XA 3IS3A 3RC9A 1U1IA 1YOVA 2QHXA 1YKFA 5L53A 1ZCJA 1H0KA 2HMSA 4H16A 4A03A 1LUAA 1MB4A 2IEDA 3QV1A 1F06A 2EHDA 3W4JA 2PZKA 4XWYA 4PG5A 3V1UA 2X4GA 3IQDB 3D3WB 2XPCA 2D8AA 2YV3A 3KTDA 1E0DA 2DAPA 2VTDA 5GY7A 5C7IO 4GX2A 1JVSA 1M6WA 2VHXA 5TLSA 5DNAA 1ZVMA 1YJ8A 3PHIA 1K5HA 4JP3A 5CDUA 5EESA 3QVXA 2ZB7A 3RQSA 4ZRNA 1GADO 4U6SA 1LRJA 2O7QA 3SXPA 3ZN2A 5G4LA 4GGPA 4GH5A 4ZQFA 4LISA 5T8KC 1A7KA 1OMOA 3V1YA 2PKQP 3DAPA 3DOOA 4Y6SA 1HDZA 4B7UA 5CDTA 3NKLA 4FOOA 3OP4A 2HJRA 2X5OA 4L9RA 1A71A 2HO5A 3OEWA 5CDSA 2D5AA 4DPMA 2PKRA 2YY7A 4RVGA 2WD7A 3KUXA 4XQ9A 5JYEA 4AL4A 2PH5A 2ZB3A 3ONFA 3GVHA 4WCFA 4XRRA 5EQDA 2TMDA 3C8MA 1HWYA 1SC6A 3E9QA 3IIEA 2Q2QA 2JFHA 2EXXA 1GCUA 2Q49A 3GNSA 4J0FA 5ES3A 1C0IA 1G0NA 1PL8A 4JJIA 4FW8A 1BDBA 4E5YA 1E5QA 5JDIC 3OM9A 1JKFA 1T2FA 4DLBA 4UVDA 2GR9A 4JLWA 2VYNA 2PZMA 2AEJA 2BKAA 3P5SA 1GYPA 2Q2VA 1WPQA 2RH8A 1HE2A 1IB6A 4NDNE 2NTVA 1PJBA 1A4UA 3T7CA 4JQCA 1B26A 2ZYGA 1I3MA 3LF2A 3ZHBA 3F6YA 1DC4A 3WQQA 4RVFA 3JQ7B 1UAYA 1XLTA 1ZIDA 1DFIA 3M2TA 4J6FA 3TNLA 5CEFA 3TDKA 3U62A 9LDBA 2WYVA 5K6AC 2JHGA 3HJAA 2J6IA 1KEUA 3PQEA 2WE8A 3RUCA 3GHYA 5LCXA 3WDSA 3QE3A 4OXKA 3ICPA 3JQBA 4I1IA 3DBVO 3DZFA 3GZNA 3NUGA 2EJWA 5HRUA 4YJDA 3S8MA 1IPFA 1F0YA 2O2SA 3S2IA 2CDCA 3WSVA 1N9GA 3M2PA 4E6PA 3FCOA 3KB6A 2GPTA 2OP1A 2D3TA 3AUAA 4PG6A 5I9LA 1X13A 2HMUA 4PRKA 3HDYA 1L7EA 4EYEA 1Y6JA 4P8RA 4KDFA 1NQOA 1GQ2A 1PL6A 1ULSA 3ZDFA 3MOIA 3GRKA 1XGKA 4EJ0A 1OI7A 4DIFA 1IUKA 3ZI0A 1IY8A 5G4KA 2D59A 2OHXA 1OC2A 3MWDB 3GUCA 1YXMA 4LVUA 4Q3NA 3ZV5A 4EUEA 4W7IA 2NWQA 2Y93A 2GDZA 2O4UX 2VRBA 4IM7A 3CE6A 4LCEA 2Q4BA 4U0KA 4HNGA 4DBZA 4EUFA 1BMDA 1Y5RA 3Q6IA 2Q2WA 4PLWA 3STHA 1ML3A 1J49A 1BW9B 2WYWA 1TI7A 1NASA 1V6AA 1PS9A 1KY4A 5A9SB 3OETA 1PQPA 3LLSA 3KRTA 4XR9A 3L6EA 5KJ1A 4M86A 1DRUA 1BDMA 1ADFA 4BNGA 3DBLA 3KM0A 1JKIA 2FPPA 3DAFA 1NVGA 4D3DA 2ZTUA 3OICA 1PJ4A 1YS4A 3F5QA 2QW8A 1PS8A 1QKIA 4U8GA 4L8VA 2HJSA 2A4KA 4U7WA 1YB5A 1QYWA 4B3JA 1P0CA 1L7DA 2CZCA 4BB6A 1RWBA 2EKQA 2FZEA 1OFGA 3NDIA 1BRMA 4JJGA 1I30A 4BL5A 3IKTA 4BS9A 2J5QA 5G0WA 6ADHA 3WMXA 1X7DA 1MXFA 2GGSA 4J1QA 3W8EA 4B8WA 3I5MA 3OQBA 2GUGA 1ZNQO 2RIRA 2CDBA 3WGGA 3GVPA 4CPDA 3G0OA 4CQMA 3WJ7A 4WASA 4M54A 3GK3A 4OOEA 1ID1A 3QWBA 4EITA 2Y99A 1SO8A 3PYMA 2GRAA 4CR6A 2FPGA 3AM4A 1UDAA 3OIFA 4RCVA 5I8WA 2EGHA 5I7SA 2EGGA 1S7CA 5JO0A 1ULUA 2HRZA 1IPEA 2C5EA 2PFGA 3QVOA 1VSUA 3COSA 2EKLA 3GGGA 4IZHA 3GN2A 1UDBA 1R66A 3A28A 4R5MA 4YT2A 3BMCB 3HB4X 2CMDA 4BKPA 2WWRA 4J3FA 4OIMA 2C20A 2RH4A 5FI5A 1UAGA 4RF5A 4UUOA 5KJFA 3RU7A 5L4LA 3K96A 3O26A 1ZXBA 3GMSA 1AN9A 3W6UA 1EQ2A 1P0FA 1F12A 3RKRA 4CM1A 3HG7A 4BKUA 4XGKA 1D7OA 1XIVA 4R3WA 3N7UA 1N7HA 1ENPA 4MP8A 4AJ4A 2C7GA 3KYDA 3PJFA 4OSPA 1CERA 4EBFA 3RIHA 1AUPA 1NQ5A 2V6GA 3CZMA 4OYRA 4GGOA 4RDIA 4L73A 3QVWA 5JC8A 4R1TA 3H8VA 3ZHYA 4CMAA 3M1LA 3I52A 5T5QA 4S1VA 1O94A 2H9IA 2YFHA 3I9LA 3NGXA 3UKOA 3ZU3A 1HSZA 4JBGA 2D2IA 3AUSA 3JQGB 3MJEA 1DBVO 1LRLA 1M2WA 3AJRA 3DBRA 3DZJA 2WEKA 3KSZO 4NI5A 2CDAA 4XGNA 2IXBA 1WMAA 3E82A 3PJEA 1HDGO 3PHHA 1HDOA 3DOCA 2IODA 2DTDA 5JS6A 1X7HA 1ADCA 4HY3A 2HUNA 3DHYA 1LX6A 1ENOA 1PJ3A 3MTJA 4BMVA 3HSKA 4XB1A 1YL5A 4M49A 1A5ZA 4DYDA 3W4KA 1LDBA 5EQFA 1MP0A 4P4NA 4Z0PA 4TRNA 3OIGA 4GI2A 2AE2A 3FRJA 5DOZA 4UREA 4J4HA 4IMPA 3S2GA 3UCEA 3C7AA 5TRTA 3LU1A 4WLNA 4Z9YA 3ZWPA 4EZBA 4CMCA 1B8UA 1B8PA 1C0LA 3U09A 1Y8RA 4ZHSA 4D3FA 6LDHA 4WOJA 3JQFA 1MC5A 2VUUA 3GFGA 1E6UA 1VL8A 4CUJA 3WQRA 4BGEA 4CL3A 3RUDA 2QQ5A 1SAYA 1I2ZA 2HK8A 1EE9A 1I2BA 5C5IA 4J91A 4IGEA 3WOHA 3OJEA 3U4HA 5F5LA 3O8QB 1LI4A 4AJJA 4UUNA 4IDFA 2J3HA 4PLTA 3LQFA 4BUCA 1GFSA 3JD0A 3PLNA 2E4AA 1RKXA 4DQVA 4F45A 5F5NA 4ONEA 2BI7A 3IOYA 4IDBA 4KTTE 3ZWXA 4YAIA 3P2OA 4C7JA 4OXYA 3TZKA 1Z7EA 4XYBA 3VZSA 2WE7A 4CM4B 2CF6A 1QORA 2BHLA 4WEOA 2X0NA 4D0RA 5DBGA 3WWYA 4NJMB 4YA6A 2Y68A 3VVCA 3WGQA 3BTSA 3QWFA 4GX1A 5JDCC 4AJ1A 1GV0A 1U28A 1FXSA 4MVJM 3BHMA 1Q7CA 1XHLA 4EW6A 1E1LA 4ILKA 2VZ9A 2PR2A 4IDEA 4HXYA 3G3EA 3WWZA 5IFLA 1Q1NA 2G5CA 4TRRA 1CIVA 4HV4A 4HX5A 1NXQA 3GLQA 3KYBA 3L9XA 1LSJA 2IZ0A 2B4QA 4J4BA 2Q50A 5DULA 1I24A 4YBZA 5BSGA 1TT5B 4JBHA 2R00A 4WNIA 1O95A 1U8FO 3JQAD 3VH2A 3PHGA 1U8XX 1SBYA 1UP4A 5DBIA 3ZNQA 1LU9A 3QRWA 3TZCA 1K3TA 5DZSA 3W8FA 2FHSA 1OZAA 1U4OA 4TRJA 2UV8A 1E3WB 4J1TA 4E2YA 2AQIA 4IZIA 1T26A 1JN0A 2PV7A 4JK3A 1M75A 4Y67A 5TSDA 2ZATA 1GQYA 3BXXA 3FNFA 1KETA 4PCVA 5I9NA 3L07A 1BWSA 1QP8A 3DEYX 3MZ0A 1Y9AA 2CSUA 1X15A 4BVAA 1E92A 3ZWMA 4CQLB 3I4FA 3VVBA 3L4SO 1P1KA 1IL0A 1PU2A 4KUHA 5T64A 1LNQA 1PJCA 4E31A 1NAHA 1E6EA 1PR9A 3OA0A 4R41A 2NADA 2VHWA 1CDOA 3F4LA 4PG7A 4R1UA 3WIDA 4YRDA 1U4SA 3PZRA 4CLOB 3Q2KA 4BV8A 3LF1A 4TSKA 4W6ZA 4XDZA 4BKOA 1TXGA 1XSEA 3D64A 1GCOA 2V6MA 4XYLA 3PHJA 3PI7A 4LMRA 4PLCA 3GG2A 3ZNNA 4MOWA 2HLPA 4YWJA 1GZ6A 3MJVA 3H6KA 4D79A 3PFFA 1U5CA 1B14A 2UUPA 1DO8A 4FFPA 2C2YA 1ZZEA 2VWPA 3PWKA 3RJ9A 4B4VA 3JYQA 4ZU3A 1SB9A 1R6DA 1DC5A 4BQPA 2JAHA 3WTCA 4D42A 4CM6A 3GPDG 4X54A 3U4DA 3JQCA 4I9HA 3G1UA 4LK3A 3RJ5A 5I7VA 2YV2A 1WVGA 4BGUA 1E6WA 1M67A 3NDRA 2Y0DA 3I9MA 4BNFA 1YOVB 4KQWA 3CEAA 1HEUA 1JW9B 4E30A 3LSYA 2HMVA 2VRCA 3S1LA 1JAXA 3JQ9A 3DC2A 3E5MA 3PJGA 1BTOA 1P1RA 2LDBA 3FPLA 4E32A 3Q9UA 2GERA 1DHRA 2W90A 1YONA 1OBFO 3FN4A 3GZ4A 3L4BA 5BT9A 1HXHA 3RCBA 3KHUA 3ONDA 5GZ3A 2JD2A 4NBTA 2GN9A 4A27A 2VNAA 4UVIA 4Z0HO 1GAEO 1NAIA 3UFXA 1YDEA 3RUEA 4A73A 1HZJA 1AGNA 1MUUA 2QRJA 3F4BA 2CVOA 3VTZA 3KVOA 5KKAA 4DA9A 2GD1O 2GZ3A 5F21A 4O59O 3GOHA 4CMEA 3WYEA 1ZBQA 5T6BA 1QLHA 4RORA 4QTZA 3ETDA 2O3QA 5A04A 1B3BA 4B8ZA 5ITVA 2P2SA 2PD4A 2AQKA 1HDYA 1DRVA 1ZK1A 3IUSA 4PFJA 2Y1GA 4CLRA 5F1PA 1BXGA 3AI3A 4QFCA 1U9JA 4KUGA 3K2EA 2GZ1A 3LYLA 4RVSA 4WCFB 3VH3A 5KCZA 1U3UA 2I3GA 2O2YA 3INGA 4OOFA 4DLAA 4Z6KA 4RO0A 1YJQA 4ID9A 2C2XA 2B37A 3EK2A 4RVUA 2JHFA 1ZEMA 4RZIA 4PZDA 1TVEA 3LT2A 1NX6A 3FD8A 2I76A 4XQEA 3JYNA 2O3RA 3BHJA 4H15A 3AK4A 2BFOA 2IDZA 2Y05A 4XD2A 1OOEA 3RSHA 5HBRA 2I6TA 1W0CA 1Q7GA 1V3VA 2DC1A 2J5KA 2YHUA 1EBUA 3TWOA 1NWCA 2YDYA 5A03A 4NJOA 1G1AA 1V8BA 3NJ8A 5ENVA 2NTJA 3VDQA 1VRWA 3GA0A 1R4MB 4ZN6A 1W73A 3D4NA 2FOIA 5CEEA 4D43A 3JYPA 3OH8A 3ON5A 2VN8A 1EEHA 3DMTA 5CP8A 3TZQA 2R2GA 4AJOA 3DQPA 4BNLA 2P9GA 2X0RA 2YQ5A 1E3SA 5A9TA 4RF2A 4XB2A 3ENNA 4KMSA 3OEYA 1CQIA 1VI2A 4PLVA 1I32A 4IQ0A 4P22A 5HS4A 3AFMA 3AW9A 3JYLA 5JCJD 2YV1A 5DBFA 3X2EA 4A5OA 4TKLA 5L95A 3RUAA 3RI3A 1LEHA 4A0SA 4PN3A 2NACA 2VZ0A 4J0EA 2XXBA 4TMFA 3IL2A 1GPJA 1IE3A 4GSKA 4AJ2A 2DM6A 1Q0QA 2FR8A 3GEMA 3RFXA 4J49A 3WICA 5L9AA 4KUEA 1CF2O 4JP2A 5IDXA 1N9GB 1P44A 4K1LA 4OJNA 1Y8QB 3SJ7A 2X9GA 1F8GA 1C1XA 3QIVA 4WECA 3ZWYA 2AE1A 4IXTA 2GCGA 4UUMA 4DUPA 2ZTLA 4YAGA 1CWUA 1DFHA 4URFA 1F14A 4J16A 1ZSVA 2BRUA 5FI3A 4YRAA 1MG5A 5IN4A 1EE2A 1U3VA 2NU7A 3AM3A 1A4IA 1X1EA 3CKYA 3C1TA 1ZFNA 4WLEA 3UN1A 1DC3A 3GPIA 3DFUA 2IYPA 3L77A 1LBEA 4YT8A 2CVZA 2DBVO 1TB4A 1XG5A 5DT9A 2WSBA 2JJYA 1UXHA 4GKVA 5A05A 3V1TC 3A4VA 3K8ZA 1P1IA 3DMYA 4KQXA 1NFQA 5JAMA 1X14A 3TF5A 3KSDO 3UHAA 4LRSB 2AHRA 3LLVA 3O9ZA 3GMDA 1DHTA 5H82A 2JAPA 5IJZA 3U5TA 3H9QA 2NVWA 1JQBA 3X2FA 1E3LA 4Q3AA 4CM9A 2EERA 4RPGA 1IZ0A 4FGSA 3NRCA 3ROKA 1C14A 2HMWA 4PG4A 2HRBA 1QRRA 3I23A 3VZQA 4DYVA 4GMFA 2VZ8A 1ISGA 4WLFA 1ENYA 2NU9A 1E3EA 1SPXA 4BQRA 1DLIA 1HSOA 2GNAA 1I3NA 2Q45A 3QVSA 2W2KB 3M1AA 4RGBA 4WUVA 1PR3A 5ENDA 1P74A 2PH3A 3ADOA 1A72A 1ZO8A 4CMIB 2VOJA 3DTYA 2I65A 1KEWA 3CMCO 2VNSA 1MC4A 4J7CA 1C1DB 4K26A 2UUOA 1LSUA 2V7PA 3EHEA 5ICSA 4BGIA 1ZJZA 3V8BA 1BG6A 1QYDA 5ADHA 5EL0A 1WXDA 4AG3A 1P77A 1OC4A 1RM4A 3BMOB 4LVCA 5BSEA 3I9OA 1B0AA 1K6IA 1TT7A 1U5AA 8LDHA 4FFRA 3BA1A 3DDNA 4D45A 2C5AA 3FWZA 4EJMA 4OHUA 1XEAA 4CODB 1LDNA 2AA3A 4AJKA 4YJGA 4INAA 3UCXA 4XYEA 2HSDA 3VPHA 2CD9A 3WGZA 5CG2A 3JQAB 2EJVA 1UZMA 3TQHA 1PJ2A 4MVJA 4YQZA 4J7UA 3ROMA 3NEPX 3PZBA 3GC6A 1ZUD1 5GMOA 1I0ZA 4E2WA 1HLDA 3GRPA 1N8KA 4KWHA 4J2HA 1U3TA 3B1JA 3ROQA 5ILOA 2PGJA 2UYYA 2OL4A 1VM6A 3LC2O 3ZW8A 3GQVA 4HFNA 4J4TA 2P4QA 3UVEA 4EI2A 1N1EA 2P68A 2B4TO 5EPOA 1PX0A 3E1KA 4Y6PA 4UUPA 3EUWA 5TF4A 2X86A 3MJTA 4DLLA 3QWIA 2Y1CA 4BNNA 1VL0A 1LSSA 4PRLA 1QV7A 2DBRA 2C59A 1EUCA 1JKJA 5A9RA 2AEMA 2P5YA 2WDZA 5KJ6A 1PGPA 4ALJA 4KTVE 4GAEA 5CPFA 4Z3DA 1NQTA 4CMBA 4BIIA 1TEHA 1IULA 5A1TA 2O3TA 4CLXA 4E13A 3VOSA 3PRJA 3P2YA 4RF3A 1GUFA 1UXJA 1N7GA 3FTPA 4M89A 4XKJA 3DWFA 5DCYA 1S6YA 4FC7A 2J3IA 4FCCA 3KEOA 3DBRB 2ZCVA 4DWVA 3M6IA 4EDFA 2QZZA 4IJKA 4MKXA 1VKNA 1YBAA 2X5KO 2OFPA 4BKRA 1T2AA 2NVUA 1J6UA 1UR5A 1RJWA 4B7CA 4F3YA 2A92A 5LDGA 4RL6A 5L7YA 3JQ8B 4AJLA 4WEQA 1J0XO 3NGLA 1PZHA 1I3KA 3H7AA 4HFJA 4IIUA 4U6QA 5FYDA 1GZ3A 5A06A 2ILTA 1GEGA 1HYHA 2HK9A 4FPXA 1GPDG 4PZEA 3QLJA 4XEHA 3ORFA 1LLQA 1X0VA 1XA0A 3C1AA 3GVXA 2FSSA 3PGXA 1Z82A 1R0LA 3AY6A 3ULKA 2IZZA 3INRA 4BB5A 5TIIA 1Y8RB 1KERA 3H65A 3INTA 4W9NC 2G0TA 2WJPA 4FDAA 3L6OO 1M66A 4IQGA 4XCVA 4BNZA 4WCDA 4OQZA 1ZSYA 3W8DA 5C7OO 5ICMA 5L4SA 2FN7A 4CM9D 3I9KA 3CTMA 5CDGA 3AOGA 1HF3A 2AMFA 2XXJA 4TKMA 4H7PA 5T67A 4DL9A 4MIEA 4N5MA 3ZV3A 4DC0A 2BF7A 5MDHA 2VT3A 1ZK3A 3PPIA 4Q39A 4FBGA 3CUKA 3LC7O 3IP1A 1PJTA 2ZKLA 4NHEA 3IMFA 4ITUA 4ZQEA 3K31A 2QX7A 4CV3A 1R4NA 2YW9A 1YB1A 4EJ6A 2O3SA 4WLVA 4Q3DA 2IYOA 4LRTB 1ZK4A 1ISMA 1ADGA 4E21A 2ZB8A 2B83A 1DSSG 5J23A 3GG9A 4RLSA 2H6EA 3TPCA 1XU9A 3G79A 1FK8A 5U4QA 5C37A 2AW5A 1H9BA 3ONEA 1I36A 5IZCA 5COAA 3Q0EA 2GASA 1MGOA 5BSHA 4NPCA 5A3VA 1Z74A 1YO6A 3D4PA 1WDMA 3H9GA 4NFYA 3ZWAA 1LA2A 4YAKA 4XQGA 3ZWVA 3R1IA 4YJHB 3JD2A 1E7WA 3DB2A 1E7RA 2CNBA 3ABIA 1HL3A 4QFDA 3GUYA 4DXHA 3D3WA 1NFFA 4UULA 5KTKA 1O6ZA 4L74A 3ZWWA 4AJPA 3P7MA 4XRGA 3WYBA 4MVJD 3ZZNA 5B4TA 1O0SA 3FTNA 1DEHA 1OAAA 3ZWBA 3EVNA 3WSWA 3FNHA 4JCOA 3H4VA 3ZHZA 2VYND 1E7YA 1I5RA 3SX2A 1DIRA 3K92A 4RVDA 1PJLA 7MDHA 4NBRA 1KOLA 1HT0A 3F1LA 4FR5A 1GQQA 5T57A 3HNPA 4O1MA 3OSUA 1IHYA 3AOEC 1E1KA 3DFZA 2O23A 4K9DA 4ND3A 2PY6A 3SLGA 2WYUA 3WBBA 2Y1OA 4QX6A 1JWBB 2Y1DA 3F1KA 4OAQA 1I10A 4IDCA 4CL8A 2C7VA 2A94A 4IS2A 1EK5A 5I7EA 1Z6ZA 2H1SA 4N5NA 1C3VA 1LTHR 3HFGA 2X0JA 2YJZA 1B7GO 1XCBA 2VHYA 3CSDA 1AXEA 2O3JA 3WGIA 4IDGA 2XF8A 4MVJH 2PA3A 3DTTA 3JCZA 4GBJA 2EW8A 4E33A 3E5RA 1ZMTA 1XWFA 4BHTA 1WZEA 1H94A 4CUZA 3NT4A 3V2UA 5K0ZA 3H5AA 1HTBA 1ZKMA 3DXFA 2OOSA 4IIVA 4U0JA 4O5OA 5DP2A 8ADHA 1K6XA 4II2A 4AJEA 5KIAA 1HZZA 4RF4A 3K73O 3CPSA 3PDUA 1UXGA 1ZK2A 2W2LA 3LT4A 2F1KA 3KEQA 3SEFA 1RPNA 2WD8A 4HFRA 4IMRA 4JROA 1W4ZA 3BTOA 3DZBA 3QQPA 3JQ7A 1NR1A 2Y1EA 1E3IA 1LQUA 2Q46A 1PQWA 4Y9DA 4CR8A 1PWZA 4MVJI 2ET6A 2EG9A 3W4IA 3Q2IA 4FJ1A 3A9WA 4G81A 2FR1A 3DBHA 1VJ0A 2FRDA 1T2EA 2DU8A 1RM0A 5JFOA 4J1SA 3GN1A 5T8KA 5HM8A 5FF9A 1DB3A 3DHEA 1H2HA 3K6JA 2F00A 1GD1O 3QJ5A 2QRLA 3OJFA 3ST7A 1NQAO 1E7SA 3D1LA 1PS0A 1P1JA 2Y67A 4IBOA 1PJSA 1TA4A 3RUIA 3TSCA 3CMMA 5L45A 5G0TA 5AXBA 5TQVA 1NR7A 3OMLA 4PLYA 3BAZA 4O63O 3TFQA 1UDCA 3U9LA 3UGKA 3DZGA 4YJFB 5B1YA 3ROPA 4RPHA 2RHCA 3DZIA 4RZHA 1BGVA 2DVMA 1R12A 3L0DA 3HZZA 3ADPA 3PP8A 1H93A 3ZWCA 3OJOA 5I7FA 4PVDA 2I66A 4MP6A 1D1SA 1BXKA 5TGDA 1BXGB 2BLLA 3U3XA 3ZNPA 1N2SA 1KEVA 4Q3BA 4YB8A 3SC4A 2EP5A 4W82A 3ZHXA 3HWRA 5H83A 4TQGA 1NPYA 4DMMA 1PGNA 1XR3A 2HCTA 1JU9A 1D1TA 4NK5A 2PGLA 4JJFA 2NU6A 1B8VA 1GYRA 4JXKA 1Z75A 5I9MA 1SEVA 1BW9A 5HA5A 5JAZA 4PG8A 5A9SA 1CEQA 1PGJA 2J3JA 3ITDA 2UAGA 1DJNA 3KO8A 4CQMD 4UVGA 5KKCA 4R4JA 4FJ2A 1GR0A 4OKIA 3Q3CA 3KLPX 1MXHA 3FNEA 5CDYA 1HDCA 5B4UA 1SEPA 1X0XA 2NVBA 4PLZA 4WE3A 3WFJA 5EERA 1RM5A 2BMAA 3AU9A 1LQTA 3JYOA 4YAJA 3TZHA 4CJXA 1PZGA 4P4LA 2POQX 4DC1A 5IN5A 2GZ2A 3KV3O 3G49A 2YHIB 1T24A 2OORA 5A4DA 5G2OA 1Y7TA 3NTOA 1H6CA 3PVZA 2BGLA 4QT0A 5G0UA 1PJQA 1ARZA 4DBVO 4XZ3A 3NTRA 4J9UE 1ENZA 3PWZA 2GN8A 3NJ4A 4BMSA 2NTNA 1UXIA 3ANLA 1DPGA 4IINA 3GAZA 4TZKA 2P4HX 3NDJA 1O8CA 3QWAA 4MPDA 2DQ4A 5COBA 3PXXA 4I5GA 4CV0A 3QHAA 3V2HA 1Q0HA 3KZVA 2IEBA 2OP0A 4BO7A 4KWIA 1LDMA 3AI2A 3PLRA 4LSMA 1QYCA 3VHRA 2EWMA 1C1XB 4W7HA 3UF0A 2DLDA 2X5JO 5EJ2A 1YH3A 1UUFA 3TL3A 1KBZA 3HDQA 2JCYA 3H9EO 4YEDA 1YDWA 1WW8A 4RPJA 5ER6A 3DL2A 4A2CA 2O4CA 3BMNA 2W2LD 4DMLA 1B15A 5JYDA 4EUHA 1JVBA 3P19A 1LDEA 2Z1MA 4GPD1 5EINA 3BMCA 5IF3A 4MP3A 2ZTMA 3WFIA 5CFZA 2P9EA 2OZPA 4IUYA 3W1VA 3NAQA 1YB4A 4EEXA 2PNFA 4NU6A 3EVTA 2TMGA 2AQ8A 2OXIA 4AJHA 4W4TA 4XJTA 3PIDA 2YQ4A 4R5HA 1U2GA 4WCFC 3SJUA 3MTGA 2DT5A 2VWHA 1B2LA 1QYVA 1XDWA 3PEFA 3BZUA 1O5IA 4DIOA 5JAIA 1DDOA 4L4SA 4B79A 4CV1A 1SZJG 1HE3A 3FPCA 2OBYA 4BNMA 1FDSA 3N58A 4BNVA 4N18A 4RPKA 3ZWOA 1RM3A 4TZTA 4TROA 1A9ZA 3R3JA 3GNQA 3UW3A 3LK7A 3NV9A 3D5TA 1LLCA 1GYQA 3R0IA 5ITWA 4D44A 1EMDA 3QVTA 4YACA 1T2DA 4GLLA 2NSDA 4GVXA 3JQGA 1JWAB 3B6ZA 4F6LA 4ZQGA 4L4XA 1QG6A 4RQTA 3WLFA 3VTFA 3VDRA 1Z45A 1FJHA 3JD3A 4HADA 2E49A 1KYQA 2FZWA 4ND1A 2FMUA 2G82A 4FB5A 3MOGA 3HN2A 2NUAA 1FDWA 1PZEA 4XIYA 2ZYDA 4BNIA 2P91A 4BO5A 4J1NA 4I08A 1NHGA 2Q1SA 3WXBA 1TLTA 2JFGA 1JA9A 3ICCA 1NYTA 1ZW1A 3WGTA 3PDJA 1E7MA 1W8DA 3JQBC 2EP7A 4YDRA 3FI9A 4ZJUA 5L40A 1GZ4A 2PZJA 3GDGA 3JTMA 4NMHA 4CLDA 3VH4A 3D4OA 2WD7B 4IJWA 2BI8A 3ZV6A 1A9YA 5DDIP 3IC5A 5F1OA 3SVTA 1PZFA 4JNKA 3RVDA 2GSDA 3E18A 3CIFA 1B3RA 4IJUA 1SMKA 1QXSA 5JAQA 1D4FA 3TN7A 4DGSA 3EW7A 4HKTA 1LDYA 4GMGA 3K5PA 4OO3A 2SCUA 4BNWA 4NH4A 2H5LA 2E48A 4KOAA 5KVSA 5CG1A 1FMCA 3LC1O 1N5DA 2WM3A 5JC1A 1I33A 4L4RA 2NQTA 5C3MA 4ESOA 2QZ9A 4IGFA 1XQ6A 4II3A 2VWQA 1R16A 4MVJG 3RUHA 1UH5A 1Y81A 5A5FA 2Z95A 2AG5A 3EZYA 3NX4A 4CM8A 4MIOA 4J2OA 1KY5A 2NLOA 1VE9A 3GEDA 3PWSA 4K6CA 5JMWA 2X8LA 2X9VA 3C1OA 3H2SA 1T4DA 3OFSA 3MJSA 3R3SA 3W6ZA 2HAEA 1G6KA 2GO1A 3A1NA 3I83A 3N74A 1JAYA 4OGWA 3RKUA 1Q2XA 4NJMA 1CRWG 2X7HA 5DP1A 1IYZA 4ZVVA 4B4UA 3QW2A 5U9CA 1PTJA 1X7GA 2E37A 2W8ZA 1NBOA 1J5PA 1KVUA 4B7XA 1ORRA 2PD3A 1XQ1A 4BO1A 4ZGWA 3GFBA 4YAEA 2C82A 1VKOA 4YQYA 2B5VA 4MVJE 3GZNB 3UICA 3WNQA 4FOSA 3RC1A 3BMQA 1O9BA 1E3JA 4GWGA 4BNHA 5JLAA 4HNHA 1NP3A 3LT0A 5KJCA 1T1SA 4QSMA 2NVUB 1LXCA 4GQAA 3WLEA 1DJQA 1T2CA 3OQ1A 3WX0A 4B4OA 3OHSX 4J9VA 2AXQA 2ZIZA 1NWHA 3KETA 3U4IA 3RBZA 3D5QA 4IS3A 1H6DA 4XGIA 1ZSNA 4ALMA 1MA0A 2B69A 1BHSA 3PQFA 3I1JA 4BV9A 2JL1A 4UEJA 5KVCA 5FWNA 3ZU5A 4B3HA 3HE3A 1KVSA 3V2GA 4DREA 1HYEA 4QO8A 1N1GA 5G4KB 1E7QA 4K28A 3K2BA 2YYYA 5KNLA 3UOGA 4RDHA 4CQLA 3LDHA 3H5NA 1VLLA 1YQDA 1LC3A 2RHRA 3VKVA 4IY1A 3EY4A 4CM5A 2VRCD 4CLOA 5JDCA 4ALKA 3F3SA 5MGBA 2HKIA 5BSFA 4NU5A 1E1MA 2QRKA 5L4NA 4OQYA 2NV6A 3DBLB 2FSVA 4IDDA 3HFSA 1VSVA 3PIIA 4FFNA 5IZ4A 1VJTA 2NM0A 1H9AA 4HWKA 3HDHA 4XR4A 1LRKA 4XYMA 1QMGA 1EZ4A 1V35A 4QO7A 3T4EA 3E48A 4UAGA 4GX0A 4GVLA 4XYGA 1H6BA 2DBQA 3PK0A 1H5QA 2PK3A 1V9LA 2GYYA 4NBUA 3TOXA 4OH1A 1PIWA 1GUYA 1LC0A 4B4WA 3H2ZA 1NVMB 5AOVA 3RASA 1QV6A 2CFCA 3L9WA 4WJZA 1KIFA 1IZ9A 2RAFA 1EDZA 1PGOA 1R0SA 2RBEA 3EC7A 1NVTA 4H3VA 2EV9A 3F47A 3RROA 4CQMB 2W98A 3MEQA 4M55A 4BO6A 4C4OA 2FR0A 2FPIA 4BGVA 5TNXA 1BXZA 4GL4A 4I5EA 3GF4A 1P33A 2B36A 4Y6RA 2E6UX 4NFSA 2A9FA 5COQA 3B70A 4J43A 2PLAA 3ZW9A 4CUKA 3OBBA 3EDMA 3I9JA 5HS6A 4NR0A 3H9UA 3IAHA 1MX3A 1HE5A 3GH3A 3C3XA 1MG0A 3WBFA 3BHIA 4C7KA 5JMPA 3G1TA 3WR5A 3DHNA 4EGFA 3RC7A 3ZNOA 3AM5A 2Q3EA 3O03A 2YFQA 4P4GA 2ZJ1A 4GKBA 1ISIA 3JQFC 2C0CA 2O3UA 3GY0A 1A7AA 1AHIA 2CF5A 1W6UA 2VQ3A 2Y0EA 2Y0CA 3IP3A 1AXGA 4R9RA 4DTIA 1V3TA 5AVOA 2XAAA 4FJ0A 1O89A 3KYDB 4AFNA 1P31A 5I8ZA 3FSRA 5JPIA 1Q0LA 3VPFA 3FR7A 2VOEA 3VH1A 1HDRA 4O6VA 1I8TA 3C7CB 3D7LA 3EYWA 1WDLA 4LCJA 3ZV4A 3WJAA 4AVYA 1RYEA 1YBVA 4E5NA 3LVFO 1R4MA 4ND5A 1H6AA 3O4RA 1YL6A 4JGBA 4WLOA 3S55A 1BVUA 4E5MA 4Z3KA 1WZIA 2Q4EA 4RV9A 3AFNA 5GZ1A 4EEZA 3UCFA 5TJHA 1E77A 3RBXA 3ASVA 4CM3A 3JQ6A 4MINA 1KS9A 3NYWA 1XELA 3CINA 1YQXA 2B0JA 4TVOA 2CY0A 3DBHB 5FEUA 2O7SA 3GVCA 3AUUA 5AXDA 1CQJA 5A5EA 3BTVA 3UAGA 3D0OA 3I3OA 4FSHA 1EBFA 1ONPA 2X6TA 4TVBA 1NM5A 3DZHA 2BELA 3A06A 2UDPA 3UXYA 2UVDA 1MV8A 4D46A 3HQ4O 1D3AA 1DIAA 1P45A 3S2FA 4MKRA 2WTBA 2R00C 1Q7BA 2VYVA 3ZWNA 3AWDA 3MWEB 1Y8QA 2BD0A 3I4CA 3QY9A 2Q1WA 3MJCA 5G0VA 4GSLA 4R69A 2D1YA 3AI1A 1UXKA 3DONA 2OUIA 2EF1A 2EIHA 4R1SA 1CETA 1K89A 3IJRA 2GN6A 4E2XA 2B4RO 1EK6A 4E3ZA 4ZA2A 5DN9A 3JQEA 2D5CA 3KYCA 4D0SA 2ZYAA 3WYCA 1EFLA 4R3NA 3E8XA 2JD0A 4FIZA 5JSFA 5JBIA 3HDJA 4L76A 1ZH8A 1K0UA 1LDGA 4TWRA 2X23A 2ZQYA 2GF2A 2J3KA 3SC6A 5BNTA 4PIVA 1PL7A 2I5PO 5AXAA 4RQUA 5BR7A 4A26A 3OF2A 3FBGA 1ISJA 1V0JA 1XKQA 1VPDA 1LLUA 2HK7A 3FWNA 4A7PA 1AHHA 1EFKA 4HUJA 4G5HA 4E5PA 3WTBA 1BVRA 4Q9NA 4OM8A 1BSVA 2I67A 3HADA 4UVEA 1V3UA 1WMBA 1YQGA 5G0SA 5TS3A 4YT5A 1HE4A 4M87A 2PD6A 1R15A 1WDKA 2G1UA 4WGGA 1KC3A 1P1FA 1U7TA 1UP7A 2I99A 3E6AA 2X58A 4FGWA 1QYXA 3GR6A 1L1FA 5KWEA 1MFPA 1DXYA 2OMEA 4PGFA 5CPBA 1EDOA 2DKNA 1YVEI 2W2KA 3PFWO 1PQUA 2G17A 4M1QA 2JFFA 2ZQZA 1E5LA 4RVHA 3ENKA 1Z7BA 2HMTA 4WKGA 4CMIA 2AQHA 3E9MA 4N7RA 2VHVA 5BNIA 4D7AA 5EMHA 4Z0TA 4BNJA 5TX7A 2CUKA 1C1DA 5DOVA 1GDHA 4DPKA 2PZLA 2Q1TA 3DR3A 3JQ9C 1U3WA 3V5NA 1XYGA 3ZU4A 3Q1LA 2ZTVA 3HHPA 4PVCA 4YPOA 1ONNA 1VJ1A 3BMOA 1G0OA 3L4BC 5A02A 2O48X 1HRDA 5AQ1A 1Z73A 5F3RA 3ETGA 5THQA 3U0BA 4CR7A 3WNVA 4HFMA 2I9PA 4ALNA 1PEDA 2J8ZA 1ISFA 3CH6A 4CMEC 4NFHA 3JQAA 2XOXA 3BMNB 3AU8A 4TRMA 4FC6A 2NQ8A 2DUWA 3E03A 5AYVA 3LT1A 2PGDA 4NBVA 5B4VA 2Z1NA 1XU7A 4I5DA 4FQ8A 5KJEA 4DQXA 3PYXA 3ZCXA 3VPXA 4XDYA 1KVQA 1EVYA 4PZCA 3KSUA 4G65A 4QECA 4E12A 3OA2A 3GAFA 4ZQBA 2EEZA 2V6BA 2RCYA 3VZPA 3Q11A 3WMWA 4WOKA 2VWGA 3PGJA 1N92A 4I9UA 4PLGA 1P3DA 2A35A 1GY8A 3ITKA 1LLDA 1GV1A 5BNFA 2R6JA 2IE0A 5JW6A 4PLPA 3WG9A 4YR9A 4I9NA 2DBZA 1DC6A 1SNYA 2VYVD 4Y8VA 2VTEA 5ER9A 5IDQA 4HBGA 2VHZA 3H3FA 3T4XA 2QYTA 5TC4A 4CMGA 4J7XA 4BNKA 3F5SA 4JIGA 4E5KA 4M8SA 3DMTC 1HKUA 3GDFA 3RFTA 3OJLA 4GX5A 5L7WA 4BO4A 3PTZA 4CMKA 2YUTA 3EZLA 5B12A 5IAAA 3WGYA 5U1PA 3GNTA 3OIDA 1UJMA 3JQ8A 4QQRA 1H2BA 2Q99A 2FWMX 4BKQA 4BNTA 1C0KA 5H81A 4NIMA 4R51A 3BIOA 4CMJA 4QXMA 5IDYA 1ZK0A 3FNGA 4A10A 4XQCA 3MJ4A 3NT5A 5JDIA 3HN7A 5JY6A 3NT2A 3WS7A 1UP6A 1FDTA 4R68A 1T4BA 1SOWA 3TRIA 3VKUA 5EIOA 4CLRB 1ZJYA 3KBOA 3JSAA 3OECA 2JCVA 3QA9A 1YBMA 4K6FA 1JDJA 1EUZA 2IXAA 4MDHA 4YYZA 3U4CA 2PTGA 4JX8A 4N54A 4R9SA 3PQDA 4LMPA 5AXCA 3H3JA 4E4YA 5DF1A 2DPHA 4D41A 3ZGYA 1J4AA 5TJ9A 2G76A 1PSDA 2HQ1A 3OJ0A 2P9CA 3WIEA 5K6AA 1EUDA 2P5UA 3HB5X 3C85A 4BNUA 4R1NA 5JE8A 3GEGA 1GUZA 4CMHA 4CM8B 3BYZA 5LC1A 4B3IA 1DFGA 1FF9A 4YCAA 1PWXA 1KVRA 2BH9A 1DAPA 1PGQA 3GDOA 4FN4A 2X0IA 4ZQHA 4R01A 4ZD6A 5LDHA 1EVIA 4ALLA 1B16A 2OO5A 3R6DA 3AY3A 4OL9A 4O0LA 4MVJF 4ALIA 2AEFA 4DRYA 3UUWA 4MO2A 3L6DA 4XIJA 5FFFA 4DPLA 1UZNA 4IPTA 2DTEA 1HDXA 1NHWA 3DZKA 4W99A 4AICA 5JCXA 4BO0A 4YJHA 1NFRA 4IDAA 4BMNA 5TT1A 3BMQB 1WWKA 5DCUA 1YGYA 1NNUA 1QLJA 2JKVA 3B1KA 4LSWA 1R37A 2V65A 3GVIA 4MJLA 1DIHA 1GTMA 2QIOA 3RBVA 4FD3A 4W9NA 2OGUA 4I5FA 1I2CA 4OSOA 3I6QA 3SBOA 4D3SA 2VUSA 1HLPA 2ZJ0A
chains in the Genus database with same CATH superfamily
5K3FB 1LV8A 2Q1YA 3UYKA 1YVDA 4CLHA 1WLYA 4NE2A 3F9IA 3QJGA 1F0KA 3AF4A 4CLEA 5KHLB 4QREA 3CZRA 3LXRA 5T6MA 3VOBA 5F7XA 4NJEB 4MMZB 2CUZA 1AVTA 2BGMA 3QWHA 1K0FA 3VI3B 4OI4A 4QLOA 2Z5LA 2ZDHA 2CLDX 3PUJA 4PF1A 4XLLA 5KQMA 2O5CA 3VVMA 2PL9A 1HYGA 1YSCA 2FSIA 3NCHA 3QLUA 1ZQ9A 2XMZA 1L4FA 2V8OA 3ILXA 3M5CA 4MVJP 3QKRA 3WB0A 2R44A 4WVFA 1WO8A 1Y3CE 3TEJA 4WPGA 2R97A 1OI2A 4C01A 3ZIUA 4G36A 4HB2A 1U0GA 2NSJA 5F1KA 1DIGA 4R2XA 3CG0A 1XMVA 4X1IA 4FSXA 1D2MA 2JZOA 3R3ZA 4L75A 4YV7A 1X1QA 3MJFA 4MV6A 3IVCA 1P7WA 4DIBA 2QL6A 2PWZA 4Q3CA 4YJ3A 5FOWA 2Y9MB 5JHGB 4G24A 7ABPA 3IOCA 1DLJA 4ECAA 3B3GA 1IHXA 2ZFUA 3D6MA 1A82A 2DH6A 3L02A 4EPYA 4F21A 2ODWA 4JFRA 5H3HA 4MLDA 4EFKA 1U7DA 4RD3A 2YDXA 3BDVA 3BQNB 2V59A 2Q6OA 1LV7A 3G6KA 3PXDA 4AYTA 3WAJA 3SNHA 2ZRQA 3GFFA 4EDHA 3C3MA 3LDAA 1CV2A 2YWDA 5ANRB 3SMVA 4XUEA 2I3AA 5F2KA 4AIRA 3USZA 5HIAA 5CR9A 3QMMA 3L0ZA 4JKOA 1QJ4A 5FA5A 5JS1A 2JS7A 3H4IA 3J7AC 1EKXA 5HTOA 3FRIA 4UJ5A 1AUOA 1DZIA 1O8BA 1H2XA 4J90A 3F7NA 5IC4A 3SSOA 1FTNA 2Z09A 1L4GA 4X20B 4H2DA 5JH7A 5K5EA 3PEEA 4HOYA 4EA8A 4HPXB 2GARA 5ALZA 2JCXA 4LGVA 1CS0B 2B35A 3ZQJA 4L5BA 5DTRA 3OCWA 1KBQA 4E5DA 1YVPA 3BN3A 4B3RB 1PAUA 3A37A 1D8AA 3ELBA 3D5EA 3G8BA 3KLMX 1GHTA 3RAJA 4D9HA 3DQQA 3LUDA 5K45A 1Y7LA 4Q9HA 2B6NA 1D0IA 4C1NA 5CAEA 1J23A 3A1FA 2EF0A 3TJRA 1FUKA 4B9AA 2WKRA 3FB1A 4XASA 1I01A 3JV7A 2AFHB 1Y33E 2ZB4A 1ULZA 1S2DA 2N75A 4JKYA 1KK3A 1NXPA 4KSYA 3GJ5A 3SLKA 3UY4A 3IMEA 2NV2B 1NVEA 2Y8EA 4K6MA 5ALDA 4YJGB 4P7BA 5AP9A 4XM1A 4M9QA 4QEDA 1COZA 3NBYC 3SFTA 1JLLA 1ZNWA 3PKIA 5IU6A 4QGSA 1Y9EA 5EP3A 1YFKA 4UAVA 4WBXC 3QF7A 3T52A 4ZICA 5KQGA 1ZXLA 3AHJA 2FG5A 4RHEA 3VR5D 2HF7A 1ONOA 3B20A 1CEXA 2GN4A 3FMGA 2H3HA 3HCAA 1KVTA 1N2OA 2O07A 1R0KA 3WE7A 2O52A 3MERA 3W6NA 3GJ6A 3R20A 2KLHA 3C6ZA 2C54A 3CT6A 4ME6A 4N7MA 1JFTA 2OHGA 4N3NA 1KGDA 1XK6A 1MX1A 1IM5A 2KBFA 2YHAA 3E61A 2AHOA 4PQEA 3TQTA 2QN1A 1YE3A 4PQFA 5A3JA 3FVRA 5KNBD 1ZEJA 4NCNA 1UJ6A 3E8SA 3EIUA 3X0DA 3VYVA 2ZE6A 2ORWA 2OLEA 4YCCA 4MKIA 3MMSA 3A4LA 4OFXA 2V96A 3E9NA 3TH5A 1JKJB 1V16A 3DMRA 4JKIA 3UKJA 2UUCB 4N5LA 4BV2A 5DHAA 3RANA 5FPHA 5CFPA 1JEYB 2WJWA 3F98A 3H42B 3P9IA 5F4ZA 3RLFA 4LWPA 3PJDA 4FU0A 5JD4A 5KC9A 1KI2A 3UPTA 2PL1A 3RYHA 4XJSA 4CYMA 2WF5A 1TM2A 5CITA 2VXBA 2DFDA 1RYDA 4R54A 5CXSA 1T3TA 1KYXA 3VR5H 3CUSA 2N3ZA 4YO8A 1KEPA 1YJAA 1I3LA 2DUNA 3GT0A 2HPVA 1G8MA 4OQFA 1KC1A 5D1NA 2GLXA 2VSXA 4OMDA 1TT5A 3EGVA 1SOAA 1ZD8A 3DJYA 4L0CA 1YNSA 1CX9B 4L6AA 3RU2A 2CL7X 4NCAA 5I45A 1HETA 3F46A 4BP9A 1ZCFA 3E9RA 4P32A 3RO7A 1LI7A 4GPEA 3TFWA 4DG9A 5KNBH 3O8OB 3DO8A 4UEKA 1HFKA 3FF4A 5DN6A 2NPFA 4AMZA 3KXKA 2MR6A 5ILGA 1ODIA 3MCUA 1MB2A 3S2EA 1O7JA 1P2DA 4JAVC 1CEEA 3QUQA 3TOZA 4CIXA 2ZRJA 2FZKA 1GAXA 3GQBA 5HQ3A 3L8ZA 5DNWA 2IHBA 1FDRA 4ISBA 5BYKA 1G8PA 2GVZC 3FHLA 1PT8A 3ONNA 3WQHA 5IHXA 1S8AA 2EQBA 5EP1A 1SXGA 2RHHA 3C5WP 4XVHA 4KZPA 1NJ5A 5IEBA 2MYTA 3ZZ1A 3GGPA 4MUEA 1MT3A 3AB3A 3EEYA 3FKJA 1X80B 1CJUC 1P1HA 4Y98A 3MWFA 2BGKA 3EMKA 2QL5A 4GLOA 1EVJA 5THKA 1FLDA 1DKLA 1UC4B 3ET5A 4IG4A 5ARDA 3UUGA 5KOIA 3NBKA 3UOAB 2QV0A 2PMCA 1MO2A 2F6RA 5JASA 5LZ8A 1K6MA 1AKVA 2AFVA 2DWCA 2ZJ8A 2WVJA 2O5EA 3A6GA 5ALHA 3IOEA 2JGMA 1PSWA 1DAOA 1VL1A 1ZMOA 5C4MA 5C5EA 5ELXA 2C2GA 5JWRA 5DMXA 3QHPA 4YVFA 4M88A 1GEEA 2C07A 3N3AC 1WP4A 4HJXA 4C2UA 2J9FB 3NI2A 4UBKA 4YCSA 3Q10A 4F3CA 3N5CA 1WSAA 4MIYA 1B42A 2H7YA 2Z9BA 3KLBA 4KBFA 4Q9AA 5B2ZA 3A0UA 3BD8A 4Q7JB 4Z49A 2XCOA 3BE6A 4R6XA 4ERNA 1AOXA 4EATA 2EFYA 3QU4A 1KJQA 2PPLA 4CM7A 5IANA 3NALA 5T4BA 3F8SA 3ILVA 2PUGA 3L0IB 1AKNA 3MILA 4NBWA 4LDRA 3SKYA 2GHIA 2X8JB 4B6RA 1FDUA 2WM8A 3IJPA 2UYHA 4MGZR 1Q83A 2GCEA 3L06A 3TW0A 1U1IA 1W36D 3KR2A 3P9CA 1ZCJA 1H0KA 4A23A 3CLHA 5KQRA 2Z04A 2SECE 2HMAA 4M9RA 3QV1A 1R8XA 1IC6A 4FVTA 4ICIA 4Y2JA 4AULA 4ETWA 5AD1A 2ZBEA 2IYRA 4IIJF 2Q4OA 2YV3A 2MSEB 4UNNA 1UEXC 1KYWA 2VTDA 3U19A 3WXMA 2VHXA 3T1TA 4IOKA 3I37X 4G0MA 5DNAA 1OXVA 2P0YA 1YJ8A 3HA7A 1QFZA 1CBUA 1DQRA 1NUAA 3ES9A 5T4HA 3S2UA 2D0DA 1QV9A 4FE7A 5CDUA 3QVXA 4JV5B 2P77A 2I4RA 2Q3JA 4TL9A 4U3JA 1GNLA 2R8PA 4CT5A 4QHSA 3LOPA 1Z0JA 4G0QA 4Y6SA 3DAPA 2WINI 4B7UA 1XZFA 4FOOA 4F06A 1B6GA 4LI0A 4B8YA 2HO5A 2V9ZA 4A1FA 5CDSA 3FCCA 1NUTA 4YUYA 4P80A 1KJ8A 3U40A 4XQ9A 2HJVA 2ZB3A 4GOXA 4IYRA 3OG9A 5K3EA 1XRMA 1HH4A 3PUKA 4WXEA 3D0KA 5E6RA 5BPHA 5HZHA 2RGRA 1ULHA 4EG1A 2X42A 5BWLA 2Y6VA 4N0QA 4XOUA 1A8HA 4KQGA 3WKAA 3T7TA 1E3QA 4U1RA 1IN4A 4P1ZA 4CU2A 4LZZA 4M36A 4LJ8A 1RS0A 5ICFA 5LFAA 4FLFA 1YI0A 4FT4A 4E5YA 1UM8A 1NYLA 3FCAA 2J31A 1T2FA 4G01B 3HL4A 1JXMA 3EWIA 1RWQA 4DLBA 3T3EA 1I94B 4EF5A 2NYVA 3DC7A 1B1AA 3M34A 3VPBA 1N0UA 5B64A 2VI5A 1XQ9A 4CIAA 3HLTA 5C4IA 3L93A 2PZMA 1RE1A 1W9MA 3P5SA 5TQ0A 1DKMA 4LZNA 2V55B 1EJBA 3FVWA 2G9NA 1HE2A 2JBWA 4KN5A 4AMUA 1QPBA 4NDNE 3U7JA 1P3JA 2J7PD 4EUKA 1S3GA 2BFFA 1KSGA 4CCWA 3KKOA 4N12A 3T7CA 2ZYGA 3KQYA 3HYTA 3LF2A 5JALA 3PEWA 5JSUA 4LV6A 4RZQA 4DVGA 6PFKA 2CYAA 4RVFA 3JQ7B 2O0LA 2DF8A 2F48A 1TK2A 1IXYA 4RYDA 5IVKA 4S1OA 5I5GA 2HLDA 3PXEA 1DFIA 3M2TA 4PQYA 3W2EA 2JAWA 2C94A 4P36A 3TDKA 5CEFA 2YX1A 4HF7A 5K01A 3FAKA 1QQTA 4R9NA 2JHGA 2RGAA 1FU4A 2HA7A 3HJAA 3K5WA 1NW5A 3OM0A 3OTQA 4US1R 1KEUA 1K4YA 2QMEA 2WE8A 1C7ZA 3EFOB 3GHYA 1FYDA 2XB8A 3QE3A 2ZQ5A 5EY5B 3JQBA 1SZDA 3GJTA 4BQEA 2JIBA 2A9OA 3GBPA 3S8MA 5FBZA 1IPFA 1EK1A 1G7SA 2GI4A 4X60A 3GGSA 4LWOA 2J87A 1GZSA 1XZHA 1NNEA 3WSVA 1QP7A 1FS5A 1L3CA 3M6UA 3VSAA 3QVVA 3V4LA 2JI7A 3FCOA 3NBMA 3KB6A 3W5HA 3QX3A 1SCJA 1VJRA 2CCJA 2GPTA 2NTEA 3LCVB 2MDTA 2CYCA 4Y7CA 2XCQA 4KIWA 4DEVA 1MH9A 2D3TA 2JLQA 2PMDA 2W4IA 1OBCA 1OH6A 1XA4A 3HDYA 3DKIA 5A4IS 1IZZA 4P8RA 5PNTA 2GCOA 4K9OA 3BE5A 3TG8A 3ZDFA 5CTAA 1T9BA 5FNVF 2GWRA 5TB5A 5ECDA 3ZBPA 2AXNA 1IUKA 2ICAA 2QMUA 3E05A 4KEAA 1QRSA 1IY8A 4OEHA 4Q3NA 2OHXA 1OC2A 3RAEC 4DLNA 5EIBD 5IF9A 1XDZA 3QEMA 4TMTA 5HEKA 4D4LA 2FZCA 1YAHA 3N6RA 3CE6A 4Q0MA 1K8XB 1UBEA 2YIDA 5SYNA 4E2FA 2OV1A 4A92A 1BMDA 1Y5RA 2C5GA 5LOVB 3QX7A 1CUBA 1K7YA 2NU6B 2PFKA 3EEBA 3QTLA 4LC1A 5H7XA 2ZJ6A 1W4LA 4KI7A 1CUIA 3U3OA 1J49A 1ZM7A 2JVIA 1TI7A 1VG9B 3ZVLA 4EVIA 1I7SB 4PBRA 2DFKB 3QEBZ 1Z0SA 3BPSA 4UMDA 3JAKB 2AX3A 1ADJA 3CLKA 1EUDB 1SU8A 3M6VA 4H1UA 1PWHA 4HAUA 3LBAA 4MW5A 3DBLA 4BNGA 5JCZA 3KM0A 3THXB 1V8ZA 1YB6A 4NFLA 5I6DA 3VR6A 4D3DA 5H59A 3OICA 2AXEA 5KYUB 1U0OC 2ACKA 3L7KA 4L22A 3B5EA 1HNZB 1CY8A 2QW8A 3IALA 1IHPA 4MR8B 5L3RA 4WBNA 2GM5A 3JR7A 2HJSA 3LPMA 3LJKA 4FNGA 3NAMA 1PFVA 4BWFB 2A4KA 4U7WA 3JVEA 1TIPA 3PCTA 3OTHA 2CZCA 1L7DA 4LDNA 2WG2A 2TMKA 3TQRA 4RY2A 3ZG6A 2E4WA 1R27A 4K8OA 3ZLJA 4OXIA 1BRMA 1E9CA 2ORED 3NU1A 3IKTA 1XL0A 4BS9A 2J5QA 1T8SA 4JOQA 2CNLA 4HN9A 6ADHA 3WIOA 2WOOA 1YS9A 2XRYA 3K9HA 4CL0A 4Y7DA 1E1RD 1BMFD 2FAXA 2EKDA 2O6HA 1E2QA 3UMSA 3W8EA 5IM4A 1CRPA 3SF8A 2XTZA 4F9GA 3R44A 4ZK6A 2FFBA 2AW3A 2HHLA 2NO5A 2C4NA 2CDBA 5K3DA 3GVPA 4CPDA 4F86A 5E9JA 2ZUBA 4MGEA 5JNRA 1UC5B 2M6SA 2XDQA 3RADC 3WJ7A 1Y63A 1ID1A 2QG9A 2DPYA 1XCJA 1P4HA 4EJSB 1SO8A 3PYMA 2GRAA 2P4SA 3AM4A 5D1HA 5BXYA 2L17A 4ZOLA 1M2NA 3E15A 1J9ZA 5JO0A 3QVOA 2ZDQA 3DF7A 1N8SA 1C4WA 1NI5A 1SJ9A 2QN2A 1VSUA 2WA2A 3WJ1A 2EKLA 4KFSA 4R5MA 1MA3A 1Q20A 3I39X 3IUMA 3SJZA 2IS1A 3P9SA 1LBIA 4CTNA 1ZN2A 3KK0A 3FKSD 1YB2A 4HEQA 2PKEA 1AH2A 4O4LF 2RH4A 4A82A 4PC2A 5ALVA 5BYAA 4RF5A 1JR3E 1NTRA 5JBNA 4CE6A 4O8ZA 1SVWA 3D6TB 2GKGA 3O26A 1ECJA 1ZXBA 2GEKA 3OEEA 4AF7A 4X1IB 1FEZA 1FTQA 4OHOA 4CM1A 1U63A 2GBFA 4GPBA 4F3TA 3HG7A 1QG0A 2WFLB 3KT8A 2JLXA 1XIVA 1N7HA 4GDFA 3LPDA 4GO1A 4ARZB 3KYDA 1JBQA 2FETA 1H0RA 2FDXA 1GQRA 1LVHA 2F8MA 2AKAB 1CERA 2IA5A 2REOA 1FNBA 5DMHA 3TR6A 4EBFA 2ZJ4A 2IXGA 1ORWA 2CHQA 3CLSC 1JA1A 3S27A 4DUGD 2J46A 1FBNA 4R2LA 3PGMA 3QVWA 4X97A 5JC8A 2PMBA 2CVPA 3SAJA 4CMAA 1DOAA 5BPFA 3HU2A 2GXUA 3M1LA 4BFWA 4BFUA 3H4TA 3L49A 1O94A 3DVAB 4NESA 3DXXA 2Q9UA 3UKOA 1HSZA 3EJ6A 4XDHA 1DL5A 2Z5VA 4DB4A 4BX8A 3DVQX 2B92A 4H6WA 2W11A 1LRLA 2B5OA 4JYPA 3SHWA 3LP6A 3OPXA 4FGLA 4C22A 3ETCA 3A10A 1R6BX 2WEKA 1JG3A 2BPOA 3LDUA 3TOCA 2VDJA 5H9WA 1AKYA 1CDDA 1RPJA 1M9NA 3MPUA 3PHHA 4R3UC 2JF0A 2B7BA 1X7HA 5H68A 1ZCZA 1ADCA 2JANA 5IW8A 1N75A 1TJ4A 4HY3A 4CTKA 5JH7B 1YDMA 1SVUA 4RA9B 5D84A 5MN5A 1PJ3A 2OLJA 4KV9A 1PTJC 2NUAB 4BMVA 3K0SA 4MDFA 1QH8B 3L1JA 3GDWA 3T95A 1G3RA 4RETA 1GPBA 3WFZA 4GYWA 2NMVA 5IZCC 1V7CA 4P4NA 1WUKS 2RI0A 1QHFA 4TRNA 5HZMA 3DLIA 1K27A 3OIGA 4GI2A 2AE2A 2ZSAA 3TEMA 5DOZA 1HTWA 2ZUUA 1PF7E 4IMPA 5CAEB 1Z29A 4MI1A 3OZRA 5DGIA 2W93A 3LU1A 3R2JA 3ZUGA 4EAQA 4Z9YA 3ZWPA 3EE6A 5DM70 3SZLA 3U09A 4F96A 5MF6A 3NBFA 2HU8A 5B1IA 3DPUA 4PXYA 2R66A 3GFGA 4OB6A 1E6CA 5FAXA 3TRDA 4BMOB 5JXIA 2HT6A 3NDBB 2GCNA 2WT8A 4ITRC 1ZM9A 2WQ7A 1EWQA 3VU0A 1XVUA 4KPYA 2HK8A 4D0LB 3RFFA 5C5IA 2AS0A 1XEFA 2Y4OA 2XTAA 3ZE9A 1BD3A 5JEEA 3O2QB 3WOHA 2BMFA 2X9LA 3R5TA 1WPRA 2W2XA 1R6XA 1T4GA 3BFJA 3K4PA 5DI3A 4O02B 4V1CA 5KNDA 2DERA 1U90A 1Q21A 1CE8A 2VEOA 4MUYA 1HEIA 3SZUA 4BUCA 3UMRA 2ABWA 4LOKA 3OZ7A 1C7QA 1RAFA 2ZAMA 3TE6A 2QNBA 2GK6A 4DLTA 2WIJA 3NHLA 4Q7KA 1RLMA 4IDBA 1OREA 1MORA 4N0PA 3TR0A 3TZKA 1QANA 2GHRA 1TO6A 1Z7EA 5BY2A 2RGNA 2QVGA 3M6WA 1YR3A 4OP3A 3PC8C 2AKEA 2CF6A 3FTFA 2BCJQ 2OBBA 1G42A 2BHLA 2ONCA 3D3QA 4D0RA 3WWYA 2EL7A 3RBAA 5IKEA 3EOBI 3BKXA 1GV0A 1FXSA 5CU7A 5IT0A 5KB3A 4B0PA 4COKA 4UAJA 4EG6A 4ILKA 1BVYF 4YBRA 4G67A 3OLXA 3MRSA 2PR2A 3HS3A 4LAFA 5JTUA 3L79A 3WWZA 4C3OB 4EARA 5HX7A 5IFLA 2G5CA 1L9KA 1KR2A 1UWCA 1CZNA 3SI7A 3T7KA 4JLOA 3GLQA 4E1VA 4HSGA 4JOCA 1U31A 3V1NA 4LFBB 2H2HA 3WZLA 1SUCA 1DXOA 4QXRA 1V4NA 1Q92A 4TS9A 4HAIA 1TT5B 3IVRA 2R00A 4NDZA 5ALJA 4R8RA 1DG9A 3VH2A 1QGOA 2ZSFA 4U7PB 3KX2A 1AS3A 1SBYA 1VIAA 3R40A 3AFHA 3LSTA 5D87A 3ZLVA 1QO0D 3W8FA 1PK8A 3W9UA 2OFXA 3OZGA 4J6EA 1AA6A 4FBLA 4H27A 4DWJA 1I51A 3H1PA 3BJRA 3KPYA 1N25A 4BC1A 3J80A 4OUDA 1TKBA 4BU0A 4CWAA 4HVCA 3JVDA 1YNOA 3GQBB 4E2YA 4AO8A 1HV8A 3CLTD 3PPXA 1XQVA 5IC6A 1JZQA 4F4FA 5GTDA 5LMNB 2ZXEA 2PV7A 5FULA 3KDAA 2IYVA 5LKRA 1L8OA 2VYCA 1M6VA 3HKCA 1NOJA 1AHNA 1C81A 2NYUA 3N0WA 4LHVA 3GJ0A 3L07A 1QU2A 3EOZA 1QP8A 1WQ4A 5JRDS 2W6JD 4AD8A 1XV5A 2CSUA 1X15A 3CN7A 3WGNA 1E92A 1X8JA 1ZESA 2C2ZA 3ZWMA 2YIMA 1P1KA 5T64A 4CDNA 1OYVA 4QUIA 4F9TA 2IOHA 3GROA 1F7UA 4E31A 4RJLA 1E6EA 4TYWA 2ZJ5A 2VHWA 3GUVA 4ESVA 2WAMA 1NG1A 3PFGA 4MW9A 4NCIA 3VTFA 4D6XA 4BV8A 1M7HA 3JW8A 1L6RA 4TSKA 4EYSA 4YAWA 1FUUA 1UAAA 2BFBA 4IGIA 5I4CA 1IUPA 3NHUA 3PI7A 3VSDA 1NMZA 3SR0A 1XL1A 1NVVQ 4OQXA 7MHTA 3ZVRA 2K7ZA 4YWJA 2K7FA 3K70D 1U0JA 3D3KA 4HDSA 3I34X 1M5RA 3BRWD 1R9JA 3FOCA 4MIKA 1B14A 1KXZA 2JVJA 4GU5A 4FFPA 4WAUA 2VWPA 1VLVA 1ZZEA 1TKCA 3OFJA 3PWKA 1G8FA 2GEVA 1HRKA 3V8RA 4B4VA 4KXQA 1SB9A 1ZOSA 4KWTA 3SCZA 5JJBA 2ANBA 1JKXA 1P91A 4OBBA 1CY6A 3QG1A 1IN7A 2JAHA 2RHGB 1OFUA 2GBIA 3EWSA 1KQ3A 3FHOA 5HKLA 5AM5A 1DGQA 3OWXA 4TOIA 3NWBA 1GILA 2G72A 1AUQA 5JSYA 1Y6GA 3SPXA 2QE7D 1Z36A 4NLLA 2RKOA 4ENQA 1N6NA 1NI4A 4BNFA 1Y34E 1TW2A 2ZBVA 1MT0A 4KQWA 3SS8A 2C8JA 1B8NA 3ZHRA 3BQ9A 3LSYA 2Q6TA 1UOOA 2R11A 4MV0A 2HSJA 5EGNA 4CU5A 1VPLA 2I2CA 3JQ9A 4OLHA 1BTOA 1CRZA 1E1QD 5AW9A 4E88A 1CF9A 3CZ5A 4EX7A 2UVPB 1ZD4A 3N2YA 4NYMR 2ACWA 1O1YA 1YONA 2C4TA 3FN4A 3RFCA 3ZBQA 5GZ3A 1HXHA 5E4YA 3ONDA 5J59A 4NBTA 4TT8A 4KG7A 5JIBA 4PFQA 2CL5A 4P0PB 2WPDD 2NAFA 3L7BA 2E6KA 1YDEA 1E2EA 4BX9A 1QHYA 1Z6XA 1U9IC 3F4KA 4A73A 2IV2X 2P1RA 4Y6QA 4AS3A 3TQIA 5FOXA 3FIJA 1AGNA 2CVOA 3ROGA 2FE1A 3ACBA 4G5YA 1JT9A 2XBMA 1RWWA 1UK6A 2E5WA 1ZBQA 4G25A 2JFNA 3ZK8A 1RTKA 4D3XA 1OFVA 3T5DA 4N6GA 3IP9A 4X24A 3L6CA 4F8EA 1OT3A 3LTNC 1Q84A 4U00A 4B8ZA 4F1JA 2Q7XA 4DSTA 1IVSA 3O74A 1B76A 3N0TA 3ZTYA 4D9IA 1AIPA 2EZ8A 3GLUA 4X5OA 3KSBC 5CFQA 1AKMA 1EUYA 1BXGA 1ZKDA 2VBIA 1OFTA 4HQ0A 1LNZA 2NAPA 1OTXA 1T6NA 3INGA 1SKUA 1TQ6A 1UXOA 2R84A 1GKUB 4RU1A 1RZRA 3N70A 1P0QA 3EZ9A 4K6KA 1W85A 1UMDA 4FWTA 3PVSA 1SBHA 3UAYA 1JR3D 1NX6A 1Z38A 1GCIA 2WKSA 2I76A 3IIJA 1EJ2A 4H15A 3DZ8A 4LJ4A 2LD4A 2BFOA 2R96A 2Y05A 3AK4A 4EFLA 1SKYB 1AQIA 4FEYA 1R6UA 1R8YA 4GBGA 4UDYX 3VHLB 5HBRA 1A7JA 1V3VA 1NVWQ 2BGTA 2YHUA 4NBSA 3NANA 4B4KA 4QOSA 1CUYA 1T8RA 3ETHA 1PO7A 3KXLA 1R7RA 2ZAIA 1KIMA 4LDZA 4NJOA 1Q57A 4ESHA 2NTJA 3N2EA 3WQBA 3L43A 3WKDA 4Y1EA 2XAUA 3GA0A 3VDQA 5K8JB 4AG6A 1WE2A 4TSRA 3AHCA 4I5IA 3JYPA 3OH8A 3ZHOA 2ZYIA 1L7VC 1QVWA 3ON5A 3GRCA 1Z07A 2QT0A 3TZQA 1V45E 2AKYA 2R2GA 2QOEA 3MQFA 2HT1A 1Z18A 4AJOA 2QZSA 2WFMA 1X8LA 5BSWA 4FZVA 1WXFA 2CBGA 3HU5A 3PFIA 2X0RA 1DUSA 4DR3B 3L3BA 1W87A 3KJZA 4BX2A 4BNDA 4KAXA 3OEYA 3N76A 3OLYA 521PA 2F8SA 2YBEA 4KVGA 1QTIA 4EVQA 4QGFA 4LEIA 3UHOA 1EXWA 5HJ2A 4D8UA 4WFKA 5FUWA 3C48A 4LA4A 4Y9UA 4TKLA 2DY1A 3NBUA 4YV0A 2E1PA 1L8LA 3PKZA 4RKYA 2OXCA 2C84A 2VZ0A 2N1MA 2J6BA 5AT1A 1SKYE 4Q7EA 3I8SA 4AJ2A 2W8BB 1WF3A 2DM6A 3IB3A 1P75A 3MVEA 4KACA 1M5UA 5BN3A 2V1UA 1FB5A 4HR7A 1APBA 2HJHA 4R8KA 2J3QA 1J8DA 1P44A 3TMYA 4HVTA 4DR7B 5KDDA 3S4YA 3DAYA 3VR3A 2X9GA 3TJMA 4A6EA 5FUVA 3H3XA 4WECA 4MEBA 3NW9A 1I4OA 2GCGA 3IR6A 5ALSA 3RC3A 5B6IA 2W0SA 1F14A 3AILA 1H2FA 4Q19A 2BRUA 5FI3A 5IN4A 4GR4A 1K8QA 4ND7A 4NZZA 4B2PA 2CN1A 1X1EA 2V7XA 4KMRA 4UZFA 4C89A 2F67A 1ZFNA 3OPVA 2O8CB 3NNSA 3H1FA 3DFUA 4IQFA 4TWIA 5KAPA 2IYPA 3SFVA 3I6MA 3QEMB 4LYYA 4N7JA 2DBVO 2X4DA 4RA6B 1XG5A 1CZRA 1QNLA 1W59A 3RVSA 4KDCA 1F4PA 2WSBA 5I51A 4GKVA 1I5OA 5HK8A 5LP6B 4U2KA 2FWBA 2YIVX 5A5DA 2XGJA 1QHIA 2G3YA 1E9VA 3TF5A 4IRXA 3VU8A 2AHRA 4KXWA 3LLVA 3GMDA 5H82A 3DKVA 3H9QA 5BUSA 2QM8A 1JQBA 2OBXA 1AS2A 2NZXA 3AHGA 3I6ZA 4Q3AA 1Z8FA 4P7GA 5EJ6A 2Y1LA 3C3KA 2EERA 4XWOA 3BG5A 4HNQA 4RPGA 2ZUTA 3RR2A 3V97A 2H2FA 3OD5A 3NH9A 2HA4A 4OXXA 3AG5A 5K4GA 1WCIA 1H65A 2YJ4A 4Q5IA 3OLZA 1XNQB 1DVRA 4PFKA 4BQRA 1TMKA 3OI7A 2P2NA 4WBSA 4BFXA 5LOVF 1G3UA 4A15A 1HT3A 2V4MA 2ZRPA 1ID8A 2JATA 1ONSA 4E09A 2J5BA 4RGBA 4C4XA 4DLKA 3T1NA 3PQ8A 3O4JA 1JEDA 4Q82A 3ZBTA 5AKEA 1QK3A 5FXMA 2XKJE 2RGCA 4JDUA 5NLLA 1MC4A 2Y2VA 1TL7C 1C8BA 3N1UA 5CM2Z 4AZ3A 4EPVA 3K3PA 4ND8A 3SF8B 3CYFA 1CJMA 3CX8A 5ARBA 4CEIB 2P40A 3EVEA 3SE0A 4BGIA 1RI3A 4QM7A 1SUEA 2YYZA 3PQ3A 3AI7A 2W48A 2XDQB 1DO0A 3BMOB 1OC4A 1RM4A 2A9KA 2AK2A 2VAPA 4L7QA 4LVCA 4OIFA 2BWJA 3I9OA 1F7VA 4AY5A 1Y5NA 1K6IA 3WDLA 1TT7A 4QBIA 4C0AC 1U5AA 4FFRA 1B41A 4Q24A 3STYA 2MSKA 3FWZA 5FTJA 1TTPB 3P9ZA 4EY7A 4LJKA 3CZPA 2E2WA 2ZE5A 4CODB 1L5WA 2GS9A 3HEAA 4K9QA 4N5HX 3RGWS 5EJ7A 1HFJA 5KYYA 4UTPA 2QGNA 4INAA 3TGPA 2QN7A 3WGZA 5CG2A 3EQ9A 4DRXA 1GGHA 2EJVA 4QYIA 1F4LA 1UBHS 3U81A 4EPTA 2VVTA 4KPFC 4YP5A 2JHAA 3TQHA 1CPYA 1PJ2A 4MVJA 2C2BA 4AZTA 2C0QA 3MS7A 1LI5A 1HQKA 1Z83A 4F9EA 4L8WB 1UK7A 2H0QA 2V7TA 3GRPA 1UDRA 3NOQA 5EE5B 1DIOB 2MT9A 4Q01A 2IEIA 3B1JA 2CDNA 2FJUA 3AR8A 2EAUA 2PGJA 3AZPA 4HDMA 4RKQA 1VM6A 3LC2O 3ZW8A 4R9UC 5LLDA 1K3FA 4EI2A 1WHTA 3M82A 4K3UA 1RACA 4DSOA 1PX0A 1R5OA 1ISSA 5DN6D 5DTEA 1NN3A 2IYLD 4HQLA 4X1YB 3PUHA 1OXMA 1KDRA 3QWIA 4DLLA 5I3ZA 2HJGA 5CA0A 4BNNA 1VL0A 3HUFA 5FTNA 1QV7A 2Z83A 5A9RA 2AEMA 1O96A 3NTUA 3O1IC 4J0DA 5JEDA 4B45A 1A2QA 4G86A 4I4CA 2IIBA 3BIXA 3KR0A 4R2MA 4UDOA 1GSOA 4BIIA 4CLXA 5A1TA 4E13A 3BOSA 3VOSA 4INZA 1M2KA 3THWA 2TYSB 1N7GA 2QLFA 1I4TD 1N2IA 3FTPA 5FB3A 2Z5GA 4UKDA 2FVYA 1C7IA 1CQWA 1KRHA 3L7MA 4XKJA 4XUCA 3BWYA 2WWYA 3DWFA 3MUNA 3FHCB 1T6ZA 1BYUA 4M0MA 4P86A 1QQAA 3B2NA 3EOAI 2FZ4A 1ZMXA 3GFQA 2ZCVA 2XDYA 4DWVA 1S8NA 2V3WA 5M3BA 3Q8KA 3GLHB 4MKXA 4GNKA 3EB9A 4IH4A 2NPIA 2AYYA 4F2DA 4IDQA 3LTEA 4PSVA 5K8TA 4BKRA 1T2AA 4OAOA 3Q72A 1YMUA 1UR5A 1TM7E 4G1CA 4Q4AA 4RL6A 3JQ8B 1AB6A 2EBHX 4PANA 2VT6A 1M7BA 5ICCA 1BE8A 3FPBA 4MPPA 4RDXA 1U0TA 1JL3A 5EI5A 4PCUA 1GZ3A 1M54A 4O4IA 2ILTA 5K0FA 3EQ2A 2HK9A 4KQKA 4XEHA 5JBQA 3QLJA 5BV0A 3VNVA 2JKYA 1X0VA 4W63A 1M8PA 1MD9A 3KPJA 3MCZA 3C1AA 3GVXA 4HWTA 3ULKA 3RSCA 1TVCA 1ZIOA 4OHMA 1KERA 2DHRA 3TZEA 1L7MA 2G06A 1S3FA 2G0TA 1DBPA 4W9NC 5ERXA 4BNZA 1M66A 4IQGA 1YB7A 5FL7D 1BCRA 1TK3A 5ICMA 4CM9D 4NY1A 3I42A 1E61A 1IBRA 3I9KA 3IELA 2XD4A 5JH7F 5E3JA 5CDGA 2AMFA 3TXXA 4JT9A 1V7PC 4TVSA 5T67A 4MKHA 1Y4DE 1OX4A 3NGMA 3KPWA 4J1TC 4MIEA 4JI1B 3ERCA 3MSXA 4A8TA 5IT9A 1XDUA 1ZRNA 2NXWA 1EK2A 2VT3A 5MDHA 4Q39A 3RH0A 3E4DA 1CE8B 3AR6A 5KTNA 3WLQA 2ZSKA 3KQOA 1YCFA 5DT2A 4NHEA 3T1HB 5KU7A 3KB2A 2H48A 5K3AA 3FRHA 2QX7A 2WIBA 2B1QA 3SF0A 2OHHA 3EXIA 1G3MA 3NB0A 5SV2A 2R4QA 2XZPA 4DIUA 4PGAA 1U2DC 1JQKA 2VHJA 3G2LA 1MQAA 2JGEA 1CK4A 5M29A 5LZ7A 2B4KA 4KMMA 4QJ4A 2G09A 5ALKA 1UPTA 2BGIA 4FFSA 4H4CA 4ZOCA 2B83A 4RLSA 5L3QA 4CEHB 3K9LA 2HCBA 2OCGA 5IBPA 2G80A 1FNNA 5ESWA 5LLTA 2AW5A 3IRVA 3ONEA 3TTWA 3QEAZ 4UM9D 4EPRA 3FWYA 4JHLA 1Z0DA 2KSQA 3H84A 2GASA 4FFVA 5AM3A 1FMLA 1W0KD 3R75A 4OK5A 4D26A 1Z74A 3NC1C 3D4PA 3JVVA 3MPOA 5EPEA 2R1ZA 1N6RA 3T3OA 3L6BA 2AOXA 1FLVA 4K88A 3VPCA 3GEIA 2WD9A 3CR8A 1GLGA 3ZWVA 3QUAA 4YJHB 1DTWA 2GEFA 5FTWA 4L6IA 3I45A 1OWMA 1E7RA 1L5HB 5ALRA 2BZ1A 3ABIA 1HL3A 3QLVC 1NXTA 3G6WA 3KAQA 3UK0A 4Q7LA 1ELOA 5AM0A 4ZMRA 1BIFA 1IFXA 4AECA 5KTKA 1SC1A 5HGJA 1EFTA 4N65A 1PFUA 3PFBA 3P7MA 3LQRA 3WYBA 4D0NA 1KAHA 2VNHA 1BX3A 5AW8A 1O0SA 1RRPA 5B3JC 4ARVA 1ETHA 1MX5A 3CRZA 2YWCA 3ZWBA 3WSWA 3I6BA 5GGYA 5FTLA 1XMOB 4JCOA 3KUUA 4BQSA 1V8FA 4JLSA 2VF7A 1I5RA 4TUYA 4REMA 4ZAFA 5LKAA 16PKA 4OUDB 2I4NA 3LXMA 4LJ6A 1G66A 1UKCA 3OEHA 4RPIA 3VU1A 1ZHOA 4RVDA 4W5RA 1Z6PA 3DOUA 1IHOA 4CIDA 4NBRA 4YECA 3DOHA 4DJAA 7MDHA 3F1LA 5T57A 1GQQA 1E89A 1JDBB 3OPNA 5C5DA 3TMKA 3K05A 1M6VB 2ACEA 3LBFA 1H2ZA 1E3DA 3DCYA 4ND3A 4PX3A 2GK4A 2WYUA 2OCYC 1QIKA 3A9VA 4L51A 2Y1OA 3RFUA 4BBJA 2Y1DA 3EVCA 2FPXA 2RI1A 2Z4TA 1E59A 1SD1A 3CZQA 1XZLA 3RE1A 2A9VA 2H1SA 1LTHR 3DWEX 1RI4A 4HWGA 1JDTA 3MGKA 5EKXA 3VGJA 5F98A 2QPAA 2WILA 3FVQA 4QEZA 3C4VA 2YZKA 2O3JA 3MIIA 3WWEA 4BP8A 2YWXA 1MJGM 1XTQA 4ZOBA 3WGIA 2XF8A 4GBJA 1CD5A 3K7EA 4E33A 2G88A 1ONBA 3HXQA 2IS2A 5AVXA 1WZEA 2FKNA 3EZXA 3UB4A 1XTPA 2C4WA 2Q62A 3MWLA 3RF6A 3NT4A 3ZGVA 4CUZA 4BFVA 1U7WA 2XYHA 4U0JA 1NKSA 3GA5A 4YR7A 5DP2A 1K6XA 2BGJA 3KUKA 5K8UA 1HZZA 4ZKDA 3CPSA 3ZOKA 4ZC1A 1UXGA 1MQ9A 3ZDRA 3NVDA 3TGLA 1P9NA 1SCDA 1TGYA 2C8VA 2QGFA 1Z33A 4WWHA 4BPBA 1XT6A 1A8PA 3KEQA 2H4XA 5K7SA 2WAXA 2CZQA 4HFRA 3OLWA 3KTAA 4CN8A 1X2EA 3H18A 3WIBA 3QQPA 3T15A 3LUHA 1L4MA 1M1YA 1RZ3A 4TMKA 2QRVA 2J30A 4CR8A 1Q1ZA 1PWZA 3FYTA 4YFYA 5L6MB 1NI4B 1OBVA 4CTJA 2ZXFA 1MB3A 3EXHA 1QGYA 3AB7A 3UGJA 3RAGA 3ZX5A 2C57A 4JYMA 1W9HA 1KTIA 5T8KA 4B3GA 2J0UA 4DQDA 1C9NA 2OCKA 4RTRA 3LUAA 1QQBA 2CNKA 2XNHA 1TU0A 2PVCA 3EUEA 3K6JA 3RPEA 1LJLA 4BYGA 2HCFA 4DMCA 2HF2A 4ZXFA 1SPBS 2MYUA 1NF3A 3BGIA 3BWVA 4XXHA 2CK3A 5D01A 3FUXA 1E7SA 1E5TA 1PS0A 1M2FA 1GO2A 2EJCA 5BSTA 3VC2A 1TA4A 3TSCA 4K8RB 4JLUA 3HUTA 1ZS9A 3OCCA 1RRCA 5TQVA 1NR7A 1N5RA 1W1WA 3NEYA 1ZVQA 1T43A 1XPUA 1ZONA 1EPUA 1KAEA 2OZEA 4TS3A 2C7QA 3MWGA 2EFEB 1VRVA 1IEVA 1G6Q1 2JGLA 4NARA 4BMXA 5BV7A 5CD9A 1CJSA 4A8JC 3N8NA 2RHCA 3VR6D 4IF6A 1OIXA 1BGVA 2FP4B 1C30A 3ZCRA 4K0KB 2HPZA 3IMKA 1ZJWA 2WWGA 1TTQB 1KFEB 2A9PA 1BEZA 4LX8A 4AS1A 2FKAA 2FR8C 2YL2A 5I7FA 5FPSA 3JSXA 3MLEA 2OC9A 2I66A 2W43A 4MP6A 3BCUA 1NUQA 3SGLA 1TLFA 1BXGB 4YMGA 5B57C 3U3XA 5JXJA 4TPKA 4Z4EA 1DDIA 5CUQA 4W82A 4DCTA 2PEZA 3I28A 5H70A 1K68A 3KWFA 2QAGC 1RHMA 4DMMA 3A9TA 2BFEB 1IM2A 3PUZA 3TCXB 1W85B 1UMDB 4NK5A 2PGLA 3CNBA 5I7WA 3TGWA 4AQYB 2HFJA 3A6DA 3QVGB 3ID6C 1C4XA 3EBPA 1VMKA 2I9KA 3EYAA 4EHIA 5HA5A 3LBNA 4WQMA 4BJHB 3EVAA 3KOMA 2PLRA 1RXSA 4L5CA 5A9SA 2DETA 5ALXA 4B1FA 5HP4A 2NT4A 5D00A 2GSWA 4CGZA 4QOJA 3EFEA 1DJNA 4FN5A 1Y42X 4BMPB 1PVOA 4N8SA 1NQXA 4QJ5A 4R4JA 4AUEA 2YJ5A 3VR6H 3UWOA 1G4UR 2WTAA