2EKQA

Structure of tt0495 protein from thermus thermophilus
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
238
structure length
238
Chain Sequence
b'ERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQSLGAVPLPTDLEKDDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
publication title The first crystal structure of NAD-dependent 3-dehydro-2-deoxy-D-gluconate dehydrogenase from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 82
structure length 238
sequence length 238
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.125: 2-deoxy-D-gluconate 3-dehydrogenase.
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ekqA00
1EQUA 3PPIA 4R1UA 2E4AA 2Y68A 3KSZO 4RVHA 4IGEA 1B16A 3MOGA 1ISIA 1JKFA 4AICA 1YBAA 1N8KA 2QW8A 4BKQA 1LTHR 1VI2A 1P77A 4D3FA 1BTOA 3NJ8A 3LK7A 4OH1A 3FNGA 1R4MA 2PZKA 2ZYDA 3EHEA 4PG8A 1C0KA 3W4KA 2Q3EA 2IZ0A 3KOUA 4GQAA 4XCVA 2ZYGA 1K5HA 3AU9A 3KV3O 3MTJA 1TI7A 5L7TA 1R12A 2HMSA 1N92A 2W2LD 4FBGA 1NPYA 2QRKA 1P1KA 3JYQA 4IGFA 5BR7A 2XXBA 4KWHA 2NTVA 4CUJA 4NK4A 2PKRA 3IP1A 2VYNA 3WYBA 1N7HA 1X13A 5CEFA 3NUGA 1UXGA 2HQ1A 4KTVE 4FSHA 3RWBA 5JMPA 3DFZA 4TKLA 1IHYA 5COAA 4MVJG 2GERA 3S1LA 2YW9A 3RUEA 3M2TA 5LDHA 4XR9A 3M1AA 1ZKMA 4BGEA 3GDGA 2A35A 3R3JA 4WGGA 1QYWA 2YZ7A 1YDEA 1T2CA 3EVTA 4A0SA 2HLPA 2I3GA 1LA2A 4WCFB 1O0SA 2YFHA 5T5QA 3V1YA 2HMWA 3X2EA 4IUYA 3AI2A 4EJ0A 3VTFA 1CRWG 3G3EA 4XYLA 5EL0A 1YL7A 1NBOA 1B15A 4BV8A 3ROMA 4JCOA 1PIWA 5EJ2A 3EMKA 4J4BA 3RUFA 3I6IA 1J6UA 1UAGA 4P4NA 1K2WA 4AG3A 4B3HA 1ENYA 1E7YA 1LLCA 1R0LA 4DREA 4GBJA 3KETA 1CDOA 2PFGA 1WZIA 3C8MA 5GMOA 4JJGA 4ALMA 4BO2A 3C7CB 3DO5A 4BQPA 4F45A 4RPJA 4WLOA 1PGJA 3JQCA 1NX6A 1Z6ZA 4YQYA 1NVMB 4NU5A 3LT4A 1NR1A 1K3TA 1ZK0A 4RLSA 5JS6A 1IOLA 1HZJA 3O26A 3H2SA 3WSWA 1HDCA 2CF6A 3JQAD 7ADHA 1H0KA 4BB6A 2F00A 2JAHA 5A3JA 1O94A 3QVSA 2CZCA 1VRWA 2NM0A 5IXSA 3S55A 4J16A 3IUPA 3ADOA 3ZU3A 3PJFA 4P22A 3ZV5A 3PK0A 2VHXA 1H6BA 3PRJA 1LUAA 2NU9A 1NQTA 4O5OA 3UN1A 4J4HA 1LEHA 1SOWA 2G82A 2WJPA 1UDBA 4GVXA 3RBVA 3VKUA 1JAXA 3KLMX 5COQA 4WEOA 5IAAA 2VHYA 1U28A 1FMCA 2ZTVA 3AM5A 1ISFA 4ALNA 2IXAA 2CFCA 3OETA 2LDBA 1AUPA 4IJWA 1KEPA 4YJFA 4CMAA 4TKMA 3NX4A 4EJ6A 1C14A 2BFAA 3HG7A 4Z3KA 5BNFA 1ZXBA 4CR6A 5DCYA 1ZUD1 5FEUA 2JCVA 2YQ5A 3PHJA 5TT0A 1N9GB 4BB5A 1LDMA 3WGHA 4CMBA 1U3WA 5L95A 1O6ZA 3TPCA 5JYDA 5JNLA 5JDIA 4L73A 4BHTA 1Q1NA 4RF4A 1NAHA 1X0VA 1SC6A 4BV9A 5DP1A 4CQMD 3L9XA 2EP7A 1KVUA 1CF2O 3GG9A 1YOVA 4G2NA 3OJOA 1ZFNA 1LXCA 3ZU5A 2FPGA 3HADA 4GI2A 4BVAA 3BHJA 3ZV6A 3KYCA 2OO5A 3I9OA 3PZRA 4JP3A 1NHWA 1I3LA 1NASA 3GQVA 1XEAA 4RQTA 2TMGA 2VZ8A 3UCEA 3V1UA 5JCJD 2PZLA 3W6ZA 3VPXA 2CDAA 4E2XA 3RFXA 1YQDA 4PG7A 2VWPA 2A4KA 1HSOA 1PTJA 2BFMA 2J3IA 3C85A 3CTMA 3CZMA 2C82A 2AG8A 3FR7A 1HDXA 2NVBA 3SXPA 4BNMA 1BDBA 2RH4A 3WGTA 4OKNA 1KERA 2ZQYA 4B7XA 4EBFA 3UVEA 3ULKA 4CPDA 4XGKA 1HLPA 3D7LA 3WICA 1QYDA 3CIFA 4I9UA 3WTBA 1M66A 1ENPA 3HE3A 4FIZA 4BO4A 5IXYA 2W90A 2OMEA 4IQGA 4OOFA 3CEAA 1M76A 2PH5A 3JQFA 2YV1A 3C1TA 2O23A 3ON5A 3E9MA 1ZK2A 2OP1A 3AY7A 4BNVA 2PV7A 3V8BA 4JBGA 5MDHA 1ZMTA 1HXHA 3BMQA 2O48X 4YT8A 3NTOA 4BO5A 2IEBA 4CLRA 2ZKLA 1KIFA 3IOYA 3Q11A 3I23A 2EV9A 4O63O 5A1TA 4KMSA 2Y1CA 1SCUA 1I3MA 4WECA 3WOHA 1WMBA 1JA9A 4BQRA 4IDBA 1IB6A 4BS9A 1WDLA 2P68A 3EVNA 2C5EA 2VNSA 4FN4A 3W8EA 4IINA 4RVSA 4ZQFA 3DTTA 4INAA 4KQWA 4XR4A 1NP3A 1UXJA 3OHSX 1NQOA 1ZO8A 3S2EA 4J1QA 3ONEA 4BGVA 1KVTA 3GPIA 1DJNA 3LDHA 9LDTA 1GUFA 4GX1A 4K9DA 4XGIA 1JW9B 1SAYA 2VYVA 2EG9A 2WD7B 4WJZA 3UXYA 3MJ4A 3AY3A 3L6OO 2RBEA 2Y1DA 3QQPA 4U5QA 4OHUA 4ZRNA 5C3MA 3DBHA 4N5MA 1MP0A 1UXIA 3PQEA 2DPHA 2GDZA 2W2LA 1PZFA 1ZSYA 3BTVA 1GCOA 1E1MA 3FI9A 1X1TA 4DL9A 3AFMA 2DC1A 4TMFA 2XXJA 1LSJA 2H1SA 2Z1NA 3SEFA 4ALJA 6ADHA 3GUYA 1ISMA 4FC6A 4B7CA 1GZ4A 2ZB4A 2XAAA 3PGXA 4DBZA 5A9RA 1YVEI 1DC3A 2WYVA 2ILTA 5JDCA 4HKTA 3RFTA 1EK5A 2IODA 3DTYA 4FOOA 4YT5A 2NWQA 2NU7A 3I9JA 4RCVA 1E0DA 4ND5A 3JQEA 5ITVA 1GYRA 1P1RA 1VSUA 1P44A 3D5TA 3OA0A 1N5DA 2HJRA 2JFFA 4LCEA 4AJKA 5TLSA 2EF1A 2JCXA 3DDNA 3RVDA 4WLFA 4LK3A 3JQ8A 4CL8A 4GX2A 3BMCB 1IYZA 3VOSA 1R0KA 2Y1FA 5ILGA 5T8KC 4DYDA 1BW9B 3UF0A 3TZKA 3OJLA 4I5GA 5ER9A 3INTA 4AVYA 5G0UA 2V6MA 1PQUA 2D0IA 1NFRA 3PHHA 4WLNA 1YXMA 3WJAA 2E6UX 2GRAA 3LVFO 1DXYA 3DZIA 3TL3A 3WG9A 1DSSG 1LRLA 3SLKA 2GLXA 1WWKA 2P5UA 5H83A 5DCUA 1QXSA 3DZHA 3DZKA 4TVBA 1UP7A 1OZAA 1QYVA 2DU8A 4GLOA 2ZYAA 3PVZA 2GPTA 3TZQA 4XB2A 4R16A 5KJ6A 4AJ1A 3JQAA 3E48A 4KWIA 5KVQA 1RPNA 4MINA 4N5NA 4ND2A 4HFJA 2EKQA 3QSGA 4CM8A 4NJMA 4E2ZA 3ZWPA 1E3EA 2PGLA 1D7OA 2ZIZA 3HHPA 3U4DA 3DMYA 1Z75A 2TMDA 3JQ6A 4C7JA 3OM9A 2BFPA 1KC3A 1PJ2A 1ADGA 4WNCA 3ZWYA 5ITWA 1DAPA 5L7YA 5L53A 1ZSNA 2B83A 4CV3A 1L7DA 1K6JA 5TS3A 1F8FA 1XGKA 4TSKA 4BNHA 4MOWA 4IDEA 1RJWA 4E5YA 1WDMA 2BFOA 2EGGA 2C29D 1QP8A 5H82A 4BNIA 2NUAA 1I33A 4CLOB 3ZV3A 5JO9A 4OSPA 4R1TA 1KBZA 1X15A 4B8ZA 2ZJ1A 5CPBA 5KVVA 1KVRA 3BMNB 5TX7A 4IQ8A 4RQUA 4J3FA 4CV0A 4JK3A 1HDRA 1DFGA 2EJVA 1U4OA 4CM7A 5JY1A 4YB8A 4ALLA 3ICCA 4II3A 1ZMOA 5JO0A 5THKA 1XLTA 1C1XA 3WNVA 2X0JA 3WGGA 3PP8A 3MWEB 2GYYA 1B3RA 1YRLA 4BNXA 4EGFA 3TOXA 5TT1A 4E5PA 2DPGA 5I9MA 2O7QA 3UFXA 1FF9A 3LC1O 3WX0A 5KJ1A 3ZI0A 4L8VA 1P1JA 3VVCA 2P9EA 3WLFA 2OZPA 1LLUA 2ZCVA 4W82A 2E49A 2NTJA 3ZHZA 2EKPA 3IAHA 4UEJA 4NR0A 1AHHA 1J49A 5EERA 4Z0HO 5DNAA 4RF3A 5TNXA 4BO3A 3V5NA 3JTMA 1I2CA 4Q3EA 1UJMA 4NPCA 1AXEA 3H8VA 3RU7A 1HZZA 3GEMA 4DGSA 4P4GA 2VZ9A 4YR9A 4D0SA 2E82A 2ZB8A 4GWKA 3W4IA 2P91A 1T24A 2C07A 3WGQA 1HKUA 5EQDA 3H5RA 1P9LA 3P19A 1DFIA 4XWYA 1YBMA 3NJ4A 3UH1A 3EY4A 1T25A 2GR9A 4HFRA 4IMPA 3SLGA 3BMOB 1IZ0A 1KETA 4FGSA 1HSZA 3VZPA 4BIIA 3NT2A 1T2EA 1YGYA 3JD2A 4DYVA 1DLJA 5CDUA 1ZH8A 2HKIA 4AJ2A 3O38A 4Z9YA 1U3VA 3MJSA 3WMXA 2F1KA 3VHRA 4ND1A 3S2IA 4YJDA 3KO8A 2AE1A 1E1NA 4NG5A 1HYEA 1PWXA 1J4AA 1Y7TA 4IIUA 1VL6A 4R3NA 2CVZA 1BXGA 3LC7O 2X0IA 1U3TA 4QSMA 3C1OA 2C20A 3K2BA 2UYYA 4MO2A 4UAGA 3WDSA 4CLDA 5TSDA 1O89A 3K92A 4J1TA 5TRTA 1EFKA 2WSBA 4OAQA 1BDMA 3ORFA 1I8TA 4GH5A 1LC0A 3AUAA 1DRVA 4PGFA 4PLGA 4PLWA 1U9JA 2Y0CA 1E5LA 2I99A 1CQJA 4HBGA 3TL2A 4QO8A 1UXKA 5IN4A 4Q3BA 5JCXA 1B3BA 2GD1O 5ICSA 1RYDA 2GN8A 1I32A 1A4UA 4ROSA 1P45A 1YKFA 4RDHA 4BO1A 3AW9A 2NQTA 1AHIA 8LDHA 4MJLA 1PJSA 3D4PA 5JC1A 4J1SA 3NV9A 3I4FA 1E5QA 1ADBA 5CG2A 4DPKA 4R69A 3ZWAA 4FQ8A 1VKOA 4RPKA 1LRKA 4CMCA 1KEWA 4EUHA 1V3VA 1JLLA 1P0FA 1YL5A 3BTOA 1R66A 2B4QA 4CUKA 7MDHA 4LMRA 1XDWA 3FHLA 5EQFA 1Y8RA 2YV2A 4L0QA 1SB9A 2PH3A 4FC7A 5H81A 4BNZA 2Q2QA 2O4CA 4J9UE 3AI1A 5G4LA 4Y98A 2GN9A 3FCOA 3ROPA 2Q4EA 4RPGA 5A9SB 4CR8A 3OJEA 5JDIC 4URFA 2P9CA 4QUKA 2H63A 2PY6A 3RBXA 2BKAA 1A7KA 3PHLA 4C7KA 3PEFA 3VZQA 2D8AA 2X1HA 1QYXA 2J5KA 4ZVVA 1A7AA 5G0WA 2GCGA 3U0BA 2Y1OA 5G4KB 2BI7A 2CSUA 2IDZA 4K28A 5F1PA 1E3WB 1YB1A 1JAYA 3H2ZA 1D8AA 4J43A 1EBUA 1RM4A 1RM5A 2W2KB 3DOOA 1SEPA 3UICA 5I8WA 4GSKA 1Y9EA 3W4JA 2C59A 4PRLA 1DOHA 2CUKA 3FSRA 2B4RO 5L40A 3S8MA 2AHRA 4HFMA 4OYRA 1BGVA 1NTOA 4TRRA 1P0CA 3OBBA 1XU7A 4O0LA 4CLXA 5KOIA 1PGPA 1ARZA 3I9NA 5JAQA 3EAGA 4II2A 1PJTA 2W98A 2ZTMA 4YACA 3BTSA 4Y6RA 2I3AA 4RZHA 1EDZA 1PJBA 3IJRA 2VWQA 3DFUA 3RKUA 3VTZA 4ZICA 3JQFC 1UDAA 4J2OA 3LC2O 2HK7A 1U8FO 4E13A 1HE2A 1W8DA 2AEJA 5CAEA 1U3UA 1GTMA 3F6YA 1NAIA 1PZGA 4IDAA 1QSGA 1PQPA 1LDGA 3FR8A 2GUGA 2I66A 3A06A 1EUZA 1HE3A 1LQUA 5HM8A 2DKNA 3B1KA 3PJGA 3IKTA 5KJFA 4WEQA 1HL3A 2P4HX 3R0IA 1GPJA 3I9MA 4YBZA 2Y93A 3AUTA 1D3AA 1A9YA 2FRDA 5A02A 3WGOA 1AGNA 3ZN2A 4UREA 2HK9A 1DEHA 3N58A 4M54A 4WPGA 5AVOA 1VL8A 3GFBA 5EN4A 1MB4A 2VT2A 4IIVA 5F5LA 3BTUA 3HDJA 3JCZA 3SX2A 2RHCA 4CMJA 2B4TO 2X9NA 3TZHA 1XQ1A 3ZWOA 1ZEJA 4ZQGA 1LNQA 2ZTLA 4WK6A 1H94A 1Y5MA 3AWDA 4YRAA 2CDCA 4R68A 3GY0A 2IYPA 4D41A 4WCFA 3Q1LA 3N74A 4FJ0A 2VYVD 4OXNA 3I52A 1EDOA 4NI5A 3GNTA 4UVIA 3WLEA 2AQ8A 3NDRA 1VC2A 4D42A 3VKVA 3EGOA 1GQYA 1M6WA 2D3TA 3DMTA 4YAJA 3PDJA 1NPTO 3L07A 2J5QA 4P38A 5ER6A 1U8XX 5KWEA 1LSOA 2NVUB 2EWMA 1E77A 1VJTA 3UW3A 5CFZA 4FJ1A 3QJ5A 5L7WA 4FCCA 2ZCUA 3A4VA 1DBVO 3LU1A 1P1FA 5L4SA 3H4VA 4AJNA 4NQZA 4TZKA 4ZHSA 3ENNA 4ID9A 3TF5A 2UUPA 2CMDA 4MVJH 4XDZA 5JDCC 3ZU4A 3T7EA 2CVOA 4EUFA 3STHA 5LDGA 5L4LA 1BHSA 2JHGA 1PGQA 2B36A 2HK8A 3KRTA 5F21A 3QVWA 4YCAA 1I01A 1VLLA 3WGZA 3LF1A 1WVGA 1GUYA 3OIDA 1KS9A 1TT5B 4I5EA 1YE3A 4GMFA 2OHXA 4R54A 2B5VA 2YDXA 4MKRA 3WYEA 2JFGA 3ZCXA 3ABIA 4DIBA 1DIBA 1IHXA 3AOGA 3DHYA 4YVFA 3HNPA 5IDYA 3V2UA 3VZRA 4DC1A 2DM6A 4J91A 4L4SA 3IMFA 1ULSA 1MV8A 1VSVA 1K6IA 1DC4A 4PLZA 2VT3A 5L4NA 4R5HA 3L4BA 4BGIA 4E21A 4H3VA 1GR0A 1LQTA 1FK8A 3INGA 1DHTA 3KLPX 1C1DB 3HN2A 3FBGA 3F5SA 3QVOA 4B79A 1KY5A 4YAGA 1XHLA 4NNJA 1B26A 3OQBA 4YTEA 1N9GA 2CD9A 4FFRA 5DULA 2HDHA 3TWOA 1F06A 3NEPX 4D3DA 1U5CA 2OOSA 3NAQA 1JKJA 3ZDFA 5KIAA 2DTDA 2FY8A 4FR5A 3EYWA 5IJZA 1RM0A 5IZCA 3GGGA 1GEEA 4TZTA 4FD3A 4NMHA 3WB9A 1CWUA 5IDXA 4MKZA 1ZJZA 4KUEA 3V2HA 4L4RA 3Q2KA 5IFLA 1H6CA 3AM3A 2ZQZA 4MVJP 3PWKA 1WZEA 3GHHA 4WUVA 3LLSA 4EUEA 4Z0TA 3TJRA 1G0NA 1HYGA 3FN4A 5ADHA 3U49A 5JW6A 3INRA 2B5WA 3B1FA 3JQGB 4XIYA 1P1IA 3O4RA 1Z7EA 3D4OA 3GNQA 3HJAA 4RO0A 3RAJA 1HETA 4ITUA 1GYPA 1I0ZA 2PKQO 4XA8A 3O8QB 5G0VA 3T4XA 3VH2A 5TGDA 5B4VA 4CLHA 3S2FA 4DQUA 3ZNPA 5FFFA 3NT4A 2V65A 4XDYA 1HRDA 3GR6A 3GRPA 4IXWA 2Q1WA 3V1TC 5I7SA 4A03A 1E6EA 1E1LA 4BO0A 4RF5A 1VKNA 1UZNA 1YWGO 2W4QA 4I5DA 2YHIB 4D79A 2EJWA 2W8ZA 1O9BA 3K73O 1MUUA 1X0XA 3R6DA 3UCXA 2V7PA 3QVXA 1KOLA 3C7DB 4L75A 1PSDA 1H2BA 1MA0A 1NR7A 2JL1A 4O59O 1S6YA 1BVUA 1J0XO 3DB2A 2J3JA 4U6SA 3CKYA 2C2YA 3VPFA 4DLBA 4RJTA 1C0PA 5COBA 1MFZA 1P33A 3HFGA 1KY4A 4CQLB 4PG6A 1W0CA 1PGNA 3R1IA 4BKPA 1EK6A 1T4BA 4CUZA 2EGHA 4XJSA 2O3SA 1E1KA 2FN7A 4RL6A 3C3XA 1TEHA 1SMKA 3Q9NA 1P3DA 2ZB3A 4Y6PA 4YRDA 1LX6A 1TT7A 4A26A 4OGWA 5TJ9A 5A03A 4DA9A 3ETGA 4AJJA 1U1IA 3N7UA 2DFVA 3F3SA 1R16A 1XG5A 3VZSA 1M75A 2G0TA 3OFSA 2WD7A 1A4IA 2RHRA 1HEUA 2NLOA 2X9GA 1CIVA 3PWSA 1IL0A 1F12A 1V6AA 2DTXA 3I9KA 4KZPA 2CVQA 1P31A 4PLVA 1Z45A 4BO8A 4FJ2A 1M67A 1GADO 2IZ1A 1HDZA 3VAZA 2SCUA 3SVTA 3HSKA 1WP4A 4Q3DA 3AY6A 2QZZA 3U4HA 4BL5A 1QYCA 2C7GA 2OP0A 1N2SA 3ZGYA 3RUDA 3BXXA 4B8WA 5JBIA 3JD0A 1XA0A 3TOZA 2OFPA 1ZEMA 5BSGA 1A71A 4W9NA 4IZIA 4DMMA 5DCWA 3RU9A 1N7GA 5K6AA 4BNJA 1ZZEA 3JYNA 3EK2A 3AJRA 1MLDA 2O4UX 2DBQA 1H93A 1U7HA 5DDIP 1QRRA 3DEYX 3PJEA 3PIIA 1I5RA 1V3UA 2J3KA 4YAEA 3GMDA 1UP4A 3QWAA 2IXBA 1XYGA 2Q2WA 1GPDG 1YDWA 3BA1A 4W4TA 4BNTA 4CM4A 2R00A 2IYOA 3CMMA 2HMVA 2OORA 4EZBA 1U4SA 2J8ZA 4CM9A 3BIOA 4GSLA 4M8SA 4PLCA 5B4UA 2GF2A 2CDBA 2Q46A 3BMCA 4A27A 5DBIA 1IY8A 3JQ7B 3H9EO 4NZ9A 1BW9A 5CPFA 3ANMA 2PD4A 1D1TA 1E7MA 5A05A 4JGBA 4AJPA 4JBHA 1GU7A 4GKVA 2FP4A 3H5AA 5T64A 1Q7BA 4FW8A 1OMOA 2WTBA 5JE8A 1SB8A 3PQDA 4DLLA 1HT0A 5CG1A 2VNAA 3CE6A 5AQ1A 1B2LA 4F3YA 1M6HA 3S2GA 5L9AA 3ROQA 5KCZA 4IQ0A 3MJEA 1OC2A 2BRUA 2EEZA 3I9LA 3O9ZA 1I3NA 5C7IO 3RCBA 2YJZA 3RJ9A 3F46A 4W6ZA 3RKRA 1M2WA 1HLDA 5G0SA 4DPLA 5FF9A 3ZV4A 2EXXA 2C7VA 1LLDA 1Y5RA 2VHWA 4IXTA 1FDTA 4D45A 3OEWA 1LBEA 4L74A 2BELA 4NFHA 2HSDA 1YB4A 1V35A 3H9JA 4GAEA 3PYMA 4J6FA 3JQDA 4D46A 4J49A 5JMWA 4IS3A 2VRCD 4K26A 3JQ9C 1R4NB 4XRGA 3L6EA 4U0KA 2PLAA 1ID1A 4J90A 4E33A 4OKIA 1LU9A 1OOEA 1RKXA 3Q3CA 4HWKA 3F4LA 2FPPA 5K0ZA 1GAEO 3OIGA 2IE0A 1H6DA 1UAYA 2HCTA 3OJFA 3ZWCA 1EEHA 4CLOA 2DUWA 1TB4A 3DHEA 1T4DA 1EVZA 4IJVA 3QIVA 3BMNA 5FI5A 4MDHA 3DBLB 1NWHA 1WMAA 2VRBA 3RQSA 1NM5A 4EITA 1E3JA 4Z6KA 4B4UA 3DAFA 1KVQA 1PWZA 1IZ9A 4MVJD 5CDSA 2GZ3A 1Q2XA 4EJMA 3U62A 2UV8A 4MP6A 3UAGA 4YJGB 2PR2A 4LN1A 3OMLA 4XB1A 2I76A 4CR7A 1P1HA 4BNUA 1LJ8A 2YDYA 4BUCA 3WQQA 4PIVA 4EEZA 3GNSA 1W73A 4Q39A 2PGDA 1PL7A 4E32A 5KVSA 3ADPA 2HMTA 2GZ1A 2O3RA 1RYEA 1O5IA 2C0CA 2Y67A 3UOGA 5T57A 2EKLA 1Y6JA 2HMUA 2RAFA 1GFSA 4NBWA 2Y0EA 5IF3A 3PYXA 2QYTA 4Z9XA 3VH1A 4H16A 1ZK1A 4F46A 4GL4A 3RC9A 1SPXA 2DBVO 2WYUA 5DP2A 2X22A 2NSDA 4BGUA 4EDFA 3FTNA 3GC6A 3HDHA 4WCFC 4NH4A 1JTVA 2YV3A 3ZWXA 2R2GA 4J9VA 1B7GO 2BI8A 4J2HA 3HN7A 1DC6A 1LDBA 1Q7GA 1SO8A 2FOIA 3ITDA 4CODB 3F9IA 1KEVA 4JBIA 3DMTC 1TLTA 1UP6A 2RCYA 1Y81A 3VC7A 4H7PA 1JU9A 3G49A 2O2YA 4D7AA 3BMOA 4YPOA 5L51A 1X7DA 5CDTA 4NIMA 1SEVA 2XPCA 4RZIA 3MEQA 1QKIA 3A28A 3Q9UA 1YJ8A 4R51A 3GZNA 1N1GA 2GNAA 3P7MA 2JHFA 4KUHA 4LMPA 1E6UA 3B6ZA 2E48A 1JVBA 4DLAA 1DRWA 4NJMB 4WLUA 3KBOA 5F5NA 3DZGA 4UVHA 4BNLA 2PTGA 3GHYA 4AJHA 3D1LA 4YT2A 3IQDB 5DOVA 1E92A 4I8XA 4LRSB 1GD1O 3T7CA 5JC8A 4E30A 3ANNA 5FWNA 4N18A 1P74A 4P4LA 3RUHA 2BHLA 1C0LA 3ASUA 2HU2A 1AXGA 4AJOA 1E7QA 1PL8A 1WPQA 4XD2A 2X86A 3RUIA 3KZVA 3GF4A 4F6CA 5A5EA 3GUCA 3OIFA 1ISHA 1JN0A 4J0FA 3RJ5A 4ESOA 3M1LA 4GX5A 1LDEA 3GDOA 2ZK7A 2VOJA 1ORRA 4ZQHA 3OSUA 2PWZA 3P2OA 3I6QA 4YXFA 4NDNE 2JJYA 3KB6A 3W8FA 1IPFA 4DQXA 4GVLA 4W7IA 3L4BC 2X7HA 5KJEA 4LRTB 2QX7A 2PK3A 3GFGA 5ES3A 3GA0A 1HTBA 3Q6IA 4U6QA 4RV9A 3EZLA 1CERA 1ZK4A 3RUCA 1V8BA 3RI3A 3DC2A 4EI2A 3DZFA 1R37A 3D3WB 5L3ZA 3KEQA 4PRKA 3AM4A 3H65A 4BNWA 4EEXA 1LI4A 5A9TA 3FTPA 2X5OA 3L6DA 3GG2A 1K0UA 4YJHB 5THQA 4DWVA 4XYBA 2P4QA 3ST7A 2EIHA 4WASA 5TQVA 3WIDA 4E5NA 1PZEA 5BSEA 4CQMB 1OAAA 1BWSA 4WLVA 1PJCA 1YONA 2Q45A 4YWJA 3ITKA 5A9SA 2G17A 3GGOA 4S3MA 5IZCC 2ZATA 4Y67A 1NNUA 2O3UA 2NNLD 2Q4BA 4XYMA 3AUSA 3HB5X 3GOHA 4C4OA 3DWFA 3GN1A 3ZHYA 5AXDA 1W6UA 3ZNOA 1KEUA 1Z82A 3CZRA 5G4KA 2Y99A 1N1EA 1G6KA 1E3WA 2VOEA 1UUFA 4ZQEA 4Y9DA 4ONEA 5HBRA 5A04A 4CMGA 1ZNQO 3K9QO 1O8CA 2W2KA 4R1NA 4WOKA 3U4IA 3DONA 3ZWVA 1D1SA 1Q0QA 1YJQA 4NBVA 4OXKA 2PD3A 1HE5A 1XQ6A 3VDRA 1GV1A 1H2HA 3M6IA 4NFYA 2FR1A 1B8VA 3LZ6A 4DBVO 2FWMX 4PLTA 2PGJA 3GVPA 3I4CA 4B4OA 1JDJA 3WQRA 4ALKA 3CXRA 3DHNA 1EFLA 4FFNA 3PWZA 4ND4A 2X0NA 2Z95A 1JKIA 4PLPA 1BSVA 4WE3A 1YQXA 4P8RA 5I9LA 2QZ9A 3TZ6A 3ROKA 5KKAA 4AJLA 1RWBA 1S7CA 2PD6A 2HJSA 4A5OA 4LGVA 4B7UA 3LT1A 2EP5A 2V6GA 4LVCA 3KHUA 3ASVA 3KEOA 4IJKA 3HWRA 3SC6A 5JAZA 3MOIA 1ONNA 3SC4A 1BXGB 4K6CA 4RVFA 2A94A 3UHAA 5U4QA 4N5LA 2BGLA 4HFNA 3ZNNA 3ZHXA 1GZ6A 1T2FA 2Y1GA 4IMRA 4N7RA 5GY7A 4DXHA 3K6JA 4YAKA 3JQ9A 2VRCA 3F1LA 3VVBA 1ADCA 4MVJF 1EUDA 3PTZA 4MVJM 5I7EA 3GVHA 4RVGA 4IZHA 3QP9A 2AEMA 5DBGA 5EPOA 4W99A 2CY0A 4Q3CA 1GQ2A 1FDSA 1HDYA 3K5PA 4YA6A 3UGKA 4E5MA 2WEKA 3DZBA 4XIJA 4XRRA 2VUTA 2HAEA 4YYZA 3G79A 4XYEA 2DLDA 3GAFA 5I7FA 1PJ3A 3L0DA 4FDAA 4KDEA 2RH8A 4NBRA 4EYEA 3GLQA 4ILKA 4FB5A 3ZWMA 1J5PA 4E5KA 4MVJA 4JX8A 1F17A 2X6TA 3WJ7A 2Q50A 5C7LO 4MPDA 1MGOA 5JXWA 4DTIA 3HQ4O 3A9WA 4GGOA 4KDFA 2QHXA 1Y8RB 1Z73A 2Q49A 1QV6A 4D0RA 4KOAA 1DIHA 1DPGA 1Y8QB 2NVUA 3TRIA 1PJ4A 4G81A 3LSYA 3GN2A 4R1SA 4WOJA 1UXHA 2EERA 3OICA 3FPLA 1FDVA 3OECA 1GY8A 3A14A 4BKOA 2H9IA 3NTRA 3CSDA 1GCUA 4W9NC 4FS3A 3D5QA 4O6VA 5K6AC 3KYDB 3OJ0A 5TJHA 3PQFA 3NKLA 1KVSA 1TXGA 2QYSA 5AXAA 4BOYA 1JWAB 2XF8A 1OBFO 2IRWA 2AA3A 3OF2A 5F1KA 2NADA 2G5CA 1NQ5A 1PS9A 2FMUA 1DB3A 2UDPA 4XQCA 2C54A 2WYWA 4CM9D 2R00C 4TQGA 2EW2A 3BZUA 4UEKA 2FPIA 4GLLA 1TT5A 5AOVA 2HRZA 2P5YA 3GZ4A 3OP4A 1LSSA 1PS8A 3OQ6A 1ZK3A 4PLHA 4NK5A 2YUTA 4PZEA 5I9NA 1DO8A 4Y6SA 3E6AA 4OXYA 2Q99A 3G0OA 1HDOA 1H5QA 1LC3A 1LLQA 2YYYA 3ZW8A 4DMLA 5A4DA 1XSEA 4DUPA 5IDWA 1Z7BA 2YY7A 3FRJA 1V9LA 4CMIB 4CLEA 1WDKA 2JD1A 4CM3A 1LDNA 3DBRB 3I1JA 2J5RA 2VCYA 1C1DA 4XGNA 1ONPA 4NHEA 3GH3A 1NPDA 2BGKA 2PKQP 3DL2A 3F47A 2POQX 1T1RA 4EW6A 2DBRA 2Y1EA 3ZWBA 1UDCA 4PZDA 5KNLA 1QG6A 2VHVA 5BSHA 3H9UA 4OQYA 3MZ0A 5EIOA 4PN3A 2FR8A 3AFNA 5EINA 4PVDA 4CMKA 5DF1A 2NVWA 1GUZA 5ENVA 1B8PA 3DR3A 4JJIA 4NU6A 3BHMA 1PEDA 4TRJA 4ZN6A 4KTTE 3PFWO 3D3EA 2B69A 3H7AA 3K8ZA 1U5AA 4GPD1 4QFDA 1LRJA 1HE4A 1R15A 3ZU2A 4R4JA 3Q0EA 3ZH2A 5B4TA 1ISGA 2PZJA 4BO7A 5CDYA 3BAZA 4OQZA 2O2SA 3JQGA 1R4MB 3LF2A 3U5TA 4ZQBA 3WS7A 4OIMA 4YRBA 3ONFA 5HRUA 1NVTA 2VHZA 3IUSA 3V2GA 4R5MA 2GN4A 3O8QA 1WXDA 4GWGA 4IDCA 1CEQA 5F1OA 2VUSA 3AU8A 1HWYA 4UUNA 2AMFA 3GK3A 3K30A 1MC4A 3ONDA 3WXBA 4OSOA 1YH3A 2O3TA 1XELA 3H3FA 5HS6A 1EE2A 3WMWA 4CMHA 5FI3A 3IL2A 1NWCA 4NJOA 3RIHA 4XZ3A 2UAGA 2VUUA 2WDZA 2YHIA 1ZIDA 5JY6A 2ZJ0A 2OUIA 2PNFA 3FF4A 3QWFA 4BNGA 1MXHA 3AOEA 5DT9A 3WFJA 5DBFA 2I67A 3NGLA 4IS2A 3E9NA 4E3ZA 3SJ7A 2O7SA 2WE8A 1XU9A 3UUWA 3HZZA 3NDJA 4BNYA 3RSHA 4AJ4A 3SJUA 1AE1A 1DAOA 5HS4A 5TC4A 3RC7A 3ZWNA 5ILOA 4RPHA 4CQLA 1GQQA 4ZD6A 2X9VA 2WD8A 4MP3A 4PG4A 3WNQA 4CV2A 3U09A 2JD0A 2AQIA 2NV6A 4GGPA 2QIOA 3O03A 4G5HA 3P5SA 4I9HA 2H6EA 2AEFA 3GVCA 4GKBA 5CEJA 1AN9A 5DN9A 4CMEA 1DIRA 2FSVA 4DQVA 2Y05A 2OL4A 3COSA 4RGBA 4A2CA 3GEGA 4GMGA 1A72A 4RLHA 1VJ1A 2GSDA 5DZSA 1VL0A 2BF7A 3KTDA 3LT2A 5BT9A 1ENZA 3QE3A 3W1VA 4MIEA 3GT0A 4JQCA 2D2IA 2FZEA 3QVTA 3QY9A 1R6DA 4QO7A 2DBZA 4HP8A 5IZ4A 1E7RA 1MG0A 1PX0A 1OFGA 3JYLA 2Q2VA 3HB4X 3PXXA 1CQIA 3VPHA 1YBVA 3U4CA 3TDKA 4HNGA 4YQZA 4WKGA 2Q1TA 1GL3A 2ZB7A 3GDFA 4E4YA 2YHUA 3L77A 4QQRA 4M86A 4XQ9A 1H6AA 4J4TA 5A5FA 1RM3A 4RORA 3VH4A 5LC1A 3QWIA 2GN6A 4JNKA 3TFOA 4UUMA 2X23A 1YO6A 3R3SA 1PL6A 4AFNA 4PVCA 1E3IA 1Y1PA 3F1KA 4ALIA 2O3JA 5IG2A 3D64A 8ADHA 1UZMA 2X4GA 4XEHA 3W8DA 2O50A 2D5AA 4YJFB 4DPMA 2DAPA 1ZSVA 2B35A 3PIDA 3H9QA 5GZ3A 3ICPA 3QV1A 5G0TA 5F3RA 3PHIA 4CM6A 1SBYA 3PFFA 1BVRA 4Z9FA 2YFQA 2ZTUA 1ONOA 3EUWA 1QMGA 3JQ7A 4DIOA 3K2EA 3JQBA 4XX0A 4HXYA 2C5AA 5A06A 4PLYA 4BMSA 5CHEA 3E9QA 5JPIA 4A73A 5JFOA 1YQGA 1ULUA 3H6KA 3ZWWA 4PZCA 1PJLA 1T2AA 3PZBA 4G65A 3FPCA 2AQKA 5JSFA 2R6JA 1H9BA 1U7TA 3LYLA 3MJVA 1T26A 4IY1A 4PG5A 1MXFA 1O95A 1H9AA 1Q7CA 4J7UA 4FFLA 4F6LA 2JFHA 3WBFA 3DOCA 5JYEA 1UH5A 3IIEA 1YOVB 2DTEA 4BNFA 3CUKA 3PLNA 4RPLA 2Z1MA 5JAIA 3WWYA 3A1NA 3JD3A 4BKRA 3KYCB 3B70A 2CF5A 1ENOA 3F5QA 1ZXLA 1DC5A 4OM8A 3QA9A 1NHGA 5C5IA 3VH3A 3C7AA 3I5MA 1VM6A 2FZWA 2AXQA 3QHAA 1YB5A 2BMAA 1EE9A 1R4NA 1X1EA 4IDFA 4YAIA 5C7OO 2Y0DA 2NTNA 3ETEA 5DOZA 1A9ZA 3RROA 1GYQA 3KVOA 4OO3A 4ZU3A 2H5LA 1YL6A 4A10A 2NU6A 4JN6B 4TWRA 3WR5A 1T2DA 3OEYA 1E7WA 4JXKA 2VWGA 6LDHA 4QFCA 3DBLA 2FSSA 2WM3A 4FFOA 3I83A 1GDHA 4PCVA 1TVEA 1D4FA 3WGYA 3G1UA 4YT4A 5A3VA 3JYPA 3I3OA 1BXZA 1I36A 5CEEA 4I08A 4L4XA 3H9GA 3BMQB 4YJGA 3FWNA 4HUJA 4J0EA 4RVDA 2VN8A 4U8GA 4UEOA 3PJDA 4UUOA 1VJ0A 4CLRB 1X7GA 3ZZNA 3B20A 3CMCO 3DXFA 4BO6A 2GZ2A 4E12A 5LCXA 3MTGA 3FD8A 3WQSB 1DDOA 3SBOA 4AJIA 1Q0LA 1JWBB 3HUDA 4J7XA 4LSWA 4RVUA 4FFMA 1MFPA 4D3SA 3WFIA 5AYVA 3D4NA 4RDIA 5T67A 4BO9A 4LSMA 4CM4B 1WLYA 1F0YA 1E7SA 3E5RA 4A7PA 5C37A 4HX5A 1ISJA 4LISA 4TRNA 3NDIA 1R0SA 4U0JA 5KVCA 5EMHA 4UVEA 1EZ4A 4R9SA 3DQPA 3CINA 1UR5A 4MIOA 2X8LA 3AK4A 2D4AA 2NACA 5BQFA 4FOSA 4IPTA 1DJQA 3TFQA 2PZMA 3DBHB 2EW8A 4E2WA 3WYCA 1DIGA 3K96A 4PLFA 4HV4A 1U2GA 4B3JA 3OH8A 4XQEA 5HTOA 2JCYA 4PFJA 2OGUA 1WNTA 3GEDA 1DIAA 1QORA 2HUNA 1E3SA 1GEGA 3G1TA 1EBFA 2QRLA 3QRWA 4FGWA 4OOEA 3UCFA 1EVJA 2BLLA 3VPSA 1LDYA 1NXQA 2AE2A 2G1UA 3KUXA 2LDXA 4JROA 4LW8A 1PZHA 2BH9A 2GGSA 5B12A 1ADFA 1CYDA 5T6BA 1IULA 2V6FA 2DT5A 4D44A 3KYBA 1FJHA 3RBZA 1A5ZA 3BHIA 3W6UA 3MWDB 4KP7A 3E5MA 4HADA 3FWZA 3QW2A 1C0IA 2X5JO 3JQ8B 3T4EA 3IP3A 3G17A 3EW7A 3OQ1A 3GVXA 3H3JA 4UULA 5CDGA 1V0JA 4N54A 4FFPA 3GMSA 3RASA 1DRUA 1PJQA 4BNKA 4CM5A 3ANLA 4Q3AA 4IJUA 4XKJA 1QV7A 2DQ4A 4U7WA 1GV0A 1PU2A 3PI7A 1BG6A 2B37A 2XOXA 2Z5LA 4IDDA 1BRMA 3NYWA 3DAGA 5U1PA 1FDWA 1ML3A 1WAMA 3E1KA 1UZLA 3KSUA 2HRBA 4IDGA 1X14A 4MVJE 5KJCA 1B14A 3LLVA 4O1MA 2OXIA 3WWZA 2WMDA 3QWHA 2OBNA 4Q9NA 3JQAB 3U9LA 2A92A 1IUKA 1HF3A 1QR6A 2VTEA 3F4BA 3ZW9A 1VPDA 4CM8B 2E37A 1V3TA 3KM0A 1I2BA 4CJXA 1XIVA 4MIYA 3D3WA 4WNIA 2C2XA 4BMNA 5L45A 3JSAA 4R9RA 1ZW1A 3DAPA 2CNBA 3LQFA 3DZJA 4YJHA 1G1AA 1G0OA 2A9FA 3WSVA 2VYND 3EZYA 3E18A 4OL9A 4NBUA 1DHRA 2QQ5A 1F14A 3M2PA 4CQMA 4AJEA 3RFVA 3L9WA 4ZGWA 3GPDG 1I10A 4M1QA 1L7EA 1MX3A 3JD1A 2PA3A 2AG5A 4WLEA 2OBYA 3FBTA 5CP8A 4MKXA 2JD2A 3B1JA 2DVMA 4D43A 4ZJUA 3IDSA 1PR9A 3E8XA 4M49A 3WGIA 1XWFA 1PS0A 4M55A 2P9GA 1EUCA 5JCJA 3ZHBA 3KSDO 1SNYA 1ZBQA 2WWRA 3CH6A 4YEDA 4QEDA 4QT0A 1JVSA 1I2ZA 1W4ZA 2GASA 4Q3NA 2JKVA 2D59A 1BXKA 3RC2A 5I8ZA 1A27A 1DLIA 2AW5A 5KKCA 1MC5A 3UKOA 4TRMA 1I24A 2RIRA 1EMDA 1PR3A 4XYGA 1B0AA 4E31A 1K89A 1LSUA 2I5PO 5B37A 1KC1A 2P2SA 3QWBA 4X54A 3FNEA 3AUUA 3L4SO 2V6BA 1HYHA 3TN7A 4L76A 1C1XB 4DC0A 4JP2A 4K1LA 1CETA 2Y66A 5J23A 4Z3DA 2VTDA 1I3KA 2D1YA 2BD0A 1BMDA 5BNTA 3OA2A 3C24A 4ZRMA 5ICMA 2G76A 3GZNB 1NYTA 3LT0A 5HA5A 3WTCA 4I1IA 2YQ4A 4HNHA 4LVUA 3AOEC 3PHGA 4E6PA 5KTKA 3C1AA 3PGJA 4S1VA 2VQ3A 4XQGA 4W7HA 1NVGA 1SZJG 2QG4A 3ZNQA 5EESA 3PLRA 1C3VA 5GZ1A 1QLJA 2I9PA 5JLAA 1U2DA 2ET6A 4LCJA 4QX6A 1YS4A 2GO1A 4TVOA 4BMVA 2B0JA 2X58A 3IJPA 4R3WA 1WW8A 3NRCA 4QXMA 1FXSA 2QRJA 1NQAO 1E3LA 1Q0HA 4KQXA 3U3XA 3IS3A 4FPXA 9LDBA 3MJCA 2FHSA 3IKVA 1IPEA 1EVYA 2NU8A 1OC4A 2AQHA 3K31A 1XR3A 4J1NA 1CJCA 4NBTA 4DRYA 4YDRA 3AI3A 2NQ8A 3HFSA 4CV1A 4J7CA 3ENKA 1B8UA 3CPSA 5AXCA 3KXDA 4DVJA 4CMEC 2Q1UA 1EVIA 5ENDA 3VDQA 4B4WA 4DIFA 4E2YA 4Z0PA 1JQBA 4HY3A 1PQWA 1E6WA 5FYDA 1HDGO 3PDUA 3RC1A 2I6TA 1VE9A 5BNIA 4BNNA 4B3IA 5MGBA 1EQ2A 3FNHA 4JIGA 4TROA 5BSFA 4H15A 3TSCA 3GRKA 4CL3A 4XJTA 4IBOA 4UVDA 1GZ3A 1KYQA 5K9ZA 4M89A 1Y8QA 3WBBA 4BKUA 2IZZA 1I30A 4QTZA 5GZ6A 3GAZA 4ND3A 4KUGA 4OJNA 3ETDA 3EC7A 5JAMA 4AL4A 5B1YA 3KYDA 3NT5A 3HDQA 4IM7A 2JAPA 3Q2IA 4I5FA 1L1FA 2EHDA 5TIIA 3JD4A 3RUAA 3DBVO 1NFFA 4QECA 5TF4A 1ZVMA 1ZJYA 3HDYA 5T8KA 4K6FA 1XKQA 1QLHA 3MCVA 1PGOA 1OI7A 2D5CA 2DFDA 1T1SA 2VZ0A 4JLWA 3NGXA 1XCBA 1F8GA 3DOJA 4GX0A 2DUUA 3NTQA 2X5KO 4OMUA 1NFQA 4L9RA 1SOVA 3JYOA 4B4VA 2FR0A 3PYLA 5IDQA 5U9CA 4JJFA 3H5NA 3JQBC 3JV7A 2UUOA 2WE7A 4R01A 4M87A 3TZCA 3E82A 1Z74A 3MJTA 4CM1A 4NFSA 2O3QA 3X2FA 1IE3A 2VWHA 3QLJA 4MP8A 1TA4A 2Q1SA 5HWSA 4CMIA 2IEDA 3VPGA 1FDUA 3BYZA 3P2YA 3DBRA 3GGPA 2J3HA 3EDMA 1X7HA 4RF2A 1DFHA 1MG5A 1Y9AA 4UVGA 3TNLA 2HO5A 1K6XA 3TQHA 3RD5A 5IN5A 5G2OA 4UUPA 4ZA2A 2J6IA 4E0BA 4I9NA 3FNFA 5I7VA 2BGMA 3IC5A 2I65A 2X0RA 4WCDA 3GVIA 1ZCJA 4R41A 5AXBA 4MVJI 2UVDA 3WIEA 3D0OA 4Y8VA 3E03A
chains in the Genus database with same CATH superfamily
4YFYA 1EQUA 1IH8A 3IT2A 4G0PA 4R1UA 3BGWA 4L6CA 3EVFA 3T1HB 5M04A 1QFXA 4QPDA 3PU6A 4MCAA 4BCDA 3GLHB 5BORA 3T5DA 3JY6A 5D8DA 4BQNA 5LFAA 2ZSIA 1SA0B 1Z7WA 3JZFA 4BKQA 5KNCH 3EXIB 4HEA6 1SKBA 4IYJA 1VI2A 3DE3X 4K05A 2B3TA 5ECDA 3Q1KA 1SZPA 3SIPA 2AX4A 1XK6A 1KWKA 3I6ZA 3OMXA 4KVGA 4UCQA 2PZKA 4PN7A 1XJQA 2PGOA 1VSTA 1Y8CA 3TLJA 1GLNA 3UJHA 2IZ0A 3N86A 2B1QA 3F98A 4V0MA 5CX1A 1ZMXA 3NS7A 3AU9A 3KV3O 5L7TA 3T5GA 2VQDA 5FAXA 3QEBZ 2HMSA 2Y4OA 3M6UA 1N92A 1NW4A 2W2LD 4YAWA 5EKTA 2AKEA 1NPYA 1GT91 4NYMR 2V4ZA 5BR7A 2JGAA 2XNJA 1UT5A 3QLTA 4DLRA 2RI6A 3IP8A 1GNRA 1I7PA 1GPYA 2H18A 2Y2UA 2HQ1A 2Q5OA 4C01A 1GN9A 2HLDD 3RVRA 1IHYA 3Q88A 2QTGA 1Z5PA 4MVJG 2GERA 1SU6A 3QVGA 4HQNA 2BFCB 2Q2OA 3M2TA 1SXIA 4HDQB 1NVFA 1U3CA 3UYKA 1DP4A 2RC6A 3QITA 2ZRNA 2P90A 4Q6WA 2B6NA 1J25A 3QBJA 2W93A 5JNSA 2DFLA 2R7KA 3L8EA 3ORYA 3Q8MA 5C0OE 1Q83A 3GLTA 4E22A 1LPMA 1T2CA 3EDCA 1KU0A 2Y1LA 4MV6A 3E81A 3ROTA 4RX1A 4WCFB 3R7FA 1DBIA 3H97A 2ZM6B 3LRPA 1CVIA 1UBUS 2OZKA 4M9UA 4RMIA 3UAYA 3UMBA 4NCIA 4BMXA 4XWOA 4DLWA 1EVLA 3DVAB 3W5VA 2JEZA 2GSWA 3VTFA 2F8LA 1P9WA 5DNUA 1QKJA 1GGJA 2VAMA 1RIFA 4ETWA 4RE5A 3G3EA 2BM8A 1DUSA 3CRQA 1OXKB 4IIBA 1B15A 3IPRA 4FI3F 4JCOA 5KPDA 2F1OA 3AYZB 1PT6A 3EMKA 4Q15A 5FV7A 1J6UA 1NGSA 5IJ0A 2VDNB 2YVAA 4FZ5A 1EXWA 4IGIA 1NVUQ 4M9XA 2ISSD 1R0LA 2W37A 2WAOA 3N2GA 4UNSA 5H68A 3SMQA 2XKBA 4ZAVA 1A5AB 2CFIA 2Q0SA 1CY0A 5GMOA 3IQEA 2CV2A 1ODCA 4ALMA 3DZ8A 3BORA 4BO2A 3AF5A 4F45A 4JWTA 1P4SA 4G9GA 5AKEA 1Z6ZA 1W5SA 2ORWA 2HA6A 5LP6C 5F33A 5PNTA 4DUGA 2HREA 2JIMA 1AKYA 3O26A 1WSBA 1Z16A 3CO0S 1R9JA 2CF6A 2XODA 5TMEA 2H0RA 5DNEA 7ADHA 1XD2B 1MVNA 1NN0A 5H0IA 1H0KA 3MWJA 3EASA 4NDZA 3Q12A 3U3JA 3VNSA 3EG9A 2WHPA 4OFXA 1I6KA 5KNDA 3QVSA 1JJ7A 2IUEA 2I91A 3EFOB 4A23A 2NM0A 2ZUWA 1ITZA 3IUPA 1F2TB 3PXUA 1Z9BA 2PUTA 1EG7A 4AKSA 3C87A 5AVVA 1EZ1A 3EFHA 1JIVA 3WK5A 2PUVA 3ZV5A 4KC0A 4WL0A 1T8PA 3PK0A 3PRJA 1JSCA 3ICWA 3OKPA 1K86A 1XVLA 4QTXA 3HA5A 4HRYA 5JAOA 1XVVA 2CWDA 2WJPA 1Y34E 4FNAA 3G6KA 4GVXA 4RV4A 3VKUA 4BMYA 1C0EA 3JSXA 4DGQA 2REOA 1GZ5A 1F51E 1EBBA 5C1OA 1P9NA 5E6SB 3LX5A 1XO1A 1VG8A 4HMQA 2IXAA 4FHGA 5CLJA 3OETA 5B6PA 3ZJVA 1TRKA 9ATCA 2IW1A 1VMAA 2GH1A 5NLLA 1GPLA 5KYXB 1LI5A 4TKMA 5ARCA 3NX4A 3E70C 3L4KA 4EJ6A 4DDKA 4Z3KA 3Q7QA 4BBZA 2GPJA 5BYAA 2IS1A 3NIBA 4XVHA 1W25A 2Z5FA 3WGHA 1HOXA 4J0KA 2JDID 1E4EA 1LQ2A 5IH3A 5CBKA 5A3SA 1JKJB 4OQNA 5H70A 3V97A 5CD9A 2LCQA 3ZDEA 3ZDDA 5IMBA 2ZXEA 2P35A 2ZWPA 5K09A 5JXHA 2Q0XA 1O6ZA 3VR4D 1WU8A 1XHFA 5JDIA 4IIJA 2Z8YM 1BS1A 1M6VA 3E8MA 1JHDA 4MARA 4ZTBA 4D99A 2D1FA 2XX3A 4BHTA 1Q1NA 4RF4A 2CN1A 5CXSA 1YZ3A 1VHJA 1SC6A 5D87A 1EUQA 3SMVA 2IT1A 2FZGA 2Q6TA 2EP7A 2X42A 1CF2O 1YASA 2I1VB 3GG9A 5D01A 5I9BA 5J9FA 3TR0A 3UHFA 1Y3FE 4A8PA 2FPGA 3HADA 2I33A 4BVAA 3KKPA 3CEHA 5FR2A 3RV4A 2ZAOA 3NQ41 5EIEA 2PE5A 1C3XA 1YRAA 5DGTA 1I3LA 1XEAA 4KQHA 4RQTA 3S81A 3J81A 1N0WA 4F91B 1T13A 4GOLD 1YI0A 1ZQ9A 1UMDB 4KCGA 4YJKA 3UCEA 1T43A 2ZUSA 5JCJD 4NG4A 1CUDA 3K15A 4NZMA 3W6ZA 3IGFA 3QM1A 2R8RA 3AERA 3ABZA 4E2XA 4MYUA 5D3MB 1PEYA 4E5SA 1YQDA 1TF2A 3QFHA 2VWPA 3W5IA 3WL4A 1U0FA 4AYWA 4ER0A 1XALA 2YOGA 4UCWA 3UAWA 1E9SA 3FMVA 2AS0A 4YRQA 2BFMA 4HDMB 4B34A 1XL0A 1P2VA 5DYYA 3K8YA 4PS0A 3TB6A 2UZ3A 1ZHHA 1HZZC 3N7TA 4XCVA 1C30B 2AI3A 4A6DA 1BWPA 4K1XA 1BYIA 4EDHA 2QVBA 4EBFA 2QUJA 4DA0A 2UZIR 4OLJA 1Z5VA 3ETHA 1IOZA 3QE4A 4LDRA 5HRAA 4KNYA 1HLPA 1M0WA 3CIFA 3TE6A 1PV1A 2MSLA 3CTPA 1ENPA 4FIZA 4BO4A 2UUAB 1QIJA 2W90A 3EZ7A 4CF7A 5FUQA 3VHXA 2BMFA 1PN3A 4CN8A 2QMYA 3JQFA 2PH5A 5IEBA 4AS1A 3QENA 1ZJWA 3C1TA 2O23A 3E9MA 4JSYA 2XKJE 3WWCA 1IUPA 1WU7A 3G9ZA 1ZQ1A 4Q1AA 1IN7A 1G9XA 3TNJA 1Z56C 3ZXXA 5CB4F 5LWHA 5ILQA 1S1MA 3RPEA 1TADA 3PC6A 3RGGA 1HXHA 4IVNA 3ADBA 3I2JA 5D3QA 3PR1A 1IXKA 4O8CA 1R6AA 2OG1A 1BC5A 1FP6A 2IEBA 3IAXA 1JE0A 2ZKLA 1IIRA 3V8RA 4O63O 3ZLJA 3I23A 5HMMA 2WRZA 4RE6A 1QIIA 2XYHA 1R50A 1X70A 2AWNA 3K1YA 4UE6A 2A33A 3G7NA 3EVNA 1J0BA 2C5EA 2VNSA 3W8EA 5IEJA 4IINA 3UJBA 3W78A 2JB9A 3QTLA 4ZQFA 1WBJB 5J2UB 3SQOA 3L02A 1U2SA 4DLPA 3ODPA 4XR4A 4QYWA 3H8SA 1IWPB 3IPXA 3OQIA 5C34B 3UUGA 4QG3A 1KI6B 4BJ6A 5LXTA 1ZO8A 2VSNA 3BX1A 4BMZA 1TW3A 4GDMA 3LDAA 5K0BA 5FEMA 4IXNA 8OHMA 3ONEA 1AGPA 2CEKA 1KVTA 4MS4B 1DJNA 3U6BA 1E89A 1YDHA 5CA1F 3VMMA 9LDTA 1IZZA 1CY1A 2ZJZA 4K9DA 2VJNA 2ZEJA 4N82A 4TSRA 4UPVA 3S5UA 3L7CA 2G28A 3G0GA 3U7JA 3WSTA 4WJZA 3UXYA 1V8PA 1JR3E 3K8OE 5HF6A 2Y1DA 3PDWA 4LXQA 1ZJJA 2WPDD 1I9GA 2ZBGA 1T3GA 1MP0A 3TNYA 4BRWA 1SKMA 2CHVA 1KI3A 4UQPA 5G3ZA 3T1VA 4YUZA 3BIXA 4JI4B 3I2KA 1GCOA 1QFZA 1YK1A 2ORED 2QP4A 3FI9A 3NW9A 3RS0A 3VBEA 3UJ7A 3IRVA 1WZUA 4US2R 1VKJA 2WWTA 3LYAA 4FVTA 5AOCA 3VZBA 1OZ0A 1K88A 1QG0A 4F4IA 4ENWA 2O59A 1CS0B 3IURA 1TJ3A 5ALGA 3SEFA 1DCTA 2O6HA 3M4YA 5BOVA 3KAPA 4DDMA 4CIAA 3F9CA 5EHQA 4BEJA 1GJRA 1ISMA 1ML4A 1EVKA 3WP0A 1JFFA 2B6HA 2UZAA 3D8HA 3OZRA 3LECA 3SZMA 3C15C 4BYGA 2ILTA 3FW1A 4KJZA 4WNAA 4YJ2F 3RFTA 4C0KA 3S1AA 1VA4A 2IV3A 4KX3A 4RCVA 3LX6A 4AKEA 4F85A 1VIVA 5ITVA 1GYRA 1P1RA 2ZPAA 1P44A 3D5TA 1N5DA 2HJRA 5D86A 3SK0A 1DDGA 4CKXA 1JT2A 121PA 4ZVPA 4Y0VA 2JCXA 3L0CA 5IHPA 2WWGA 3D6TB 4MPTA 1XTSA 5EE3A 4LK3A 1YKGA 2MTBA 1QZUA 2F2TA 4RWEA 2QMUA 1CUJA 1G98A 3F5DA 3PGA1 2ID7A 3A8TA 4NLLA 3RIMA 1UC9A 1QTNA 3EISA 3RYHB 3OJLA 1QZXA 2PRKA 2WU4A 3L8HA 3L1KA 3INTA 3NYIA 4JJ7A 5ER9A 4AVYA 2V6MA 1NFRA 1KOJA 1WBBA 1QH0A 2FP4B 1N6LA 2E6UX 5FBKA 1X7XA 2JBHA 3F90A 1DXYA 4ATNA 1VG0B 5I4KA 3TL3A 3C3WA 2DX7A 4Y0NA 1QHHA 3RAFC 1RZRA 1JYFA 1LRLA 3O47A 3PF9A 5DLEA 3RWOA 1WWKA 3RS2A 2OAQ1 5J2TA 4BGDA 1WXXA 5JWRA 5K8JB 1GTJ1 2JIDA 1TFUA 4RK5A 1T0HB 1TYBE 2CUTA 3UAZA 3ZZMA 2RB5A 1U1DA 1OZAA 2BKVA 2ZYAA 2HZ7A 4RETA 2WHQA 1X8LA 1IJBA 4R16A 4XB2A 4MWBA 1XN4A 4XB6B 4BVBA 5KJ6A 4UXHA 3F8SA 1RPNA 4ND2A 4N5NA 5IT9A 2MJLA 3IOCA 3BJZA 1QGUA 4OVKA 4NJMA 4CM8A 1Z5OA 1GGVA 2VPIA 3HWWA 3HNRA 2PH7A 1TJPB 3HHPA 3N2YA 4R1LA 1A96A 1N2CE 2DY1A 2BFPA 4LDQA 3GD7A 1RLUA 4TQUS 2Y4NA 4FLEA 1ADGA 4WNCA 3ZWYA 2YWHA 4BLUA 1EP9A 4DJ5X 3HCPA 1ZSNA 2EWWA 5K3BA 1JLRA 2BEUA 2HSWA 1U0EA 2PS3A 1SUBA 2WT9A 1K6JA 3AVOA 3OUUA 3SBDA 3PENA 2I71A 2Q3JA 4YHBA 3UAXA 2XITA 3ELYA 3K0HA 1AUXA 3OWOA 5ES4B 4OP2A 1SCNE 4IDEA 4DLZA 4ZWNA 2W6PA 5DM70 3K1TA 1XP8A 2NT4A 4NZYA 1KK2A 4E5YA 1WDMA 3VO1A 3FG9A 2C29D 1QP8A 5BQPA 1G8AA 5LPNA 2Q4RA 3A58B 1XLVA 2W83A 3G8CA 1JDNA 3MD0A 2ZJ1A 1P4JA 2X3YA 2FLKA 4QXRA 1KVRA 3QIAA 1JKXA 3U80A 1CG6A 3FETA 4CV0A 3BF7A 4ZIRA 1H1LA 5IVHA 2QVGA 3WYNA 5FA6A 1P5JA 2VJAA 3R5KA 5GJCA 3D2BA 3HUUA 1DBSA 2BGWA 3BKXA 3KVNA 1X92A 2XQFA 5THKA 2WT8A 5H5JA 3RG8A 3SYNA 1J39A 2UVQA 3AHEA 4XSGA 1Y4UA 1FZQA 3JR7A 3PP8A 3G8YA 3NHRA 2X0FA 3KKQA 2W42A 5KYUB 1ZITA 2C8JA 2G1JA 2ZM5A 3BRCA 2W5UA 1AC5A 3EQ9A 4E5PA 3IEPA 3LC1O 3I5AA 2OCPA 2WLSA 5I7WA 4R7GA 3SEQA 5HQTA 5ELLA 1PAUA 4L8VA 4ZMRA 2VATA 3WLFA 3VJLA 1BDIA 1MB3A 2ZXFA 3GWGA 2ATXA 1LLUA 2JLXA 2J6CA 5F1YA 3U9TA 2F8MA 2GZMA 3BREA 3HNOA 3IAHA 4IDPA 4X3OA 1TAHA 5SZIA 4J07A 1AHHA 1J49A 5L8VA 3EIWA 3B8HA 5AUQA 4RF3A 2D13A 1UOPA 4BO3A 4AT1A 3V5NA 1T8TA 1UKYA 2EBFX 3EPLA 1WHSB 2CW5A 3O2NA 5IKXA 1W2HA 1HZZA 3GEMA 2RONA 4D0SA 4P4GA 4C0JA 1QTRA 1Y48E 4K03A 2ZB8A 2AFHE 3MWKA 5JZVA 2IHTA 2OXCA 5FJIA 3A1DA 2C07A 5FWNA 1I7DA 1HQKA 1XD8A 2WF9A 2ZIGA 2XHEA 1O0CA 1Z17A 3H5RA 2VNKA 2ZG6A 3EVEA 2HPVA 1VCHA 4Z54A 2UUBB 1DMRA 3BXEA 5FUBA 2GR9A 1KI4A 4IMPA 5BYBA 2V6IA 3BMOB 1I1HA 1TO1E 1U2QA 1HSZA 1TM1E 2J7KA 1HG0A 3NT2A 1NJ5A 4IFTA 4UNQA 4B6FA 1N6PA 1YGYA 2P6PA 2Q62A 3C6MA 1WZ2A 1O4VA 5BPFA 2OAGA 4WX2B 4AJ2A 3NATA 2G5GX 3FGOA 4WXMA 3NWJA 2C99A 3IT1A 5C51B 2F1KA 3VHRA 3S2IA 3VSAA 2W8BA 5DSXA 2WJZB 2AE1A 1E1NA 4H59A 4DMRA 1M2KA 1JL3A 3QK7A 4LY0A 5A62A 1PWXA 1TMGE 1U6IA 3LQ1A 3CH7A 3IVRA 1NNLA 2ZJAA 3HC7A 1K98A 1DJOA 1XMSA 2AB0A 3PQ8A 4OAPA 3DTNA 2RHGB 3OIWA 4K6OA 3W8RA 2IA5A 2X0IA 2CE2X 1DRJA 2YV4A 5KNDD 3SIRA 3GLGE 4MO2A 4TN5A 5FLEX 3U56A 4WBNA 4LRUA 3GRZA 1K63A 4JFRA 3BE6A 3T5TA 2YIJA 5K2OA 4OAQA 4QHTA 3W2IA 2X2FA 1K7FB 4PGFA 3S44A 4PLGA 1L6RA 4LFAB 3PNOA 2RHHA 4HBGA 2VPTA 3L0OA 3C14C 4S12A 1QRDA 4QO8A 1UXKA 2VLBA 4MW6A 4Q3BA 5JCXA 1FIUA 1JJVA 3ZG6A 1GXSB 1EFDN 1GTL1 1WOMA 3G2JA 2VBGA 1Q1ZA 1HOTA 1K8ZB 1A4UA 4ROSA 1P45A 2RDMA 3CUWA 4QBFA 4BO1A 4IHJF 1XQWA 2R6GA 2PZFA 4MJLA 1M34B 2PRIA 3CEJA 2H52A 3D4PA 4Y1FA 1P72A 4Z2AA 5JC1A 3FOEC 1UJBA 2KHZA 3H9BA 3I4FA 4EO7A 4QYSA 4DV0B 3FVWA 5C1BA 3CIOA 1J1IA 4QPCA 5C5CA 4GQIA 3D6HA 4DE5A 3MCAA 1VKOA 4FFDA 3W0LB 4DCOA 4EHIA 4KXNA 3SXUA 1P0FA 4TS9A 3BTOA 5CM9C 2BKXA 1Z2EA 1ETUA 1LPPA 1NR5A 3FHLA 3OG9A 2FV8A 5EQFA 2C5FA 5EE9A 2YV2A 4ZV4A 4D96A 5LMNB 3LUGA 1UC4B 4FW9A 1OTYA 2Q2QA 4J9UE 4YO8A 2JGNA 5G4LA 3ZCSA 1RWXA 1JEYB 1I0LA 3VR6A 2PMDA 4WXYB 4NICA 4CR8A 2ZUCA 2H63A 3WADA 4ITVA 3PHLA 3T5MA 1KDZA 1VOTA 1ZD5A 3KQHA 1YZYA 3M5PA 5AM3A 2GVNA 4CWAA 1T3HA 1X87A 3F49S 4M9QA 5KYYA 1QYXA 3AVVA 1IK6A 2OXEA 3SF8B 4IDNA 5JECA 1A7AA 1WRBA 2GKOA 2HXGA 2XT6A 4N4AA 3G2LA 2Q7XA 2B61A 3VV3A 3WGLA 1NC1A 4A8JB 4DS3A 4K28A 3R3ZA 2V1XA 1VMKA 1L8OA 1JAYA 2OO5C 2WNIA 4FBMA 4MRMA 2X9LA 1D8AA 5HJ7A 5LLDA 1RM5A 4H1TA 2LV8A 3DOOA 5TB5A 4GMDA 1W4CA 2M2IA 2I8CA 2QAIA 1PNQA 1OILA 4HI0E 1Z8DA 5C8YB 2A5LA 2D1TA 2CUKA 2XDQA 1NVVQ 4HQKA 2C7OA 2W4IA 2B4RO 1FY2A 3O92A 3S8MA 2QZ4A 2AHRA 4W5WA 4HMOA 4Y6LA 2OFWA 1BGVA 3R5HA 3AHJA 1LB1B 2QD5A 4TV9B 3WIVA 4TRRA 4YIHA 2PT5A 4C6SA 5BWLA 1UBCA 4LJ9A 3OBBA 2PMFA 2Y0BA 4D82A 1AKVA 3LT5A 5KOIA 4UJ5A 1PGPA 1ARZA 1BHJA 4JLDA 5EE5B 5IBCA 3KKMA 1PJTA 4KVFA 1XN1A 4W9RA 4Y6RA 4RZHA 4JZYA 2V3WA 2EX1A 4DCSA 2VTKA 4Q4LA 1Q5PA 1WX1A 4RTRA 5CURA 1NIPA 1T5SA 1YZLA 3H1FA 4OA8A 1JAZA 1F5NA 2YWEA 5DV9A 4E13A 5ILOA 1HE2A 3U1VA 5CAEA 5CHYA 5FORA 1I7SB 3F6YA 1FW6A 1KDOA 1TZMA 1PF7E 1QSGA 2ODPA 1ZP6A 1LDGA 2GUGA 1XX6A 2OO3A 1M5UA 1CD5A 2DKNA 3IODA 3PJGA 4PPYA 3ZD9A 4FD2A 3OX1A 1HL3A 2V5UA 3DFIA 2AOTB 2P4HX 3R0IA 5HIMA 1GPJA 3EF0A 3I9MA 4M0LA 2WTMA 1RT9A 4YBZA 2Y93A 2JI7A 5B1IA 5A02A 1J70A 3GYGA 4I4TB 2VH5R 4G41A 4UREA 3KDPA 2MU1A 2K2WA 1T5IA 3N58A 3SQNA 1QRAA 5EN4A 7REQA 1MB4A 3WXMA 5T6MA 5F5LA 3JCZA 4CMJA 2RHCA 1TUGA 1XQ1A 4NE2A 1RYFA 2R8OA 3FFAA 1LNQA 4ZQGA 1MPXA 1CUAA 5FQNA 4DHEA 2PUJA 1WA5A 1EYZA 1Y5MA 1FTSA 3R7NA 4DNOA 4YRAA 8GPBA 1YTUA 4FYXA 1AA9A 3GY0A 4E03A 3KOZA 3MTIA 3Q1LA 1ZVKA 1TAUA 1M1ZA 3ERCA 4KJXA 2HYDA 3NDRA 4MYRA 2CXOA 1KEEB 5E95A 2QQGA 2WW8A 1U7OA 2HRQA 4U9IS 3KWLA 4AC9A 3L07A 2J5QA 1CY2A 3SJAA 5JVDB 2FZ4A 4JLJA 5ER6A 2ZFUA 4GEGA 4XWKA 2O07A 3RFCA 4WJLA 5KWEA 2Q9CA 3IE1A 2H7YA 1E63A 2QUZA 4Y7DA 1E77A 5CFZA 1SVKA 3O3MB 1XAHA 1G63A 3MK31 1D4ZA 2RJNA 2PO7A 2HT6A 1SHLA 3CE9A 4HGNA 1GKUB 3TIXB 1IAVA 3M83A 4L51A 5GTDA 3USES 2AJBA 2YY5A 1NVBA 1FSPA 4AUEA 3KJZA 1KAHA 5E6RB 5JDCC 3RVQA 4E88A 3T7EA 2CVOA 2PUEA 2Z2JA 2QZJA 1T0JB 3HO8A 4FCVA 4B73A 1YQWA 1NZJA 3MD9A 4KYUA 3ZDCA 1PGQA 2BGIA 3KTAA 4YWHA 1F4VA 2A59A 1FSZA 2ZKIA 5F21A 2A9PA 1K7SN 3E5NA 1VLLA 2C9CA 1H5NA 1ZM2A 5AK6A 4PYNA 3I05A 2A0FA 4ARSA 4F6RA 3U37A 3LCRA 4I5EA 3ELWA 5B3JA 1LS1A 2OHXA 1BH2A 3OUZA 2B5VA 2YDXA 4HJXA 3WYEA 5E1OA 1XTIA 3BM5A 4DIBA 3OZVA 1DIBA 2H3EA 1TK9A 5H3HA 1JB9A 3DHYA 3BD8A 4YVFA 3STWA 2AUTA 3TIVA 1SVWA 2DM6A 3IDQA 3CRRA 4YONB 3R23A 2D62A 2HNBA 1ULSA 4OKSA 4AUMA 4DR1B 1B23P 3GBSA 3K9CA 4F2PA 3WKEA 3WJ2A 1RZRD 3SM3A 3U7QA 1NBMD 3LFHA 3KCNA 3S27A 4H3VA 1XCLA 1DHTA 1FNSA 2WVJA 4ZVTA 2ZRLA 1U2TA 4AQ7A 1RAHA 5KTMA 3L3BA 2DF8A 3RU3A 4JI2B 4TTPA 4M37A 4OBEA 2N46A 2QBYA 4P4SA 2PHZA 3ZQUA 1RAAA 2I6SA 2HB6A 1VA5A 5DI9A 1XNRB 1J00A 2BBSA 4JDUA 3R3VA 4QXAA 5DULA 4JT2A 4BFYA 4CFZA 3NEPX 3Q7PA 4R9VA 4REQA 3B89A 3ZTWA 2ZB2A 4HAIA 2B2CA 2VXOA 2JJ2A 2QI9F 3EDYA 3ZQ4A 4C6TB 4Z51A 1KU6A 1UBTS 3ASZA 4M1KA 2DTDA 1PFGA 4GYJA 4CKBB 3CR3C 4ZFNA 1P0MA 5IZCA 1Y6RA 1NVWQ 3AZQA 1MC1A 2IGTA 3M8KA 4R2IA 4WXEA 2LE0A 3CJRA 1X42A 1EFTA 2QTMA 4H7JA 5TGTA 3ZHOA 4MKZA 1SWVA 5IDXA 4X8OA 3V2HA 1NONA 1AZTA 3JW8A 2ZDHA 3Q2KA 3C6BA 4MVJP 3HYNA 4GKJB 1ZNZA 3LUKA 3HXOA 1IC6A 3TJRA 1ULHA 3PQ2A 2DPLA 3U49A 2REXB 3KFXA 1UC8A 3B1FA 5A3QA 5JW6A 4KQEA 4IJMA 2FMKA 2DHQA 2GZRA 4I2NA 3EGDB 3O4RA 3MUEA 3PXDA 4RO0A 3X1XA 1UFOA 3RAJA 3KTFA 1A4RA 2IPOA 3H0CA 3ZHVA 3T4XA 5DM1A 4DQDA 1U5BB 4R1PA 1JVNA 1DO2A 2PMBA 3S2FA 5I7UA 3ZNPA 3ACDA 4QOJA 2JHCA 2V65A 3RGWS 4XM0A 1X77A 3CT6A 5EFZA 3BH6A 4M7OA 3RK4A 2I2DA 1CPYA 3DT8A 1W44A 5I7SA 2ZJ5A 4L2IA 3OZCA 2F3SA 1VKNA 3M6LA 4RF5A 4EX6A 1YWGO 3WE7A 2X5NA 3K9NA 3O3CA 4I5DA 4B82A 3SWWA 2JJ1A 2W8ZA 4CKZA 1ZINA 2AZDA 3RTGA 2L0XA 3FIJA 5J2UF 4M0UA 1NQXA 3DVQX 4MGYR 3UHPA 4ZYZA 1XRPA 5JSQA 4TTRA 1UFVA 1W5FA 1U3GA 3NTUA 1C5KA 1KOLA 4Q34A 1UBOS 1PSDA 4N0PA 1G8MA 1T0UA 3OZEA 4W8OA 1OFIA 2C0PA 2VPZA 3TX6A 1BVUA 1NV8A 2D0PB 3EG9B 5F7ZA 3V1KA 2GB4A 3CKYA 2R1VA 4TTQA 1L7XA 4DLBA 1P75A 4JVOA 5JISA 3T7IA 3K1ZA 1MFZA 1OD6A 1P33A 3DMGA 3HFGA 3J7AC 1H2AS 4KR6A 1II9A 2XHZA 1W0CA 1PGNA 3AP3A 4A92A 4UD2A 2OLEA 2GX6A 3D2CA 5SYAA 4FSXA 4Y1RA 4BNDB 2WZCA 1NVEA 1AZLA 4DY6A 4CUZA 4RLQA 1G8PA 3PDCA 1KZ6A 4AU1A 3R74A 3DM9B 1UKZA 5DTJA 3K0SA 2OT3B 3EH2A 4MI9A 3C4JA 4R2JA 1A50B 4Z7OB 1Y6GA 4KKVA 3GEBA 1TT7A 4LVOA 1UBSB 1Y82A 2P2YA 3GZTB 3NTVA 4H31A 4DA9A 3OTWA 5JD6A 5MN4A 4JBLA 2ZBVA 4IHAA 4U7TB 3NWPA 3VNBA 3EFBA 4N8EA 2X1VA 3NV7A 1TVKA 5DGDA 3A6FA 2WD7A 1A4IA 4DNQA 1HEUA 2V1UA 1JEAA 2NLOA 4EL0A 3I9KA 3W5DA 4WSOA 3K6SB 1B6RA 2OAEA 3JAKB 5IAJA 4PLVA 1MOQA 2C5LA 4FJ2A 1NRXA 3E2PA 2C2WA 2IZ1A 1HDZA 3ZUPA 1A95A 1D4AA 5GPBA 3SVTA 1CQIB 3HSKA 5EQTA 1WP4A 2JCBA 2V4MA 3AY6A 4HGQA 4JR2A 3B51X 4AZVA 1U80A 1OE0A 1QYCA 4BL5A 1XF9A 2R60A 1N2SA 3BUSA 3DYBA 4L3WA 3ZGYA 3HXMA 4ZCPA 1CZLA 1Y3IA 3E22B 3R0XA 1N6NA 3VKWA 5FHRA 1ZEMA 5BSGA 1VMDA 3VTKA 1OXUA 4DQ0A 4W9NA 4MX8A 1NV9A 2NXCA 4DT1A 5K6AA 3JYNA 2ZJBA 3P0HA 5HUHA 1MLDA 3RB8A 2DBQA 4LGMA 3VPBA 3GPCA 4EB6B 4MAAA 3PJEA 5K1ZA 1HI9A 4K0RA 1SIWA 3KQMA 4RHYA 2G3YA 1SIOA 2P67A 5FOWA 1GUDA 2J3KA 3FOWA 3GMDA 4W63A 3T0FA 1HYQA 1EFRD 3GELA 3OKFA 1PUXA 1FXWA 1UQTA 1XDBA 1GPDG 1YDWA 2EBWA 2Q2WA 4W4TA 2G9NA 3FROA 2R00A 3LHSA 4ALNA 3HDGA 2EZ4A 2FEWB 2J8ZA 4G2TA 4GSLA 3G13A 3IERA 3RO7A 4OK5A 5EHXA 2XB2A 5TARA 1GPUA 2FN8A 1RWWA 1P5FA 5AHOA 2Q46A 4K3VA 4JGGA 5ALLA 3A9VA 4D02A 4OSEA 4XUDA 4EG7A 2Z09A 3PGKA 4JL6A 3IOBA 2ALJA 2WLTA 4B6SA 4IJ5A 4YRGA 1M8JA 5A71A 3SEZA 3AEKB 4JBHA 1E9EA 1WP9A 3MTBA 4GKVA 5E7MA 2BFNA 3WBKA 1R3UA 1JG4A 3H5AA 3I12A 5T64A 4KOEC 2C8VA 4M99A 3ZJTA 1AZSC 4IO1A 1VIYA 2XB8A 3I2GA 4RM2A 2YY6A 5LA6A 2FJPA 4HVAA 1HT0A 4KMRA 4H3KB 4PSVA 1BNCA 3WL3A 4ZRDA 4F3YA 3BL5A 3GYBA 4KXYA 4ZZ1A 3S2GA 2HPZA 2XWQA 2HGZA 3OZTA 3VHXB 3NNSA 3CBQA 1CVLA 4C5BA 5EXEA 4BDTA 1EP3B 2RGWA 1OC2A 1KDTA 3H1BA 1J2YA 3O9ZA 3VR6D 2DLCX 1MH9A 2VJPA 3HUFA 4QQNA 3RCBA 2ZBDA 3QKIA 3RJ9A 1L4KA 1JQKA 2EXXA 2C7VA 1LLDA 1UFRA 1Y5RA 3DLPX 1F6WA 2P1RA 2UZ1B 4V3CA 4LHSA 2HU8A 2JHAA 3FGPA 5SICE 1FDTA 3MB8A 1E0SA 4ZQCB 4TTIA 1Q77A 1P5HA 1THZA 2BELA 4NFHA 4DEYA 1YB4A 2C04A 1V35A 3JASA 1VE1A 3VR2D 1I94B 3ZDYB 4J6FA 2Q6OA 4G63A 5FAKA 4RJIA 4AQDA 3QPBA 2E4WA 3FPEA 2BOVA 4PAWA 4XM1A 1CRLA 5AESA 4KHZA 1VE6A 3E15A 3CVUA 1JKMA 1ZMRA 5CT4A 1R4NB 2A1TR 3QKRA 4U0KA 4ADSG 2IELA 1BEEA 1ID1A 3H83A 4OKIA 1LU9A 1UDRA 3Q3CA 1OKKA 3L40A 4JI6B 3SQLA 2FPPA 3TINA 1PFVA 1GGHA 5K0ZA 3JZIA 4JJ6A 2NU6B 3C5WP 1MQ8B 1UAYA 3ABRB 1JS1X 2LCFA 3ER6A 3SU8A 4C08A 2CB0A 2XQIA 2I2XB 2JVKA 1T4DA 1EVZA 4HUQB 4JQZA 3BMNA 2DJ5A 4JJZA 3DBLB 2JS7A 4FZJA 1WMAA 5IBQA 4MUXA 3RANA 2G1KA 3PX2A 4K6HA 5K5EA 1DAGA 3BL8A 2QPAA 5DWQA 3OCVA 4E5VA 4BMCA 2GZ3A 1Q2XA 3F96A 3M1IA 4DR6B 2FK7A 4LHYA 5ICCA 2UV8A 3EHDA 2CJWA 3UZUA 4TMVA 2PR2A 2IKSA 3QMMA 1QJCA 1VCOA 2XOKA 1X86B 4XEUA 1H42A 2GPAA 4CR7A 3I92A 4H1UA 1LJ8A 5FR1A 1JIQA 4MRVA 3WIOA 3JAMA 1V5IA 3R9IA 3LWNA 2AOWA 5BMOA 4PIVA 1JFFB 5TEVA 2WFMA 3GNSA 3PE6A 4HYTA 2D1RA 1W73A 1KOFA 2KM1A 4PTLA 3TAUA 5LU9A 3N05A 4ZEMA 1PL7A 1DV1A 3LJKA 4LRQA 1UDWA 1NC3A 3KXIA 3SYTA 1T8RA 1O5IA 4X8MA 3LHFA 1KKLA 4UM9B 2EKLA 2E21A 5DWDA 2HMUA 2X8JA 2BL4A 2QQ0A 2Y0EA 2FK8A 1Y6ZA 2ORIA 2NUPB 3C5EA 4LJ4A 1IEXA 4P5EA 3PYXA 5KAPA 1SOUA 3BWYA 3BN3A 4BFUA 4YMIA 1UT8A 1JI3A 1FA9A 3AVQA 1NKSA 4Z9XA 3L01A 4BU0A 1ZK1A 2QSUA 4OP3A 4OEHA 1HO3A 2HMYB 4TT8A 1PD0A 3R3XA 3BFPA 3ZCUA 3OESA 4ND8A 3QMPA 4IV5A 1KWGA 3IVCA 2F8TA 2X22A 4TXJA 1RI3A 5AIBA 4MXDA 5AD1A 1EX6A 3GC6A 5C5DA 3GLHE 1BXRB 2AKAB 1FP7A 3MUNA 2A67A 5F35A 4J9VA 1ZVJA 4DLTA 4AD8A 1B7GO 3TXYA 3E7WA 4K9OA 3ZPXA 4A0GA 4JYMA 1S2GA 1DC6A 3OSZA 4B48A 5AVZA 1Q7GA 4LHEA 3ITDA 4ZT3A 3FF1A 4JBIA 1NIJA 3DMTC 5DJ5A 1IXRC 1OIVA 1PFKA 1DNPA 1P8JA 1E64A 1Y81A 3BMXA 4EHJA 4RK7A 2A1IA 3G49A 4H7KA 3KT0A 4D97A 5LP6B 1TK2A 2OVBA 1Y6FA 3O0TA 4NIMA 1SEVA 2J59A 4EHBA 1AKNA 2G0NA 4IXMA 4UFOA 3THWA 3ZCQA 1Z4QA 1N6HA 4UE3S 3TW4A 3M81A 4B3BA 1KYIA 1E6UA 2GZAA 5JD5A 1QGUB 4NJMB 2ERYA 3B7WA 5F5NA 5GVSA 1DJLA 3CRNA 4OXQA 1QAOA 1DKRA 1XV5A 2PBFA 3KSRA 3X1JA 4AJHA 2R7LA 3R3UA 2YINC 5DOVA 2VCEA 5AJHA 1M0TA 5CDHA 4HNAB 5JRJA 1T4CA 1OREA 1CIPA 3AONB 1P74A 2B94A 4X3PA 4BP3A 5IHXA 2POCA 1XA3A 3P2KA 4MAMA 2JLYA 1AQJA 1Z5UA 1AXGA 1AXRA 2F7SA 4AJOA 4KO1S 1AY0A 2X86A 5TMBA 3RUIA 2H4WA 1GZVA 1VPEA 3GF4A 1FYEA 2Z4SA 3OJWA 3T9BA 2QD3A 4F6CA 1ISHA 2XD9A 2FMXA 4QOIA 2IBMA 2QUAA 3CZCA 1ZW6A 4QREA 2RGCA 1CUBA 5AVKA 3SKXA 1GLVA 1TPYA 4ESOA 1XEXB 3LG2A 5CYPA 1LDEA 4Z7QB 2AFVA 3N5CA 2ZK7A 1XF1A 4L7QA 4ZQHA 1D4OA 7ABPA 2P4SA 1S8FA 3KB6A 3W8FA 1RRGA 4DQXA 1YE5A 2AC4A 1OBVA 3G0DA 3ZE0B 4LRTB 2ATIA 4UXIA 3HABA 5BUZA 2BF4A 4KH1A 1QK4A 4MQFA 3KPYA 4F4DA 5HKKA 4BE9A 2HBZA 3D6VA 1XMVA 3KVRA 1VJRA 4RV9A 2OK7A 4I1YA 2BHSA 2FJ0A 3RUCA 1V8BA 2QL7A 3EZ9A 4IFIA 2DHRA 3HVJA 1PVOA 3D3WB 3AQ4A 4CI0B 4F3TA 1KYWA 4DRXB 4EEXA 5A9TA 4TYPA 5ED0A 2WP0A 1K0UA 2YN2A 4B6JA 1ZUNA 1V4BA 2PIDA 5BSVA 2OBFA 5TQVA 1QCDA 3MQFA 3BQMB 1KJ9A 4Y2YA 2PFKA 4RD6A 1KBOA 1OAAA 4WLVA 4ZEWA 4Q00A 1PJCA 4CQMB 2Q45A 4YWJA 4WKPA 5B55A 1GQFA 1UK7A 5BMVB 1YS2X 2ADFA 4L0MA 1D6JA 5C8YF 4G5XA 2WUWE 2XADA 4U2KA 2H1OA 4HSEA 4G67A 3R76A 5A4MS 5BN4A 5LZ4A 3UXEA 1P4AA 5LYJB 5JASA 3P9QA 3QBVA 3V34A 3HB5X 3GOHA 4C4OA 1Q1BA 3DWFA 4TV9F 3WHKA 4YLEA 1AV6A 1ULTA 3BB3A 1EX9A 2H11A 2ZS9A 3ZNOA 3HRHA 3CZRA 5G4KA 1EUCB 4UDYX 3WLQA 4D9IA 1YBFA 2Y99A 2AOUB 3KE9A 4FGKA 4KV7A 2QRMA 1QUEA 2VOEA 2GNPA 3EB9A 1CDEA 4Q7KA 1IY2A 1VPTA 5A04A 1TO6A 1TZJA 3WMFA 4CMGA 1O8CA 3DAYA 3JALB 3QUAA 2GM5A 5CX4A 3UJ3X 2R7NA 821PA 3N6XA 4WOKA 3U4IA 3ZS9A 3U3OA 1D1SA 4UD6A 3OCWA 4PZUA 1KZ1A 1EPUA 2PD3A 1XQ6A 3VDRA 3Q7EA 1PK9A 1GV1A 3RFFA 4CETA 1Q7EA 1L8LA 4FDMA 1XTBA 2FR1A 3W3ZB 2V58A 4PLTA 4UHKA 1W5TA 3CF4A 1W36D 3QKSA 4TYQA 4DOMA 2VAWA 3TH5A 1EFLA 3IXLA 3G2QA 3CSUA 4G4IA 1L4HA 4GRDA 3W9BA 1ATIA 2W2XA 1T8SA 3X1DA 1E2BA 2PUDA 1XCJA 4PLPA 4XFJA 3CH5A 2R5NA 4KVAA 1R0RE 2E55A 1HQDA 2EG5A 1FX0A 2HWYA 1R8QA 5I45A 2JH8A 1M1UA 2JJ1D 1IJEA 3ROKA 5EXSA 1ICIA 2JIOA 4I4TF 1S7CA 3MJHA 4LGVA 2O2ZA 3LT1A 4LVCA 5C81A 3KHUA 1T9BA 1WO8A 3Q9SA 4B6OA 2XE8A 2FSIA 3SC6A 4C3VA 1R6VA 2I6GA 2BE7A 4MRRA 3K2QA 2KB0A 3GJXC 3OLZA 4RVFA 4UMEA 5FL7A 2A94A 4MUEA 2JAQA 3P26A 3DLBA 2AMLA 3HWX1 5A6SA 3TIFA 3KQTA 2CLLB 2Y1GA 1ZD9A 2W6NA 4QKQA 1IJKA 4Q4AB 3KC2A 4YAKA 2VH1A 3M9XA 3BC1A 1PFQA 3F1LA 4R8KA 4O2RA 1FUYB 1SBHA 4P82A 4MVJF 2ATVA 1MVLA 5D5HA 4BXOB 1EUDA 2RHJA 3B85A 1YA4A 1YZKA 4XIFA 3VAYA 3ETNA 2QMHA 4M0CA 2VK4A 4BLQA 4XVQA 1RQXA 2IV7A 2RB4A 3RVKA 2OXTA 2B9VA 4W99A 1JT9A 3CEPB 2CY0A 1J2JA 2K4MA 4EKIA 5B3KA 5JVDF 1GQ2A 5TMDA 2VSOA 4MCJA 4YA6A 5BR8B 2C9DA 5BQ3A 2WEKA 3DZBA 3E7FA 1G60A 3O94A 1SK9A 4KIFA 4HAVA 4XRRA 5TR9A 4KPYA