2EKQA

Structure of tt0495 protein from thermus thermophilus
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
238
structure length
238
Chain Sequence
ERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQSLGAVPLPTDLEKDDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
publication title The first crystal structure of NAD-dependent 3-dehydro-2-deoxy-D-gluconate dehydrogenase from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 82
structure length 238
sequence length 238
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.125: 2-deoxy-D-gluconate 3-dehydrogenase.
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ekqA00
5IDYA 5EINA 5CAEA 1OAAA 4NHEA 4ZU3A 1OMOA 3H4VA 5MGBA 3ZCXA 1NVGA 4WOKA 4YJDA 4AJ4A 4BNJA 3ANNA 4AJIA 4TQGA 4Z3KA 3Q2IA 1V3UA 4JXKA 4Z3DA 3WFJA 3WIEA 3KHUA 2GN4A 1TEHA 5JMWA 3DDNA 5CPFA 2EF1A 3AFNA 4INAA 3I4FA 2DAPA 4E12A 1U4SA 3P2YA 3NTQA 1DIAA 1H6DA 1HZJA 2FMUA 2I66A 4ND3A 3IJRA 1P31A 4H7PA 4CM1A 2FPGA 3KSZO 1ENYA 1MC4A 4E2ZA 3NJ4A 2QRLA 1I2ZA 4TKLA 4ZICA 1WZIA 2G76A 5BR7A 5TT0A 4KTTE 3RU9A 2V6GA 4YRDA 4R4JA 3ONFA 3ANMA 4UVDA 3ZWNA 5AXBA 4IUYA 4BKQA 3HFGA 5CEFA 2JCXA 2X58A 4L4RA 1I2BA 3O38A 3O8QA 4HUJA 4YBZA 5DBFA 3WSVA 1MFPA 3H65A 4BNFA 3GFGA 1R12A 2Q2WA 2OO5A 3ZHYA 3FD8A 3E8XA 1LU9A 3OHSX 3ZU5A 4B7CA 5A1TA 3AUSA 1EUZA 1LRKA 1GD1O 1SMKA 4Y6RA 4NJMB 5T64A 1Q2XA 2OP0A 4MIEA 4E2XA 2LDXA 3UCXA 2CVOA 2DBZA 2DQ4A 4IGEA 3RBZA 1PZHA 3QVTA 4OH1A 1U5AA 4KWHA 3I3OA 1VL0A 4YA6A 1BHSA 4D3SA 1XEAA 4RVUA 2Q49A 3GVPA 1LDYA 2UUPA 2W2KA 3NV9A 5ES3A 3NJ8A 4BKRA 4R41A 1LDNA 3RUHA 2Q2QA 4CR8A 4Y6SA 4YACA 3I1JA 3K96A 2NACA 3RKUA 1RPNA 1ZEMA 2JL1A 4E5NA 3PXXA 1P44A 1BDMA 1V6AA 2X22A 4RQUA 3OP4A 1UXJA 2W8ZA 1BW9A 2PWZA 4CQMD 3U62A 4YPOA 1NP3A 4XDZA 2EW8A 1V3VA 1J6UA 4W9NA 1ADGA 1H9BA 1QLJA 1WAMA 3B20A 1I5RA 1QYDA 4LMPA 1SO8A 5LDGA 1B15A 2FZEA 3KXDA 1N9GA 1TT5A 3DBRB 5HM8A 3DOCA 1DDOA 4XA8A 1I3LA 3OJFA 4YAIA 3CKYA 1VPDA 3JQ7A 4A26A 5JDCA 3G49A 4L0QA 4MINA 4M8SA 4RF5A 1PJLA 2C07A 3KB6A 4RF4A 3HE3A 1Q1NA 4FW8A 2YFQA 2Y1CA 5DCUA 2EP7A 3RUDA 1AHIA 4F6LA 2VN8A 4DXHA 4KOAA 4G5HA 1YRLA 3WGTA 5ICSA 1SNYA 1D7OA 1HE5A 1SOWA 4O0LA 5KVCA 4XKJA 3CE6A 5T57A 4YT2A 4CV1A 1IYZA 4CQMA 4CR7A 4XIYA 3HSKA 2X9VA 3VHRA 1I01A 2NQ8A 1R15A 1NWCA 1ULSA 4U0JA 3NT5A 3JYPA 3WWZA 2VWQA 3L9XA 4W7HA 3L4BC 4Q9NA 5A5EA 5KKCA 1Y1PA 1LQTA 2AG5A 3ZZNA 5HRUA 1EVIA 4YRBA 4GLLA 4RV9A 2Z1MA 2E49A 1V3TA 3PLNA 4GPD1 1YQXA 3LDHA 3QVOA 4LGVA 3QP9A 1I2CA 4IGFA 4Y98A 3V2UA 4Q3AA 1F14A 2AXQA 1DC5A 2Z1NA 4RPHA 1XELA 2OXIA 2E37A 2DT5A 4K9DA 5FFFA 4BMNA 5L53A 3RC1A 2YHUA 4YWJA 5AOVA 3VPSA 1B3BA 4IM7A 1IY8A 4QSMA 3MWDB 4CL8A 4IJUA 3LF1A 1KETA 3IUPA 3NDIA 3E9NA 2ZYDA 2ZJ0A 5F1OA 3WICA 2EP5A 3GVHA 1TT7A 2A4KA 4CMIB 1NVTA 4BNMA 5JYEA 2TMGA 1JA9A 1WPQA 4HX5A 2VRBA 5DULA 1R0KA 4YAJA 2NU8A 2ZKLA 4EUEA 1JVSA 2Y1FA 3LT4A 1ZCJA 2IEBA 1HKUA 4PRLA 2POQX 3JD3A 3PFFA 4Q3CA 3C1OA 3GAFA 1H93A 4Z0HO 4XD2A 3DZIA 2FR0A 1GQQA 2C5EA 4L76A 2QW8A 2VZ9A 1BTOA 4IINA 4E31A 1UXIA 1GTMA 1E6UA 3DL2A 4QECA 3DBVO 4YJFA 3OSUA 5DCWA 3E18A 1TA4A 4OKNA 3RUEA 3ZWAA 3I52A 4GKVA 2GN8A 4RL6A 1R4NA 3SLKA 1LXCA 5HBRA 3ASVA 5B37A 3DZFA 3HFSA 3TL2A 5GZ6A 1DFIA 4K1LA 2BFMA 4FFMA 1E7SA 1TI7A 3QWBA 4GX1A 3TZCA 1PS0A 5JS6A 4BO1A 4DPKA 3INTA 1XCBA 2HRZA 2VQ3A 3WGYA 2F00A 5AYVA 2NV6A 2X5OA 4PVCA 3U4HA 1HYEA 4P8RA 2ZB8A 2CD9A 3C24A 3ENNA 4WEQA 5I8ZA 3VH1A 3OQBA 2NU6A 1RM0A 3AU8A 1ZBQA 5JBIA 3H9EO 3TDKA 4I9NA 1BXGA 4YJGA 5L7YA 1P1IA 5L40A 2C82A 4GSLA 2ZTMA 3COSA 2WD7B 5U1PA 3E5RA 3NEPX 3Q3CA 3RVDA 1Z45A 4OYRA 4XR9A 4BGIA 3U4DA 1E7RA 1XU7A 3I83A 4GI2A 4E21A 1CERA 3GOHA 1H94A 3Q2KA 3VAZA 4NBUA 2GUGA 2GN9A 3FBGA 4GLOA 1E6EA 3S1LA 3ROPA 3PWSA 1EFKA 4GWGA 3PQDA 5JY6A 1I36A 4E5YA 4JJIA 1N7HA 1G1AA 2DFVA 2D2IA 2X23A 5K9ZA 4XQ9A 3KZVA 2GYYA 2ILTA 1ZSVA 4BHTA 2QRKA 4PLTA 3PIDA 4UVHA 1DLJA 4RO0A 4DQVA 1HWYA 2OGUA 3UGKA 2Y66A 4RJTA 1B14A 1VSVA 2NU7A 1HDYA 3U4CA 2FP4A 4CMAA 4NZ9A 2DPHA 3D3WA 2YV1A 3G0OA 4B4WA 1PGNA 1C1XA 4RVGA 2XXBA 1X1EA 1E3EA 4D44A 3NT2A 5THKA 1BMDA 5ITVA 4ZRMA 1JKIA 4HADA 2QX7A 4CLDA 2BGLA 1VI2A 4GWKA 2GR9A 2PZKA 4NBVA 2Y1OA 2RH4A 4AICA 3T4EA 1NR7A 1RYDA 1CRWG 3ZWCA 2RCYA 1B16A 2VUTA 1SPXA 2DU8A 3WLFA 4A7PA 2AE2A 1WZEA 1B2LA 1LA2A 2EKPA 2AA3A 3GN2A 1ZJZA 4DGSA 1Q0LA 2W2LD 4WPGA 1PJQA 4M49A 2O3JA 2YZ7A 4WNIA 2HMVA 3CPSA 4IZHA 1P45A 3F4BA 3VH4A 1KIFA 1O94A 4MVJE 5FI5A 2DC1A 1Y9EA 2X7HA 1UXHA 4OKIA 5CP8A 4BNGA 4CMCA 1BXZA 3C1AA 4RVSA 1CIVA 3GPDG 4Q3EA 3D3EA 4J49A 2Q2VA 2YHIA 2VYNA 4PFJA 3EC7A 4ID9A 1NAIA 5EQFA 2PY6A 4L9RA 5DBGA 4E0BA 2DUUA 1UDCA 3IS3A 4BO7A 1R0LA 1SCUA 4NG5A 4Z9XA 3JQ8B 1DJNA 3TNLA 1H6CA 4N7RA 3K5PA 3WMWA 4W9NC 1LUAA 4B3IA 2W2LA 4CM7A 1NQ5A 4WLVA 1A4IA 5I9LA 5KJ1A 3FBTA 1UR5A 3F6YA 4EBFA 4R1TA 1YBMA 3EY4A 3FNFA 1K3TA 5JDCC 1FF9A 4W99A 3G1UA 3I9OA 1PR9A 5TLSA 4OIMA 4DQUA 4XYEA 2P4HX 4TROA 5T8KA 1VSUA 1NQOA 1WLYA 4MVJH 5I9NA 5IN5A 2YDXA 4NNJA 4Z9YA 4EW6A 4GMGA 5IF3A 3KYCB 4DYVA 1CYDA 1M67A 2D3TA 1YJQA 3FWZA 5BSEA 5I7SA 2AQIA 2IE0A 2VHZA 3DAGA 3I6IA 4CM6A 4RF2A 3NYWA 4IXWA 5K6AA 1LNQA 2G17A 3M1AA 1P1JA 1K6JA 3BMOA 4KWIA 1D8AA 5JO0A 3JQDA 2X5JO 4CMGA 4ND2A 4WASA 1DC3A 1SEPA 5L3ZA 4YB8A 3PI7A 4LW8A 3QV1A 3V1UA 1DLIA 3G3EA 3ZU3A 3UVEA 2JFFA 1EVZA 1EMDA 1Y5RA 1GAEO 4GAEA 3E1KA 1NTOA 2JFHA 4LCEA 3JQFA 5COAA 4A2CA 1C1DB 3HADA 3RFTA 3CZRA 1ADFA 5G4KA 2FR1A 4D42A 1Q7CA 1E1LA 4QO8A 1A7KA 5CHEA 4D3DA 1W4ZA 3DBHA 4LSMA 2C0CA 2DTXA 3V2GA 1QMGA 3F9IA 4DA9A 3OIFA 1EVYA 2I65A 1R4MA 3WLEA 1Z6ZA 4P38A 1J0XO 2ZYGA 3OJLA 3PRJA 1YBAA 1PZFA 2BLLA 3QW2A 1GU7A 3BYZA 3ETGA 2VNAA 3BTSA 3PYLA 4JNKA 4R1SA 1ZJYA 1NFQA 4XGIA 4KDFA 4D7AA 2FOIA 4J9VA 4ZN6A 2B4QA 3EZLA 1DIGA 5T6BA 3UXYA 4WJZA 2HK7A 2UDPA 4WUVA 3P19A 4DRYA 3A4VA 3A06A 1O6ZA 3ZWXA 1HDOA 3GDOA 5CG2A 2O23A 4CQLB 3H9QA 2WMDA 3K8ZA 1J5PA 1ZW1A 2GO1A 1ISHA 1RM5A 3AI3A 3CTMA 5JY1A 3OH8A 5A4DA 1UDAA 2Z95A 4E33A 2WYVA 3DB2A 4K26A 5CDSA 3ZH2A 1E6WA 3VPFA 3SJ7A 2P4QA 3C7CB 3Q0EA 2Y1GA 2Q45A 1JKFA 4IDFA 4BGEA 2WEKA 2VCYA 1JDJA 2VT3A 5IDQA 3UCFA 4BNHA 1NQTA 3L6OO 5JLAA 1FDWA 4A73A 4XYLA 3GC6A 1KY4A 2FPIA 3EK2A 1DSSG 5TF4A 2R6JA 1X14A 3LT2A 2ZIZA 2P9EA 3FTPA 2P9GA 5ILGA 2YQ5A 5U9CA 5KOIA 3RUFA 4IDBA 3RFXA 3F4LA 4HFMA 1RWBA 1EE2A 1Y7TA 5DOVA 4J16A 4XIJA 3T4XA 4EJ0A 5EESA 1KY5A 3W6UA 1PZGA 1YQGA 4LISA 1HSZA 1LRJA 3DTTA 2IEDA 5FYDA 4NI5A 5JAQA 3PPIA 4U8GA 1Y8QA 3DXFA 3JQGB 4ITUA 2NVBA 4CMBA 4CM9D 4IMRA 3DBLA 1DB3A 4ZRNA 1M6WA 3OA2A 3PP8A 4IXTA 5I9MA 3V5NA 3WWYA 4YT8A 4IDGA 5IXSA 1IE3A 2PZMA 3ICPA 4ZHSA 1J49A 3GY0A 3KBOA 4PZEA 4RVDA 2QYTA 4UUOA 1MG0A 1Y8RB 1P74A 3FN4A 5EQDA 5IG2A 1DHTA 1B0AA 4HKTA 4JBGA 3BMNA 2Y1EA 4NH4A 4BOYA 3GGPA 1ZK0A 1A7AA 2BFOA 4IDDA 2JCVA 2O48X 3QWAA 4XEHA 3BTUA 1EUDA 1GADO 1OFGA 2EKQA 4OXKA 1X7DA 3NX4A 2X9NA 5A9TA 3TZQA 4F6CA 3GZNB 2HSDA 3UICA 3WJAA 3NT4A 4BV9A 3WSWA 3HDJA 4D41A 3TSCA 2QZZA 4L4XA 1HTBA 1YWGO 3FPCA 1LSJA 1WMAA 1NQAO 3OJ0A 2PH5A 2O50A 4IPTA 5CDGA 1V0JA 3HUDA 3DMTA 2Q99A 4GMFA 3K30A 4WLEA 5BSGA 4K28A 3RU7A 2O2SA 4DLAA 4R16A 4MVJG 3RFVA 3V1TC 3F47A 1PGPA 1U4OA 1ORRA 3ZNOA 4YRAA 3VPXA 3LT0A 4IY1A 2ZCUA 4PVDA 4YQYA 1M6HA 2H63A 4EDFA 2HUNA 1CJCA 3VOSA 1YDWA 2JCYA 5HTOA 1PGJA 4NMHA 3ITDA 4CV2A 2X6TA 5MDHA 3NDJA 4E32A 2WYWA 3FRJA 2VWGA 2V6MA 1XQ1A 4YJHB 1UDBA 1E3LA 3ZWPA 5CFZA 2HMUA 1F8GA 3KM0A 1U2GA 4PZCA 5IXYA 1YH3A 4GKBA 4J43A 1ML3A 4YCAA 2NQTA 2P5YA 2PR2A 4FOOA 3MOIA 1CQJA 5G0TA 1XQ6A 1EUCA 3AI1A 2OOSA 1IHXA 1G0NA 4BNIA 5TNXA 3ETEA 5G0UA 4WKGA 4XB2A 5L7WA 1R66A 4CPDA 3ZDFA 4LRTB 4R3WA 2IODA 4J91A 3PHGA 4GH5A 2HO5A 1Z75A 1U3TA 4JP3A 4B4OA 5U4QA 4YQZA 2I3AA 3K9QO 3RBVA 2I6TA 2VHVA 1BSVA 1QSGA 1T25A 4MDHA 4B3JA 1BRMA 2D59A 2O4CA 1HXHA 5L95A 2OFPA 2Q4BA 2X1HA 3GF4A 3QVXA 4AJLA 1K2WA 3RKRA 2EJVA 2Y0DA 2OBYA 3D7LA 1NXQA 1A9ZA 2IDZA 2YQ4A 1IUKA 5BQFA 5ENVA 4RPJA 3QJ5A 5KJCA 2EKLA 2NVUA 1JTVA 2NTJA 3AWDA 2O7QA 4RVHA 3B70A 1WNTA 4RCVA 4HFRA 1QYWA 4NDNE 4LK3A 2GZ2A 3WR5A 1T2DA 1NFRA 2Y0EA 1T24A 4QXMA 4DLBA 4Q3DA 3ITKA 1P1KA 4WLOA 4Y9DA 5T8KC 4CMJA 1TLTA 3GNQA 1DOHA 5JCJD 1ENOA 1ZEJA 1PTJA 1NAHA 4EUFA 3GEMA 1HT0A 2B35A 2CSUA 3VZQA 1LLDA 4MVJD 3RI3A 3IDSA 5K6AC 1PQWA 2EHDA 4CMEA 3MJ4A 1Y81A 5EMHA 3TFQA 1T1SA 5FF9A 3HJAA 3PJGA 3GNSA 4NJMA 1R37A 2BD0A 3ICCA 3PLRA 4Z6KA 1U2DA 1JW9B 4FQ8A 4MP8A 1IPFA 3TOZA 1GUZA 1M66A 3U9LA 3LU1A 2B4RO 1AUPA 3HWRA 3JQFC 4H15A 2JAHA 1FDUA 1HZZA 3JYQA 3KUXA 4NU6A 4AL4A 4HWKA 5DP1A 1T2AA 1HE4A 2DFDA 4IDEA 3DEYX 4AJ1A 8ADHA 1ZXLA 1DIRA 3BAZA 4J90A 4NK4A 3FPLA 2ZQYA 3OA0A 5ER6A 3RC7A 4CMHA 4DBZA 4TRRA 3ONDA 4DC1A 4XJTA 5COBA 4BNYA 1B8VA 2FR8A 1JU9A 4WLUA 5BNFA 3MTJA 2JD2A 2YYYA 5KJ6A 2B69A 2NWQA 2B0JA 2BI8A 3O8QB 1LDGA 5CDUA 5BNTA 5JFOA 4BKUA 4PLWA 3H5NA 3ETDA 3WDSA 1K89A 3OICA 3DBRA 2G1UA 1E77A 4AFNA 1K0UA 2TMDA 2VOJA 1BVRA 3W8EA 3PJEA 4IMPA 4FB5A 2P9CA 2AMFA 1VM6A 1MUUA 1SC6A 2C2XA 3GDGA 5TSDA 3VZSA 4BMVA 1ZMTA 2CNBA 4NBTA 3MJEA 4PLFA 5KJEA 4RPKA 4DTIA 2HK8A 3VZRA 3IOYA 1ZK2A 5F21A 3W1VA 2HMTA 1JAYA 4RPLA 3ZWWA 1HRDA 4KZPA 1YB5A 3IJPA 4QO7A 4XRGA 1GYQA 3F3SA 3KYDA 1YXMA 3KEOA 5F1KA 3H2ZA 3WQRA 1KVSA 5CG1A 2B36A 1TVEA 2ZK7A 1KEPA 2F1KA 2QRJA 2I99A 1WMBA 1XYGA 3L4SO 4GX5A 4UULA 2EGHA 1I3MA 1PWXA 1LLQA 1OOEA 4IQ8A 1V9LA 5L45A 2EJWA 3PDJA 3M2TA 1XLTA 4OSPA 1TT5B 3QY9A 5A02A 1GV0A 2YY7A 1O95A 1E7YA 3GEDA 3OEWA 3MEQA 3B6ZA 3M2PA 3JQ7B 1PGOA 3UUWA 4W4TA 2HU2A 3FR7A 3O26A 1YONA 2JFGA 2PZJA 4XQGA 4WEOA 3O03A 4BNXA 2IRWA 3OFSA 4DIBA 2G5CA 1D4FA 4M86A 4MVJP 1U3WA 1D3AA 1LQUA 1MGOA 1P1FA 3M1LA 3L6DA 4XR4A 3W4KA 4XX0A 1WVGA 4O59O 1T1RA 3S8MA 3RJ5A 4BO6A 6LDHA 3AUUA 4O6VA 4CMIA 2C7GA 4BNZA 3FI9A 3DWFA 5A03A 1E7WA 5A9SA 5L4LA 3OF2A 4DIOA 3HB5X 1U8FO 3TWOA 3JQ9A 4KQXA 6ADHA 1B8UA 4J6FA 1W6UA 1ZNQO 3Q1LA 4J4TA 4CM3A 5F1PA 3LSYA 4NIMA 2VHXA 5CEEA 3NGXA 2ZATA 1P0FA 3DMTC 4EUHA 2O3RA 4RORA 1SBYA 5B4UA 3SBOA 2QQ5A 2H6EA 4AJJA 4G81A 3GFBA 4J7XA 1QYCA 5TJHA 3WGZA 3STHA 4FD3A 4II3A 2DKNA 2PNFA 1I0ZA 4O5OA 5B4TA 3SC6A 4BNTA 2W90A 3AOGA 1U9JA 1GCOA 1EDZA 2Q46A 4UUMA 1ISJA 3MZ0A 1X0VA 1ONNA 4XGKA 3S55A 3QE3A 4UVIA 1EFLA 1X13A 3SX2A 5IZ4A 3ZHBA 1PJSA 1I8TA 1W73A 3VDQA 4A5OA 1E92A 3H3FA 1ADCA 1X0XA 1ZSYA 3T7EA 4JGBA 4EITA 5B12A 4WE3A 2UVDA 3W8FA 3QRWA 5KWEA 1DIBA 1GY8A 2O2YA 1Z73A 5T67A 2GPTA 1K6IA 1PS9A 2JHFA 1OC4A 2H5LA 3DC2A 4XDYA 4YAEA 4MP6A 1MA0A 3LT1A 1XU9A 1OC2A 3PWKA 3KRTA 4KQWA 1LSUA 3GMSA 1ENPA 3UF0A 2OORA 2WD7A 1NASA 1ZFNA 4ND5A 4L8VA 2PGJA 3JYOA 2V6FA 5JPIA 5ER9A 3OIGA 4YJFB 2Y0CA 3FF4A 3JQAB 3H5RA 3KSDO 3RCBA 5JO9A 3AOEA 4BNKA 4KDEA 4W6ZA 4UVEA 3DZGA 4TZTA 4ZD6A 1YJ8A 2PD6A 1B8PA 1A71A 1N1GA 3RC2A 2WD8A 3GT0A 3K2EA 3PGXA 2PD3A 1ISIA 1SEVA 4J7CA 2R00A 1C14A 3GG9A 1PJ4A 2OHXA 2EIHA 4B4UA 1NFFA 3FCOA 3OMLA 2FZWA 3GLQA 4OMUA 2RBEA 5IDWA 3GR6A 5BNIA 1MV8A 2BH9A 1CETA 4YXFA 1N1EA 4QTZA 3EMKA 1R16A 3SEFA 2JAPA 4MJLA 4BIIA 4U6SA 2WJPA 4MKRA 1BXGB 1U1IA 4YJGB 3DO5A 4KTVE 4HXYA 3AW9A 3KO8A 2Q1UA 3JYNA 3TRIA 4MOWA 1ISMA 1PZEA 5A04A 1L7EA 4S1VA 3DHEA 4FC6A 1JKJA 1QP8A 2VHWA 1J4AA 1GZ4A 3EVTA 4CUKA 3Q6IA 1F17A 1LC3A 1I3NA 4ESOA 1HETA 5IN4A 1PQPA 3H9GA 4OAQA 3WGQA 1YO6A 4MKZA 1CQIA 2DBQA 2J3IA 3LQFA 4HFNA 4UAGA 2FSVA 4JLWA 3PZBA 4CMEC 9LDBA 1VRWA 4IIVA 4PLHA 4CV0A 4X54A 2BELA 3JD2A 4CM5A 1F06A 1Q0HA 4EJMA 3PQEA 3JD0A 1WWKA 2Y67A 3WTCA 4B8WA 3ZV3A 1MB4A 5JAMA 5AVOA 2LDBA 3ADPA 3DOJA 1AXEA 1UAGA 1XDWA 1YDEA 2Y68A 4HFJA 3F5QA 3B1JA 3HZZA 3U49A 1N7GA 4FN4A 4R1NA 4F3YA 3EGOA 2C20A 4PLGA 3D3WB 1E3IA 3GRKA 4XYGA 4U0KA 5TQVA 1C1XB 4D45A 2WSBA 4IJKA 3IAHA 4ZQGA 3WGOA 1LDMA 1PEDA 4FFLA 3ROMA 2JD1A 4JBHA 3GUYA 4I8XA 2A92A 2ZJ1A 3ZW9A 2ZYAA 2G82A 2HMSA 2RIRA 4FDAA 4J2OA 1Q7GA 1EK5A 3WYEA 4FBGA 3CZMA 1WDKA 3I9LA 3OJOA 4MPDA 4WLNA 3UHAA 5DN9A 4BNLA 4AJ2A 3RAJA 3AI2A 4WCFA 3EW7A 3R3SA 5TC4A 4ZJUA 3DQPA 1KEWA 3RROA 1Z7BA 3L07A 4GGPA 3I9MA 2GNAA 1L7DA 4BGVA 3DTYA 1SB8A 1PJ2A 3M6IA 2ZTVA 4WOJA 3HDYA 1EDOA 3BMQB 3B1KA 4IJVA 4P22A 4LCJA 5THQA 2NLOA 3G17A 4PIVA 3GMDA 3WQQA 2WM3A 3GEGA 4MP3A 7MDHA 1TB4A 1ZK1A 3KYCA 4PLYA 5L4NA 1M2WA 3RUIA 4HV4A 1NPDA 2D1YA 2RHRA 1V8BA 1LRLA 4EEZA 1B7GO 2FY8A 4XGNA 3LVFO 3D4PA 4P4NA 2GERA 4OOFA 2HKIA 1DIHA 1EBUA 1Q0QA 3MJCA 4GSKA 4PG5A 5CDTA 3CH6A 3NGLA 5JCXA 1IZ0A 5H82A 5HWSA 2B5WA 4Q3BA 2X4GA 2CF5A 2PFGA 5HA5A 1DRVA 2IXBA 3W6ZA 5IZCA 5C7OO 2Q50A 4MIYA 2Q1TA 4UEOA 4FGWA 4XB1A 5G0VA 4CJXA 3HDQA 3K31A 1E3JA 2VHYA 4DYDA 1MLDA 4ALMA 1QRRA 2X5KO 5DCYA 3B1FA 1C1DA 4CMKA 4OL9A 4NBWA 4L74A 1RJWA 4FC7A 4XZ3A 5TJ9A 5LCXA 1YS4A 3MTGA 4J1QA 3DZJA 3H7AA 4I5EA 3I5MA 5C7IO 1PL8A 1K5HA 3BHIA 1XGKA 2W4QA 1UP4A 3QWHA 3VC7A 4CM8B 1KOLA 3GVXA 5A9RA 4CLOB 1JN0A 1K6XA 1HE2A 3DOOA 3WGGA 1CEQA 3BMOB 1XHLA 1BDBA 4NBRA 4XRRA 2D5AA 2CVZA 4JX8A 1GQ2A 1GDHA 2GLXA 2EWMA 3JQ9C 4GQAA 2I9PA 4K6CA 2NM0A 3SJUA 4OQYA 1M76A 4RZIA 4E2WA 1VE9A 1QXSA 1VLLA 1MP0A 1KC3A 3WQSB 4OO3A 4NFYA 4CQLA 1FDSA 5EJ2A 4L73A 1ZSNA 1A9YA 2VWPA 2Y05A 5A5FA 1JVBA 4XWYA 3DAFA 4DL9A 3NRCA 2SCUA 1ZVMA 3WOHA 2ZB7A 1LTHR 3VH3A 3ZWVA 4J3FA 1D1SA 1LSSA 3ULKA 3WFIA 3DBHB 1JWAB 4J2HA 2P2SA 2WTBA 1DFHA 3UN1A 1EBFA 4E13A 4BGUA 2NNLD 5G0WA 2V7PA 4R9RA 2VUUA 4UEJA 3K6JA 1PJTA 1WW8A 1WP4A 3INGA 3KEQA 1MFZA 1P3DA 4LVUA 1XA0A 1MX3A 5F3RA 4FOSA 1YOVA 2EV9A 1BWSA 1VJTA 4GVLA 3TZHA 1C0IA 1E5QA 4M89A 1DRUA 1YL5A 1IULA 1I3KA 1U7TA 4WNCA 4AVYA 2J3KA 4AJPA 1E0DA 2J5QA 4Q3NA 4EZBA 2VT2A 5KKAA 2YFHA 1RKXA 3JQCA 3FHLA 1OZAA 3FTNA 2NU9A 3RJ9A 4FFPA 2X0NA 1GCUA 3OQ6A 1F8FA 4ONEA 3UCEA 2V65A 1LI4A 1LLUA 3IIEA 4BO9A 4L4SA 4CLXA 1NPYA 2OL4A 3OBBA 4OM8A 3AOEC 3VDRA 4YR9A 1KYQA 3O4RA 2VRCD 3S2IA 1R0SA 3BMCA 1P33A 1NYTA 2D4AA 2PKRA 2RAFA 2X86A 1Z74A 3AM3A 2P68A 5JAIA 2R00C 4NJOA 4RGBA 3ROQA 1IL0A 1E3WB 3VPGA 1LDBA 2GZ3A 4CODB 1P0CA 3RASA 2HJRA 1XR3A 1HDXA 1FDTA 2VZ0A 1DAOA 2BGKA 3E03A 1GYPA 1C0LA 4HBGA 3PFWO 1LX6A 4JIGA 4I5FA 3GAZA 1GR0A 2D5CA 3AY6A 4J9UE 4E2YA 4UUNA 3FWNA 3JD1A 2EEZA 3D4OA 4IS2A 3R6DA 3DBLB 4NR0A 3TN7A 3RQSA 2YJZA 5GY7A 3EDMA 4CM9A 3AY7A 4ALIA 2HQ1A 1JWBB 2CZCA 4Y6PA 1L1FA 1ZH8A 4BVAA 2XXJA 1OBFO 1RM3A 4G2NA 4BO5A 5FWNA 3SVTA 3IP3A 3KYBA 4RDIA 2VRCA 1UP6A 3ORFA 4BO0A 4BMSA 2QIOA 3N7UA 4ZVVA 3PTZA 1W0CA 3HN2A 3E82A 4YEDA 4DVJA 4FR5A 3ZNQA 3U3XA 3MJSA 4QFCA 3BMNB 2YDYA 2ZB3A 4I5DA 4LSWA 2GRAA 5DBIA 3ZWOA 1NBOA 3H6KA 5C3MA 4FFOA 1T4DA 3ZGYA 5KVSA 1CWUA 2X8LA 2WWRA 4CLRA 3WXBA 5DNAA 5JDIA 3X2FA 3AY3A 2X0RA 1IHYA 5DZSA 4KUHA 4ALJA 1UZMA 1O89A 4PG4A 2XPCA 4TRNA 4AG3A 1JLLA 1U5CA 4JP2A 3MJVA 4NK5A 2H1SA 5AXDA 3WGHA 4IBOA 4CM4B 3RC9A 4IDAA 4Z9FA 4J0FA 3PJDA 4ZA2A 2AQ8A 4IJWA 3LC1O 5GMOA 1HYHA 2JJYA 3EZYA 3GHYA 1UJMA 3DZHA 3ENKA 2HCTA 4BO3A 1NPTO 3FR8A 4IQGA 2PV7A 4CLHA 3NUGA 3S2EA 2CFCA 3NTRA 5JC1A 1YL7A 3D5QA 2PKQP 2ZQZA 4ALNA 2E4AA 1KC1A 1PQUA 1PX0A 1O0SA 3ZV5A 3A14A 3QHAA 2IYOA 2NSDA 3JSAA 3U09A 1UH5A 4UVGA 4BNWA 4WCFC 5COQA 1KVRA 1VL6A 2J8ZA 3WX0A 2ZTUA 2X9GA 2HAEA 2OMEA 1GUYA 1YBVA 3PIIA 4GL4A 4OXYA 2DPGA 3C3XA 5IJZA 2B4TO 3IKTA 1MXFA 3WTBA 1DPGA 1S6YA 4YDRA 2O3UA 5BT9A 1ENZA 1YVEI 3BHJA 5H83A 1JAXA 3NKLA 3QWIA 3HHPA 2P5UA 3RUCA 3N74A 4FIZA 1R6DA 5EERA 4OJNA 1FK8A 5A06A 1U8XX 3CSDA 3AM4A 5AXAA 3WNVA 4EEXA 4ND1A 3H9UA 4CUJA 2O3QA 4H16A 1E1KA 4J1TA 4BQRA 4DBVO 4YYZA 3TJRA 2NVUB 5AQ1A 2Y93A 5IZCC 1Y5MA 4IZIA 5GZ1A 4YT5A 3OQ1A 2E48A 3L6EA 3I23A 1XWFA 3WYBA 1QKIA 2X0JA 3CEAA 3GQVA 4BO2A 3TQHA 3GUCA 3H3JA 1MC5A 3ZHZA 1MXHA 4N5MA 3S2GA 1Z7EA 1E7MA 4R51A 1GZ3A 3KOUA 2PH3A 3DHNA 2R2GA 5AXCA 3VZPA 3WMXA 3P2OA 2CDAA 1CDOA 3OIDA 4TVBA 3WGIA 4GGOA 3D64A 4FGSA 1X1TA 3W4JA 1W8DA 5JCJA 1AN9A 5JC8A 1I30A 2I76A 1EK6A 4D79A 3PVZA 2GDZA 4MVJA 1AHHA 2WDZA 4M54A 4BQPA 4E6PA 3FNGA 5CDYA 5JW6A 1U28A 3AJRA 3AUAA 4BS9A 2HMWA 3HQ4O 3DHYA 3GVIA 2PKQO 3W8DA 3BIOA 4XJSA 1GZ6A 4S3MA 5A3VA 1KVUA 2C5AA 3QLJA 1XG5A 4A0SA 4AJKA 3ZV4A 3JD4A 4FS3A 1XKQA 1NHGA 1GYRA 3BTOA 4NQZA 3LLVA 4FSHA 4IS3A 5DDIP 2VTDA 3ASUA 1ZO8A 5LDHA 2GD1O 3GG2A 4FFRA 4TMFA 2HDHA 2IYPA 3CINA 3TPCA 5KNLA 3E5MA 3UFXA 1IB6A 4ALLA 2RHCA 4Q39A 5G0SA 5HS6A 2BGMA 3I6QA 2D8AA 1LJ8A 2W2KB 2OBNA 2C54A 4R1UA 5EPOA 2UUOA 1UAYA 5DF1A 2WE8A 2EGGA 2J6IA 4EJ6A 3H2SA 4R5MA 4N5LA 4PG8A 4YTEA 5C7LO 4HY3A 5CPBA 1YB4A 3GA0A 5B1YA 3RBXA 2FPPA 4ND4A 2BF7A 1KVQA 1PS8A 4PLCA 1YQDA 1IPEA 3QIVA 1BW9B 4R69A 1DEHA 1ZK3A 1NHWA 3R0IA 2ET6A 1B3RA 2DM6A 4JJFA 3H9JA 3I4CA 4ROSA 4TKMA 3QVWA 1ZK4A 1N9GB 4ILKA 4O1MA 2EW2A 2J3HA 3ADOA 3U4IA 2Q1SA 2BFAA 2VZ8A 5ICMA 4DIFA 4FJ0A 2FHSA 1ARZA 2BKAA 5C37A 1NNUA 4DLLA 2Z5LA 4JK3A 3VPHA 2VNSA 3DONA 3E9QA 4B3HA 2AG8A 3H5AA 4R5HA 4Z0PA 3Q9NA 4U5QA 3KYDB 1HE3A 3AM5A 3G79A 4DC0A 1GFSA 4XYBA 3OECA 5A05A 3A28A 4BO4A 5KJFA 1YE3A 4CQMB 1N92A 4W7IA 1NWHA 5DOZA 3S2FA 3VVBA 2HRBA 2BRUA 2GASA 1BXKA 5F5NA 1HF3A 4F46A 2QHXA 5I7VA 1EQ2A 3GVCA 3RWBA 1VKNA 4HP8A 2UV8A 2HLPA 4OQZA 3OEYA 4TVOA 2AW5A 4GX2A 1CF2O 3MCVA 3CMCO 1T2EA 4JCOA 4KUEA 3TOXA 2NVWA 2DVMA 4TSKA 2GCGA 4N54A 1F12A 1HLDA 1I10A 1DBVO 3PK0A 4J1SA 1A27A 4DWVA 4ZQEA 2DUWA 1QG6A 3EAGA 1Y6JA 4J4BA 3ZU4A 2BHLA 1BGVA 3JQAD 3ZN2A 4RF3A 4WCDA 3JQ6A 3WS7A 3AU9A 3WB9A 1QYXA 4BV8A 1G6KA 3GH3A 4YAGA 3BHMA 1VC2A 5A9SB 4KUGA 5JDIC 2CDBA 3LF2A 3I9KA 2OUIA 1KEUA 4D46A 3VTFA 3HNPA 3Q9UA 1C3VA 1V35A 1U3UA 1VJ0A 3GGOA 1FJHA 4XQCA 4AJNA 4B7XA 2DBVO 2IXAA 2WE7A 3INRA 2V6BA 3GDFA 3IMFA 4F45A 1DFGA 4ZGWA 3LC7O 3AFMA 2H9IA 5B4VA 3QA9A 2IZ1A 3UW3A 3SLGA 4JROA 2JD0A 4U7WA 4PCVA 4UUPA 2C59A 1DC4A 3JQAA 4QQRA 3TL3A 5JAZA 4QX6A 4I1IA 3P5SA 4LN1A 2BMAA 3D0OA 4P4GA 3PYXA 4UREA 4PN3A 3KV3O 2G0TA 1EVJA 1PJBA 1X7HA 1R4NB 2RH8A 3R1IA 3DR3A 4A27A 4AJOA 1HDCA 1T2FA 5BSFA 4PLVA 1GL3A 1E1MA 1PJ3A 3GNTA 4MKXA 4OSOA 2YV3A 4A03A 3MWEB 3EYWA 3JQBA 1SB9A 1LDEA 4QFDA 4PRKA 4YT4A 2I67A 3EHEA 2B37A 1ISFA 1RM4A 3F5SA 3IC5A 3WBBA 1ZMOA 2XOXA 4C7JA 3UAGA 3PYMA 4BUCA 3D4NA 5ENDA 1G0OA 3GRPA 3TFOA 4CLEA 5JYDA 3A9WA 2HJSA 5FEUA 3RUAA 3RSHA 2YV2A 1O8CA 1PJCA 2VWHA 3R3JA 4ZQBA 5BSHA 1AXGA 1NX6A 2PA3A 1X15A 3ONEA 4E3ZA 3U5TA 3K73O 4URFA 1ZUD1 2PGLA 9LDTA 2ZCVA 2GGSA 3C8MA 4D0SA 3AK4A 5TT1A 1DJQA 4DPMA 2FN7A 3ZI0A 1T4BA 1N2SA 3PHJA 4TZKA 3ZWYA 2Q4EA 1DO8A 3L77A 3KLPX 4YVFA 1MG5A 3O9ZA 4GBJA 3VVCA 1A72A 2WYUA 5L4SA 1ID1A 3IUSA 4JN6B 1LBEA 4C4OA 4JJGA 4OGWA 3IKVA 4FCCA 1ZKMA 4DQXA 3JYLA 2NADA 2X0IA 2CY0A 3PHLA 1GV1A 1GUFA 4H3VA 3KLMX 2PK3A 2FSSA 1X7GA 2VYND 4BNUA 4OXNA 4R68A 1TXGA 3P7MA 3AUTA 5KVVA 4BNVA 2O3SA 4J4HA 3I9JA 3G1TA 1YB1A 4DMLA 1PL7A 1QORA 4J1NA 1PIWA 1UZNA 2A94A 2DBRA 2DTDA 3LK7A 3F1LA 4HNHA 2C29D 4I08A 1UXKA 2C7VA 2AEJA 5DT9A 3IL2A 1WDLA 2FRDA 1A5ZA 4B8ZA 2PLAA 2ZTLA 3KSUA 4Y8VA 4PG7A 2YUTA 3HB4X 4XQEA 3JQ8A 5TIIA 4G65A 5A3JA 1D1TA 2Q1WA 3HDHA 4J0EA 2VYVD 3PHIA 4M55A 4YAKA 1UP7A 2OP1A 1KVTA 4NPCA 2CDCA 3C7AA 2DLDA 1C0KA 3JV7A 3WIDA 4K6FA 3Q11A 2CMDA 1KS9A 2YW9A 2UAGA 4BL5A 1FMCA 3K92A 4IQ0A 1FXSA 3BMQA 3PEFA 4CUZA 4FJ2A 4BB5A 3ZNNA 1DRWA 1GPJA 3C7DB 3JQEA 3EUWA 1O9BA 1PSDA 5H81A 2YHIB 3PWZA 2PD4A 1LC0A 3N58A 1PGQA 5LC1A 5ITWA 3EVNA 1ZIDA 2GSDA 5JNLA 1JQBA 4P4LA 2BFPA 1E5LA 1P1HA 4BNNA 3CMMA 2VYVA 3PDUA 4RQTA 4RDHA 3TF5A 3CXRA 4WCFB 3L9WA 4E5MA 1P77A 2C2YA 5IAAA 1H6AA 5I7EA 5DP2A 2VOEA 1XIVA 2XF8A 3ANLA 4LRSB 4II2A 3GHHA 1KERA 1LEHA 1YGYA 3QWFA 4FJ1A 5FI3A 3BZUA 4IIUA 1T2CA 3U0BA 1GQYA 3UH1A 2I3GA 1DHRA 4I9UA 3D1LA 1DAPA 1HEUA 2I5PO 2NTNA 3L0DA 4M1QA 3E48A 4WGGA 5KIAA 1EQUA 2A35A 3JCZA 1A4UA 1QR6A 1HSOA 4BB6A 3V2HA 3V8BA 3GPIA 2O7SA 1E3SA 4MVJF 1VL8A 3GZ4A 1O5IA 4I9HA 3RIHA 4IDCA 4CM8A 5TS3A 2QG4A 5I7FA 3KETA 1QV6A 3LZ6A 4CLOA 4PLZA 2EG9A 1QYVA 3ZHXA 2NUAA 3OETA 4LVCA 3OM9A 3QSGA 1YL6A 4R3NA 3V1YA 1ONOA 1ULUA 2GN6A 5I8WA 1ONPA 3DZKA 3NDRA 4PLPA 1KEVA 4C7KA 1LLCA 2Q3EA 3NTOA 3PGJA 4B79A 3CIFA 3ZWMA 1NR1A 3SXPA 5L51A 4XCVA 4EGFA 1SOVA 4ZQFA 3DFZA 1HLPA 1ZXBA 4RVFA 2J3JA 4NFHA 4NU5A 1Y9AA 5C5IA 4FFNA 3PQFA 3K2BA 1VKOA 3GK3A 3E6AA 4TWRA 3T7CA 2XAAA 5G4KB 4Y67A 1P9LA 4E5PA 4DMMA 4E30A 1IOLA 1GEGA 4B4VA 1HL3A 4XYMA 1R4MB 4E5KA 7ADHA 1KBZA 2FWMX 1ADBA 2J5KA 3SC4A 4DREA 1P1RA 2P91A 2JKVA 4L75A 1BVUA 5HS4A 3WJ7A 4RLSA 1N8KA 4RZHA 1YKFA 2HK9A 4N18A 1QV7A 1WXDA 2E82A 4EI2A 5EIOA 4QT0A 5GZ3A 1SZJG 3IQDB 3PJFA 2PTGA 3JQGA 1H9AA 4NFSA 4OHUA 1H6BA 1HYGA 2CF6A 4JBIA 4BKPA 2IZ0A 8LDHA 3C85A 1N5DA 3PHHA 5IFLA 4GVXA 4HNGA 5JMPA 2ZB4A 3F1KA 3BA1A 2JHGA 3ZWBA 1H2BA 1Y8RA 4RPGA 1YOVB 1HDZA 1UZLA 1E3WA 4PGFA 2AE1A 3W4IA 4Z0TA 1NM5A 4TRJA 2EXXA 4EYEA 3FNHA 1FDVA 1M75A 3OJEA 4TRMA 1HDRA 1B26A 4GX0A 5CEJA 2CUKA 4FPXA 3TZKA 1RYEA 3A1NA 3GZNA 3JQBC 3QVSA 3L4BA 4E4YA 1XSEA 3HN7A 4U6QA 3QQPA 5KCZA 3WYCA 3F46A 3WNQA 3DAPA 5TRTA 4DPLA 1I32A 2O3TA 1Y8QB 4WLFA 4N5NA 5T5QA 1GPDG 1Z82A 1SAYA 2J5RA 3NAQA 3TZ6A 4MIOA 5TX7A 1E1NA 3D5TA 4LMRA 5J23A 5JE8A 2E6UX 3BMCB 2PZLA 1I24A 2UYYA 5JXWA 2O4UX 4J7UA 1H0KA 2BI7A 5K0ZA 4R01A 4O63O 3GGGA 3LC2O 2Y1DA 3DMYA 2B83A 2QZ9A 3X2EA 4CR6A 2GZ1A 4D0RA 4PG6A 5EN4A 5EL0A 3RD5A 3FSRA 1E7QA 2Y99A 3VH2A 4YJHA 5KTKA 4OOEA 3ZNPA 1HDGO 1U3VA 1LSOA 1OI7A 4BKOA 2AEMA 3UKOA 2AQHA 1NVMB 4B7UA 1UUFA 4CM4A 3BTVA 3LLSA 4MVJM 4QEDA 3PZRA 2IZZA 2AHRA 3C1TA 4A10A 2AQKA 2DTEA 3WG9A 4R54A 1ZZEA 3ST7A 1F0YA 2B5VA 2NTVA 1PR3A 1Q7BA 3ABIA 4PZDA 2GF2A 2VUSA 3ZV6A 2QYSA 5ADHA 1C0PA 2W98A 4M87A 3I9NA 4D43A 1WDMA 3LYLA 1UXGA 3KVOA 1T26A 4AJEA 1S7CA 1U7HA 2PGDA 3MJTA 5JSFA 3ROKA 1PU2A 4AJHA 3ZW8A 4R9SA 1I33A 4BO8A 4W82A 4CLRB 3MOGA 4KMSA 1ISGA 4WECA 3H8VA 4DUPA 1EEHA 1PL6A 5ILOA 1AGNA 3WBFA 2A9FA 2CVQA 1DC6A 4KP7A 1IZ9A 4ZQHA 5F5LA 3VKVA 4ALKA 2VTEA 3CUKA 2AEFA 1QLHA 1H5QA 2EERA 1EZ4A 1H2HA 4MVJI 3KTDA 3GN1A 1BG6A 5TGDA 4UEKA 3FNEA 4I5GA 3VKUA 3VTZA 4CV3A 5G2OA 1DXYA 3ON5A 2D0IA 4WK6A 3E9MA 5L7TA 4MO2A 4RLHA 1GEEA 1VJ1A 4CL3A 1EE9A 5G4LA 2OZPA 5IDXA 3DFUA 3JTMA 1AE1A 3HG7A 3DZBA 5L9AA 3IP1A 4D3FA 1PWZA 5KVQA 4JQCA 3UOGA 3ZU2A 4QUKA 3BXXA
chains in the Genus database with same CATH superfamily
4PW0A 2QTLA 4F56A 5EINA 5CAEA 1OAAA 2ISSD 3BWXA 3G2NA 1AMNA 4HRVA 4YRGA 3PUHA 5AVVA 4E07A 3FLAA 3ZCXA 3D43A 3DNPA 4X3OA 4YJDA 2R6FA 4G4JA 1EJBA 1GZHB 4BNJA 4ZVTA 1OB5A 4ZI5A 4RD1A 2Q5CA 3WNCA 3LP8A 1A98A 5HJ2A 2Z57A 4Z3KA 3R7LA 3DULA 2FOXA 4DADA 5BW8A 3KQLA 4MEJA 3BE8A 4QBTA 1C5KA 4Q1DA 5HQJA 3RNLA 3WFJA 4D6XA 2XVMA 5LFAA 1MAAA 1XZBA 1P62B 1G17A 1FDIA 1Z5OA 1JQEA 3DDNA 3NWBA 1SK9A 5B58T 1NC3A 3G59A 3NVKI 4MYHA 3I42A 3I4FA 2DAPA 3ZJVA 1CCWA 1U4SA 3P2YA 4UUAA 5AW8A 3NTQA 4C22A 4ABTA 4L50A 1MQ9A 1HZJA 2I66A 4LJLA 1V96A 2B1IA 3BCHA 3IJRA 2WHXA 4KXFB 3AVVA 2FPGA 3KSZO 4O4JF 1MC4A 4MS1A 2QRLA 3QQ5A 4ZICA 4KHPB 1WZIA 2I91A 5TT0A 2P2ZA 4QBIA 2DMRA 3NHMA 4KTTE 1FJXA 3F2IA 5EWLA 5T7BA 1GQOA 3LTEA 4UVDA 2BWJA 2OHGA 5AXBA 3VJMA 3A6FA 4CF7A 4BKQA 3I8SA 1CG6A 1VL2A 4PPFA 4HQLA 1I2BA 3O8QA 4Y3UA 2JDID 3GZTB 3OPVA 4HUJA 3W3AD 1MFPA 4BLVA 1JECA 1LY1A 2PWBA 1D2EA 1NATA 2HBZA 3VR4A 1NIPA 1R12A 3CXUA 2IV2X 4BNFA 2OO5A 3ZHYA 4DCTA 3E8XA 3DAYA 3OHSX 4B7CA 3EXIB 5KPDA 1SMKA 4MIEA 4W1QA 4M0CA 2LDXA 2OMKA 2WOJA 3IUNA 3TSWA 3R5KA 1XZCA 4RY2A 1ESNA 2GESA 4IGEA 1PZHA 4KSBA 2H4WA 1U5AA 3IHLA 1KIAA 1WD5A 3I3OA 4OH1A 3FPFA 5JAHA 3BZWA 3RVPA 1BHSA 4D3SA 4RVUA 5J4VA 3MUOA 4CG0A 2Q49A 2UUPA 2KI5A 2OR3A 4ECEA 3NV9A 5ES3A 2JW5A 3NJ8A 4MKIA 5FRDA 4BJ6A 4Z51A 2HJWA 1JYSA 1LDNA 4M9CA 3RUHA 4WZZA 4Y6SA 1M1ZA 3GJRA 3C3CA 1KQNA 3TLEA 5H5JA 1NVDA 3RKUA 3ZHUA 1TK3A 1XEWY 3V6LA 3NAZA 3PXXA 3TIFA 1ML4A 1P44A 2X22A 3GL9A 3CHYA 3TR0A 3ZEIA 3ZS9A 3RVBA 4I6GA 2W8ZA 4RXUA 3AVPA 1TYBE 4FNAA 1K63A 4YPOA 4TZ6A 2UYOA 4ZYLA 4WKCA 1URPA 1V3VA 1ORDA 3DO6A 1RKUA 3BULA 3NP9A 3G7UA 3TIGA 5CD1A 2XNKA 1KDTA 3U2QA 1PG0A 4G0UA 4RZ2A 5K51A 5LDGA 3HEMA 2A5FA 5BR8B 1B15A 2FZEA 5TQ0A 1KQFA 1TT5A 1U9IA 2R84A 1SXPA 3QVGB 3JXEA 4F04A 3DOCA 1RVV1 5DTJA 2F4NA 5DX0A 3RVRA 1XRRA 3CKYA 4DQKA 2WB2A 1VPDA 1ZQ1A 4BU1A 2Q9BA 1J2EA 3AZOA 3G49A 3NVDA 2BISA 4LEIA 4MINA 5TY0A 2TMKA 4WTOA 1L5KA 3ZZTA 1TMKA 2VUIB 2Y1CA 4QOSA 2VJAA 1WOYA 2R48A 1XJ0A 4QXAA 2WA1A 2RHLA 4C76A 2ZTHA 3FSGD 4PNPA 1SCIA 1Y89A 1G63A 4RETA 3WGTA 4DXHA 1SNYA 3N3AC 5ICSA 1HE5A 1Z28A 1V5FA 3E2PA 4YT2A 3ZZ0A 5GVSA 1E2JA 3LUKA 3GP3A 4XIYA 4Q9JA 4QODA 2Z2KA 1ZD4A 2QBYB 4URUR 3UAWA 5B36A 2Z3VA 3VO9A 4TM8A 4PYJA 3CJQA 4NU0A 5ALOA 4L57A 2IITA 1C80A 2VWQA 1WPXA 4W7HA 3L4BC 1DAMA 5KKCA 4KQ1A 3ZZNA 4F4DA 5HRUA 4D25A 3C16C 2JIDA 2AOWA 5FTMA 1CR1A 4X94A 2CLOB 5JZSA 1N2CB 1V3TA 4GPD1 4MQEB 4LGVA 4C6TB 3QP9A 1I2CA 3ZDRA 3H5WA 3F5DA 3N75A 5JISA 4FM9A 3CT4A 3BGWA 2EJTA 5ALVA 4F4HA 2ZULA 1JL3A 1SG6A 2DT5A 5AJWA 5FFFA 1KYZA 3S7TA 4PCLA 1YHYA 1E9DA 5CNMA 2C4HA 4IYRA 1B3BA 5SZIA 1CJBA 2QTNA 2XMCA 4QSMA 2CUZA 3A3NA 3U7QA 4IJUA 3OSZA 3T99A 3G88A 4EHLA 3HJFA 1UFOA 3Q7TA 3D6AA 3MT0A 2ZYDA 1W85A 2RARA 1OX4B 2EQAA 3UEOA 4KZKA 2EP5A 2CMGA 3FUUA 4MXDA 4QWWA 4S2EA 4Y0AA 1G8MA 4UM8B 4AZ0A 4F71A 1XZIA 5CB6A 1TT7A 4LGYA 1HEIA 3KK0A 3UG7A 1JA9A 1WPQA 4HX5A 3CCFA 4K9SA 1YRBA 2C84A 1R0KA 4CG2A 2FEAA 5F7JA 5HHTA 3DPIA 3EDYA 2ZKLA 4UBNA 1JVSA 1EXVA 1CFZA 3N0VA 2IEBA 2HA5A 2DHEA 2YIVX 1E9VA 3IBCA 3AP2A 3JASA 1V5WA 2Y71A 4PRLA 5DYYA 4B4UA 1D9ZA 4I4TF 2WU3A 4LHZA 4ZTZB 1NDQA 4G41A 1FVHA 3JD3A 4IIYA 2BEVB 5I9TA 3H1GA 2R751 3GAFA 3MTQA 2CVHA 3LECA 4NRDA 2AJCA 5DLEA 1UMBA 4Z0HO 2XVYA 3N6RA 2NXWA 2WLSA 3LH5A 3O1HB 5AKGA 2ZS8A 2HA4A 5KX5A 1OGIA 4KQEA 4L76A 4DWWA 1JHOA 5ELLA 1GCGA 3BX1A 4Q7KA 1Q1BA 3BGVA 3P4UA 3PR2B 2JJ2D 2V59A 1N57A 3R7BA 1T36A 1I7PA 2R8BA 5EP3A 3SR3A 3DBVO 4YJFA 4ZKEA 2JCGA 3ITNA 3KKEA 3VR1A 3E18A 1WCIB 2IS6A 1NRXA 3OCWA 2XKJE 1HYQA 3NNDA 4WBSA 4DNPA 1KMQA 3SFTA 2QUHA 5B37A 1SVSA 3DZFA 1RWVA 4D6YA 1HOXA 1LJUA 1TUIA 2OB2A 3EGXB 4OHKA 5J59A 2W2VA 1DFIA 4FE4A 1E7SA 1TI7A 4GX1A 5HDBB 2AI2A 3EF1A 1PS0A 4J8PA 1XQ9A 5C4IA 2H54A 2J48A 4DJDC 3PGLA 5H68A 5EJ7A 4XH9B 3U61B 3QVUA 4JBLA 3SX4A 1ADYA 5ALWA 2WR8A 4K87A 1R8JA 1Z2AA 2OG2A 1FU7A 1QR2A 2V98A 3EVBA 1IZZA 3V42A 1ZOLA 3W34A 2GZRA 3ZHTA 2D1SA 2HGZA 4P8RA 2ZB8A 4WEQA 1E4YA 2O5EA 1YTLA 3LQYA 3REGA 3KJZA 3OQBA 4DB2A 4GRIA 3UJ7A 3AU8A 3FVQA 3EA5A 4I9NA 3OM1A 4MPPA 5EE3A 4HNVA 3VU8A 2C82A 2J3DA 2ORIA 4GSLA 3LW8A 2WD7B 5U1PA 1V9CA 4B7AA 4K3UA 3MK31 5GJVC 2XZLA 3NEPX 1D6NA 1JVNA 1N6NA 2PRYA 3P45A 1OSNA 2XB4A 2J9FA 3D9QX 4XR9A 5EHNA 5EHXA 3WL5A 2PBLA 4D9MA 1P73A 3OOYA 3RVNA 3V7YA 2RHBA 3CM0A 3I83A 3QENA 4EHFA 4ICIA 3TMYA 4E21A 1FDOA 2KM1A 1H94A 4A8HA 3Q2KA 4K6MA 1TCCA 4NBUA 3QGMA 4R2JA 5L3SA 1OYYA 1MZVA 1K5PA 1DRJA 2YYZA 3T5DA 3V4SA 4KL8S 2Q8NA 5DTIA 4QPCA 3TNYA 3NP7A 2FU5C 2O8DB 3HDVA 2ERYA 4I9GA 3K0FB 1AGPA 2PKYX 3KR9A 4UHBA 2OSVA 2D5BA 4WZAB 4F2HA 1G21E 2X23A 4XQ9A 2XWBF 5GV7A 3TMKA 1JZSA 3ZK9A 2X3YA 3GA7A 1Z9BA 2G80A 3ESZA 4BHTA 3IQXA 2UZ3A 4FOTA 2BBTA 3O93A 3I9FA 2AD5A 1HWYA 2QX6A 2R8PA 3BKXA 5ALXA 5LSAA 3IUYA 3T1NA 4RJTA 4RABA 2CCGA 5K05A 1FB5A 3FDIA 1B14A 1TPYA 1I4TD 3U4CA 3P71T 4CMAA 1ZITA 2JCSA 1YI1A 5DIFA 5EUQB 1NRIA 1I13A 1M5UA 3BFKA 3NI2A 3O3OB 1NIJA 2YV1A 2PLRA 1PGNA 1KYIA 2PSFA 3N2YA 5KNCD 5LYJB 2QTRA 1X1EA 1E3EA 3PPYA 1TA0A 2ORVA 3NT2A 3HI6A 1GFZA 1YJAA 4ZRMA 5LNK1 1M83A 1JKIA 5GV8A 1YJXA 2QX7A 1SVUA 2REXB 4X8OA 4BASA 2BGLA 2P0AA 4GWKA 2WQ6A 4NBVA 4MUHA 2IS2A 2O1SA 5B30A 2FX3A 1RYFA 2D2XA 2PEYA 1CJUC 3RKSA 2OV3A 2M6KA 2JFVA 3BH0A 3R0JA 3THWA 2RCYA 5LZ8A 1GPBA 2VUTA 4C89A 2G5PA 5KYYA 2G25A 1X1RA 2AE2A 3NEJA 1YRQA 2YMQA 5B58C 2EKPA 3IA7A 4HNAA 3HBJA 3SY8A 4DRXA 1P91A 1OZFA 3QOWA 1U5BA 4QYSA 4YXWA 4E2FA 4L08A 4M1WA 2YNMC 3ESDA 3I1IA 1N5KA 4MJ7A 4NECA 4OD0A 4B6SA 2O3JA 4WNIA 4EB6A 3LUHA 1FFXB 1IXRC 1MX9A 2Z56A 2FMIA 3FZGA 1PP4A 4FILA 2JAXA 1NW3A 4MIKA 1X8KA 4RJJA 4PBSA 2A5GA 2ZIFA 3H2YA 1GILA 3VH4A 3PNLA 4MVJE 3AXSA 3ENVA 1H2AS 4MH0R 2BMVA 4BNGA 4DSUA 1G7RA 3M4NA 3QITA 4P7JA 1CIVA 4G8CA 2QX8A 4K9LA 4Q3EA 5AHKA 4V0NA 4AS1A 3EC7A 3W9SA 4QU5A 5EQFA 1NAIA 2W2OA 1QTQA 4E0BA 3UUEA 3IS3A 1OAOA 4Q6BA 5GONA 3QEOA 2Y76A 3TCKA 1T3SA 2FWRA 4JLVA 2I4OA 5AKLA 3SQDA 1ZJ6A 3RGWS 1RQ7A 3N2GB 3ZOZA 2AMVA 4Q9KA 2IPAB 4B7ZA 2FNAA 1XZJA 4N40A 4MV1A 5FB3A 3WMWA 5AW7A 3LUJA 2BUBA 3H0KA 1QGOA 4XDGA 1AX9A 2O2ZA 4FE3A 1A4IA 4XSVA 5FTWA 5KJ1A 3FBTA 4L72A 3DOHA 1UR5A 4ZQIA 1ZC4A 4HJRA 4U7FA 3F6YA 1ZOPA 2ZRNA 1VJ5A 1YBMA 3PLAE 1US8A 3Q7SA 2BEUA 4W99A 1PYGA 1M33A 2QF7A 2Z30A 4FBMA 2QJTA 2GTHA 3CLKA 4DQUA 2AOTA 4CGZA 2QRGA 2P4HX 4TROA 1LPNA 3JAKB 4Q66C 5IVPA 5T8KA 1NQOA 1BROA 4UCXA 4AZTA 2HJHA 4Z9YA 4TQAA 2G06A 2VJPA 1TZKA 3NBFA 4LHXA 3U3KA 1F48A 1QLWA 3DL7A 4H0FA 4LDPA 3SZLA 4W6QA 2O8BB 3S2SA 1CYDA 4M7OA 2F48A 3ZBPA 2YVKA 5DGTA 3F6RA 2IHJA 2AQIA 2IE0A 2O0JA 2YZNA 4ZO8A 1RLTA 3LAWA 3NYWA 4IIHA 2WJGA 1E1QD 1LZKA 3LGAA 3OTHA 4TTTS 1L5GB 3NM6B 3MS2A 4NEGA 5LXTF 2AB0A 2W58A 1GZUA 1K6JA 1P1JA 2C9BA 3A7DA 3FTEA 4EJ2A 2Q3DA 1WBDA 3H42B 3JQDA 4BTEA 2FFQA 1J2TA 2JFYA 3LG2A 4ZEXA 1DC3A 2QN6A 5FO0A 4OQXA 4G8BA 1MQAA 4O25A 3S7ZA 1DLIA 2N1MA 3G3EA 2OXTA 3VBCA 3X3HA 1KO8A 4OGFA 1C50A 2QRVA 3H13A 3LL7A 4KXLA 4Q5IA 1LH0A 2W6QA 3H5LA 2AZTA 2CYCA 4NYIQ 5COAA 1A9QA 3PNOA 1P2SA 3DBOB 1O03A 2FOLA 3WAGA 3G9XA 2I80A 4X60A 1F6DA 3CZRA 3RFTA 3VBEA 5E0KB 2FR1A 5SYMA 2R8OA 3HK2A 1NVVQ 2VDOB 2JIQA 3DBHA 4XAQA 2XCLA 4CWAA 2JVJA 5JNRA 1GRCA 1FMFA 3TH5A 1NI4A 4OV6B 1BD3A 3SQMA 3R7FA 4P38A 1J0XO 1FZQA 1RRMA 2B2XA 2ZYGA 5CA1A 1ZMXA 1GU7A 3PYLA 1YK1A 2RGWA 1CTQA 3ETGA 4GOOD 4JNKA 5I51A 1ZJYA 5IAEA 2QN8A 4D7AA 4MQFB 2FOIA 4M0MA 2FPKA 2VS1A 4CW7A 5JLJA 4ZN6A 5F98A 2JC3A 4MTLA 1WW3A 4Q7LA 5T6BA 5TVKA 1U3CA 3AW8A 3LCUA 1CFJA 2HK7A 4WJZA 5JWRA 2NYUA 3PEYA 2UDPA 4WUVA 1ZL0A 3FF1A 3HWWA 4OL0A 4DRYA 1GARA 4PAOA 3A4VA 2WNSA 3A06A 1UMCB 1HDOA 2JGEA 4P3YA 3ZWXA 4TUYF 3C70A 3E53A 3FOFC 4CQLB 3G6WA 4EECA 1XQVA 2OT3B 4Y1RB 1ZI8A 2JFBA 4DOMA 2BH2A 4EYKA 1ZW1A 2A4MA 4QGHA 3KD2A 3K0AA 1ISHA 1RM5A 3AI3A 5JY1A 2OAEA 2XA2A 4PX9A 1NKTA 2NV0A 6Q21A 3KQKA 1UDAA 4E33A 5CDSA 3DB2A 3JQRA 4J7AA 4EENA 1MAHA 1IWBB 3SJ7A 3RYIB 3C7CB 2Y1GA 1TJNA 3AO0B 4P4SB 5IVHA 2YWGA 1TO2E 4P82A 4LNUA 4FFVA 2H9YA 1LTKA 3HA3A 4AMYA 1G2PA 2VT3A 1XRQA 3FZEA 2QSUA 1HFJA 4RHXA 1FDWA 2WIJA 3GC6A 3KOWA 1KY4A 3BGSA 1QK4A 2FPIA 1DSSG 3EK2A 3SYMA 5K8TA 2REBA 4GP7A 4PF1A 1I4DD 1K9VF 2ZIZA 4Y2UA 1QH8A 2P9GA 5ILGA 4HN2A 3RJZA 5JD6A 4GC5A 3QW4B 1D6SA 1LBSA 2C9MA 1E2KA 1N5JA 1DT3A 3ELYA 3ORQA 2IC5A 4HFMA 4BUZA 2JLVA 4QBFA 4J16A 1B41A 2EZUA 4XIJA 3W2HA 3D4LA 4ZVKA 1SUDA 2QR3A 3DMRA 5CGQB 3W6UA 3WBJA 4CKCB 1YQGA 5LNK6 1LRJA 4ZOQI 2IEDA 3Q88A 3TGWA 1Z5NA 2I87A 1L5VA 2O9JA 5AKKA 3EBLA 2WF6A 4HVTA 4MQ6A 4UHKA 1XB2A 2N75A 3DVSX 3PPIA 3DXFA 4U8GA 2J5XA 3MGAA 3FCCA 5CVUA 4EOGA 1CUVA 5F2NA 4RJKA 4ZRNA 8AT1A 2P4SA 3B52X 1M6WA 3OA2A 3IX7A 3V5NA 4YT8A 3DWEX 4YJ3B 3VJLA 5JQGA 1GFIA 4CKWB 1EGVB 3K20A 5D87A 1J49A 1TQHA 2OFXA 3IQHX 3AKDA 1YRYE 3HKCA 3F5FA 2RGEA 4DDHA 1N9KA 3KXLA 2BFCA 3K1AA 2FFRA 2D2EA 3EXEB 5AJUA 3UB4A 2IUEA 4NH4A 3A36A 3CNQS 4TN1A 3E7WA 3FTCA 2X8WA 3GLIA 4IDDA 4ZOEA 4BRUA 3IB6A 5IYZB 3O1JC 1VG1A 4EGCB 1G8YA 2R7AA 3A2MA 1PNQA 3O4VA 5IJ9A 4GXQA 2LKCA 2RH9B 2X9NA 2FV8A 4G1CA 3GZNB 4JEIA 3TZQA 1AA6A 3COPA 1CQPA 1QO0A 4BV9A 3R9WA 4YI5A 2QZZA 1BCRB 2WAOA 5BYKA 3ZTYA 4P80A 4JUIA 2O50A 4ZOBA 2Q8QA 1ESEA 5DK6A 4CDRA 1FNMA 4L15A 4KIUA 1V0JA 3IP7A 3PKIA 1G8AA 1ZNYA 2PX4A 3CT6A 1MO2A 3GLHE 1GM5A 4L9AA 4DLAA 4Q93A 2AF3C 1JLKA 1Z34A 2CHVA 1JBKA 1KR2A 1V1MA 2P62A 3TG2A 3QU2A 3BZBA 5DM0A 4DHEA 3TQTA 4NBNA 1XMOB 1EFDN 3L7MA 4Y0VA 3U3ZA 1X8XA 4IY1A 2ZCUA 1OV4A 1CY0A 1Z6GA 4OJMX 2H63A 4HWRA 4Q82A 2HL6A 5JD3A 4F9FA 4DKJA 2HUNA 4H1HA 3UJBA 1Q6ZA 4ETNA 1VG9B 4CV2A 1G8KA 5LN1A 2O6LA 1FYEA 4MRPA 3V48A 5MDHA 4ZOLA 3KKQA 1P8JA 1RCTE 1U0HC 1X3SA 4PFSA 2JJMA 2VWGA 3RSSA 1GTG1 2V6MA 1TPZA 3MJRA 3T5AA 1UDBA 2J33A 3OZFA 4XUGB 5EP1A 3F78A 4IHAA 3ZWPA 5CFZA 2R6DA 2WG1A 5IXYA 2OXCA 4GKBA 3REOA 1C8LA 3RANA 4KVFA 4K2HA 1FXWF 4YCAA 1PCXA 2NQTA 4UE6A 5IT9A 4HDKB 4MCHA 2N9UA 5ANRB 3RS7A 1CQJA 2OCPA 2PBRA 3FPKA 3LBIA 4NQRA 1CUYA 5BW4A 2OE2A 3VJKA 1RVDA 4PY2A 3SBDA 1M0TA 3ETEA 3W79A 3L04A 3PR1A 4DLUA 4ACAA 2KW5A 4XB2A 5KNDA 1CBUA 1J5XA 3OZWA 4CPDA 1ZR4A 4EY3A 4JHXA 3CE9A 3ET5A 1OE0A 1DQPA 1CHNA 4R3WA 4YO8A 3FJ1A 3TM5A 4ARUA 2Y92A 1I1NA 2J9GA 3CKMA 4GH5A 4C5AA 5K0SA 1ST2A 1IZYA 1AUQA 4ZCSA 3U13A 4KX5A 3R5FA 3HC7A 1H0HA 1QV9A 4LYAA 5U4QA 3RF6A 1I94B 3RBVA 1ZLXA 2V7QA 4JUCA 4RHUA 1T13A 3AHHA 5TPZD 1BSVA 1QSGA 1AQYA 2QR2A 3C6YA 2C4NA 1BRMA 1PG5A 1CRLA 1RE0A 2W6JA 3NV7A 4GZMA 3HLTA 2OFPA 1YS6A 3UC9A 4G2TA 2Q4BA 5JRJA 3WXMA 2EJVA 1H4QA 1D03A 1V9SA 1T1GA 1VRVA 3DMHA 3GRVA 3NYRA 3PQ4A 2IDZA 4O1HA 3ZE7A 5BQFA 2PSDA 3BFPA 4N7BA 3HCPA 4YCCA 4KGVA 1IONA 3V9PA 4DQLA 4O1IA 1Z8DA 2NTJA 2NVUA 1GZVA 1EZ1A 1WNTA 2GEVA 1IN7A 5CU7A 2FN9A 4LCBA 1TZ2A 4TWZA 3OPYB 4L4UA 4E5DA 2GZ2A 3R9XA 1T2DA 1KK0A 5FOUA 3Q7IA 2ISQA 4DLBA 4DV2B 1BMTA 2IUSA 4WBNB 1P1KA 1TNDA 3CW2A 4WLOA 4Y9DA 2FF7A 5DGDA 3EASA 2AK2A 2PL1A 3AJAA 3A2NA 3GFRA 4M9ZA 1C9EA 4MWTA 2QD1A 4DV4B 1ENOA 4HDOB 4TYWA 5C8DA 2YN0A 4AU1A 4EUFA 3GEMA 2B35A 1WXGA 2C42A 1L4KA 2OHFA 3G68A 1LLDA 1QHIA 3IBSA 3NGMA 4H7FA 3TR5A 4R8VA 4TTIA 3VZQA 1WLSA 2OV6A 3RI3A 4BLOA 4DT1B 3IDSA 4GI5A 4YQFA 4QASA 3RG2A 2EWVA 5K6AC 2VQ6A 1PTKA 2VKTA 4GWLA 4J3NA 1Y6GA 5FLKA 2FW6A 4NS1A 4C30A 4OHPA 3QLTA 3QFFA 5EMHA 3T0FA 3HJAA 3QELA 1FUUA 2EJCA 3CN7A 3PJGA 4WK0B 2QD5A 1W581 3IV9A 1BWPA 3NR2A 4J3JA 5GVRA 1OPRA 3STTA 1U2DA 3VM6A 1JW9B 2IYAA 4KMMA 3OZAA 2W2PA 1JXMA 2YXBA 4MP8A 3FVVA 3ZCUA 2VDWB 2B4RO 1A0OA 1UDWA 3DJFA 3SDSA 3JQFC 4ZGGA 2JAHA 3I2KA 3JYQA 4NU6A 5AJZA 3ZV7A 4HWKA 5IP5A 3K9HA 2I7TA 3LY8A 4IDEA 4AJ1A 3IO3A 2H1CA 1SELA 4K3VA 1HQCA 5AVSA 4J90A 5LLDA 2XITA 5IVIA 2ZQYA 4QPPA 3OA0A 3HB7A 1L7PA 2FWIA 4H6WA 3O8LA 2NXCA 4TV8F 3RC7A 4FTWA 1BKYA 4TRRA 3HYTA 3SZMA 4N65A 4RK0A 5HFNA 4M1ZA 1JU9A 4A9AA 1ETHA 2WU4A 3DP7A 1VDMA 1V5EA 3MTJA 2JD2A 1JJAA 2BEWB 3L06A 1H2FA 3ECSA 1XEXA 4G4SP 3M83A 2I2BA 3AJ9A 4JEUA 4BZZA 3I8OA 5C80A 1LDGA 2ZUBA 1WQ3A 5CDUA 1VHQA 1NVXQ 2WSSD 3W3AA 4TKVA 1FYXA 1JS1X 4LYEA 4PLWA 4I7EA 4O29A 3OICA 4C0QC 3LPNA 3N0WA 1XVAA 2G1UA 3QVGA 3C8ZA 2JLQA 4HYQA 5KOJB 2W6ID 1CUEA 2JA2A 4PNZA 1B76A 1K0UA 3D8BA 3PJEA 4IMPA 4RKWA 4MGHA 5JH7B 5M5BA 1SC6A 2C96A 3TRFA 4PAMA 1ZMTA 3NBAA 4NBTA 2ONCA 4KMOA 4PLFA 1OREA 1SVOA 1T6NA 1E62A 2HK8A 2HREA 3IOYA 3SLRA 2KBFA 5F21A 2HMTA 4MULA 1H3FA 1HRDA 1INLA 2JIMA 4MRRA 2WDPA 2QW0X 3NIFB 3UNXA 1SWWA 5KMGB 2FW1A 1JZTA 2OLKA 5FPSA 5KQMA 1HKHA 1OASA 1A8QA 1V4NA 5CG1A 3EUFA 2C3PA 3CZ5A 2HA2A 3D6UA 3NG1A 4L9SA 2F1KA 4WW0A 4WGFA 1Z2NX 1H3NA 3P2MA 2ZBRA 4UULA 4ZYUA 1MJGA 2Q6VA 2HYDA 4P3NA 5L45A 2EJWA 3GJXC 4XVCA 3A6KA 3PDJA 1Y42X 1PDVA 4QPDA 4OQ4A 4ENUA 1RBYA 3AHGA 3IDZA 3L7NA 2I78A 4LE0A 4QRHA 3A4MA 4ENPA 5A02A 5FULA 1GV0A 2YY7A 4KQKA 4R2IA 4B71A 1Z0UA 3H2IA 2O8EA 1N2CA 3MEQA 3B6ZA 1IWOA 2H7CA 2HWWA 3FWYA 4FEYA 4JA0A 4C6TA 2BIFA 2P6NA 3HI4A 4AECA 3FR7A 2CV0A 2PZJA 4QJBA 1W36D 4H6VA 3RVLA 4BNXA 4F4JA 1O08A 2G5CA 4D92A 2VK2A 3THYA 3C5VA 4PXYA 3FSGA 1Q2UA 4X62B 1XYVA 1WVGA 1Q0SA 1PFKA 5HE8A 5HYVA 3S8MA 1G8HA 5C8XA 2BFBA 2PKEA 3TTSA 4EQZA 3DMDA 4GECA 3WWDA 3HSSA 5JXJA 3UT5B 3D4BA 3YASA 1V4BA 4ZYXA 5LQCA 4C4AA 3FVWA 1IAQA 1MW8X 4F2DA 5IUKC 3DWFA 3WV5A 1T9ZA 1QRDA 3TS1A 3N7TA 3HB5X 4I46A 5AO9A 1U8FO 1YBFA 3SVZA 1XZNA 1N6IA 2C7QA 1KGSA 1JYEA 1UC4B 1B8UA 2XOKA 1XMJA 4M8IA 1KWGA 1P2UA 1EFRD 5JSKA 1M2OB 4DCUA 3OE5A 1SUBA 4NIMA 2VHXA 1AZTA 5TQ2B 3THSA 1AQLA 3NGXA 1P0FA 1X8JA 3LW7A 3CR8A 5J2UF 5B4UA 3SBOA 2ZRJA 4LZNA 5CCBA 4G81A 1Z6AA 1TEXA 1ABFA 5TJHA 3ZIUA 4BFWA 3CF2A 5EZQA 1GKKA 1F60A 4RM2A 1CU1A 1DQZA 1I0ZA 1Z5VA 2DKNA 2PNFA 3O7MA 4O5OA 1C30B 5B4TA 3GEBA 1R18A 2ZSDA 5AJHA 3SYTA 4EX6A 1GCOA 3SS7X 3W77A 1WCIA 1N1MA 3N7AA 1Y3FE 2M98A 3MZ0A 4XGKA 3S55A 1REQB 3HKBA 2Y2UA 5FOTA 5NLLA 2F3SA 621PA 1RBMA 3ZHBA 5F7OA 2FMFA 3EGXA 1X2EA 1E92A 5A6VA 4HB4A 2ZYSA 2AXPA 2PRSA 2BMFA 3CH7A 4UNRA 2CEKA 5KWEA 5JI3E 4QZVA 3JARB 1DO2A 4D4LA 4X6UA 3ETLA 3FUCA 5ICGA 1OC4A 3Q7RA 2H5LA 3AR4A 4P3XA 5AM4A 1V3QE 2KX7A 4JEHA 5DGXA 3EGDB 2X7JA 3LT1A 3GIWA 1OC2A 2GXQA 4N0MA 5I4CA 3LZCA 2QYHA 4YP7A 1XZHA 3QI7A 4P92A 1ENPA 4YASA 2GEJA 3UF0A 3D6FA 1Z5UA 3B5JA 3QNMA 2IHUA 2JH3A 4MB0A 4QTTB 2WD7A 3O7WA 3IGFA 4MQUA 2LPMA 3D1JA 4L8VA 3JYOA 4QAJA 2G4VA 1FXWA 3LX5A 5BN1A 1N2EA 4CKXA 2ZJ4A 3JQAB 2F43B 2JJ2A 3RCBA 5KU7A 4YP9A 5I5EA 5AVZA 1M6NA 4IV8A 5D84A 1N2XA 1F4LA 3H87A 3Q7QA 4NBSA 1A9OA 4XGRA 2BE7A 4ZD6A 2HQOA 3WOVA 4ANFA 3BMXA 3VOBA 1A71A 5E7MA 3OLXA 1Y33E 3LWNA 2WD8A 2FSHA 2Z6AA 3PGXA 3ZQ6A 2O8DA 4D8WA 5EHZA 1OX6A 5K8UA 5BORA 2PD3A 4CG1A 3CRW1 4RMIA 5ALSA 3D2CA 3FPEA 4CU5A 3T3HA 4AQYB 1CB0A 1PJ4A 2J6CA 4TPKA 2EIHA 5FBRB 2HB6A 2Y1XA 1NFFA 3G2HA 2YWBA 3FCOA 5FA5A 1G7TA 2FZWA 4I36A 3WKBA 3H1EA 2FWNA 4I6JA 4PICA 4C4ZA 4ME6A 5C2JB 4GM1A 4RL4A 1MV8A 2I3ZA 4K9PA 1Q0TA 3COYA 3I2JA 2W42A 4DVGA 5AW4A 1QTNA 3AR5A 3SEFA 2JAPA 2JCBA 2NU6B 4ND8B 4MJLA 4XGQA 1CZHA 5DBHX 4A0FA 4BBAA 5AVQA 5J43A 1N0UA 2JG3A 4OBWA 3ELWA 4UE3S 4HXYA 2DQSA 1XXHE 3SDBA 3X44A 3ZZMA 1TTTA 2MMGA 3NTVA 3EQ2A 2FFHA 4V1CI 1BQ4A 1L7EA 2ES4A 3EB9A 5D8DA 4MS3B 5LYJA 2FW9A 2V8OA 4O2RA 4YLYA 3N0TA 3ZUPA 1RHJA 1FPMA 4IV5A 1QP8A 1VG0B 3EVTA 3KFLA 4CUKA 2NG1A 2HX1A 1CW2B 1F17A 2BKVA 3PX3A 3Q6IA 3RQIA 2G9QA 2ZXFA 1X87A 4N48A 4G0OA 1YCDA 2IY9A 3KJHA 4FFBB 5IN4A 2RHWA 1Q21A 3H9GA 2E4WA 4HGYA 1YO6A 5AW0A 1QANA 1VBMA 1DEKA 1N2GA 1Q0ZA 1UF9A 2DBQA 4LGMA 1GZ5A 1FYDA 2X76A 3UW1A 3VZSA 2FSVA 2ZBUA 4IOJA 3L8ZA 2XDYA 5JEEA 1G5QA 5BWBA 9LDBA 4CV0A 5KYNA 1R27A 4O4IB 2VP3A 3PXEA 2XT6A 1F06A 4P3PA 3IEMA 1YFLA 1HG1A 3JD0A 3TVYA 2Y67A 1A2BA 4YALA 4G86A 4RTNA 1F4PA 1USUA 4N3GA 3R09A 5DE3A 4DCPA 2H4JA 1JU4A 2LDBA 3ADPA 3NHSA 4OGKA 5JADA 1XTKA 1P5HA 4YRSA 3F5QA 3B1JA 1I0LA 5BQOA 2B8WA 4R1NA 3L02A 4RKRA 3TW8B 4DMKA 3DO8A 1IUOA 3ABZA 2C20A 3LO5A 3OWXA 3OPMA 4UCWA 5F9HA 4R1LA 1E3IA 4XVQA 4IXMA 4LKOA 4U0KA 5TQVA 1C1XB 3HU1A 4D45A 1VKZA 2D3WA 4O2LA 4IJKA 3ZHRA 1PEDA 3OZVA 1PWEA 3F2VA 5KNCA 1IPHA 2YZMA 2FPXA 3VKFA 1BWQA 3R0QA 4KN9S 5HGXA 3SZUA 4U4AA 3ZW9A 3EXG2 1SVKA 2C83A 2G82A 2QTWB 2RIRA 4NE9A 3BREA 2PN1A 3NATA 4DM3A 5K0FA 4OQMA 3KR2A 1KP2A 1L6RA 3I9LA 3OJOA 3HP1A 3EOAI 3KJGA 4ZDJA 5JCZA 1CYEA 4AJ2A 1E3MA 4BX0A 4X20A 2NZXA 4TV8A 1KI3A 4IDNA 3RROA 3L07A 1R5JA 4F11A 3I9MA 5CDFA 2MCFA 1PT7A 2EARA 1Y1LA 3TSAA 3OJCA 1L7DA 1K7EB 1SB8A 1PJ2A 1Z36A 3G2JA 4CXMA 1OWLA 3PD1A 5FKJA 2JGNA 4LFCB 5CA0B 2AUNA 4WOJA 2IS4A 3VU3A 1WU7A 1VECA 1BRTA 5ALIA 3ER9A 1TIKA 3JAKA 5JD5A 1X9GA 4XASA 1MB3A 2VTBB 2PRIA 1VB3A 5CT9A 3OFND 3G17A 1LK7A 2P75A 3GMDA 4MUGA 4OUDB 4MP3A 1S96A 2J3MA 1C0EA 4PLYA 4IOLA 5B7QA 1SCUB 1YR2A 3IPXA 4V0OA 1EDBA 1V8BA 1LRLA 4EEZA 4BQQA 3CLVA 3VR4H 3D4PA 1UBFA 2WWYA 2EFJA 4LC9A 1EFTA 2J32A 1EBUA 4GSKA 2PZFA 2C4UA 2GEBA 2C2HA 1P5RA 3EXHB 1TE2A 4OU5A 4PG5A 3CH6A 3U9TA 4HDMB 5CDTA 3PDCA 1W88B 4PZUA 3BB3A 2WJZB 2B5WA 1XA3A 3JYHA 3WRWA 5HWSA 3EEQA 1JKXA 1DBRA 3V8EA 3TTYA 4KR0A 5C7OO 4MIYA 2Q1TA 2YWRA 3H9BA 3NDPA 3ACBA 3HDQA 3IUMA 3CRNA 4XTCS 4NARA 1G3MA 2VHYA 3R5SA 4DYDA 1AZWA 3ZQKA 1K5GA 1KDRA 1V11A 2IIVA 2PS1A 3WL8A 4MI3A 1DE0A 3QTBA 2YS6A 2ZSIA 5K6RA 1VCNA 1U3DA 1ZKDA 1TEVA 4FC7A 3DR5A 1Z56C 4D9EA 2QE6A 3HACA 4QDOA 3NQ41 3QYFA 2OK7A 3RUPA 1CXZA 4I5EA 3WIVA 3Q85A 2J0UA 4O2AF 1K5HA 1TM7E 1ZM9A 1XGKA 3BHIA 3CLHA 2M2IA 3QWHA 4BCCA 1WY5A 4MLDA 2VNKA 3GVXA 3IR5A 4FMCF 3TZBA 4CLOB 4MQFA 4FEAA 1B93A 3DOOA 4HR7A 4KAJA 3WGGA 3BMOB 1E1QA 1XHLA 3U19A 4IYJA 4NBRA 3A9UA 3OCVA 2D5AA 4QYXA 1KI2A 2VJOA 2H9AA 3JQ9C 2QWXA 5JWHA 2I9PA 2RAPA 2XX3A 4KSCA 1UMCA 1TOAA 2V58A 3PQ3A 4ER3A 2JI9A 4DMFA 4CQLA 1XZGA 2VRNA 3H4MA 4FYPA 1UPFA 4L73A 4Y1RA 1Z4NA 3GLVA 4HGQA 5A5FA 2OECA 3T1YB 4GM4A 3D8RA 5T41A 4R7ZA 1KJ9A 1WCWA 4X6YA 1MB2A 4XWYA 3AHEA 2HSJA 2H16A 1BA3A 2OLJA 2R7LA 2E87A 1YZHA 3AB7A 1V8FA 1N0VC 3WOHA 4CL2A 1U94A 3O94A 2JEOA 5DCLA 1P5ZB 1XWWA 4P4SA 4H31A 1X38A 1YS2X 4L02A 3L4KA 2FDCA 5KWIA 3CW9A 2WTBA 1DFHA 2J9RA 3NNNA 1EBFA 4KYUA 5DYGA 3WNDA 5HFJA 5G0WA 4EB8A 4JQYA 1A1SA 4R9RA 5FUWA 3ISTA 3KZCA 4D74A 2BM1A 1WZNA 1PJTA 1VLMA 1WP4A 3MMSA 2IIBA 4JY7A 4LVUA 4W1SA 5E6UA 1MX3A 2NO4A 5K2MA 5H02A 4OHYA 2NAPA 4KRFA 1MHTA 1VJTA 3GRZA 3H8SA 1O97C 3DD1A 3TZHA 2OOKA 1E5QA 3R0ZA 4ZOAA 5EYPB 3T7RA 4AVYA 3IULA 3U3OA 5CVTA 1FUYB 5AH0A 2J5QA 2XE4A 3ECCA 3MXTA 3C3MA 3UANA 3TI9A 2CFOA 3STXA 1J1ZA 3ZU6A 2NYAA 3FTNA 3AESB 3AFGA 3Q3IA 1ZS9A 3OT4A 1QHHA 3N8NA 4FFPA 1NQUA 1GCUA 3ZJ4A 3VYWA 1SZCA 1A76A 5IJ0B 1KI8A 3ROZA 4CKWA 1LLUA 5DN6D 3LPLA 1OHHA 4TS4A 1II8B 2LWIA 4J0GA 4M38A 2QN1A 2OL4A 5D7BA 3ZG6A 4BO9A 1BXRB 1BCSB 1SUWA 1UDRA 3NHKA 1THMA 1SCKA 2V7TA 3VDRA 4YR9A 1EXNA 5AHWA 2RK4A 1JIXA 3BMCA 3EXEA 2PMEA 1NYTA 3K4PA 1DCFA 1Y98A 5BRJA 3PT9A 4V24A 3NHLA 3AM3A 4G5FA 1XCGB 3S1AA 5JAIA 1JHUA 1U0TA 2R00C 3M6MD 4FYHA 4NJOA 3OZSA 4PZLA 3B7WA 1MQ8B 3C3EA 4TLLB 4QNMA 3TBKA 1FMTA 2CYAA 2HJRA 3NXKA 1HDXA 3N8DA 4HH3C 1JLHA 2A9VA 3UPUA 1UINA 4UBMA 4I19A 1BCRA 4JB0A 4UATA 4QTYA 2IYYA 3DWIA 3DKKA 4I5FA 3UJ9A 2OCDA 4E2YA 4TS3A 1GPLA 1RXIA 2CXRA 4UUNA 3ZXSA 4UTVA 5KQRA 1PT5A 2EOAA 1E3TA 5JSQA 3R6DA 1R9NA 1V48A 2QORA 3HRHA 3AY7A 4CCYB 4ALIA 2HQ1A 1JWBB 4MI9A 5JZMA 1L1FA 2XXJA 1V39A 4WK4B 4BO5A 2C00A 3BJEA 1K7YA 3IP3A 3SVTA 1L1RA 3KYBA 1SIOA 4KXQA 1XCPA 1FLNA 1UP6A 5J58A 3COWA 1DKLA 1T5SA 2OZVA 2WICA 3PTZA 1W0CA 3E82A 3UAXA 3H1TA 4MUJA 4CN9A 3AEKA 1H3EA 1LLFA 2C95A 4ZCLA 2OHIA 4MW7A 4XM2A 2YDYA 1U1EA 3NCHA 2CCKA 2GRAA 3ZWOA 3QE0A 1II9A 3H6KA 4HB2A 3KOXA 1CKEA 5K0GA 1A5SB 1JU3A 2HBYA 4O4LB 5CIYA 3JWJA 2WWRA 1LGYA 3HM2A 3X1KA 3VTAA 3AY3A 2QTMA 1A8UA 2ZI7A 4GGMX 1Y4ZA 3P4YA </