2EKSA

Crystal structure of humanized hyhel-10 fv-hen lysozyme complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
EIVMTQSPATLSVSPGERATLSCRASQSIGNNLHWYQQKPGQAPRLLIYYASQSISGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQSNSWPYTFGGGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-LYSOZYME ANTIBODY FV REGION
publication title Critical contribution of VH-VL interaction to reshaping of an antibody: the case of humanization of anti-lysozyme antibody, HyHEL-10
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/hydrolase
total genus 23
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2007-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2eksA00
2AJ3A 3RU8H 1H9VA 4LLDB 2VKXA 4JRXA 3EO1B 3QRGH 5FA3A 4Y2OA 4BFIA 1AHWA 1VDGA 4HK3N 3TBSB 1P69B 3BT2L 4FQ1L 1JI1A 1H0DB 2FECI 5DRNB 4NP4L 2ZSVA 3IU3B 2VLMD 4XTRD 2H6PA 2R2HB 4YFLF 5T1MB 5J9PA 4Z7NE 3ZE1F 1YMHA 5C0CA 1U8OB 4C56A 2JK5A 2GI7A 4JRXE 2CPCA 1K6QL 1GGYA 3OGOE 3ZKNC 1UC6A 2AJZA 1MUJA 3UAJD 5HVHB 5FOBB 2HP4A 4ZPVB 5EZLB 1WEJL 4QHUB 1MCBA 5IB2B 5C0CE 4C56E 3G5VA 5KZCD 3V7MA 4LMQE 1U8JA 4MA3B 5AAMA 2WW8A 1HXYA 5AG8A 1BVLB 4X6BA 2EDKA 5MEPB 2GT9A 5EFIA 2EDLA 1WBYA 3MCKB 5L6YL 2A73B 1LO3H 5SWZB 4TPRL 4ESKA 2NXZD 3P9WB 2CRIA 2ZCHL 2GQHA 3IKCA 2JJWA 3BN3B 3QJHB 1MFNA 1PKQB 1UEYA 5BZDA 1CU4H 3P73B 4XBGA 2VLJB 4ZDHA 2VO5A 4PS4H 1PQZB 1GH7A 4RMRA 1AXTH 2B1HH 5IOPA 1D9KD 2F5BL 2PR4H 2R0ZH 3WLBA 4IIQB 3ROLB 3H3PL 5HI5D 3BP5A 3GSQB 3RU8L 3N06B 3EDEA 1FNHA 3TA3D 3PP4H 3QQ4A 3DIFB 4M7LT 1K8IA 1EBAA 3UJTH 3I6LE 4WEUD 2R1YB 2HFEB 1MI5A 4Z78A 5IT2H 1FFOB 4HH8A 4OCYH 3WFHB 4ZO9A 3LKNB 3VXUA 1GGTA 4F7EB 1A1MB 4MB4A 2P5WA 3ARTA 1T7XA 1MLBA 3KYKH 4YGVA 4EDXA 1U3HC 4JRYA 3B9KC 3DVNA 1KIPA 4TVPL 1C5CH 2GTZA 1MI5E 4FFVC 5IB4B 1UWGH 4RBPK 5D2LB 2ATKA 2R23B 4I5BA 3VXUE 2W1NA 4ZFGH 2P5WE 3IS0X 4DK3A 2P7TA 4XP5H 2NW2A 4ODSH 3LPGA 4OJFL 3Q6GH 4JRYE 1SM3H 5C8JB 4HUUA 3RY5A 4N9GB 5HTSA 1DQDH 4GH7B 4BSJA 3L3HA 3ZDXE 2NR6D 1WTGT 3HCVA 4ZFOA 4NJ9H 4NKMB 1LO3L 4KRPB 4KMLB 2VZTA 4TVPD 4PJGA 4K23L 4OF6A 3MBXL 4Q6IC 1JYNA 3IXAB 1O0VA 2DQGH 3LEYH 4WHYH 3GSVA 1KTLA 2CXKA 3W0WA 3O3EA 2BVPB 3PWLA 5EU7E 2YPVH 1AXTL 4IDJH 4E9LA 2R0ZL 1MCKA 1L9NA 1N7MH 4PJGE 8CGTA 3PP4L 4W70A 5ESVB 4HHAB 3H3KA 3GSUB 5FECA 2ORBL 3HAEH 1KB5H 2B4CH 2Q86B 3U7YH 3W0WE 3GUTB 1JBJA 2LTQB 3PF2A 5MEOB 4OCYL 3V4VH 4RWHA 4Y16C 1SJHB 1KGCD 4KROB 5J1SC 1ZV5A 4O9HH 3SDAC 1EGJA 4BQBA 2AGJH 2AJ3B 1TCRA 1A7NH 4LU5H 4HEPG 4JRXB 3TZVA 1DANT 3EYQC 2VUOA 4BFIB 2BOCA 5FHAL 4YGAB 1C5CL 1AHWB 4XHQA 4LK4A 1E27A 4D0DB 3N1MC 2EC9T 3VI3F 2ZSVB 3L5XH 5SX4I 4AH2A 4ZFGL 2H6PB 4LVHB 4IOFD 1Z0MA 5J9PB 1V5JA 3ZKMC 1YMHB 1KIQA 5C0CB 4C56B 3Q6GL 5D1QD 2Q3ZA 4WO4B 3SJVA 1IC1A 2ARWA 4KK9D 4NJ9L 1A6ZA 1YY9D 3KYMA 2AJZB 1GIGH 1MUJB 5I15L 5GGUA 3FO2A 3JWOL 4DVBA 3VH8B 4XCEA 3BMWA 3G5VB 3LEYL 3RY6A 2HMIC 2ICWI 1U8JB 4NO2B 1HXYB 3IF1B 1MPAH 5ADPL 4X6BB 3TH3T 2ZUYA 1H5BB 5CEZL 4ELKA 1P84K 1L7IL 2YA0A 3EYOA 4R2GD 4F33A 3BAEL 4XT1C 2CMRH 4OF3A 1ZGLM 2DQEH 2G5BA 2CGRH 3ALPA 3FFCD 3IKCB 3K4AA 1A5FH 5IQ7H 1FO0L 1F6AB 2WWMC 5BZDB 4JPWH 1KB5L 4OSUH 4ZDHB 2VL4A 1R0AH 4M7KH 3DETD 3V4VL 2P44B 3TN0D 3UX9B 3T2NH 4RFNC 2A1WH 3UC0H 5IOPB 5JW4R 3TT3H 4A6YA 3T0DA 5GS0C 1RIVL 3FOLA 4OAWA 5BRZD 3WLBB 3STBA 1BQSA 2AGJL 3BP5B 5CEZD 4EN3B 4LU5L 3QQ4B 4WFGE 1G6RL 1FNEA 5F70A 2FBOJ 4WY7H 2O5ZL 5EWIL 5F1IA 5GGQL 3QFJA 1MI5B 1V05A 3O8XD 4Z78B 3O2VH 5A1AA 3K8MA 5I1IL 3L5XL 1BJ1H 4KRMB 5INDA 3VXUB 4N9OB 4UU9A 5KBNC 4PJCF 1U95A 2P5WB 2VDRH 4YHKL 3NN8A 1MLBB 3UO1H 1I1AA 1MJ7L 3QA3A 4YGVB 2AK4D 5CD5C 2J1KA 4JRYB 1QFHA 4TTDD 3UTPD 3DVNB 1KIPB 1SMOA 1OAUL 2X1QA 3QFJE 2GTZB 3QQ9D 3PIQA 1AR2A 5H37H 1AO7D 4EKXA 12E8L 1LO0H 1GIGL 2ATKB 2DQCH 2XY1A 4GG6F 4WWKD 2P7TB 2OL3A 5D7IF 1FZMB 3OHXA 2PF6A 1KLGB 5IGXL 4HUUB 4JFHD 4DKAA 1NGQH 1DN2A 3ALWA 3L3HB 1DZBA 1FC2D 2P43B 2QSCH 1CE6A 4P3CH 3HCVB 4ZFOB 2XKNA 1VFAB 4PJGB 3RTQA 2CGRL 3OJDB 3KLHD 3LVEA 4NQEA 3RA7H 1A5FL 5E1HB 4OSUL 3WXWH 4XPHH 3ARYA 3BHBA 2BFVL 2B1AH 1WZ1H 3W0WB 1R0AL 4U1NB 2WV3A 3PWLB 4M7KL 5B22A 5D7LB 3DJ9A 2YPLD 3Q5YA 4U2YA 3TT3L 3MLRL 3JV6B 4LRIA 5DJDB 4H0GA 4I0PD 3VA6A 1E28A 4NBXB 2QLVB 3W39A 3UAJC 3IT8D 4NQEE 3EFDL 3T3MF 3IJYA 4EXKA 1ZS8A 1NLBL 4WY7L 1G7IA 1WZLA 2CQVA 3G08A 4IOSD 3EBAA 5CS7A 4YFEA 4XX1E 3T3PE 2J7LA 1E0OB 4I2XA 4RRPA 4MD4B 4PJAB 4JZNA 4LHUG 4ODXA 2VXVH 4TQEH 3RX7A 3O9WA 1EJ6A 1ERNA 4HWEH 3QSKB 3IFPA 4KV5E 5E24E 2NXZC 1FAKT 1RQ5A 1TCRB 4KUZL 1KACB 1QKZL 1CQYA 5IWLC 3X11B 3NCFB 2BOCB 4NWUH 3C87A 5GQBA 1CWVA 1E27B 3MV7D 4Z7UA 1EFXA 3O6KL 2NY2B 2DQCL 5T1LA 4AH2B 1RU9L 1GZPA 1QLRA 4YHNA 3ARDA 5E9DE 3PWJA 3JTSA 1EMTL 1KIQB 1I1CA 5IB5B 4FTVA 2R15A 2IPUG 3H9HA 4BYHA 3FN3A 2BX5A 3QI9D 1NGQL 2QSCL 3QULA 3V0AC 1IC5L 2YWYA 2HKFH 4XAKD 3KYMB 4L4TA 4YR6B 3ZDZF 5GGUB 3FO2B 4DVBB 4M1CD 4XCEB 3I9GL 3RA7L 4J2XA 3DUUA 4FTVE 3WXWL 5IB1B 4GXUM 2IGFH 3KPSA 5K59F 4UOW0 4KZEL 1A6UH 4HCRA 4ELKB 3EYOB 4F33B 1J1OL 5F89A 4JJHA 1YEJH 2BSED 2G5BB 4YWGH 4LVOC 3D6GA 4NO0A 4N8CH 5I66B 3L3JA 3N9GH 2ICEA 4E0RA 1JWMA 1T83A 3DI3B 2CJUL 3KPSE 3L1OH 4NN7C 5GRJL 5JXAH 2VXVL 4TQEL 4NQVA 4MQXD 4A6YB 3BH9A 3ORJA 2NY3D 3FOLB 4OAWB 4UUJB 3UYOD 4B7IA 4WJ5A 4HS6A 1BX2A 1FNEB 4YE4L 5IEKA 1NAMH 4DW2H 5F1IB 3QFJB 4IJ3B 4KHTH 1FQ9C 3NIGE 4LVEA 1QYGH 1F97A 3SPVA 1RIUL 1I7TB 4OM0H 2IAMC 4LSUL 5INDB 4UU9B 4M03A 1U95B 3LQAH 1ED3B 1G7HA 3NN8B 2GY5A 1J8HD 1I1AB 5D2LF 3QUML 1WWBX 1BPVA 4CVWA 1QZ1A 4RDQF 2ESVD 4S1DC 3LRSB 3PIQB 3LIZH 1W72H 4M4PA 4N8VG 5C09D 1S3KL 4LEOA 4RGMC 1YN6A 4XNYH 2RB8A 4P23A 3CVHH 1WC7B 4X7CC 3SE8H 3RVVD 4NQDA 1KPRB 1QG3A 2OL3B 4KDVA 2P49B 3TO4C 2AS5M 4YZFE 1MNUL 2IGFL 1KPUA 5I1JH 5JHLH 4QKXB 3HB3D 4HGMA 3ARFA 1K8DA 1A6UL 2HJLA 4GRMA 5CJ8A 4W4OA 3QNZB 1CE6B 1F3RB 1Q8MA 1J87A 4IMLB 3X3FH 2XKNB 1XH3A 3RTQB 1JL8A 3MRDA 3HRZA 4H1LB 4NQEB 4NQDE 4IMKA 5IBUB 2QSTA 3S34L 3VFRA 4I9WE 4IOFC 3N9GL 3BHBB 1OSPH 3L1OL 3WFZA 3B3IB 4NFCA 4PJBA 2E3VA 1PY4A 1ZAGA 2WBWB 5KSVA 1E28B 3OR6A 4PP1D 5IFJA 5JIPA 4TUKH 4LPWA 2FLBT 1PG7H 1ZS8B 4M6ML 1G7LA 1WTLA 4Y2DA 3VFTA 1G7IB 3KYNA 3G08B 4KHTL 5B8CA 4OLWH 2XACC 4PJBE 4Z7NF 1QYGL 4JHBA 3WKNA 1MH5A 3ULVH 4JZNB 4ODXB 3RUGF 4OM0L 1BM3H 3QEGL 4P49A 3O9WB 5DJZA 4NUJA 1C5BH 3QG6A 3IFPB 3IDYB 5E9DB 1QSZA 1G0DA 5CJ5A 1LMKA 2D0GA 4JKLA 4GKZA 3DECA 1VKXA 4XNUH 3RFZC 3TBWA 1NCDL 5J6GA 1QR1A 1EFXB 3B5HA 2XZCH 1T1ZA 3F7YA 4XNYL 2AXJA 3LAFA 3DVIA 3TN0C 4M43H 5C2BH 3SE8L 5T1LB 1GZPB 1BQHA 3ARDB 1ZANL 2IBZX 3PWJB 4EUPH 1CDJA 3JTSB 3EOAA 3BP6A 3MBEC 4FTVB 4OFIA 3H9HB 1ZSDA 3RL1A 5JHLL 3VD9A 3RAJL 1V3LA 5E08L 4X7SL 3B8SA 1KB9K 2CUIA 2X2YA 1B4RA 5C0RH 3EYSH 3LEXA 3QULB 3O8XC 4HG4J 5C0ND 1YYLL 2B4CC 2FHFA 3QDMA 1J0JA 4HGWA 3CAFA 4IM8A 2ZPKL 1PSKH 3DUUB 4LLAA 4RGNC 5FA4A 3WLWD 4PJ7A 3WMSA 3NBNA 4H25A 3KPSB 1WAAA 1QSEA 4LLQA 2ZZUT 4JDTH 5I1AA 5JTWA 2ZUTA 1AR1C 3X14B 4JZJA 3QQ9C 3CSPA 5F89B 3U7AA 4JQVA 3AVEA 4TUKL 3QDME 4NO0B 1OGTA 4MJ5B 2ICEB 4E0RB 4AEIH 1JWMB 3CZFA 4PJ7E 5C08A 3T04D 1WAAE 1QSEE 4OLWL 3ULVL 1MHHB 4GAGH 4MDJA 4NQVB 1Q0YL 3BH9B 2DLHA 1JTOA 1K85A 2QTEA 2C4FU 1UA6H 1G0XA 4N0CC 4L1DA 5TDPA 4WJ5B 4HS6B 1BX2B 3F65A 2CIKA 3QXTA 1BF8A 1A7RH 4FZ8H 4XNUL 1BFSA 4PBWD 2BC4A 2AEWA 3K0WA 1NBVL 4E5XA 2XZCL 3SPVB 4M43L 1JZ2A 3ELAT 2Z8RA 3KPTA 5CBEA 1FGNH 3ULVD 2QHLA 2FJGA 1INDL 4UNVA 2BY1A 3ZDXF 2A38A 4J3VA 5EUKA 1ZA6B 1TVHA 1ADQH 3QEQA 1SJEA 1GYAA 5C3TA 4RQQA 3EYSL 4FQXB 4PV8A 3HE6A 2Q6WA 4D9QE 3CMGA 4JZOA 3UBXG 4HFWA 5JQ6H 1FNGA 3RI5F 4NQDB 3DMMD 3T0EA 3LS5L 4MAYA 5ADOH 4JO1H 1TJGH 4PJGF 1DQTA 4JDTL 4QRPD 3UXFA 2HJLB 4X4YA 1H8OA 4GRMB 4TUOA 1LO5A 4HC1H 2ZKHH 1XH3B 2L0DA 4PB0H 5D5ME 4RWYH 3HRZB 4RMVA 2WBKA 1AGCA 5E8NA 2EDOA 4M6NH 1MCCA 4AEIL 4XZUB 1RUAH 5JOFA 2AEPL 2R1XA 4PJBB 3QI9C 4GAGL 1KTDA 3S3SA 2OQJA 5KSVB 3OR6B 5IFJB 2NZIA 1JWUA 4PRDA 3FTGA 2FIKA 4PJAF 1G7LB 4Y2DB 1EO7A 4FZ8L 3WJJA 4FG6D 3KYNB 4M5YH 1IGML 5B8CB 1S7VA 4ZNCD 2BY2A 2YPKA 1MH5B 3FL7A 3LKRA 1JCKA 3OJ2C 2FRGP 3ARRA 2CR3A 5I1GL 3BPNB 2ZP0T 1FGNL 3VXRD 5ICZA 3QG6B 4J1UB 3S4SA 2AQ3A 2OYPA 1ADQL 1HQ4B 1JNHA 4GKZB 1KELH 2DL9A 4MA1C 5CZVH 4YHLH 5F71A 3DRTA 4FFZL 1QR1B 4EZMA 3STLA 1T1ZB 3F7YB 4MQ7A 2AK1H 3IFOB 1JV5A 4QT5A 4MQXC 4OZHF 1BQHB 2NY3C 3VJ6B 1I8LC 2BJML 3EOAB 2PTVA 3AS0A 5IHUL 3C5ZA 3BP6B 4XP9H 3WHE1 3RL1B 3VFWA 1OT2A 5I75B 4YBLB 1EEUA 1RMFH 3LEXB 3KPMA 3NCJH 4HC1L 3S3JA 1XGQA 3PWNA 4KMQA 1KJMB 3JUYA 4RWYL 2C3WA 3KXFD 1WIPA 3SGJA 2B5IC 1YEKH 3QDMB 3ZKXC 4HGWB 3K2UH 5BV7B 2XYCA 2J88H 1EZVY 5FA4B 1RUAL 2GCYA 3RQ3A 4PJ7B 2Y07L 1JWSA 2BXZA 1Z0NA 1PX4A 4H25B 1QSEB 4CW1A 2Z9TA 4JZJB 5JR1H 2X7LA 4GAJL 3SDCD 3RVVC 1OGTB 3MGTA 5HHOA 5FB8B 4UBDD 1HDMB 4YUEH 2EDTA 3AY4A 3CZFB 1I3RA 4LQFH 4M5YL 3U1SH 3KYAA 1KJ2A 4PY7A 5DWUH 2W91A 5ACMA 1ORQA 5HHOE 2I25N 3D3VD 2CIKB 4P57A 3QIBD 4YHLL 2BC4B 3CLFL 1R3KA 4E5XB 3S3PA 1B90A 1GPOL 2AK1L 3DXAD 4OFYD 4J6RH 2C1PA 1F4HA 4PJ5A 2I9TA 4ZXBA 5CBEB 4IRSA 2P5EA 3PNWA 3HUJE 5EUKB 3LY6A 3RDTD 1TVHB 1SJEB 3C08H 1XAUA 4RQQB 3VI4E 1MJJA 1PEWA 2X4RB 4PV8B 5HDLA 3RRQA 3HE6B 2PW2A 2Q6WB 5D5MB 2VISA 4PJ5E 1P4IH 3LB6D 4HFWB 1Z3GL 3K2UL 4YFLI 2CK0L 4PRNB 2ZUWA 3WJLC 2P5EE 3WUWB 1IARB 4LIQH 1CE1L 4DVRL 2VL5A 3QCUL 4JQXA 4X4YB 4YAQA 1CL7H 2ADGA 3NIFF 4TUOB 1S9WA 1LO5B 4Y4HD 2MJWA 5EA0H 4I1NB 5B3NA 2HJFB 2MCPH 2X4NB 3HLAA 1NBQA 3ES6A 5E8NB 3T3PF 1MAKA 4Q97A 1QLEH 2YC1B 1DEDA 5F9OL 3U1SL 3S7GA 1NPUA 4WW2C 3ZKSD 2R1XB 4HWNA 3LQAC 5A3IC 2DBLL 4DQOL 1YQ2A 1KTDB 3V6OC 2BXYA 2OQJB 5HPOA 3VG9C 3AREB 4LRNH 4HPYL 3SQOH 3FTGB 1IM3A 4LEXL 2FIKB 1RZJL 1MCEA 5CJXC 2BNQD 3RVTC 1FFPB 1IRAY 1S7VB 3AM8A 5IHZA 2VDPH 3O6LL 1DBAL 2YPKB 1INEH 1HZHH 1MY7A 2YA2A 4NWTH 4GRLA 4J6RL 4OZGA 1KIRA 1UVQA 2DD8H 4HLZG 3VD4A 1CICA 5ICZB 1BREA 2FSEA 3S97C 3S4SB 1Q1JH 4K07A 4U3XA 4K3DL 4BKLA 4QY8B 4U1GC 1KLUB 4BA8A 3S8WA 2IWGA 1A6AB 3K4ZA 2DMCA 3VG0L 3L3IB 3DRTB 3STLB 2C7UA 4HWZA 4MQ7B 1F11A 4OZGE 1JV5B 3TCLB 1A3RH 3NFNB 4QT5B 4CL7A 1P4IL 2E6JA 3ZSTA 1CDYA 2AV1B 4OUUA 2AJYH 3MLUL 3C5ZB 1S7XB 3VFWB 3D85A 2H32A 2XQYK 2F53D 1MLCB 4R7NA 2V17L 5FO9B 5K9OA 4WUUD 4OLYH 4HWBA 3PWNB 4FP8H 2F54A 4K3GA 3M17A 4PRHD 5T3ZE 5CZKA 4O2CA 1N5YH 2J5LC 5AZ2L 2GCYB 5F7FA 1JWSB 2NY7H 4GBXC 2L4OA 1NGZA 1RURH 3GO1H 4CW1B 5EU6D 3RNKB 4Y4FB 4LARH 4JFZH 4G8IA 4QF1A 4XBEH 3VXMA 2F54E 4QLRA 4LCYA 2O5YL 2X7LB 4LRNL 3SQOL 1IEBB 3D39A 25C8H 3DROB 4HQQH 4M8VA 3NIGF 4P0DA 1MFEH 1MF2H 3MGTB 5HHOB 4NZRL 2FATL 4F8QA 5E03A 1I3RB 2X41A 3KPRD 4RBPH 1KJ2B 1NC2A 3MRMA 1INEL 5E00A 5JNYA 4PY7B 2EDJA 3U9PL 3VXME 1YY8A 4UMGA 3CPLA 3D39E 3MPCA 1R3IL 1DQMH 1ORQB 2EH8H 3HUJB 4HS8H 4Y8DC 2A6DA 3K8KA 1EUTA 2BVEA 1R3KB 4YDVA 4WV1A 5IEHA 2FJFA 5EZJA 3HNVH 1A3RL 1CR9L 4PJ5B 2JJSA 2I9TB 4ZXBB 5IG7A 2AJYL 1I3GH 5C1MB 4IRSB 1MIEH 2P5EB 3PNWB 1JF5A 2C4XA 3AFLA 5DJCA 1JRHL 3T4AA 2ZNXA 5IMKA 2NTSP 1GSMA 1OTTD 4OLYL 4PPTA 1MJJB 5T1KB 2PW2B 2VISB 3LDBB 1JHKH 1Q94B 1AQKL 3LZFH 2QQLL 4AENA 2IALA 4GXVL 5EOQL 1G7MA 1TNNA 5D7JD 3RIFK 1RURL 4NOFA 5MEQA 4Z7QE 4YAQB 2ADGB 1S9WB 3EZJB 1CGSH 5FM5M 1IEHA 4G42A 4KKAC 5TGBA 2WINB 5HPMA 3HLAB 4HQQL 3ES6B 1ONQB 2W65A 1MFEL 1CL7I 3C09B 4Q2ZA 2E7HA 2B2XL 3C60A 2R4RH 1DCLA 3KS0H 4D94A 2C5DC 4Q6YA 4GXUN 1T7WA 2ARJA 1RVFH 4R4BA 1DDHA 4WTZG 4RA0C 1UADC 3BKJL 3LKOA 2BVOB 4W6WB 3BYYA 1IM3B 1JPST 1XIWD 1YEFH 4NT6A 1T6WA 1FJ1A 2BVTA 3PL6D 2QQQA 4U7MA 1HCVA 5IHZB 1AGBA 1YEDA 3AS1A 3STZA 4UIKL 1JPFA 4G5ZL 1QOKA 4GRLB 3P0YL 4OZGB 3BIKA 4F7PB 2YD5A 1UVQB 1XGYH 1I3GL 2UZYB 1CICB 4Z7WA 4U4BA 5DVLA 2FSEB 4OD3H 1FL5A 4BUGA 1XT5A 2VDNH 4ZUTA 2BRQA 4RIRA 1X5KA 3SBWA 2PYFA 5AD0B 3QIUD 4XI5D 5HYSA 3QAZC 2C7UB 4HWZB 2DWDB 3KLSA 1XEDA 1SY6H 2JKXA 5CGTA 4F80A 1TVBA 3SQBA 3FQUA 2H32B 2W07A 2GUOB 4QXGH 4R7NB 5K9OB 5I0ZA 1CGSL 2J12B 2F54B 3L9RB 4PJ7F 1ZGLP 1CIDA 1WAAF 3M17B 2BY0A 3CC5A 4YPGA 2NZ9D 3UYRL 4O2CB 4KJWD 1QSFA 3EYFA 3GJFA 4N5UA 4DN3H 1N6QL 5DSCA 3LEVL 4XPBH 1NGZB 1RVFL 3MZGB 5D9SA 4GUPA 4G8IB 3VXMB 3EYUL 1L9MA 2C4FT 4LCYB 4LSTH 3EUUA 3QXDA 3KAAA 4YQXH 4BZ1H 1SVCP 3RWEA 1XF4A 3LB6C 1U36A 1QSFE 2VXQH 4NNPL 3WO4B 1INQA 5E6IA 3FRPA 4KQ3L 5D1XA 1NC2B 2CIIA 3MRMB 2Q76B 1X7QA 5E00B 5JNYB 2X1XR 5D7KD 2PYED 4WI4A 1KN4H 2Y6SC 2VLJD 4IRJC 1KSRA 3HS0B 1TJHH 4ZOCA 1LHZA 3MUY1 3V4PL 1ORSA 1YY8B 4OD3L 1BAFH 4PUBH 3JZ7A 4WGVB 3O4LE 3TO2A 5I16A 2A6DB 2PXYA 4HIJA 1NMBL 5L2JA 5EU4A 4YDVB 4Z8FL 4B0MM 5IEHB 2FJFB 2VQUA 5EZJB 1E6OL 4NCDA 3IXTA 5KN5B 1A2YA 1W8NA 5IG7B 1LEIA 3X3GH 1SY6L 2KQNA 3P4NA 3BZEA 4V1DA 5D5MF 5DJCB 3D48R 3T4AB 5FO8A 5D71H 2OK0L 4L3EA 1CIUA 4PJ8C 5IMKB 4BFEA 4D9RE 2YD1A 4XP1L 3TJHC 5EO9B 1BBDH 1RZ7L 5FGBA 1RFDL 4HK3J 1N26A 4J23A 4KJPD 3QXVA 4FZEH 5EPMA 4AENB 4PD4J 2IALB 4G3YH 3RPIA 4DN3L 3QJFA 3CU1A 1AE6L 1G7MB 4V1DE 5J06A 2Q8BH 2AJUL 3CDCA 4XPBL 5MEQB 4L3EE 3V6FA 3H9SA 4APQC 5DJXA 1T89A 2PETA 5D2NB 5A16A 4G42B 3BSZH 4LSTL 4K7PH 5TGBB 2D9CA 2GSIA 5HPMB 2W65B 3VGEA 5BZWA 2VXQL 1EBPA 4KK6D 2BVQA 3C60B 4FNLH 4KRPD 2ZCKL 4ODHL 3QHFH 3PWPA 2ARJB 4R4BB 3GRWA 1DDHB 2EE9A 4M61B 2JLLA 3QUXC 1KN4L 4LPTA 1LK3H 3NH7H 5HDQH 3VGBA 3G9AB 3I6KA 4G8GD 4L9LC 3Q3GA 2BVYA 5TJWK 3QP3A 4NT6B 1FJ1B 4U1IB 4U1LB 4AM0A 1EK3A 3IGAA 1G9NH 3PWPE 1YEDB 2F74A 3K4DA 2MMXA 1JPFB 5BJTA 4NZTH 2YUVA 2CRMA 5DZLA 3BIKB 4JHAH 2O61A 3X3GL 1HYSD 4UV7L 1MFCH 4MSWA 4YH6A 5T5FH 5DC9B 1JFQH 4KROD 2DQJL 4KI5D 4OQTH 4ERSH 4ZUTB 4RIRB 1CCZA 4WNQB 1B6DA 4NRYA 2PYFB 4ZMAT 2J4WH 3QUYC 4BSVA 5HYSB 3FO9A 4JRXD 1PAMA 4PJHA 5MERA 1BBDL 1F5WA 3GMMA 3LV3A 4FZEL 3X12A 3T2PA 4G3YL 3KPOB 2J3SA 2R4SL 3H7LA 2Z91A 3RZWA 2Q8BL 1TVBB 1L7TL 4J3WA 2HRPL 4MD0A 1GGIH 1LO4L 5C0BA 4K94H 2NYYD 1I4FA 2DQTH 3QPQD 5C0CD 4C56D 3HE7A 3BSZL 4RAVB 1N59A 3HI5L 1KCRL 2FBJH 4RDQG 4DFIA 4P46A 5CFHA 3CXDH 3CC5B 4YPGB 4BZ2H 4RA3A 4ZG1A 1QSFB 2LV4A 3GJFB 4CN4A 1FL6A 5CP3A 5GIRA 5DSCB 3B8YA 1D6VL 2DI8A 4DUXA 1CDCA 2ADIA 5C0BE 2MPAL 1U2HA 5D9SB 3TH2T 1N5AA 3TV3L 1LE5A 2A9ML 3NH7L 4GUPB 3G6JB 2DQDH 3I50L 4W81A 2VN7A 4QXWA 2F58H 3QXDB 3P40A 4NM8H 4K2UH 3RWEB 1GVIA 3O4LB 5I9QB 3QHZL 3P4OB 4NO5A 1P1ZA 5D1XB 2CIIB 3BH8A 2OR9H 4WHYG 5DJ8A 4NZTL 4UNUA 1T5XA 5CSZA 3HUJF 4DTGL 4PGJA 4KGJA 1UJ3A 3I6LD 3LSOA 3P9LA 4JKWA 5DC0A 4AZ8A 5T5FL 3P4MB 4UINH 4JFEA 1KJVB 5K33A 3VI4F 3OKLB 5F6HI 4H88L 4I18A 3KPNB 3MV11 3TO2B 4OQTL 5I16B 3RX8A 4ERSL 1NDMA 2PXYB 2FZ3A 3GSWA 2JJTA 3NAAH 4WI6A 1IE5A 2J4WL 1IAIM 4HIJB 3HAEG 5L2JB 5EU4B 1E6JH 1O5DT 2NY6D 3BQUA 2X89A 3QDAA 4DKFH 5HI3D 2FO4A 3IXTB 5C70A 1MI5D 1A2YB 3S6CA 1LEIB 1FZOA 4HMEA 1TCMA 4JFEE 2HLFC 3P4NB 1II4E 3BZEB 2FD6H 3VXUD 4V1DB 3LQZB 2GSGA 5FO8B 5KG9B 2QHRL 2P5WD 1BLNA 2VYRE 4L3EB 1Q9KA 2DQTL 5JW4N 4TULL 3KGRA 4JRYD 4ZFOL 4P4KB 5KW9H 3DYPA 4HUKB 3CXDL 5EOCL 1MHEA 4MB3A 5KANI 4WFHE 1UCTA 4BZ2L 4ORGA 5BXFA 2FDBP 3RPIB 1TNMA 3ARGA 3QJFB 5B4MD 3MGOA 4RMWA 3VGHA 2WAHA 2HTLD 5BS0A 1OB1A 2I60H 1BFTA 5DD6A 1OAKL 2CDGB 4GS7B 4OT1H 2R29L 3V6FB 3K1KC 1VCAA 1NKOA 4UQ2A 1NCNA 5DJXB 1FAIH 3QIUC 3GSRB 2GK2A 1I1RA 4RISH 1OM3L 4NM8L 4P9MH 1YEEH 5GRYA 5LVEA 3VH8G 5KVGH 1JZ3A 1T5WB 4G9FD 3OG4B 1G9EA 5BS0E 1T7ZA 5IVXA 2OR9L 3FN0H 1OLZA 4P2RA 5F8RC 5M94B 5HDBE 5EZOL 5HSFA 1AJ7H 1S9VA 2FHCA 3VA2C 3QO1B 3W0WD 5DQJB 1JZ4A 5B39G 1T20A 3I6KB 3PG2A 2ED8A 4UINL 4HDIA 2GHWB 3Q3GB 4QXUH 2LE9A 2IBBA 4KJWC 4OZGF 4NO3A 4PJFA 4AM0B 3IGAB 1D5IH 5IVXE 1JNLH 4I0KA 5D93B 4FFWC 4P2RE 5BJTB 2V7NA 2NY0B 1NBZA 4C54A 3QFDA 2O61B 2MKLC 5C0GA 1MRDL 3EO9H 4MDIA 3C5SA 5FYLH 2D7OA 4JB9L 4YHYB 4PJFE 4ZUUA 3K7UA 1LDPH 3AAZA 5F44A 1KV3A 2B8OT 4NRYB 1MQKH 2XT1B 3L95A 4BSVB 3TZVD 5MERB 5KW9L 3CVIH 3EO0B 3LS4L 3RIAF 5GGVY 3JTTB 1QO3A 3S88H 1IJ9A 3GMMB 3LV3B 4DKEH 2H45A 3X12B 1DSFH 2V9RA 2NY2D 5E2UL 4M4RA 3K1DA 1JN6A 5DRXA 2Z91B 4M7LL 4JN1L 1JNNH 4MD0B 4N0YH 4OT1L 5HHME 5C0BB 1I4FB 1CT8A 1FAIL 1RUQH 4LFHD 4Z0BL 3HE7B 5LBSL 1N59B 2ZG1A 4P46B 1M71B 4P9ML 1YEEL 3SJVD 4BQCA 2UWEA 4PFEA 5KVGL 1ZKAA 2HWZL 1ZE3C 4RMTA 5DLML 3WFCH 1C7TA 3FB5A 2VAJA 4WHTA 1T4KA 1FL6B 5GIRB 1RJZA 3JVGC 3DV6A 1IBGH 2Y25A 1MAML 2ADIB 4RSVA 3NTCH 2Y1VA 4P99A 1TPXC 3SDYH 1AJ7L 1LE5B 4A6YL 2FX8L 1FCGA 2NNAA 4LHUA 1QNZH 2YSSB 4WI8A 2UWEE 3ARZA 1T0PB 5LG1A 1MWAA 2V2TB 1S5IH 4QXUL 2H1PH 2GK0B 1B0RA 3VFUA 2PO6A 4WU5A 3BVNA 4KUCF 4NO5B 1D5IL 4JKPH 4OQ1A 1JNLL 3BH8B 2ICES 1QFUL 4K8RL 5DJ8B 5A2IH 4WFGD 1I7ZA 1T5XB 2X05A 4ZFZA 2N1KA 1Q0XH 1UJ3B 3OPZH 3P9LB 3LSOB 5HXMA 4S1QL 4L29B 2JELL 3QNXA 2VDQH 1IAIL 1FORH 4JFEB 5FYJU 4I18B 1IEAA 3UPRA 5EBGA 2D4DA 1NDMB 4KK6C 4X6DF 2FZ3B 2COQA 3GSWB 1LDPL 1A0QL 1EAJA 2MCG1 5ALCL 4OCXH 4R6UA 1PZUB 1B0WA 3CVIL 3BQUB 4KGLA 3O3BA 4GSDH 3S88L 1LWRA 2FO4B 4DKEL 1KG0A 1NGPH 3QFJD 5HHXL 1FZOB 1NCTA 4K8RD 4Z7QF 2OL3L 4OGAD 4EIZC 1C8PA 5DD1H 1JNNL 2GSGB 4CN1A 4N0YL 3EKCA 1Q9KB 1I1AD 4NNXA 4MB5A 2ZOLA 3WN5C 3WS3A 1MHEB 3WBDA 3QCTL 4M3KB 3SE9H 4XMKH 4ORGB 4HBCL 1HYSC 1J5OL 3WFCL 5BXFB 2YZ1A 4LFHG 5DK0A 3ARGB 3DX9A 5BS0B 3ZT6A 1OB1B 4KI5C 3SKUD 3H2WA 5H35A 1ZHLB 3NACL 3NA9H 3RY4A 1LEKA 1EH9A 4F37F 2XTJE 1UXWB 1JGDA 1WWAX 3D87B 1FGVH 1U6AH 4S1SH 3L3GA 2H1PL 5HVGB 1IFHH 3GDBA 3REVA 4NC1C 3ZHKA 2OX5A 4LPVA 4PB9H 4OGYH 4X7EC 4NQED 5IVXB 1E4KA 4P2RB 4HJ0C 4AJ0A 1Q0XL 3OB0K 4O5LH 2M8XA 2NYYC 3C5JA 3OPZL 1NUDA 2D7PA 2VZVA 2VDQL 1T20B 3LCYA 3IFNH 2YS4A 5IROC 4P2OB 1K4DB 4ZODA 1CLZH 3QWOA 4NO3B 3WS6A 1N8ZA 4PJFB 1AD9A 4YXHH 1A6VH 5J13B 4YK4B 3U0TA 3BPCA 1KBGH 4RX4A 2YWZA 4OCXL 1KCSH 2V7NB 1NBZB 4NBYB 4GSDL 4U1KA 3VD3A 4ODTL 2R2CA 1A6WH 3QFDB 4N8VA 3FQXB 15C8L 3GMNB 4TUJA 5C0GB 5FEBA 5J11B 4NQCA 2X9WA 4MDIB 3I02A 1CZ8L 3C5SB 3O9WD 1T22B 1MCQA 2JJVA 3MA9H 4PG2A 4ZUUB 3AAZB 5HHMB 1SBSH 1IAII 3ARXA 1MRFH 1ZHNA 5CHNB 1HIML 4JPIA 3ECBB 4MXWL 1UWEL 3GB7A 4AMKH 3NPZB 4JFXA 2P8PB 1QO3B 5JIKA 3SE9L 5E8OA 3PJSA 2X44D 4PLKC 3L6FA 1EFXD 4NM4H 3I75A 3AB0C 2RQ8A 3C8KA 5E6ZA 1JN6B 1GC1H 2EIDA 5T1LD 2LU4A 3ARDD 3ZYZA 1RSFA 1HK6A 5TQ2H 4X9IA 3T0BA 4XXCA 1I9RL 4HCRL 1CT8B 4FTVD 3TVMB 4IS6A 1NMCB 4S1SL 1MVUA 1GHFL 2NY6C 5D6CA 2UWEB 1G9NC 3ARQA 3CFEA 3BISA 3E6HA 5HI3C 4KPHH 5A2LH 4OI7A 4L4TD 4FXGA 1D6EA 5HYQA 3G6JF 1PKOA 1OW0A 1T4KB 4WHTB 1RJZB 3BUYA 3I3DA 4TNVF 3DV6B 5JIHA 1TVDA 5F1KC 5IJKC 5JDSA 4M1DL 4JM2C 4QCIA 4LSRH 4XMLH 3KPSD 3IFNL 1MWAB 4H1LG 1CLZL 2XXMB 1P7QA 3UDWC 4PRAA 5D70H 3VFUB 2PO6B 4WU5B 3BVNB 2VQ1A 1A6VL 1OP5K 1NEZG 1ZVHA 5B4MC 1KBGL 4NO0D 1KCSL 1I7ZB 4OCRL 4R4NC 1VFMA 1A6WL 3D5OF 4HXBH 4X5XA 4ZUVA 3RWIA 1P7KA 4K94C 2OS7A 1IEAB 1RHHA 3UPRB 4PLJD 4DFHA 4GMTL 3E3QC 1X9QA 4O02H 3U2SA 4TNWF 5EU5A 1SBSL 3WFEH 3RZCA 5F9WC 4OLUH 1I7RA 1U92A 2FX7H 4HMCA 4RRPG 5DHVH 4CMHB 5I1EH 1FRGL 4AMKL 1YPZA 3O3BB 4X6CA 2VDOH 4P5KA 3SKJH 3C9NA 4CRPA 3DX7A 3BGAA 4P5TA 3D0VA 2HG5A 1U3ZA 5TQ2L 4OCWL 4F58H 3TPUA 4NNXB 1KEGH 2XTJB 3VWJA 1M7DA 4NN5B 1YPZE 4X6CE 1CDBA 5D1ZA 3T2OA 3LD8B 4KPHL 2J6EA 5CIPB 4Y5VA 5IMLA 2DMKA 4P23D 4J8RA 5DK0B 4X0KA 1F58L 2BNUA 1MHCB 5E4EB 3VDBA 2UY7A 5H35B 4NQDD 3DYOA 2MOVA 4I9WD 1OAYL 4UOW1 1LEKB 2Y5TA 4LSRL 1ZLUK 1JGDB 4XMLL 2Z93A 3DO7A 3TZVC 3WDHA 5KVDL 3ARFD 4I3SL 3QDHA 3RBGA 3A6OA 3EJZD 3KJ4B 2CKBH 3REVB 5FGRA 5DMKA 1QBLL 3HA0A 1KLFA 4PJ9A 2EH7L 5E99H 1CFNA 3HMXA 4OV6F 5EU3A 3WFBH 1NUNB 2EDDA 5DMIH 1OSZA 2YBRA 1V7NH 1EV2E 4K3EH 4K3JH 4OIIL 1OTSD 4K55A 4TN9A 5DVMA 2H2PD 3PGCB 5T33H 3RGVC 1XF1A 1JNJA 3QWOB 3OZ9H 5DQ9B 1N8ZB 4O02L 1AD9B 4WDIA 4V2BA 4OI8A 3B2UD 3U0TB 3BPCB 3HN3A 3EDJA 4LSQH 4Y2DD 1AC0A 1EHNA 1FP5A 1QUNA 3REWA 4U1KB 4CVXA 4RFOH 5FDYA 1P9MA 3SKJL 3MRPA 4N8VB 1OLLA 1OVZA 1UYWL 3UBXA 3I02B 4KHXH 3MLVL 3VFVB 4GAYA 4F58L 4UI2A 1AGFA 1QLFA 1ZHNB 4JPIB 4MS8D 3GB7B 2VTFA 5KVFH 4JFXB 3PJSB 3VRIA 3JV5A 3L6FB 4MLIA 3I75B 1TETL 4NDMA 5BV7L 3C8KB 3WFDH 1N0LA 4MHHI 1FSKC 5CJBA 2PN5A 4M62H 3AXLA 2O93L 4H20L 1FLRH 5HJ3B 6FABL 4NRXA 5DUBA 1MVUB 5KSAC 5D6CB 1IL1A 3CFEB 3E6HB 2XWJB 4U33A 2CKBL 2EDYA 2XQBL 4CADB 4FXGB 5HYQB 3F7PC 1P5VA 5E99L 2ZUQC 1WZMA 4N5EC 3BUYB 5F88A 3QDMD 3F6IA 3VMPA 5LAXA 1A02N 1DQQA 5JDSB 5FM5O 4QCIB 4K3EL 4K3JL 4O51A 3LN9A 1QSED 1HHJA 1NLDL 3ILPA 4WI7A 5T33L 1P7QB 3HI6H 4GO6B 2E9IA 4PRAB 5CJOH 3OZ9L 5DUMH 4X8JA 2VQ1B 4NOBA 4HIXH 1R3JA 3P30H 4LSQL 1TDQA 3DOSA 3HNSL 5KS9A 4RFOL 1C1EL 4XVUD 3QG7L 5C08D 2ITCA 5L8KB 5J1TC 4F7MB 3IYLW 4ZUVB 3RWIB 1P7KB 2OCFD 5CEYA 1H15B 1CVSC 2Z0BA 4E42A 1RHHB 2X1OA 2DTML 3TWCH 4EI5A 1KFAL 3U2SB 3RZCB 5EU5B 1OGAA 1UM5L 4XWOD 1NUFA 1U92B 2BK8A 3MREB 2FEDD 4R7DB 1A1OA 5KS9E 4AL8H 1YPZB 4X6CB 5IQ9B 4JO3L 4KVCL 2P24A 3C9NB 5L7XH 3HMWH 2KQMA 2VERN 1FZJA 3OV6A 3WFDL 4P5TB 3D69A 4P9HH 3S96A 4D9QD 3V95A 3T0XA 2W9EH 2HG5B 3MCLL 3WHE0 2AV7A 3V79C 3ULUE 1OGAE 1FLRL 4M6OH 3TBTA 1MELA 3VWJB 2ZCLL 1UH3A 3QEQD 1BHGA 2Z35A 3NFSH 5I0DA 3MLXL 2G60L 2DJSA 2IG2H 4G7VL 1BQHG 1D5ZB 5ACZA 4Y5VB 4NUGH 3D9AH 4G7YH 3J7HA 3SE4C 3HE6D 5HDBF 3HTLX 4J8RB 1CLYH 4X0KB 2BNUB 3CX5J 4NPYA 3T0ED 4MAYD 2XZQL 4Q0XH 2Y5TB 2NW3A 2VLKA 2CDFA 3MRCA 2Z93B 1TQCC 1ZHKA 3L5WA 5IVXF 1JPTH 3V0WH 2VDLH 5CJOL 5DUML 5DMKB 3IAPA 3GIZH 3B43A 2K3TA 4PJ9B 4I4WA 4W6YB 5EU3B 4JG0H 4PJDA 1OSZB 4Y4KB 2YBRB 1RHFA 2OM5A 2VLKE 4P4RA 5EB9A 5CWSA 4PJFF 2RBLA 4CGTA 4CU7A 4LL9A 5CKAA 1NCAL 1V8HA 3BD3A 4KVNL 4XWGH 1FVCA 5IJVA 5H94A 4NZJA 4WDIB 5DF0A 4PJDE 3WV0A 4WW1A 2ZG2A 3REWB 4AL8L 4CVXB 4AIZA 2UVEA 2OZ4H 1I9EA 5L7XL 4HK0B 3MRPB 4TVSa 3BX7C 4I3RH 4OKVB 1IGCH 4PREA 4J3OC 3JBG7 4Y5YB 1EVTC 5ALBH 4EDWH 2V7HA 4V2CB 4GAYB 5TH2A 5GSVB 4E41A 1HNGA 3JV4A 1AGFB 4OFVA 3U36A 1QLFB 4U1HA 2NY1C 2EDHA 4C83A 2WSKA 2NY4C 4R97B 3V5HA 2G5RA 1FIEA 3H7BB 2D31A 3VRIB 1M4KA 2K9UA 3D9AL 1R3LA 3GSNB 3MYZA 1U3YA 2W9LA 4NDMB 4QRRA 4QWWD 3QYCA 5HVWA 4KZDH 3LQMA 1CLYL 2NY5L 4QHNA 3F62A 2YUXA 4DGVH 4X7TA 3MRRB 4E41E 2UWEF 3FQTA 3QO0A 3PXJA 4LAQH 1DLHA 1WISA 3C5ZD 1C7SA 5C86A 1UB5B 2X1PA 3RWHB 1BJ1J 4KJQD 4NRXB 4DJMA 5DUBB 3DUHA 3ZE1E 2R9HD 4KC3B 3PP3K 1IL1B 4S1RH 3SHSA 5GS2D 4JFFA 4QRRE 2YHGA 3FB7A 3WUWG 3GIZL 1U3HA 3CGTA 3FN9A 1DFBH 3B9KA 4X5WA 5I1CH 1L4IA 4HZLB 4JG0L 5F88B 4HKZA 3JSSA 4LSSL 1DQQB 1KJ2L 4PYGA 1U2CA 4ONGL 5E5RB 5MHSE 3L5JA 1FDLH 2FL5A 1HHJB 3KG5A 3E8UL 4CDHA 3ILPB 4JFFE 3U4EA 2YKLH 1OP3K 3RVXC 3W5NA 2H8PA 2B0SH 1F42A 4X8JB 1YNKH 4P23C 3OXRB 5JZ7D 4QOKA 1R3JB 4HJGA 5HHOD 5AYUH 1K5NB 4JFDA 2IBZY 4JO4L 1BZ7A 5KS9B 1GC1C 2OZ4L 3LKSA 2ITCB 4OFPA 3ZTJG 1NCBH 3ARFC 5DD5L 5CEYB 1YEHL 5ALBL 4EDWL 3QUZA 1RUMH 2WP3O 4ZO6A 3EJZC 1UJTA 5ID0A 1JI2A 3MQIA 4EI5B 1P53A 5D96B 3DV4A 1OGAB 4X98A 4QOKE 5F7KC 4XCCL 4BFGA 4JFDE 3INUH 1A1OB 2EEBA 3I3BA 4R0LA 4DZBA 5T3ZH 3FO1A 5I1DA 3D69B 4OZFH 3S96B 4DGVL 5GRZA 3MRIA 4PJ5D 1MFAH 1NFIA 4ZXBD 2VWEC 2AV7B 4G9DA 5HGAA 3MTRA 2EKSA 4IRSD 2P5ED 3P9MA 1KCVL 3B2UC 4Y16A 1NCWL 3TBTB 4JHWL 5TDOA 4HWBH 2DWEA 2Z35B 4GJTB 3ZLQC 1U41A 3JWNC 3OBAA 4LCIL 5ACZB 4U6VL 1V7MH 1SEQL 2Q87A 1N0XH 5E1AB 2OI9C 1SYVA 4NPYB 2DS4A 3Q5OA 3IDMA 5FAAA 4MNQA 2JIXA 1WCBA 2A6IA 4RAHA 1IC4L 4ZOEA 5EORH 2NW3B 2VLKB 2CDFB 3MRCB 1YYMH 3R8BB 1D5BB 1CQKA 1ZHKB 3L5WB 5HHVL 3GMQA 1K3IA 2QR0A 1HINH 4I4WB 4XNQB 1OL0A 1S7QA 4MNQE 4M8QA 4PJDB 3OMZA 1NC4A 1ZLSH 1BGXH 4F3FA 2MQ0A 4JG1H 4P4RB 3QUKA 4LSDA 5F9JB 3WHXB 5IW6A 1NCBL 1PFCA 4Z0XB 1FE8H 3JWDL 4LCUB 1ZXQA 4HKXA 1QA9A 2X1WL 2NCMA 1RUPH 4QGTA 4J4PC 5L8LB 1FVCB 5L9DH 3VXPA 5I19H 4Z77A 5IJVB 3TFKD 2GAZA 2C3VA 4HUWA 4MCYB 1ZLWK 5GZND 1URLA 3HHRB 5DGRA 4OF7A 1HILA 1O7SA 4AIZB 1LILA 1CXFA 4MNGA 5T3ZL 4PREB 2BZDA 2E8ZA 4GRLD 3TNNA 1A7PH 4F7TA 2V7HB 2NXYD 1EIBA 4GOSA 4EJ1C 3OB8A 5TH2B 1QHOA 4E41B 1CICD 3CSYA 3JV4B 3U36B 4U1HB 4WU7A 2R0KH 4OLVL 4HWBL 3NVQA 4C83B 1P7HL 3TCXA 3GI8H 3V5HB 3SCMC 4ONOA 2D31B 4MNGE 3MODH 2AJVL 4QRRB 2EDRA 3T1WA 1N0XL 3C6LC 3LHPL 4QHNB 2OLDA 4X7TB 1OCWH 3ZO0A 5T3ZD 4JY6A 3M8OH 3FQTB 3QO0B 4NIKB 1SBBA 4D9LH 5EORL 1JMXA 5BVPH 3GBNH 3D85D 3CFBA 2FEDC 4WTZA 7FABH 3IFLH 3SDDA 1YMMA 4UDUA 4JFFB 3TYGL 5FYJE 4FS0A 5AEAA 4AY0A 1U3HB 2F54D 4X5WB 3B9KB 1JP5A 3O6FC 4NFBA 1MCHA 3FO0H 1YA5A 1BGXL 2OBGA 3FMGL 3CDGA 1WFUA 1MFDL 2FL5B 1YJDH 3BD5A 4F9LA 4YEEA 4XPGH 3QIWC 3CFJB 1VGEH 3U4EB 1GGCH 2VAAA 5EIVA 1JPGA 5L9DL 4D0BB 1WF5A 3VXMD 5IBTH 3C6SA 1F4WH 1YEGL 3EAKA 4N0UA 1OAXL 3D39D 5EOTA 2AQ2A 4QOKB 4HJGB 4JFDB 3T0EC 3SEPA 4MAYC 4AIOA 1BZ7B 4AIXA 2I5YH 2P8MA 1NC2D 5DDHB 2DDQH 4G6JL 1BZQK 3ARBC 1UACH 2Z31C 4Q6IB 3A67H 5ID0B 1YPZF 2D0HA 1QRNA 3MNZA 4N0UE 3ZHDA 4X98B 1I7UA 3P11H 2R0KL 1ZK9A 3PHQA 4KU1A 1L6XA 3RVUC 2EYRB 3Q2CA 2GIYA 2OMBA 3FOMB 1U8NA 3MODL 1YECH 4IHOA 1IGIH 2JTDA 4DZBB 3O11A 5I1DB 2AEQH 3MRIB 1W2KT 1NFIB 1C08A 4J7RA 4G9DB 4FQCH 2EKSB 5FKPA 4QYOA 4D9LL 5KTEL 1BD2A 2VN4A 4Y16B 5F1NA 1TTGA 3GBNL 4O2FB 5D7IA 3MR9A 1D5XA 3SDAB 5GRUH 4XPFH 3ZHLA 4OB5H 1OAZL 4IRZL 3GMRA 5IWLA 1TZGL 1FFQA 2YK1L 3Q48A 3EJYD 5LGKA 1SYVB 1PBYA 5SV4A 1D7FA 2JIXB 2BRRH 1A4KA 1BD2E 4ZTOL 1UM6H 4QXTA 5D7IE 1YJDL 2R0WH 2DQUH 4XPGL 3BW9A 4AEHH 1C5DA 3GMQB 3DSFL 1VGEL 1GGCL 4WGWB 4J12A 2QR0B 2A6JA 1CFQB 4KMTH 1F4WL 2XA8L 5EO1A 1S7QB 2VB5A 4XNXH 4AT6A 4ZOBA 4IOIB 4WTWA 5IMOB 5D6DC 1NC4B 3C60D 3G6AA 1OPGH 4P9HC 4F3FB 3HC3H 3QUKB 4KJQC 4QTIH 5IW6B 2DDQL 2E7BA 4HUXA 1WFNA 3EIFA 2HTKD 5HHPB 1DBJL 3A67L 4HKXB 4XP4H 5I1LA 1U93B 3VXPB 2LAAA 2XICA 4ZS7H 1UT9A 2GAZB 2C3VB 3QXWA 3FT4A 5LGJA 3EO1A 4Z7VF 1JHTA 3GI9H 4MA7L 3TBSA 4LLWA 1YECL 4M7ZC 1IVLA 3IU3A 4MJ6A 2I9LA 4MNGB 5DFTA 1AGDA 2DM2A 3BYTA 3TNNB 4F7TB 3BDYH 1XGPA 1Z9SA 4QRUA 3CFDA 2OJZH 2W9DL 4WU7B 4RFNB 2CKNA 2X4OA 5GRUL 4XPFL 1UXSB 5TQ0H 3ZL4H 2H2SC 3VFGH 5TF1H 4ZPVA 5EZLA 1G1YA 3CFKB 3ISWA 3OKOA 3D0LB 3KDMA 1AI1H 3HRPA 5MEPA 2IAMA 2DLIA 3CFBB 4XVTH 4P59L 4DZ8A 2A73A 4UDUB 1S7SA 5SWZA 3UPAA 4I0CC 1OQOA 5F1SA 4GW5A 1P4BH 3ZDZE 1QSFD 4JDVB 3CDGB 3A0OA 1VSCA 3CXHK 5IVZA 5D8JH 3BO8B 3FHQA 5E8DH 2D7QA 4IIQA 1FYTA 4XP4L 3TO4A 1JPGB 1KYOJ 4YDIL 4ZS7L 3C6SB 2W0FA 4N0UB 5EOTB 3DIFA 3D18A 1DBMH 5DFVD 5C6WH 1F02I 1FBIL 2CRYA 5E6ID 4LAJH 4FQ2L 1EAPA 2P8MB 1FFOA 5D1XD 5K9QI 3LKNA 1FYTE 3FFDB 4X6FA 1JK8A 4JFQA 1XCQA 2HT3C 1UKSA 1WIUA 5EULV 5I73C 2PXYD 5IB4A 1SVZA 5EBWB 1TITA 2FX9H 3B5GA 4NP4H 1BEYH 4IHOB 1U8NB 5TQ0L 3ZL4L 5EUOE 3VFGL 5TF1L 5MP6L 2JF1A 1JPSL 3B9EA 4X6EA 1LO2L 1Y6NR 1T2XA 3QWQB 5FYKU 3OB0H 5FKPB 2R69L 5C8JA 3SDXA 1BD2B 3OTTA 1AI1L 5F1NB 3F58H 4JCMA 4V1DD 4PGEA 4XVTL 5D7IB 5ETUA 3MR9B 1D5XB 4L3ED 3AGVA 5DURD 4NKMA 5SX5K 2NXZB 3AM8C 5FV1L 3GMRB 1WEJH 3FAWA 2QADD 3T1FA 2NXYC 4PP2A 1P4BL 1ZEAL 1A4KB 3GRWL 3T8XA 3SDXE 4OF0A 1A7BA 4LASL 5L6YH 1T0MA 3SE3C 1H3PH 5I76A 3H0TB 3H9SD 5FFLA 1F90H 2ED7A 4PJDF 3MBEA 5I2IA 3FFCE 2VDMH 2A6JB 3BP4A 5EO1B 2P1YA 1XCTA 2Q86A 4KKLD 3MJGX 5EH1A 5A2FA 1OF2B 1RK1B 3HAEA 1KB5A 4KKCD 3PWPD 3BKML 3BXNA 4HUXB 2F5BH 3BWAA 3VRLE 5BW7A 3H3PH 5I1LB 2XTLA 1WFOA 3FRPG 2RR3A 3RUGA 2Y36L 3FT4B 5LGJB 1BVZA 5AUMA 4U7KA 5SX4H 1SQ2N 3VGAC 1JHTB 4R26L 1L0QA 1G1CA 4XCYA 3KYOB 2VXSL 4D0DA 2FX9L 1CXHA 4LLWB 1BEYL 1M6OA 4UZGA 4MJ6B 4LVOB 2I9LB 1AGDB 3I84A 5DQDH 1G9ML 2DL2A 2NY0D 4RGNE 4JDZA 4YJZL 1XGPB 2DRUA 4QRUB 2VABA 4NN7B 3RUGE 3CFDB 2AJSH 4KKBD 5J0BA 2ICCA 2Z8WC 4WO4A 4D0CA 4OGXH 1J11A 1J86A 3F58L 5AAWA 2I24N 3WIFA 4LP5A 4L8BA 4TVPH 2X4OB 1ACYH 1ZWIA 2VRAA 2WP3T 1OP5H 2LU7A 5DFWH 5GGSA 3VH8A 5KJRH 3OKOB 2F15A 3BP7A 3SO3C 5L0QC 3KDMB 4NO2A 4OJFH 1Q38A 3IF1A 3DUSA 1WZKA 3BN9D 4R90H 5J89A 1S78C 3NZ8A 1QVOB 2IAMB 1H5BA 2DLEA 1H3PL 4DZ8B 5C0BD 2ATPB 4U0RC 1F90L 1IMHC 1S7SB 1CD9B 3HE7D 3NFPA 5B39A 2VDML 4K23H 4WV1C 4P46D 4GW5B 3MBXH 4QGYA 1CFTB 1F6AA 1G0YR 3MV8A 4LPYA 4RGMB 4HMDA 3PQYA 4YFDB 3U4AA 4JEGB 1ITCA 5IVZB 3MUHL 5E8PB 1FYTB 1VEMA 1CBVH 3TO4B 1TLKA 1X5XA 4PJXF 4GFTB 4HBQA 2YRPA 1SEBA 4EN3A 5HYEA 2W0FB 1T2QL 3MYJA 3D18B 2ORBH 1TJIH 1JZ5A 3MV8E 1UKQA 3PQYE 1EAPB 1PY9A 1FL3B 4XMPH 5EUOB 2Y5EA 5ACLA 4WI9A 5DQDL 4LLUA 2RGSA 3M45A 4HKBA 4YPJA 4X6FB 1JK8B 4U6YA 2N4IA 4EEEA 5FKAA 4GRWH 4JFQB 4XP6H 2AJSL 1ZLUH 1XCQB 1CDGA 4JFED 4LBEB 4OGXL 5FHAH 2R1WA 5LQBL 3MV7E 3RL2A 5J1AA 5C7XH 5JW4Q 1ACYL 3H42L 2VNCA 4H8WH 4JVPA 1IGFL 3BQUD 2X89D 3PDDA 4X6EB 2XFXA 5FHBL 5KJRL 1IZKA 8FABB 5E7BA 4WFHD 1IM9D 1FZMA 2X4PB 3FJTA 1YJDC 3IAGC 2AVGA 1B6UA 1KLGA 3UEZA 2EIBA 4R90L 3SDXB 5HGBA 3EOYG 1HHHA 4PGEB 3WO3B 5ETUB 4ZUWA 3MFGB 1VFAA 4QHKJ 5I15H 3JWOH 4PBVC 3FFCB 3OJDA 2FGWH 4NHUA 3T1FB 4PP2B 1A9EB 1A7OH 1EJOH 3T8XB 4U1NA 3ARGD 3TT1H 3RHWF 5ADPH 5D7LA 3TN0B 3VWKC 5BS0D 3GHBL 5CEZH 3JV6A 1L7IH 1T0MB 1I8LA 4KDWA 3BAEH 2GEEA 5DJDA 5I76B 3N0PB 3WKML 2HT2C 1CBVL 3MBEB 5I2IB 1JTTA 5DI8A 3BP4B 4JFYA 4X4ZA 5JPMA 4LKCA 3MA7A 1FO0H 5CGYD 3TM6A 1TJIL 1XCTB 4DCQA 3O8XB 2D7TL 2I26N 5D7LE 5DXWA 3HAEB 1CLOL 1J0HA 1KB5B 3QWRA 2XWBA 4MD4A 4PJAA 4XMPL 3TEUA 3X17A 9CGTA 3BXNB 5CUSL 4P2RD 1KCKA 1RIVH 2YXMA 3BWAB 4RGNB 3TF7C 2DQIH 2IH1B 1MCWM 4XP6L 5BO1H 2XNAB 3RUGB 5FIEA 5IVNA 1G6RH 3X11A 5AUMB 5FUOL 2O5ZH 5EWIH 3IDJA 4XCYB 5GGQH 3TH4T 5C7XL 4PJAE 1M6OB 1T21A 5HHQA 4H8WL 2V6HA 3L3OA 5I1IH 4G8EB 4YNYA 1PVHA 4U0QB 4JDZB 4YHKH 1J8HE 5T5NF 2VABB 3R0MA 5IB5A 1G7JA 1I9JH 2WBJC 4ZUSA 1MJ7H 4NCC2 1JGUL 5FF6B 2XZAH 4D0CB 4OZHA 1EO5A 3WIFB 3MNVA 4L8BB 1OAUH 2WLZA 5A40E 4K71C 5E6IC 5HHMD 2HLAB 4CMMB 4Z7OF 12E8H 1ZWIB 4YR6A 2AEIT 2VXTL 2FGWL 4YIQA 5GGSB 4NQUA 1UH2A 5ELIA 4M48H 3MX0A 1A7OL 3BP7B 1EJOL 5IB1A 3TT1L 5IGXH 4OZHE 3DUSB 5DZOA 1B4JL 2YPLB 3NZ8B 3S37L 1U8MB 4ZAKC 1MWAL 4XRCA 2BOBB 3NFPB 5B39B 4K7FA 1X5JA 4M93C 3RWJB 1DLFL 2DQHL 4JRWA 1RAMA 4C4KO 5I66A 3MV8B 4PLOB 2BFVH 4G6FD 1E4WL 1I8KA 1B2WL 2HFGH 3PQYB 2W60A 4MZ2A 1MSPA 3MLRH 4CJ1A 2YRLA 3WJLA 3GMOA 4UUJA 4FQQA 1SJXA 1DVFC 2DQIL 1SEBB 3CMOL 4LHUD 5BO1L 3EFDH 3K8LA 2QADC 3BMVA 3MYJB 1NLBH 4X7DC 2PTUA 4NJAL 4Y7MA 2RAMA 1U8QA 2PO6D 3O3UN 3MV7B 1NAMA 4FQHA 3QNYA 2Q7NA 4F2MA 5LWYL 5HY9B 5GISH 1I7TA 4LLUB 4X83A 4HKBB 5JXEC 2WUBH 4U6YB 1ED3A 3G5ZA 1I85C 3KS0J 5FKAB 4WW2A 1I9JL 4Y5XC 4KUZH 1QKZH 2A0LD 3QI9B 2XZAL 4ODWA 5K93A 4XC3L 2F8VA 3V6OA 4LDOB 4LPXA 2R1WB 3LRSA 3RL2B 5J1AB 1YNTA 3MRGA 4KKLC 4WEMB 3O6KH 4XHJC 3EHBD 4PV9A 1WC7A 2EDEA 1W72A 3GFUA 5CJXA 1RU9H 2BMKB 2E6QA 2BHYA 1IAMA 2XFXB 5GGVL 1KPRA 2FWOA 1WUNT 3CVHA 5AZEL 3U82B 4M48L 1EMTH 4PGZA 2D2OA 1KENL 3V6OE 1G7PA 3DYMA 5HGBB 4YDKH 4UAOC 4AEFA 1HHHB 2BSSA 32C2A 4ZUWB 3QNZA 5EC2B 3F5WA 1IC5H 3LKQA 3LN5A 2ADFH 4IMLA 3FT2A 2XTJD 1KUMA 4MA8H 1DEEA 4XTRC 4H1LA 1HSBA 3I9GH 4MA1B 4MX7A 1DUYA 4NHUB 3OQ3B 3Q1SL 1NEZA 4JR9L 5DT1L 3B3IA 2HFGL 1TXKA 4KZEH 1RIHL 2XN9A 2NY3B 3D25A 4L8DB 1KCLA 1J1OH 1CD0A 1RZFL 1QRKA 3VD7A 1F8TH 5DI8B 5CSGA 4LDEB 1A64A 4JFYB 3NIFE 5JPMB 2JB6A 4LKCB 3MA7B 3O4OC 4MWFB 5LXGL 2KL6A 4DCQB 2CJUH 4YXLL 5GRJH 1QBAA 1T66D 3BN9C 2XWBB 5GISL 1W0YT 2B5IB 2XN9E 4NFDA 3ZKXB 3IKKA 3V8OA 3SY0A 2WUBL 1UCBL 1U8PA 3C2SA 5E9DA 1J8HB 2PCPB 3F8UB 4GBXA 1CF8H 3SKMB 4YE4H 3NGBC 4LCCC 3IDIA 4HPOL 3IDJB 3PP3H 3VFPA 1T21B 2ZUXA 5DHXB 5HHQB 1RIUH 4RX4D 1FPTH 3L3OB 2V5YA 1KXTB 4LSUH 2QQNH 4OI9A 4YNYB 1D9KC 1T1YA 1A8JH 5HI5C 3OKMA 1G7JB 3CIQA 4ZUSB 4F57H 3TA3C 3QUMH 3OAUH 4YDKL 1T7YA 4NQCD 4EUPA 4OZHB 2YMXL 5A2KH 3MNVB 1TMCB 1FVDA 4OM1H 4CBPA 2ADFL 4OD2A 1T1WB 2WNGA 5JUEH 1S3KH 5F21B 2J6EH 4MA8L 2G2RA 2BSRB 4JVUA 4YIQB 1J1PL 3IJSA 1MNUH 3VXTA 1JGLL 4JM4L 3EDKA 3X14A 5JLZA 1F2QA 2JJTC 1F8TL 3MLYL 4XRCB 2EO1A 2OXGA 4K7FB 3FAXA 3S34H 5JOEA 1S7UA 2AERT 3QQ3A 4MJ5A 3ABZA 2FJHA 2E9BA 1I8KB 1TZHB 3D2UA 1MHHA 4LVNC 2W60B 4HUVA 5JORB 3U4BH 3RI5K 4WFEE 2D0FA 2NR6C 1J0KA 2HN7B 3GMOB 4KY1H 4ONFL 4FQQB 4OCSH 2D3VA 4TSBL 4WWID 1X5IA 4GQ9H 4POYA 1CF8L 4M6MH 5EUOF 3EDDA 2MHAA 5JMRA 1NL0L 1U8QB 3GSXA 2QSVA 2ED9A 4PJIA 1U91A 3LPFA 1NAMB 3OKYA 4FQHB 3QNYB 4MQSB 4BK4A 4F2MB 1FPTL 3DARA 1LEGA 4CN6A 2QQNL 3QEGH 5GGTA 4M5ZL 3SN6N 3G5ZB 3K74B 4WW2B 4F57L 4KQ4L 2YEZA 3OAUL 1ZA6A 1VEOA 4ODWB 1T1XA 3BEWB 4FFYL 5CGYC 1NCDH 4PJIE 4FQXA 4OM1L 1YNTB 3MRGB 5GHWH 3VG9B 3RZCD 5JUEL 2OR8A 5ICXB 1ACZA 4PV9B 2J6EL 2PNDA 2X4QB 1W72B 3SDXF 1N64L 1KCUH 1XZ0A 3ARUA 1ZANH 2FWOB 3CVHB 4HD9A 3DGCR 2HH0H 1PLGL 1EO8H 4P5TD 1G7PB 1H3XA 3RAJH 5JIIA 3MLZH 5E08H 4X7SH 2BSSB 2YD4A 4G43A 32C2B 3GKWH 3F5WB 3LN5B 3LKQB 3FT2B 1H3UA 1YYLH 4U1GB 3VWJD 1DEEB 1ZLWH 1HSBB 5DA4A 2H9GA 4MX7B 5D1ZD 5C71A 4W6XB 2VSCA 1DUYB 3C8HA 2ZPKH 4MXVF 4XZUA 1NEZB 3VRLF 4GKNB 5D1QC 4JQIH 4F15C 2XN9B 3D25B 3U4BL 3UTOA 4KY1L 4KK9C 4FQLL 4OCSL 1YY9C 5CP7A 3N1FC 3G5YA 1VEPA 3QH3B 4GQ9L 4Q9BA 2LQRA 2CLRA 2JB6B 4N1EA 5DEGA 4H8WC 1HHKA 5HBBA 4U05A 4PJ9D 2OMNA 3KVQA 2EEDA 2C3HA 1Q0YH 1MEXL 1J18A 4R2GC 3SY0B 3W9DA 5IFAH 4NZUL 4ZPTA 2J5LB 4L4VA 4MJ4A 1U8PB 3NOIA 4X8XA 5DK3A 4J1UA 1WITA 2JCCA 4GBXB 1NCUA 1HQ4A 3GM0A 2EDNA 1F3DH 4WFFE 3JWOC 3IDIB 4KRLB 4XBPA 5ESQA 5F7MC 1NBVH 5GHWL 4UV4H 5F97E 3V5KB 3VFPB 3BRGC 3DETC 3RVWD 3SGEI 5ESAA 3IFOA 4L4VE 1KCUL 1T1YB 3VJ6A 1T0NB 1EEZA 1NQBA 3BOVA 2HH0L 2JCCE 1EO8L 1INDH 3OKMB 3VMOA 4EUPB 4QRPB 1N6VA 4QRTA 4HLJA 3MLZL 3GGWA 1YN7B 1B0GA 1FVDB 4IRJA 4JJ5A 5CEXA 1QFWM 1AXIB 3GKWL 4C55A 2FNBA 4OD2B 1FYHB 1KJMA 3CNKA 2G2RB 3F7VA 3FQNA 1DL7H 3LS5H 3IJSB 1BFVH 3VXTB 4J3TA 4TTDC 3UJJH 3MJ9H 4Z6AT 4JQIL 1YQVH 3W2DH 4XVSL 1XF3A 2I27N 5JLZB 4NKIH 1KC5H 5C0AA 2WMPA 1ZT1A 1VFUA 1I3VA 2LABA 5HHNA 1BOGB 2OTUA 4WWKC 1S7UB 4NQSB 4PJ8A 5FB8A 3QQ3B 5E2JA 1HDMA 2FJHB 2HRLA 5TE7L 5IV2B 2W0KA 2AEPH 3D2UB 5KVEH 5B38G 1AH1A 4KK8D 4HUVB 3GNML 5JQHC 4S2SB 2HJKA 5FM8A 5C0AE 5IFAL 3ZYJA 4FMFA 4ZTPH 2MTPA 5E2VH 5EIQA 3KLHC 5FYKE 3ULUL 1HH6A 2BNQE 2MHAB 4APQA 3GSXB 5F7EL 1HXMA 1IGMH 4PJIB 4UV4L 1U91B 3UTSA 4G6KH 3BGFC 1LEGB 2IEPA 4CVZA 3T0VA 2GYSA 5I1GH 2R8SL 4I0PC 4N90E 1RZIA 1IQDA 5D72L 5FCUH 1PJ9A 1J1XL 4YHZL 2YEZB 2W92A 3GIVA 3QUXA 1T1XB 3IDXH 3R4DA 3UBXI 4EI5D 3UTSE 3ULUD 5I17A 4FFZH 1OGAD 4ORZC 2X4RA 4L9LA 4XVJL 5D5MA 1C16B 1E4KC 2IH3B 1DL7L 1XZ0B 1KB9J 4FHBD 4PRNA 2BJMH 3WUWA 5IHUH 1BFVL 4GQPH 5JMOC 3EGSB 4Q7DA 1KNOB 3UJJL 3MJ9L 4NN6C 1YQVL 1FNLA 3W2DL 4U6HA 2APTA 4G43B 4FQIH 4NKIL 1KC5L 4Z5RA 1GOHA 1J7VR 3FZUD 2XY2A 1AQDA 1T3FB 3VXOB 1CGVA 2HJFA 4LOUD 2X4NA 3MSPA 3FB8A 1XF2A 2H9GB 4BSWA 2PTTA 2YC1A 3QUYA 5F8QC 3QAZB 1AY1L 2Y07H 1X6LA 3OSKA 3L5IA 4L8SC 4LIQE 4RGOH 3MROB 5KVEL 1X4XA 4PG2C 4DEPC 4ZTPL 4FOMA 3MC0A 1TFHA 5I8OL 3E6FB 2VLKD 3PDGA 5CP7B 2C26A 2V5MA 3AREA 4GAJH 4HLZH 3G5YB 3MRHB 5E2VL 4M1CC 1RZ8B 1U58A 3KPPA 4P5MB 3RPKA 2CLRB 5DEGB 1HHKB 1FFPA 4XNZC 4YC2C 2V2XA 4G6KL 5FGCE 1JGVH 3W9DB 3N85H 2EDFA 4ZPTB 4L4VB 4C4KT 2M1KA 2JCCB 4LSVL 5FCUL 4QY8A 1KLUA 2CD0A 3QDGA 3IB4A 2QQKL 3IDXL 5ESQB 4UNTA 4BQ6A 4XBPB 1A6AA 1HCFX 3L3IA 5I1HH 3CLFH 3BKYL 4U1MB 1IILE 4ZSOB 1GPOH 2EZ0D 5ESAB 2Y72A 3TCLA 5IFHH 3NFNA 3PUCA 5ICYA 1QHPA 2AV1A 2F5AH 1DN0A 1EEZB 3RJQB 1QFWL 1U8HB 3PV6A 4O4YH 1S7XA 5CBAA 5I6XC 3QDGE 2VIRA 4QRTB 5DK2A 3GGWB 1B0GB 4IRJB 4JJ5B 4FQIL 1MLCA 4E41D 5CEXB 1WBXA 5FO9A 3FT3A 3DBXA 5I18H 3F7VB 3FQNB 3IJHB 1GL4B 3QEUB 1Z3GH 5FV2A 2CK0H 1Y0LA 1WICA 4OZFG 1RK0A 1CE1H 2VXUL 4QRRD 4DVRH 4UT7L 5T3XE 4RGOL 3V7AE 3TYFA 3QCUH 1AD0A 3QZWA 3RNKA 1S9YA 1XF3B 4Y4FA 5DGQA 3NPSC 5C0AB 1WT5C 5CCKL 4ODBD 1ZT1B 1HI6A 1DQLL 5CAYB 4W68A 1IEBA 3DROA 5HHNB 2ERJC 3MLSL 3VFMB 5C07A 2OTUB 3O6MH 1HN1A 3BDXA 4PJ8B 2BNQB 4JFFD 5F9OH 4HV8B 1U3HD 2APVA 3B9KD 3HB3C 3QR2A 2DBLH 4DQOH 5BVJA 4FFVD 3DI2B 2HJKB 1JGVL 1KYOK 3N85L 3K46A 2Q3AA 2A77L 2V9TA 3U0PA 4WHDA 4HPYH 4LEXH 5C07E 4R4FH 1RZJH 3HUJA 1HH6B 5D1ZC 4YO0B 4APQB 1KF9B 1I1YA 1HXMB 5I1HL 4EQ2A 5SX5H 3UTSB 3O6LH 1DBAH 4WW2F 3BJLA 4QOKD 2X09A 5IFHL 4JFDD 4CVZB 2O5XL 2X5PA 5EC1A 2F5AL 4PP1C 5ECJE 1QTYT 2HA1A 3VXNB 1RZIB 3MXWL 1K9TA 1IQDB 2VKWA 4O4YL 4K3DH 1G6VK 3GIVB 3HC4L 3QUXB 5DJAA 2GKIA 3QUZD 1JYWA 3O2WL 1XR9A 3U30C 3VG0H 4X9FA 5LCVH 5I17B 5T1KA 3AUVA 4L9LB 5I18L 2YUWA 1Q94A 3MLTA 2G75B 5JW3L 5MENA 3MLUH 5DD0L 4P2QA 5KSUB 3BESR 3CD4A 4NHCH 1AKJA 5TPWH 4ODVL 4U6HB 4Z5RB 1FHGA 1QFWI 3PGFL 2V17H 1XGTA 1AQDB 4Y16D 3RVWC 2WINA 1X5YA 1VFOA 3ZKQD 2H26B 3PHSA 1MRCH 1ONQA 3FB8B 1XF2B 3O6ML 5I1KL 2LAGB 4BSWB 2ENSA 2CXGA 5MENE 2PTTB 1P9MC 4HWUA 1K4CA 4P2QE 3QUYB 5AZ2H 3ROOA 2AXFA 2I07B 3EYQD 3KHOA 4MNQD 5FGCB 2JIXD 1X5HA 1IQWL 5C0NC 4KK5D 2R0LL 2O5YH 2BVOA 1YEIH 3O0RL 4R4FL 3S37X 1U58B 3KPPB 4NZRH 3HZKB 3ZKMD 4J3UA 3MV9A 2DLTA 2FATH 3ULVF 1IT9H 3WLWC 4YX2L 2R56H 5MI0C 4EOWL 2PYEE 2V2XB 1MOEA 3WNOA 3U9PH 3E1F1 4F7PA 1NC4D 1KT2A 2VE6A 2AI0L 1R3IH 3ZE2F 1I1FA 3C2AH 3MV9E 3QDGB 3GMLA 2HMID 4YLQT 4BFBD 4WHCA 5AD0A 5LCVL 5FUCC 3IS1X 5IF0A 4QO1A 1CDHA 1OD9A 5FYJL 3ZT7A 2DWDA 1CR9H 5ICYB 4S11A 3UJIL 1DN0B 4HT1H 3PV6B 3W82A 5CBAB 4NHCL 2V5RA 5TPWL 2VIRB 2A6KB 2WWMD 5DK2B 1JRHH 4UQ3A 2EDQA 3X13A 2GUOA 1WBXB 4K7PY 5GXBB 5JO5B 3L9RA 5D7SH 3FT3B 4KAQL 3DBXB 4L4JA 1MRCL 2C1OB 2NX5A 1WQVT 1QBML 1AQKH 2L7JA 3TNMA 2QQLH 1Y0LB 3ULVC 2EE2A 1RK0B 3BEVA 4GXVH 5HYJA 5IKCB 5FYJD 2P4AB 5EOQH 4NSKA 3LPWA 2X6MA 1CYGA 3TYFB 4UB0L 1AD0B 3WIHA 3QZWB 1R24B 1S9YB 2X40A 1J88A 4JREC 1U9KA 1HI6B 1YEIL 2NX5E 5BMFH 5GZOD 1MJUL 4JAMA 3WE6A 5C07B 3V4UL 5IHLB 3SDDD 1YMMD 3DMMC 3U79A 5HYJE 2IQAA 2IANA 2B2XH 1IT9L 2WIIA 2F19H 5CD5D 2R56L 3NCBB 3WN5A 2Q76A 2HT4D 5BVJB 1U42A 1CFVL 4CVUA 3SGKA 3HS0A 3BKJH 3O45A 4G8GE 2VLRA 3OKDA 3U0WL 3U0PB 4KI1A 3ALXA 4OBSA 4PJIF 4GG8A 4F9PA 4LSPL 5J12C 1MCDA 3C2AL 3RWFB 3P0VH 2IANE 3VXSA 4X80L 4F8TA 3ZYOA 1I1YB 3QIUB 4UIKH 1DBKL 3U9UB 2CR6A 4G5ZH 4YDLC 1EVUA 4XPTL 4HUNB 3P0YH 4X6DA 2V2WA 1VPOL 5EC1B 5KN5A 4JY4B 3T4YB 5C0JB 3SOBL 3FCTA 3UTZA 2VLRE 3DURA 4KXZI 2ZNWA 1I9IH 4HT1L 4KI5E 5FM4A 1AXSA 3CZJA 3VXSE 5DJAB 4CDGC 4FG6C 1XR9B 3NCEB 2VQTA 1QRND 3RJDA 2MFNA 5EO9A 5IROA 5D7SL 2YD7A 5ILTL 4X6DE 4LNRA 1ZVYA 4NC1E 3RNQA 1LQSR 3MLTB 5MENB 1I8MA 3QEHA 1A7QL 4P2QB 1EHLL 4WVRA 1BECA 1AKJB 5DJ0A 1G7QA 3A6CL 2J8HA 5T5NG 4PLNC 5D2NA 2ZJSH 1XGTB 2WQ8A 1BD2D 3QBTB 2H3NA 2EZ0C 5BMFL 3L3DB 5F7WC 4GKSA 3UYRH 2VR5A 3ZTNL 1K4CB 3PABA 2F19L 3ROOB 1H3WM 1N6QH 4PIRF 3LEVH 2AXFB 3UPCA 2PYEB 4M61A 2BDNL 4HFUL 4YHOL 5D2NE 3EYUH 2DKSA 3JUZA 3P0VL 2G9HA 4NNPH 5FK9A 3MV9B 4U1IA 4U1LA 1PYWA 4KQ3H 3QRGL 2BSTA 2JCCF 4U6XA 5E7FA 4POZD 3GHEH 1QQDA 1WGOA 2QL1A 1I9IL 1FG2A 3V4PH 2FR4A 1AC6A 1KT2B 2VE6B 4MD5A 5IJKA 1EEQA 1I1FB 3SDCC 1MHPH 4MCZA 3GMLB 4JM2A 4UBDC 4WNQA 1TPXB 4OQTA 1NMBH 4Z8FH 5IF0B 2IMNA 3RWDA 1E6OH 2NQCA 3UDWA 1H3VA 3WDIA 4ELMA 3KPOA 5EIIA 1VACB 2YN3A 1PW3A 4Q9CA 4UQ3B 1X5LA 2OK0H 3QIBC 3X13B 3MRKB 3HFMH 3NCMA 3WNNA 3FQRB 4XP1H 4OFDA 2ZJSL 4RAVA 1RZ7H 1ES0A 1JRHI 1MCNA 1RFDH 1P2CA 2NX5B 4JFOB 3TNMB 5GPRA 1F3JB 4ELME 4G9FA 2DYPA 5HYJB 3BEVB 5KSBA 3RWCB 1AE6H 3RDTC 4NSKB 2AJUH 3QUZC 1CU4L 3BPOC 4PS4L 3QDJA 3G6JA 5GRWA 4G8GB 4OGZA 2B1HL 2IAMD 5DHYB 5CLTA 4B53A 2PR4L 4JAMB 3WE6B 3E3QE 3O4LA 4G9FE 1O7VA 4KTEH 2IQAB 5KSBE 2IANB 4X9BA 5SWZD 2X10A 3GKZA 3P4OA 4R0LC 2ZCKH 4ODHH 2WIIB 1LP9A 1LK2A 3WN5B 3UJTL 4S1DD 2FYYA 4M7JH 3QDJE 5IT2L 3G6JE 4PGCA 2AP2A 3GHEL 1UQSA 3O45B 4GW4B 4Y4HC 3ZE0E 2VLRB 3LN4A 3VGGA 3OKDB 3O3DA 3P4MA 4GG8B 4IDLA 1KJVA 3OKLA 4S0TD 1MHPL 3KPNA 5IB3A 1FYTD 3VXSB 1GZQA 3TO4D 4U7SA 3KYKL 3FQWA 4FRWA 1LP9E 2VLLA 1L0YA 5GRVK 5FA3B 1N6UA 1UWGL 2C3GA 2V2WB 4X6DB 4X7FC 3ZSSA 3FCTB 3Q6FA 3UTZB 1EHAA 3DURB 2UUDK 4KK5C 4UV7H 5J7CC 3MUZ1 3UZEA 2OXHA 4HSQA 1AXSB 2DQJH 2J2ZA 1T2JA 5JOPE 3P0GB 3LQZA 4XP5L 3U46A 5KG9A 2UVFA 4ODSL 3HFML 2JK5B 1SM3L 1BF2A 4H0HB 5I71C 4P4KA 1DQDL 4LPCA 4LNRB 3RGVA 3RNQB 5IK3A 1L0XA 1S7TA 3QEHB 1I8MB 2R4SH 4WI5A 1KXQE 2M2DA 4LGRB 5DJ0B 1JIBA 5C2UB 1L7TH 1G7QB 1N3NA 4BH7A 3V9FA 2HRPH 2CDGA 2DQGL 4OLEA 1LO4H 2W0PA 4OLZH 1RZJC 3GSRA 2VR9A 2YPVL 3SJVE 2GT9B 2WM0A 3HI5H 1KCRH 5EFIB 1WBYB 1HYRC 4IDJL 3MZTA 2H3NB 4Z95H 3BIAX 3CUPA 5EBLA 4GKSB 1N7ML 3KPLA 4KTEL 1T5WA 5DC4B 3PABB 1D6VH 4Y19A 5F6IC 3RIAK 2E9WA 3IDNA 2B4CL 2MPAH 4XBGB 4M7JL 3U7YL 2IPTH 3N1GC 2UZIH 3TV3H 2A9MH 2DJUA 3QO1A 3AB0B 5DQJA 1H8SA 3I50H 4XC1H 1MCSA 4O9HL 4LLVA 1EFQA 2G9HB 5FK9B 3MBED 3QHZH 3W9EA 1PYWB 5BOPA 4NQTA 1A7NL 1DBBH 2EE6A 4Y19E 1IKNC 1K8IB 5H8DA 2NY6B 5KSAA 2BSTB 4HIEA 4U6XB 1J8KA 4DTGH 1U8LA 3BJ91 4GKOA 4YEFA 1QFOA 1QQDB 2YD6A 5I74C 4DGYH 5IP4A 1FG2B 1Z6JT 2FR4B 4MD5B 1WWWX 1Q72H 5DRZA 3HPJA 5GZOC 1F2XK 4H88H 4MCZB 4LHJB 5IESH 4RGND 3SDDC 4JM2B 1CXKA 1ITBB 5DJ6A 4JPKH 4EDXB 2RCSH 2VJXA 1AR1D 1S8DA 2E7LC 2HT4C 4G6MH 3EO0A 3RWDB 4CUCA 3JTTA 4RCAA 1S7RA 1TQBC 2GJJA 3JV0A 3B6SA 5H2BA 2ENYA 4ELMB 4I5BB 1PZ5A 2EDBA 3NIDF 5EIIB 4C57C 2F8OA 4F9LC 2E7CA 1A9BA 2AXHA 2QHRH 2NW2B 5FYLE 4OLZL 3U83A 1MPAL 4TULH 2J8OA 4WO4D 4U6TA 4Z95L 1M71A 1ES0B 4HIHA 3IAQA 4Y1AA 5EOCH 1P2CB 2HAZA 3WL9A 2CMRL 1S7WA 1DP0A 4G9FB 2DQEL 2DYPB 4N0CD 3UTTA 1FC1A 5F9WB 5KSBB 1OQXA 4X4XA 5J56B 5IQ7L 4OUOA 1S9XA 2IFFH 1OAKH 3E2HC 4JPWL 2R29H 2IPTL 2UZIL 1KTLB 3GBMH 3GSVB 3O3EB 4LLMA 3QDJB 1OTTC 3NA4A 4XC1L 2R2EA 3T2NL 2YSSA 2A1WL 4Y1AE 3UC0L 1OM3H 2V2TA 4B5EA 2GK0A 2X42A 1H3GA 5GS1C 3UTTE 3MOBH 2DB8A 4QNPE 3HZVA 1DBBL 1EXUA 3MO1A 1LP9B 1LK2B 4BELD 5D7JC 5FECB 4HAGA 1BJ8A 2FYYB 1JTPA 3OJVC 1CK0H 4PGCB 3MV8D 3O2VL 5EZOH 1UQSB 4L29A 4DGYL 3SE4A 3PQYD 3LN4B 1EGJH 3O3DB 3F7QA 4CNIA 1Q72L 1HQRA 3BUTA 2L7UA 5IB3B 2VDRL 5IESL 3MRQA 1GZQB 3BPLC 1NGXA 3UO1L 4F37K 3FQWB 4JPKL 2A2QT 4EN3D 1OWWA 2RCSL 1QPXA 3V5DA 3TZVB 2VLLB 3IETA 3HZYA 4G6ML 3B9VA 4I2XE 3Q6FB 1LO0L 3BZFA 1F4XH 1G84A 1MRDH 2JE8A 2WQRA 2VZUA 1XIWC 4JB9H 1BMGA 3U46B 5LGHH 3ARWA 3PL6C 5JW5A 2HVJA 4I3GA 2K1MA 3SJVB 4LMQI 3LS4H 3B83A 1CXLA 3RGVB 4Z7UE 4P3CL 2BNRA 4POZC 1AFVH 1A6ZB 5E2UH 5IK3B 1S7TB 2E27H 4M7LH 4TSCH 4JN1H 1N3NB 2IFFL 4BH7B 1ZHLA 1WBZA 4XPHL 5F96H 2A74A 2B1AL 1WZ1L 2B7DT 3GBML 1UXWA 4S0SD 2Z8VC 4XI5C 4Z0BH 1QR4A 5LBSH 1RUKH 2AAVA 2BNRE 3CUPB 1EEYA 5EBLB 4L4TE 3KPLB 4ZQKA 2HWZH 2XXCB 3MOBL 5DLMH 1QEWA 5DS8A 4Y19B 4AEEA 1MAMH 3IDNB 3MRBA