2EKSA

Crystal structure of humanized hyhel-10 fv-hen lysozyme complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
EIVMTQSPATLSVSPGERATLSCRASQSIGNNLHWYQQKPGQAPRLLIYYASQSISGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQSNSWPYTFGGGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords ANTI-LYSOZYME ANTIBODY FV REGION
publication title Critical contribution of VH-VL interaction to reshaping of an antibody: the case of humanization of anti-lysozyme antibody, HyHEL-10
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2007-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2eksA00
2NCMA 1PZ5A 3U0PA 4JREB 1UM5H 2VXQL 4X7DC 4EUPH 3PIQB 1VEPA 4JY5H 3DXAA 3W39A 5J57B 4KROD 1ZXQA 3DPBA 4JM2F 3MV8A 5L7XH 1VADB 1YY9C 1NFDF 1CWVA 1I3GL 1YEDA 2H32A 5D7KD 5FCSH 3BYYA 5A2IH 3SGJC 3BH8A 2R1WA 3EYSL 3OKNA 1U95A 4N8VG 43C9A 4U1HA 2XNAB 3HI1A 4MJ5B 4UI2A 5H2BA 5L2KA 4KU1A 2RCSL 1LEKB 2W65B 1T0MA 1FZJB 2LABA 4TNWK 4H8WL 3HPLB 2R1YA 2NY1C 5GGSB 1NBVL 1JPTH 5I18L 4OUUB 2BHZA 2EIBA 2J6EH 4P23B 4OI7A 5FGBC 4G3YH 1AHWB 1L4IA 4FA8A 4JQVC 2NY6C 1MCDA 5FM8A 4WTZA 4YDJB 2OLDA 1ZA6A 3I85A 1ES0B 4WTXA 3O3UN 3WUWG 5KTEH 1KPVA 5ACMA 4R7NB 5HDBE 4A6YB 4OFIA 3QIUB 4NKOB 4PJ8B 4N5UA 4Z77B 5GRYA 4OM1L 2NX5B 3Q5TA 2J8HA 1BQHA 3H42H 4I9WD 4LRIA 1R3LA 4NN7B 3PE9A 5DVNA 3FB7A 1R5WB 5BV7H 2I9LB 2YEZA 2EZ0D 3IU3B 1CE6A 1QUNA 2CUHA 3VI4F 1SMOA 1H3XA 2CIKB 5ADOH 5HHMB 3ULVC 2NY0D 4M7LT 4UZGA 2YXFA 3CFKA 4N0CC 1A47A 1KIPA 3EOAB 1AXTL 5DK0B 3M07A 3DV6B 3RPKA 4OFKA 3IJYA 4PLNC 2UV3A 3QI9A 4E41D 2CDEA 4XVUC 1KLFA 5DC0A 4NYLB 4Q9BA 4Z18A 2H32H 3AVEA 5J89A 3EJZD 3UCRA 3RZCD 1OPGH 3RHWK 5DA4A 3OF6A 1MIMH 3VWKC 2NR6C 1QA9A 3MLTA 3O2DA 5MHSD 4QHLA 3OXRA 1T2XA 5I0DA 5GQBA 2JB6B 3BPOC 4LLVA 4PJBA 3VGDA 4TPRH 4PV8B 1S3KL 3SDCA 3TBYB 4BZ2H 4OZIE 3MYZA 4WUUB 4V1DD 3T2NL 4EBQH 4Z95H 3JV5A 3OKLA 4HS8H 3RA7L 2UUDH 2BNUB 3PQYB 4WGVB 2VZ1A 2BVEA 4JPWL 1NMAL 2ZP0T 3QCTH 4XCFL 1MHPL 2X9YA 2Z8WC 4G7YH 2ZUWA 3IDNB 4OZ4B 5ANME 1JTOA 5ETUA 4HH9A 4ALAL 4YGVB 4P2CG 5CP7B 4YHZL 4BKLB 3T0VA 4EVNB 4Z76A 3DSFH 3QAZB 1TLKA 3SJVE 1FFOA 3GK8H 1MHHA 4L5FH 3SO5A 1G7PB 3GSXA 1BHGA 4FXGA 3UZEA 1AP2B 3PWNA 2BCKA 4ELMA 5C6WH 2X1XR 4K8RH 4LIQL 2GITA 1OGTA 1SJHA 2UZYB 4HDIB 1KEGH 3V6FA 3MOAH 4NNPH 1YEHH 4Y5VC 1ZGLA 5IVZB 1T6VN 4OQTA 4RWYL 4PJCB 1BZ7A 2J4WH 1NDGA 3QHFH 3H8NA 2O26U 4NPYB 1CI5A 5EU6B 3HZKA 4P5MA 3OAUL 4YBLB 1B0RB 4JHWL 5F1NA 3VU2A 4J3VA 2P8LA 4DWHA 1QBAA 3VFGL 3L7FA 3O2DH 1MI5D 3GJFB 4OTXH 4QRUA 4RRPA 3CXDL 1N64H 1IGTB 3MV7E 1NGYA 5C0AA 5MEOB 5A2JH 2E9IA 1WIUA 2F5AL 4G42A 1GCFA 4OCSH 3SKJL 3PWPA 4TVPE 1JF1A 3P4OA 1OAYL 3ZE2E 5ILTL 5MP6H 1LK2A 1XCTB 4L8CA 1S9XB 4JM4H 5C2BL 4JG0L 4ZAKA 2PO6A 2E6PA 4JANA 4Z5RB 3IFPA 3P4MB 2V5RA 4BH8B 1IGJA 4G6JL 4JKLA 3K8KA 3ZKND 5FA4A 1RZ7L 3JXAA 1VFMA 1EHLH 4FQXD 1A6VL 2FH8A 4F9LA 1CE1H 2DBJA 3KPRB 4PJEB 5MENB 4EN3D 4ZTOH 1FFNA 1M7IA 3BZ4A 5J1AB 2ZG2A 1P2CB 1UVQB 4ZOBA 3L3DB 5AD0A 4HGWB 1MSPA 4WUKH 3CXHK 5IMLB 4ZUWA 1X5AA 4OQTH 5T1DL 3EJYC 3LSOB 4K3GA 1DP0A 3DARA 1YEGL 4HEPG 3QQ9C 1RZKL 2HN7B 3QG6A 1C5CL 1MCSA 4JDTL 4AEIL 1U42A 4KTDL 3RDTA 1QBMH 5GGTA 1OF2B 1CT8B 1JZ2A 4GOSA 2G2RB 5C0GB 4KPHL 3FONB 4ODXA 5JHLL 3BP7A 3RGVA 4E42A 4QHUB 3C5ZD 2NY3D 4UTAL 2CK2A 3ZT5A 3CFJA 4PRDB 3BUTA 1TETL 4JO1L 2VLRB 4JQXA 2BY1A 1W2KT 2LU7A 3N1PC 3IDUA 4Q9QH 4HWEH 5EPMB 5KANI 5J4MA 2EDTA 4TSCL 1F11A 3DGCR 1BM3H 5B3JF 4UILL 3V7AG 1RK1A 3PL6C 2EDXA 4NKMB 2NY2C 1J12A 2J88L 1AE6H 5JOFB 1VKXA 1BZ9A 2VKWA 3KPLA 1D9KB 3QDJA 3D3VB 1J88A 1WBYB 4YH6A 5T1KB 1XIWC 1J87A 5TE4H 3EFDH 5DJ0B 3PWUA 2WV3A 4KDTC 2AJXL 1KJ3H 3KPNA 3CMOL 4WO4A 4AIOA 2JJSC 3E8UL 3K46A 4WTZG 4DKFL 4YHNA 3GGWB 3C2AL 3BE1L 3H9YA 1NCAH 4KMTH 3MJ7A 3PGCA 1JNLH 5SWZE 4JN1L 2Q7YB 2FEDC 4GRLA 1AKJB 4KJQC 1DBBL 25C8L 1BQHG 2YD5A 1RJZB 2HLFC 2CRZA 3H9SA 5HDOA 3IS0X 3UTSD 2K9UA 2X4SA 1N4XL 4J6RH 3GJFK 5CIPH 4XBEH 1MFDL 2MTPA 2DLFH 5GGTH 2VZVA 4P46A 4KRPB 1A1OA 1RULH 2J2ZA 4HXBH 5KW9L 4KJWC 1P7HL 2GCYB 3P30L 4KZDH 3KLSA 2R2BB 1VFBB 1I8MA 4M5YH 1PFCA 1A0QH 3DUUA 1NC4B 5J12C 3ZE1E 5D1ZD 4NQXB 3C08L 1IM9B 4LLAA 4P2RD 4OFYD 2H9GA 4JPKH 5C0DB 1K6QL 2BVOB 3X12A 3G08A 4B41A 3BQUC 1G0XA 3RWJA 4JFXA 2YD9A 5DJAA 4KUZL 5BMFL 5KSAB 1RU9H 5GS1B 1NGWA 2D7TH 2BJML 4I3SL 3TYFB 1OWWA 3NFSH 3BIAX 5J9PB 1G0YR 2F9BT 4AT6B 1CGTA 1D6VL 1TQCC 5ESAA 1S5IH 3PP3K 4Y2DC 1VERA 3QXVA 4C54A 1MFBL 5I8CA 3WHXB 4YNYA 1V5JA 3D39D 1OGAB 5I15L 3DBXA 3GNMH 3VCLB 1LO2H 3C5SB 3GRWL 3DYPA 5E7BA 2ED7A 1XGUA 3D69A 4ZUTB 3Q3GA 3TN0B 1KELL 1I7TB 2YSSA 1JJUA 3OB0H 4HK3J 2VABA 2GY5A 3T1FA 5BOPA 2AJ3A 4PRAA 2UWEA 4JFED 1DL7L 2M1KA 5DFTA 1O0VA 1U41A 1A4KA 2F53B 3SE9L 4MA8H 4X6DE 2FWOA 1U0QA 3NA9L 3D2UB 5KS9A 3WYRA 1CXHA 3C6LB 4OV6F 1WWAX 1JHKL 4YPJA 3BRDA 1R0AL 5E1AB 3O3AA 5DMGC 3U82B 3VD7A 5GGRY 1DCLA 1P84K 2CIIA 3LKNA 1VFOA 5HPOA 4JB9H 1D6EB 5BS0E 4FQJL 4GW1A 1MIEH 2O61B 3NPSC 2DWEA 5D9SA 1PQZA 1FE8L 1NAML 2BSSA 2X4PA 1FPTL 4S2SA 2FJGB 3I84A 2IFFL 5EU4A 2YK1H 3WS6C 3GMOA 3N50A 4JM2A 4JY6B 2XA8L 4X6FB 4X80H 2W0KA 4UQ3B 1GC1H 2P5WB 3G5XA 1NFDA 2HTLD 3DI2B 4XTRD 3GHBH 1BJ1H 2HJLB 2UZXB 3ARED 3QUZC 4M43H 3S3JA 4H26B 1OAXL 3O6ML 3UC0H 4BFBD 1QBLH 3L6FB 3VMPA 2HJFB 3LS4L 3UO1L 4WENB 2GJ6B 3DX7B 3SO3B 4U1MA 1FL3A 1KCUL 2CDGB 4N1EA 3MR9A 1J0IA 4JQXC 3VWJC 1GVIA 3V8OA 1AH1A 5F71A 3KNBA 3T0EB 4KHTL 5CD3A 3EO1B 1MEXH 5CJQL 2YA0A 4MJIE 4M7KL 1A1MA 1G7MA 1YUHA 2P8MB 5LVEA 5DFVD 2BVPB 5IJVA 5HYFA 2IF7A 1DQLL 4Z7UE 3BRGC 2NY7H 3UYOD 4M7LH 3VA2C 2FLBT 4LHUA 4KK8D 3EDJA 3PNWA 4WO4C 2B5IB 1NEZA 5D4QA 2Z93B 3REWA 4M02A 1T89A 1F13A 1U8LB 1F58L 1FBIH 4KY1L 1QEWA 3MSPA 1R6VA 1T5WA 3G04A 3RVWC 1JE6A 5C0BE 1NJ9B 4MAYC 5KOMC 1DVFA 5FYLL 2H2SD 1L0YA 5IHZA 1W72L 1S9YA 2QQKL 4PJ5A 2HRPL 3V8CA 3K1DA 3S34L 3CUPB 4DEPB 5FA3A 4HJJL 1TJHH 3MLVL 2E9WA 2F58H 3KPSA 5FYKU 3UTTA 4QHKI 1J5OL 1UXSA 1X7QA 3CSGA 5HHOE 2X7LB 4WI3A 1ZWIA 2ZOLA 3D0VA 5A16B 1PEZA 1H3GA 5E6YA 1BWMA 1J05A 3U1SL 3O6FA 2Q8BH 4Q97A 5EN2A 4PPTA 4Z7VE 3S36H 3MBEA 3G5VB 2DKMA 4KVNL 5ESVB 5FDWA 1Z0NA 3O3EA 2WIIB 2YPVH 3NH7H 4TSAH 3TJEL 3HFML 4MMZC 2VXVL 3W0WD 1NCTA 5KG9B 1YDPA 5DS8B 1KFAH 1PG7H 3MLSH 4UV7L 3B2UD 4PJ9B 5HVWA 3OKOA 2YHGA 4D9RD 5FUOL 5ALBL 1MF2H 1XR9A 2F5BH 4TNVK 4ODTH 3FQTA 5DJ6B 2MCPL 3FQUB 1FL6A 2IQAB 4X8JA 3A6CL 3G5YB 1G84A 4PJHB 2EICA 5EUOB 2PETA 5E00B 4MQXC 1UM4L 5F9OL 3WL9A 4LCUA 5C1MB 3CXHJ 4JDVB 3QEUA 2JJWA 4GBXD 1A5FH 5B8CB 4N8VB 1CFQB 1K4CB 4NUJB 1IFHH 1F90L 3QDMB 4I0PB 3O4OC 4PBVC 1KIRA 3I02B 3V6BR 5K59F 4NQCD 4L9LA 3UYRL 3FB5B 3I50H 4P2QB 3VDCA 4BSWA 5C3LD 4PJAA 1T4KB 4C56B 3TVMD 5TFSH 3QEHA 4KUCF 4IOIB 5C0NC 5DVLA 3O4LB 4YDKL 5IK3A 3GM8A 4GKNB 4OCNC 3MMEA 5BRZB 4X7SH 3WUWB 1IEHA 5BQ7A 4U2ZA 4YFLI 3AGVA 4P4KC 1I9EA 3NGBC 4L29B 3BPCB 3BPNB 3BDYH 3IDIB 4TUJA 5AAMA 1D3CA 2P47B 1ZSDB 5AYUL 1GJIA 5FOBA 1N2RA 5CZVH 2PUQT 5JUEL 3V6ZB 3IKCB 3QCUL 4NZUH 3TBTB 4GXVH 1FN4B 2QKIA 3TWCH 5FHAH 1P4IH 1X6NA 3LIZL 3LS5H 4HUWA 4MVBC 1C12B 1FNGA 3L3OB 5D5MF 4IIQB 1AQDB 5DZLA 3ZE0F 3DWTA 4X7TB 4H20H 1L7IH 2VL4A 5HHME 4HIHA 4GRWB 5FKPB 3RIFF 3BKYL 1IT9L 1UM5L 3KDMB 5EA0L 3TYGL 4Z6AT 4JY5L 4MSWA 1CL7H 5CJ5A 1TZGH 5EC2A 2CLZB 1G1CA 3JUZA 5HHNA 2DS4A 4HAFA 1ZLWK 3NFNA 2CKNA 2W38A 3F7VB 3WIIL 3BSZL 2VE6A 4JJHA 3C60D 4HF5H 1S7XB 1TVBB 4X99B 3N1FC 4OAWA 3F7QA 5HGHB 3TPUA 5HI3D 1EEZB 4V1DA 3HMXA 2IQ9H 2OR9H 1LO3H 3O0RH 3VI3E 1UZ6F 2NY5C 4CMHC 5HY9B 5DJ2A 2QHLA 4WUUE 4Z7OF 3ROLB 5HHPB 4ODVH 2Y1VA 4M6MH 2ZUXA 3PQYE 1FORH 3S5LG 1ORSA 1T83A 1A4JA 2AJUL 3LKOA 5E4EC 5GSVB 3QQ3A 3MRDA 3CFBB 3QP3A 2GFBA 1UWXK 1BFOB 5KTEL 5IMMA 2IEPA 4JQIH 2EECA 1FJ1B 2ITDA 1A6TA 4LSUH 5TF0A 1CG9B 3QIWB 4OLWH 3QRGH 5EU5B 3X14A 2ZPKH 4Y5YA 1EEYB 3KHQA 3I9GH 4IRJD 3QIBC 4JGUA 1KYOK 2VITA 3VFTA 4LHUG 5I9QC 2X4NA 2W0FB 4KK5D 1NEZG 5F6IC 3VD4A 5T33H 4APQB 1E4KA 4UDTA 1T03H 4PJCE 4KKBD 1QFWH 3VXMB 1T22A 1AJ7H 5EU6E 3UROR 3MBEC 35C8L 2ICES 3MUGA 1MI5A 1MCOL 1H3VA 3JWOH 5F3BB 2F54E 1OPGL 4NM4H 2FHFA 2JB5L 4WEMB 4O58L 4FQIH 5E8OB 2GSGA 2LQRA 5HGAA 5F1IA 4MJ4A 4YR6A 1XGYL 4DN3H 1P84J 3HMXH 4NKIH 3HE7C 4J1UA 3FB8A 3ES6B 1YN6B 2J8OA 4P5TB 5F7WC 1HQ4B 3ZL4H 3WV0A 1E28B 4BZ2L 2PXYC 1FNLA 1XGPA 5C07B 3DIFB 3TT3L 4J23A 3U2SA 2L0DA 3Q6GL 1CFVH 5DMIH 5CBAA 3RP1A 1FZKB 3TH4T 5K9OB 4XBPA 1FNFA 3FO2A 2ADGA 3SE4C 4K2UL 4G7YL 4XVSH 4MB5A 3RWFB 3U9UB 4G7VL 4NO3B 4LBEB 2E3VA 2DQEL 4EN3A 3KR3L 3DSFL 2VXTH 3V4PH 2RAMA 5IB1B 4P2OB 4PG9B 1MY7A 3KPRE 3GK8L 4L5FL 4PJEE 5GRUL 4ONHA 2JKXA 4JZNB 5IHUL 2VUOA 1IILE 1GZQB 4LIQE 1F6LL 5BV7B 4WU5B 1GGIH 4NM8H 5CMAA 4HS6B 3U0PB 1T7ZA 2G60L 2JIXD 2XT1B 2ADIA 1KEGL 3DXAB 4KJPC 3MOAL 4GMTH 3W39B 2BVYA 2D7OA 3E2HC 4GRMA 2BNRD 1FNSH 1BQLH 3MV8B 3EOTL 2J4WL 1GHFH 5GHWH 4LF3B 2WWMC 3PG2A 5DJXA 1JWUA 1YEDB 2H32B 4N8PA 4L8DA 2GI7A 3BH8B 2R1WB 43C9B 1U95B 4U1HB 3QA3A 4G6MH 4PP1C 5D2LF 2X4TA 1OWRM 3HI1B 3T77A 4OTXL 5H2BB 3WXVH 4D9QE 1FFPA 1RUAH 1T0MB 5H37G 1QOKA 2R1YB 5D96C 4M3KB 4OB5H 2BRRH 3X11A 1A7OH 1KN4H 1FLRH 1AGDB 2B1HH 2VSDA 4XPFH 5I73B 4JM4L 2P48B 1ZA6B 3D3VE 1RFDL 4RFOL 1KPVB 1L6ZA 4Z0BL 1A14H 1CZ8H 2XA3A 4FZEH 1BVZA 5LGKA 4WCYH 1L6XA 1BQHB 2GJJA 4G43A 1R3LB 1I3VA 4D0CA 4EZMA 1M7XA 1NCWH 2ICCA 2WBJC 2YEZB 1WAAF 3HRZA 3ARFA 1F3RB 3EYUH 4KKNA 4O02L 4HWBL 2BSRB 2OYPA 2NY4B 3IJYB 1TPXC 1JGUH 4L4TD 1QPPA 4U0QB 3QI9B 2CDEB 1ZKAA 5I30L 4PRHD 3OL2A 4J7RA 4Y5XA 2OP4H 4N90E 4Z7NE 1QBML 3MLTB 5EBMA 2ADFL 1KIQA 5HYEA 4QHLB 3OXRB 4PP2B 4OFYA 1KC5L 4K7PH 4GKZA 2PN5A 2VXSL 2IG2L 4LLVB 2J7LA 4PJBB 4ZSOA 3RTQD 2COQA 3N1MC 4H1LG 3SDCB 4LGRB 1U8MA 4KDVA 2AGJL 2R23A 3O45B 4Y16D 4HWEL 4XX1G 5JDSA 3ZDXE 1BM3L 2EDJA 5ETUB 4HH9B 1R3KB 3CMGA 3D39A 1AO7D 3TA3D 1X5YA 1CD9B 4I18A 1X4YA 1DSFL 3RI5K 1FFOB 3HS0A 1MHHB 4K3JL 3OBAA 5HGBA 1OGAE 4U7MA 2ZCHH 3GSXB 4XPHL 4FXGB 4X6EA 2PCPA 3PWNB 4WEUD 2BCKB 4ELMB 5IKCA 2FIRT 15C8H 2XKUA 3I6KA 1SJHB 4L3ED 4DN4H 3V6FB 2R9HD 3AB0C 1NCAL 1CDHA 1JNLL 1ZGLB 3HZVA 3DRTA 3OG4B 3U0WL 1A7QH 1DFBH 4XCCH 4ZTPL 1BZ7B 1NDGB 2XN9D 4JPVH 3LHPH 3HZKB 4RA0C 4P5MB 4NRZA 3NPZB 1DEEA 1B4RA 1IGIL 5F1NB 2ZJSL 2P8LB 3MFGB 2F53E 3PP4L 4XBEL 2NXYD 5GGTL 5TDOA 3MJ9A 4X4ME 4EEEA 4QRUB 4KZDL 2Z9TA 4NJAH 5I1HH 1NGYB 1JGVL 4A2MA 3BEWA 1LK3H 3EZ8A 1G6VK 2UUDK 4UAOB 1HYRC 3PWPB 4L1DA 1JF1B 1OT2A 4CW1A 2Y5TB 4JO3H 2WUBH 2BFVL 1BOGA 3LKSA 5F9WC 5DD3L 5D7JD 4L8CB 5F7LB 5GRJL 3RKPA 3DX8A 5F7NC 4FS0A 1FG2A 4ZAKB 1RU9L 2PO6B 1TNNA 4JANB 1G9NH 2APWA 4KK9D 3JV4B 3NFSL 3OKEA 1JYVA 4UT7H 5CFHA 4FFVC 1IGJB 2X6MA 2CR6A 1RUMH 3VXPA 4OF7A 2IPKA 3RZWA 3STBA 5JORB 3CFCH 5CEYA 2ICWJ 4RIRB 5DQDH 2ZUUA 4AMKH 4XI5C 4XMLH 4EIZC 4PJ9C 4HJGA 3BZ4B 4HKZB 3EOBA 3D1MC 3MLYL 5AD0B 2EH7L 3G5ZA 4ZFZA 4ZUWB 5F7KC 2GJ6E 4OQ1A 1AIFA 1EO7A 2CGRH 4Y89A 4HCRL 5DK2A 4XH2A 3QG6B 1WITA 2OI9B 3GSOA 3T0EE 3RDTB 1OP9A 5ESQA 3E6FA 4TTDD 1D5ZA 4KQ4H 3CFDA 2V5MA 1Z3GL 4ODXB 2OK0L 4HIXH 1PYWA 3BP7B 5DRNB 3RGVB 4E42B 2XZQH 2UVFA 3BYTA 3CFJB 3WFEH 4GAFB 4DAGH 1HH6B 4QF1A 5T5NG 1Y6NR 1F11B 4JB9L 4GLRI 4L8SA 1RK1B 1MRDL 1MHCA 1NLBL 4WTWA 4IRSC 3E1F1 3OJDA 1BZ9B 3KPLB 4HUKB 1NFIA 3QDJB 1KYOJ 5JW4R 3BKCH 1QTYT 4JFDD 4TYUA 1XF3A 2YK1L 1HWHB 3PWUB 3KPNB 1KENH 4Y4FD 4PYGA 5DUML 4M1DL 5CP3A 1U93A 3U79A 1WFUA 4YHNB 2XG4A 3V0AC 3MJ7B 3PGCB 2QADB 2GTZA 5E56A 5ACZA 3UC0L 3GSVB 5E9DD 4GRLB 3IAPA 3HA0A 3RGHA 1IGYA 2HG5A 3DX6A 5L88L 3LEYL 3H9SB 4LLDA 4HV8A 2X4SB 5DHYB 2DL2A 1FG9C 5ENWB 5IQ9A 4FABH 4G9FE 3W0WA 1RZJL 2V6HA 8FABA 4P46B 2PF6A 1A1OB 1RVFL 4RAUA 3UTPD 1MEXL 4UIMA 3MV9A 3RY6A 1J0JA 5DQJA 4HUXA 1I8MB 3U30B 3ZYOA 1OY3B 4S11A 1UA6H 4X4YA 3FN0H 3DUUB 2DYPD 1UADC 3B5TA 1KBGH 4F7MB 1OARH 1I85C 2H9GB 2R4RL 4S10A 2FJFA 4NQDD 3G08B 3WD5L 2Z8VC 3F7RA 3RVUC 3RWJB 3F8UB 4JFXB 1ND0A 2C3WA 5DJAB 1K8DA 1RJLA 1I1AD 5EBLA 4HHAB 1NGWB 4PJHE 5EUOE 4NP4L 3TGXA 3DV4B 2YKLL 4GBXA 3U6RA 4FQ2L 3QUYC 2OJZH 4W70A 5D7IF 5ESAB 5FYLE 2ZCLL 3MRIA 4YNYB 2C3VA 2YD2A 3MNVA 5F7MC 4NQCA 5EORH 3DBXB 3QDME 5CP3H 3DTXA 4IDJL 4Z0XA 1B9ZA 3S37L 2CLVA 3TVMA 5ERWA 1XGUB 3BEVA 3VXUD 3D69B 3Q3GB 2VMFA 4P2QE 2YSSB 1F3DH 4ODHL 4D3CH 4LMQI 4XGZA 1YEJH 1JPSL 2FEEI 1YC7A 3T1FB 4C56E 2AJ3B 1GGTA 3L3HA 3O4LE 4PRAB 2C7UA 5HYSG 4PTUB 2EYSA 2UWEB 3UJTL 1WIOA 5DHVH 4RISL 1IC7H 1A4KB 2DIBA 1JRHH 5JPNA 2FWOB 4CJ0A 5EC1A 2FBJH 2EC8A 2F8OA 5KS9B 2YPVL 1V7NL 5GS0D 5DDHB 3VG9B 1DQTA 3VG0H 4WFHD 1WFOA 2CIIB 4K3DH 2PYED 5I19H 2DDQH 2Q87A 3QXWA 3MLXH 3MBXH 4RGNB 4MNQB 1MF2L 3CFEA 4GW1B 2F5BL 4X5WA 2BNQD 2DWEB 5D9SB 3K0WA 4LPYA 1PQZB 1CBVH 4FMFA 1IC4L 2X4PB 1MHEA 4S2SB 4WV1A 3OR7A 1JGDA 4ZNEA 1YQVH 1EBAA 5EU4B 2A73A 2B7DT 3GMOB 1HE7A 4GRWE 4JM2B 3AAZA 1A5FL 1NFDB 2FGZA 3LKRA 4U1KA 3OB0K 5E5UB 4JE4B 5GGVL 4X5XA 3ECBB 4GQPH 2NQCA 3QXAA 4LVEA 1HEZB 3C60A 4CU7A 5I1CH 4POZD 3PDDA 3UAJD 3U7WH 5IM7B 5KSBF 4JGMA 3HG1D 4OBSA 2Y9RT 4U1MB 4JFZL 3CZJA 3MR9B 4GAJH 4Z7WF 3OXSA 4DK3A 4LAJH 2CRYA 3ISWA 4XXDA 4MQ7A 3U46B 3S5LB 3HC4H 5J1SC 1BJ8A 3A67H 3CDYA 4BELD 5KSVA 5CD3B 1T1XB 4U05A 4X7SL 1EGJL 5BZWA 1A1MB 4NBYB 4F58H 1P9MA 5IEKA 1UB5B 3NZHH 4O00A 5ICYA 4YHPA 3ZYZA 3OB8A 5IJVB 2LV4A 4LU5H 1T80A 2A6DA 4QXTA 2XY1A 1QVOA 3I3EA 5D1QA 1KUMA 2EDDA 1NCCL 4LHUB 3PNWB 4K23H 1NEZB 4GXVL 4ORGA 4IRJA 4LCCC 2YN3A 1FHGA 1P4IL 3REWB 3BKJL 3RKDD 5A2FA 1WAAA 3DO7A 1T5WB 2M2DA 3G04B 4CVXA 3N1QC 2XICA 5SWQA 3CDGA 3SDYL 1FZOA 1L7IL 1M1SA 1DVFB 5EOTA 5IHZB 1S9YB 3QG7L 4PJ5B 3VXME 4QKXB 1TZGL 1CLCA 4M00A 1S7SB 5FA3B 2DQDL 1OSZA 2F19L 4Q6IC 1BBDL 2E7BA 4LEXL 3UTTB 3HC3L 2A9NL 2KPNA 3GMNA 1C7TA 1NPUA 1NH6A 1J1XH 3MRQA 1ZWIB 3KPMB 1DQMH 2ZOLB 3B9DA 3D0VB 4NZRH 4HF5L 3NIFF 2HRLA 4YAQA 1J05B 5I6XC 3ILQD 2WQ8A 3O6FB 2Z8RA 2WIMA 5EN2B 3HNVH 4PFEA 4YHLH 5FDWB 2FJHA 2IQ9L 1LO3L 2OR8A 4AENA 2E7LA 5C07E 3WS3B 3QSKB 1YDPB 4KWUA 5F1OB 3KYKL 4U6XA 1NGZA 4ZNCD 4M6ML 4PBXA 4QNPF 1FORL 3TO2A 3P11L 3C5JA 3P3YA 3O81A 5DMYA 1BF8A 3LN5A 1P4LA 4RGMC 3FQTB 4XNUL 1FL6B 1GZPA 4X8JB 1DBMH 1K3ZA 4B5EA 1GOFA 1IKFL 3DHJA 2JIXA 4OLWL 1T1ZA 4N8CH 1LVEA 1IVLA 3K2MC 2W07A 3MUJA 4KROB 4TRPH 3LQZA 3WCYA 3WL9B 2UZIL 2BNRA 4LCUB 3FZUD 5GGUA 1Z0MA 2BC4B 3DXAE 3E6HA 2CH8A 5GISL 4ZMAT 3MV8E 1A6ZA 2Y4SA 1T03L 3LB6D 3AY4A 2EE3A 2H2PD 1TDQA 2FO4A 1KIRB 4PGCB 3WHE0 1AXSA 2Y07H 3V6OA 3MJGX 3JWOL 4L9LB 2UY7A 4HD9A 4BSWB 2FB4H 4PJAB 4NM4L 3QEHB 4TUKL 3HPJA 2NX5D 2JJUA 5DF0A 4OZHA 4QRQA 2H8PA 3ZDZF 5IK3B 4MLIA 4YGAB 1P4BL 4DN3L 3MMEB 2CMRL 1Z5LA 1RURH 2RJMA 4HG4K 3SPVA 5CILH 1OAKH 3ZL4L 4WW2A 4WV1C 4TUJB 4MQTB 3ARRA 4LVOB 2D7NA 3WN5C 3LQAL 3ZT6A 3GIVA 5CEZD 1N2RB 2VISA 4OD2A 4K71C 3FAXA 2QKIB 4JCLA 4HUWB 3VXSA 1FNGB 1U3ZA 1XF5A 3EDDA 4K07A 3V4PL 5JXEC 1N6VA 2N7AA 2NY0B 4HX1A 2MQCA 4M5ZL 5GRZA 5DD0H 4YWGH 5BZDA 2BVUA 4J8RA 4N9OB 2KZWA 4J3TA 4L4TA 3QHZL 3X3FH 2HVKA 1KJVA 4E41B 3FFDA 4JO4H 4MSWB 1CDYA 1EERB 3NIGE 4PRHA 5EC2B 3RZCB 3SGEI 5SWSE 1BZQK 3NFNB 5GHWL 3J7HA 4RAHA 4H1LB 3OV6A 4LASH 4CADA 3EAKA 1UACH 5F1SA 1WWWX 3FMGH 4KHXL 4QWWC 4G6ML 3GIZL 4ZO7A 4YC2C 5MI0C 3O8XC 3TPUB 3MCLH 1CD0A 2W1NA 4V1DB 4XPTH 4Y16A 4PJBE 3T3PF 3RU8L 4JFPA 1MAML 4NO2B 4YFEA 3BW9A 1TJIL 5DJ2B 3MXWH 2VZTA 3VJ6A 5EH1A 2YRPA 3DROA 4S1SL 1A7OL 5D1XD 3VFOA 1AO7A 3TA3A 4XCYA 2B1HL 4DQOH 1ORSB 1W8NA 1A4JB 3LKOB 2RFXA 3K8LA 3PF2A 5C0RH 1BX2A 3MRDB 3K81A 2ED8A 2GFBB 1HIMH 2N1KA 5IMMB 3MV01 5E2VH 5E94A 2BY3A 2WANA 1W0VA 2ITDB 1A6TB 1CZ8L 1WBXA 4L3EA 1F02I 4LVNB 3IU4H 3FO0H 3OKDA 4Y5YB 3A6BL 4ELME 1Q1JL 1CVRA 1ZT1B 1EJOL 2VITB 4PJGB 3VFTB 2XN9A 3WIFA 2X4NB 3RWGA 3WO4C 1RZGB 4UDTB 4DVRH 1FIGH 4DW2L 4CVZA 1NSNH 1T22B 4JFHE 5ADPH 1SVCP 1A7NL 4FP8L 3MUGB 1MI5B 1YJDH 1J11A 5ID0B 4KI5D 4PJIF 2MSPA 2GSGB 5H94A 1A3LH 5HGAB 4KK6C 5MEND 4YR6B 5F1IB 2O93L 1OTTD 3B5HA 3G6JF 4K7PL 4MXWH 3GMMA 4AJ0A 5IESH 4GMSL 4J1UB 4TULH 4BZ1L 3FB8B 4OLZH 5D7JA 2R2EA 5JPMA 1ULVA 3PWPE 4OM0L 1XGPB 1FDLH 5DO2C 4M6NL 2EXYD 5CBAB 2MNUA 1RIHH 4HKBB 4I77H 4WJ5A 4XBPB 2KDGA 1XR8A 2OZ4A 3FO2B 2CSPA 3DUSA 3GSQA 4XBGB 4EN3B 4RQQA 1WFNA 2RB8A 1DE4A 2YC1A 4I2XA 4ONHB 1AQKH 3HE6D 3DNKA 3W11D 4EIGB 1QNZH 5CMAB 2VLRD 2Q8AH 15C8L 2ADIB 5C0IB 2A83A 4GRMB 1QLEH 3EO0B 4XCCL 4Z7QE 3KYMA 4P99A 2P5ED 1CD1A 1ACYH 4JPVL 5DJXB 5DR5L 1B3JA 1JWUB 3VXRD 1U8IA 5JOEA 3C5ZB 4HS3A 4L8DB 3UMTA 1A9BA 4B0MM 4HIJA 1DQJA 4NC0B 3QA3B 4XCEA 2X4TB 4IHOB 2QHRH 2E9JA 3T77B 1ZE3C 3D85D 3BKML 2EH8H 4WW1A 3HUJF 4LAQH 2A2QT 3SE3A 1T1YA 5E2JA 1OAUL 1LK3L 5JW4Q 4M03A 1IGCL 3X11B 1T0NA 2R0ZL 3HNTL 4JO3L 4KQ3H 2XY2A 4JZJB 1VHPA 3FAWA 4NKDA 5E99H 5I17B 1TCMA 4UDUA 4JFDA 1RZJC 2OZ4H 3EDEA 4NFDA 2XYCA 3QDJE 1M05B 3WIHL 4YX2L 3FB6A 2HMID 4OV5A 1BJ1J 1G9NL 1QD0A 1B2WL 3KYOA 2DTMH 5FYJD 3TT1L 3CFCL 3TPKA 4KDWA 1YJDC 2YRLA 3I3DA 5DQDL 3UZQA 4F7CB 4G43B 3VFVA 5EFIA 1BQUA 1K3IA 4ZPTA 5BO1L 1MJJA 2B20A 3HRZB 2W9DH 2CKBA 4FQPA 3ARFB 4Y1AD 4J12A 1JPFB 1CGWA 1DR9A 3O3BA 3UTSB 5JQ6L 3ROOA 2V5SA 4XP6L 2N56A 4Q9RH 1WWCA 1JGLL 2XWTA 4JHAL 4ENEC 3ULSA 3HRPA 1Q0XH 4Z78A 4LDOB 1MFNA 3MNZA 2Q3AA 2R69L 4KI5F 4Y5XB 4KTYA 5LQBL 5EBMB 2NZ9C 3TIEA 2DYPA 5D1ZB 5FV2A 3VFPA 1NCBH 3MJ9L 3IDYC 4NQDA 3BDBA 4HIXL 1BGXH 4NO0D 2WP3O 3DVIA 4G6AD 4R4FH 4UQ2A 1G9MH 3WFEL 4ZSOB 3ARGA 1MRCL 1I1AA 3TN0D 5FO7A 1U8MB 1Y6KR 1WBZA 2R23B 4FOMA 5EBGA 3GBML 3P0YL 5JDSB 3L3JA 5TDPA 1BAFH 3RBSA 2Y5EA 5FYKD 4OKDA 4XMPL 1NEUA 1BREA 3RUGF 3D39B 3NAAH 2IBGA 2DBLL 2W60B 1U8NA 3BKCL 4I18B 4OZFA 3QXDB 4GW5A 5K9JL 4FFYH 3HS0B 1HXYB 5F9DC 1LP9E 4NZTH 5HGBB 3VXUA 1FGNH 3NVQA 2PCPB 3LDBB 5HYSB 5IKCB 4PJFB 2LE9A 3BIBX 1KPRA 3I6KB 1MH5A 2CKBH 3QWOB 4OGYL 1H3UA 5HPMA 2FX7H 4WFFE 3ARBD 3HZVB 3DRTB 3QDGD 1UJTA 4JFEB 2UY6A 3AS1A 2DLGA 4NRZB 1Q9WB 5JOPD 1NMCC 4G9DA 1DEEB 4G8GE 4HG4J 1MCKA 5J3HD 4QTIL 2ZCKH 1IKNA 3N0PB 4Y19D 4BZYA 5TDOB 3SCMC 3ARDC 2OL3L 2P5WD 2CD0A 4MDIA 5DJ8A 3MRKA 4K94L 5KS9E 3AFLA 2PYEA 1ZTXH 4WWKD 1LILA 1PX4A 1FH5H 3BEWB 1UA6L 4QRRD 4LSQH 1KBGL 1R3IH 1OARL 4NC1E 2BNQA 3ZKMD 5GJTH 4CW1B 4Z8FH 1A64A 4RGNE 4MNQE 1OW0C 4NFCA 1K4DA 4XAKD 2N4IA 1R5VB 4P3CH 3ZKXB 3DX8B 3S6CA 1FG2B 3RVXD 5DMKA 3NCCB 3OKEB 1F4WH 2Y23A 1NCUA 4HIIA 4ZO6A 3VXPB 2IPKB 4OZFH 5T1LD 4X83A 4IMKC 5CEYB 5I16A 3V2AR 5KVFL 2O5YH 1NFDE 4YIQA 2EO9A 1DQDH 4HJGB 4YUEH 4OD3H 1YEIL 3EOBB 3HG1A 1WEJH 1WK0A 3RL2A 3AU1B 3SKUD 4OGAD 4GAGH 3G5ZB 4HXAH 3DGGA 4V2BA 4ZFZB 3OHXA 3EIFA 3OR6A 1L7TH 3MZTA 1NLDL 1OP3H 2H1PL 4XCNA 3SE3C 1YEJL 1F00I 1AIFB 3QISA 1RUPH 5DK2B 4QT5B 2VZ3A 3GSOB 2VH5L 2PTTA 1SM3L 5GS0H 5I71C 2APXA 3E6FB 5ESQB 1RHHB 1D5ZB 4AYFA 4MWFA 5J56B 4KGJA 3CFDB 2R0WH 4J3OC 1PYWB 5IFJA 2DQIL 5E70A 5IIEA 4EJ1C 4KKLD 4QF1B 4XWOD 3VG0L 5D2NA 1Z9SA 1XT5A 2DDQL 4AG4L 4POYA 3MBXL 4L8SB 2BOCB 3VXQA 5F9JA 2X4RA 1MHCB 1NUGA 5IWLA 3VI4E 2HTKD 1PZUB 4JFFD 3GSRA 3OJDB 1Q72H 1QP1A 1BVLB 1MAKA 2ZZUT 3QNYA 1XF3B 2EEAA 3CPLA 3FQNA 2X4OA 4PJ5E 2A9ML 1U93B 3WNPA 3RWCA 4F57H 2HT3D 3UTTE 3DLQR 1OM3H 5I1CL 4M7ZB 1F6AA 4OI9A 5C6PB 7FABL 1CFSA 1IGYB 2FECL 2HG5B 1GAFL 3DX6B 5T3ZL 4HWUA 2EE9A 3EOYG 3ARGC 4LLDB 4RFEA 4TNVF 2X42A 3V52L 5GZNC 2ESVA 1AGCA 2DIAA 2X70A 2FD6L 1DLFL 3W0WB 4UUJA 3HC4L 4GSDH 8FABB 4RAUB 3J8F7 1E6JH 4UIMB 4DUXA 2A6IA 3IDMA 5DQJB 1D7FA 3GSUA 2LTQB 3NZHL 4X4YB 3ULUD 3TZVD 3MOQA 1TIUA 3DSNA 3QWRA 1MQKH 5EIIA 3FL7A 2FJFB 4CDHA 5IMOA 4MS8D 2BZDA 4QXWA 4D8PA 1ND0B 1K8DB 1RJLB 4WVRA 2AQ1A 3VRLF 2HWZH 2DQUH 4GBXB 2NTSP 3U6RB 4FRWA 1HCVA 5BRZD 1UEYA 1YY9D 3IVKA 1YYML 2XXCB 3CU7A 5D6CA 5D7SH 1JZ4A 1I3RB 3LQAC 3MRIB 3TEUA 4DKAA 2C3VB 5D7KE 2GY7B 3MNVB 4NQCB 4ZFFA 2AJVH 3DTXB 5ICXA 3GHEH 4PJ7F 3G9AB 5D8JL 1U3YA 4Z0XB 2CLVB 2XIDA 4U6YA 5ERWB 3TVMB 3BEVB 3L95A 1UT9A 1I7UA 4PJIA 2FZ3A 4LSTL 4OZFG 5CJOL 2C4FT 1H3TA 3MCKA 1G7JA 4XGZB 3R8QA 2Q3ZA 1MFEL 4PJAE 5JIIA 2FX8L 4LARL 3T0XA 1FO0A 2NY1D 1A22B 2C7UB 4OCMC 1DQML 2EYSB 3HNSL 1CR9L 3JWDL 3BZEA 1BEYH 2WWKT 2VC2H 4JKMA 4KMQA 5DFWH 3PDGA 1P1ZA 5EC1B 4NIKB 3UPRA 1CF8L 4AEFA 1HWGB 3X3GH 3JTSA 4OCRH 4TOYL 2Y25A 2BVQA 3MGTB 4DUVA 2W9EL 4O5LL 1I9JL 4I9WE 4IDLA 2ADJA 3SE8L 3RIFK 2Z35A 4X5WB 3ULVD 2VJXA 1JZ3A 4N0CD 3T2OA 1MHEB 5HTSA 3VXNA 4RSVA 4PB9H 1HKLH 3OR7B 1JGDB 4EQ3A 4XVUD 5HDBF 1IE5A 5CD5C 4JY4A 1UWGL 5F6HI 4E41E 4G6FD 1TMCB 3AAZB 4TUOA 3RY5A 3LKRB 4WI2A 4OBRA 3REVA 4U1KB 5A1AA 3VWKD 3WBDA 2NR6D 1A6WL 4X5XB 3RJDA 5JLZA 4FQXC 3QXAB 4JRXD 2B4CH 5MHSE 3HCVA 3C60B 1HYSC 1G0DA 5LGJA 1JGEA 1NUDA 2Y07L 2AK4D 5D71H 1X5HA 2VDQL 2DB8A 4NN5B 5GRVL 1ADQL 4JVPA 1FNEB 4XX1E 1FO0H 3OXSB 2VERN 3N1GC 4XXDB 1S9VA 4MQ7B 1KT2A 3EYOA 4MD4B 3NTCH 4V1DE 1WF5A 4HWZA 1UCBL 5D1XA 4OLUH 1J1PL 2Z31A 3JVGC 2EEBA 1NBZB 5K93A 5BZWB 3QO1A 3SGDI 4KVCH 5IEKB 2VL5A 2NXZB 3ULUF 1VGEH 4YHPB 3KYAA 2AV7A 3GMRA 4QXTB 2VRAA 3T4YB 3WJJA 1QVOB 1G7HA 3KPPA 5D1QB 1MREL 3C5ZC 2GTWB 3QO0A 2Z4QA 3LEXB 3UBXG 2NY3C 2A77H 1ZV5A 4ORGB 4I4WA 3INUL 4IRJB 4F8TA 2D4DA 2IAMA 4U33A 4H25B 5MERA 4RDQF 1INDL 1JNNH 4U1JB 5HVGB 4CVXB 4PJGE 4QXUH 1MCRA 4ZD3L 4O4YH 4ZYKA 5SWQB 3CDGB 5CZKA 1FZOB 2L7JA 5DJZA 5ABDE 1ZHBA 5EOTB 1AI1H 4JO4L 1UWEH 2IADA 2X1OA 3LRHA 1W8OA 3RPIA 1IMHC 3H7LA 1OSZB 4NBZB 1MI5E 5DXWA 5FXCH 4J4PD 4RMTA 1T1WA 4C83A 3NOIA 3MRQB 2VDNL 3BESR 3QBTB 4P2OD 1YNTB 4DGVH 1OCWH 1UACL 1XGRA 8CGTA 4DGIH 2WBWB 5DYOA 1CLOL 2VQTA 3V4VH 1E4XI 3S35H 7CGTA 4DFIA 3HR5A 4IJ3C 5E2UL 2FJHB 4AENB 4NRYA 3U9PH 1NQBA 3OPZL 3OWEA 4LVHC 4NCDA 3MXWL 4Q0XH 5INCA 4U6XB 1NGZB 2GUOA 1IAOB 2I60H 4NHCH 3TO2B 4NQVA 1REIA 2IH1A 3GBNH 3W2DH 3C5JB 3BD3A 1S7RA 1CDIA 4JN2A 1CN4A 5AEAA 3LN5B 1HIML 1UJ3A 3HE6A 2MHAB 4FZ8H 3ZE2F 1GZPB 1JVKA 1NC2D 3BMWA 2JIXB 1T1ZB 5L2KD 3MCG1 3EJYD 3D87B 2CK0H 3QUXC 3LQZB 2FIKA 4U0RC 2VDLH 2BNRB 3QQ9D 4WHYH 5GGUB 2P5EA 2FSEA 4XT1C 3VXRA 2VXUL 4PRNA 1A6ZB 1NL0H 4YHKL 1KACB 1JPGA 1NSNL 4JFYA 2FO4B 1AXSB 1WZ1H 3D85A 3TNNA 2B2XH 3PP3H 2AABL 2GAZA 5C70A 4PRPD 2R56L 3BPLB 4S1QH 4OZHB 2H8PB 2B39A 1A3LL 4R96A 2I26N 3U83A 5I8OL 2DTSA 1QG3A 2I27N 3PL6D 5BVPH 4YFLF 2NY2D 5IFHH 5MEQA 4KZEH 1Z5LB 2Z92A 4ZS7L 1FRGH 1YEKH 4X7CC 3AM8C 5IVXF 3N06B 4WW2B 1AD9A 2P24A 1FDLL 2YPLD 3WFDH 5T5FH 1MNUL 1J8HA 4OZGA 2Q6WA 3GIVB 3LEVH 4FMKA 4WY7L 3HR6A 2VISB 4OD2B 4CVUA 4W4OA 5F9AC 1NKOA 5AZ2H 5HYJD 1X5LA 3CVHL 4NNYA 3K2UH 3VXSB 1XF5B 2ZKHH 4Y1AA 2HVJA 2FEDD 2J5LC 1ZAGA 3UXFA 4KTEH 1V05A 4HX1B 3FT3A 5KN5A 2HKFH 2HLFD 4QCIA 1CQKA 3AS3A 5BZDB 4J8RB 3UTQA 4M6OH 1QNZL 3IJHA 4LSPH 4PG2A 4L4TB 1KOAA 1UG9A 3F12B 4MHHI 2HVKB 3TNMA 3UJJL 3UTSE 3TF7C 4OD1H 1R24A 4P9HH 1ZLVK 1TTUA 2AEQL 6CGTA 4LQFL 4PRHB 4WGWB 4HZAA 5DD1L 3HAEH 4KJWD 1U8QB 2Y36L 3QHTC 2AK1L 2Z31C 2QSCH 4LSVL 3AUVA 3U7YH 4XPBH 1E4WH 4NO0A 1IZJA 2W59A 3AREC 4CADB 1C1EH 1LO0H 4P2RE 3RAJL 3RTQB 3UDWA 3RWHA 3BQUD 4M93B 4R26H 4EDWL 1IGMH 4ZFOA 3RI5F 2OM5A 4YHYC 4Y16B 4S1DC 3H3PL 5JMOC 4JFPB 3FOMA 4BQ9A 3IFLH 3MNWB 2IAMC 3C87A 5CINH 3BW9B 2Z91A 3VJ6B 1NCDL 5HGDA 3DROB 4Y2DD 1VESA 4LDLB 3VA6A 1AO7B 1N6UA 3TA3B 4XCYB 4IOFD 3ZE1F 2BX5A 1MFCL 5FYJH 2DI8A 4HJ0C 5H8DA 3D39E 2NLJA 5B4MC 2VDMH 1F4YH 5F70A 2XWJA 4S1RH 1W0VB 4HBQA 2VDOL 4L3EB 5E8NA 4XP1H 2K3TA 4KFZC 5C0AD 1PY9A 2AI0H 4M7JH 4ONFL 5INDA 4C59B 4PJFE 3QDGA 5DLML 1T66D 3HZYB 1A7BA 2W9DL 2XN9B 4ZODA 3PGDA 5CCKH 4JFEE 1I8LC 4K9EC 1ZHKB 3VFMA 4CVZB 4Y19A 1OD9A 2CQVA 1BMGA 1Q0XL 3O9WA 1HHJA 1YMMA 4HK3N 5DMGD 4WWKA 5KVMC 1KULA 4GS7B 2ARJB 3I2CH 5DD6A 3FQRA 1YPZF 4MGXA 3KLAA 5I1IL 5H94B 3ELAT 1FVEA 1WZLA 3QQ4A 4BA8A 1P6AB 3VH8A 5TE7H 3S35X 1RUQH 3GMMB 3VFRA 1K8IA 5D7JB 2R2EB 5IROA 4F7EA 5JPMB 1U36A 4FQLL 3T3ME 4M7ZC 4JO2L 4XNZC 4U31A 4X6DF 4HLJA 1U3JA 4WIQA 2XWBA 1YEEH 3UX9B 1YNKH 3GSNL 2PW1A 2DQJL 4WJ5B 1U8KA 4MXVE 1BAFL 3DUSB 1NAKH 5FUCC 2D7PA 3EHBD 3PGFH 5DWUL 3QUZD 1OSPH 1IL1A 4MCZA 5BXFB 5C71A 3MODH 2G5BA 1L0XA 5DTFA 3BVNA 4FFYL 4NO5A 5GGQH 1F3DJ 5D7LA 1EX0A 4I2XB 1YECL 1JFQH 1T3FA 3A0OA 4LCIH 3RWIA 4R7DA 2VIRA 3LY6A 1PW3A 1ZLSH 3PWLA 3VWJD 3TBSA 4JJ5B 1I9IL 4NJ9L 3NIDE 5CEXA 2FX7L 5FM5O 4OCYH 4Y4KC 4ZQKA 3FQXA 4P5KA 5KVDL 3T2PA 5EOQL 3KYMB 4WWID 4XNXH 1U8IB 1UXWA 4ISVA 1ONQA 4XVTL 4HS3B 1G7QA 3L7EA 1A9BB 4HIJB 1DQJB 1I7RA 4LGSB 3S4SA 4I5BA 1RSFA 3UPCA 4XCEB 5DD5L 2APFA 5ITFA 3D9AL 4YE4L 4WO4D 5E08L 4XVJH 4WW1B 3LZFH 3UP1A 5GZOC 3U4BH 4HGMA 5DRXA 2D31A 1T1YB 4KXZI 3O11A 4NGHL 2QADD 3TV3L 4LSQL 1OT1A 2J8UF 4DKEL 4DTGH 4JFFA 3RVWD 1NCNA 1T0NB 5DGQA 3GSNB 4QYOA 1LDSA 3H9SD 4GG6F 4NKDB 1GL4B 2ZUQC 4UDUB 4JFDB 4P3CL 4ZUUA 2H26A 5EZJA 2W92A 1IJ9A 4Z7UF 3T08A 3FB6B 5CBEA 1CLYH 2V17H 1KTRL 4OV5B 4Y4FB 1P7KA 1FGVL 2XTJC 4GJTB 1HINL 3ARSA 3PDOA 1FFQA 3KYOB 4NWUH 5T1MA 1QSFD 3WEXA 5EZIL 3H7BA 4PGDA 2XRAL 1UKSA 1DN2A 5BJTA 2CXKA 5LWYH 3E3QE 1ZANH 5EFIB 5E9DB 3NABH 4ZPTB 2PKDA 1MJJB 1QFUL 3T0BA 3NCBB 2VSCA 2HFEA 3O3BB 1N7MH 3ROOB 2V9RA 2E6JA 3DOSA 3WLBA 5JR1H 5E03A 5IF0A 1NANI 4OFDA 4UT6L 1IC1A 3KS0H 3IXAB 2XWTB 5DSCA 3ULSB 1KB5L 2DLIA 3WHE1 2VDRH 1RUPL 2HFGH 5F93C 4Z78B 3W0WE 4Z7OE 3MNZB 4QRTA 1OLZA 2JK5A 5GS0L 4UBDC 4K3HA 3TZVA 3TIEB 4POUB 3SKMA 2DYPB 4XB7A 3VFPB 5EZOL 4D9RE 4NQDB 1JBJA 3GEWB 1GIGL 5C9JA 4UQ2B 2X9XA 3THML 4R8WH 1T20B 2OTWA 1I1AB 3QNXB 4MQXD 5FO7B 1EV2E 1WBZB 2XZAH 3P9MA 4Z7VF 3WKML 5EDXA 1INEH 1Q9KB 1A7PL 3L3JB 4ZFGH 1EMTL 5KANG 5TDPB 5LCVH 4LDEB 5C0CD 3RX7A 5A3IC 3SGJA 3KJ6H 3CVIH 5DT1H 3VD5A 1G6RA 4OZFB 1Y18B 3GI9H 5IFAH 1FAIH 4ONGL 2Q7NA 3HMWL 3VXUB 3BZDA 4NQCE 3RNKA 5TE6H 1CFTA 3O9WC 3FN3A 4U1GB 2PW2A 5C0ND 1KPRB 2YR3A 1MH5B 1DDHA 3V5DA 2XI9A 2X4QA 2OSLA 1UWXH 3LD8B 4MZ3A 5ITBH 3L9RB 5FGBA 4PV9A 4P4KD 4JQVA 5DC4B 4LSSL 4LKXA 5IROC 4AH2A 1EHNA 5CGTA 3SOBH 3QWQB 1UYWH 3N9GL 4G9DB 5K9QI 4KKBC 3O41A 3ULUH 4JRYD 1WZKA 4G8EA 4GSDL 1WCBA 4WI6A 2B0SL 4MDIB 5DJ8B 3BUYA 3MRKB 4QOKD 4PUBL 1NBQA 2PYEB 4M3JA 4P3DA 2XZCH 4D0BA 4MVBD 4FFZL 1JZ7A 3MJ8A 4L4VA 3MRFA 4QY8A 1KPUA 5FHBH 3ABZA 2BNQB 1GGYA 1D5IH 4F3FA 1N6QL 5ECJE 3SDDA 3VH8G 4OLVL 2R0KL 4EKXA 2HWZL 5EU7E 5DMKB 2DQUL 4ZNEE 3TFKD 3VWKA 2VB5A 3WLWC 1OTUD 4HIIB 1ZGLP 1G6RH 1CICC 4NUGL 1A9EA 1LE9A 4G8FB 4JRXA 5I16B 1K85A 5D7SL 4YIQB 1D5XA 2JJTC 3UJIH 2AK4A 2AJVL 3HG1B 2I9TA 3GHEL 2OXHA 3RL2B 5IR1A 1MFAL 4OF8A 3R0MA 1DEDA 5I1EH 1EUUA 4OLXH 3WUZA 4FNLL 2FR4A 3OHXB 3OR6B 4YEFA 1SBSL 2DJ4A 1U58A 4RX4D 4XCNB 1E27A 2AXJA 4EUPA 3QQNA 5BW7C 4HUVA 3TLRA 5I75B 5IVXA 4LLWA 2ZUTA 2KZ1B 4LPCA 3QJFA 4MWFB 3UBXB 4AQ1B 4NFBA 1OTSC 3NA4A 4EDXA 3FT4A 5IFJB 1C16B 4AQOA 3BD4A 3QPXH 3BGFC 2C3XA 5IIEB 2RHEA 2AXHA 3VMNA 4F7PA 1S7VA 3R06A 4NSKA 3KPQA 4XC1H 4F9PC 4XRCA 5GS2D 3KPSD 5D2NB 5FAAA 1KV3A 3ULVH 3S4SG 5AZEH 1PX3A 4YK4B 3QIBD 5TGBA 1ZLUH 4UTBH 3VXQB 5F9JB 2X4RB 3CH8A 5IT2H 5KVGH 4AM0A 2AEIT 1TVDA 3CSYA 4MD5A 1PD6A 3HZMA 1IAIM 5I1KH 3O6FD 3CLEH 1EO8L 3SDAC 4PB9L 3QNYB 3MBED 5IBTH 3CPLB 2X41A 3FQNB 5DUPL 2X4OB 4I48B 5LJYH 2Q20A 1RZFL 3IETA 3S96A 1QFOA 3BX7C 4A6YL 1M4KA 1OP3K 3K3QA 3RWCB 4PRID 3L5XH 1MRFL 2B4CL 3RRQA 2EDOA 2KBGA 4M4PA 3HE7D 1F6AB 2YA1A 1CFSB 2PXYD 4RFEB 1FO0L 2WUCL 1AGCB 2X70B 1H3PL 3MA9H 4R0LB 3TCLA 3NTCL 2AJSH 2FDBP 4WI5A 1SEQL 5J11B 4OLUL 3B9KA 3Q1SL 2A6IB 3IDMB 2IAND 4UIKH 5CEZL 3GSUB 1B4JH 1KEMH 1RZIA 4U2YA 1IC5H 5EIIB 1CD8A 5TF1H 4NBXB 4EOWL 4UV4H 2C5DC 1NC2A 5EO0A 5IMOB 4HMEA 4WI7A 1A7RH 2ZSWB 4OGXL 4D8PB 1EO5A 4H0GA 4J3XA 4HBCH 4OCLC 5BVJA 4TSBL 5TQ2L 1AY1L 1GGBL 4KJPD 4KRLB 2P43B 5DHXB 1T21A 2BNRE 3IVKB 3MFFA 3TCXA 4NN6B 2WWMD 4CVWA 2O5ZL 2IMNA 5D6CB 4DCQB 1X9QA 2ENSA 4PS4H 2DQFA 3M8OL 1RMFL 3O2WH 5IBUG 3EGSB 3O6KH 2RIKA 2DAVA 4PJEF 4ZFFB 5IJKC 4PP1D 5ICXB 3L1OH 4PRPA 5F21B 4U6YB 5TDNB 4JKPH 5ICZA 3L95B 5EWIH 1I7UB 1YPZA 1G7JB 5D93C 5HI4C 2P1YA 3PL6A 4ERSH 1IARB 4IRZH 1Q38A 3M17A 3MUZ1 1FO0B 4OZHE 3L5WA 3T4AB 4ZS6C 4GUPA 3BZEB 4GKOA 5H35A 2F8XC 4G5ZH 4DGIL 1XIWA 1YYLH 3VGAC 2KUTA 2YPLA 1A3RH 3V4VL 3GB7A 1RHFA 1NMBH 3SDDC 1URLA 3UTZB 4KDTA 4PY8I 2R4SH 5EO9A 3UPRB 5LBSL 1OL0A 3OJVC 4LNVA 4XAWL 2JJSA 2DQGH 2NXYC 1FVCB 5HYJA 4FQCH 5GPRA 1A8JH 2BVQB 1CDUA 4NHCL 4HC1H 2YZ8A 4BUGA 3GBNL 1MCHA 3W2DL 1DBJL 3CX5K 2ADJB 1Q9OA 1C5BH 2IALA 4DJMA 2Z35B 4Q7DA 5IBLC 5IGXH 4ELKB 3BO8A 3BP6A 4OF0A 4ETQA 1NUNB 3IKKA 3KJ4C 3VXNB 3BAEL 5IW6A 2GK0A 4HPOH 3HI6L 4XWGH 1IAII 1LNUB 2CR3A 4L4TE 4JY4B 1N3NB 1TITA 4TUOB 2OCFD 1FV1A 1QRKA 5I74C 3REVB 4PRHE 3BIKA 1IQDB 2MWCA 3C8HA 3ZTNH 1NL0L 5JLZB 1X44A 1MJ7H 1F4HA 2QQLL 1XF2B 1RIUL 2MQ3A 5TPWH 3BQUA 3CIQA 5LGJB 1JGEB 4CL7A 3L5HA 2OS7A 1X5KA 2PTVA 2A1WH 2BHYA 4S1QL 1GH7A 4HFUL 5FGRA 1KT2B 3EYOB 3B9EA 4O9HH 4RGOH 4HWZB 2J8UA 2EDWA 4UT9H 1U3HC 4Y2DA 1QSED 1IGFL 4UINH 5D1XB 2HT2C 5I8EA 5L6YH 4YHOH 4N9GB 3QFDA 5AWNL 5AG8A 3LMJL 4GG6A 1YEKL 1J1OH 1KLGB 4JVUA 4GG8A 4EUPG 3NN8B 1AO7E 4Z7UA 3QFJD 4L4JA 5J0BA 5DA0B 2AV7B 1N0LA 3GMRB 3T09A 4HKJA 4KV5E 4NC2B 1G7HB 3KPPB 4U1NA 4YZFE 4RA3A 3QO0B 3IFNL 2Z4QB 3RVVC 3SDXA 1QR1A 1FZMA 3BOVA 4FQHA 3X17A 1QFHA 4I4WB 3GMQB 4D9LL 2A0LC 4L3EE 5MERB 3ZDXF 1QLRA 2AW2A 5D6DC 2ZKHL 4KTEL 5C0BA 5ALCH 1X5XA 3NCYS 1E6OL 3GDBA 2XN9E 5JXAH 1T2QH 4WHTA 3MC0A 4ZYKB 4E5XA 4ETYA 2VDKL 5DJZB 4LCWD 1ZHBB 4P9HL 2IADB 4NQSA 5KJRH 2QR0B 4HKXB 3RPIB 4JLRB 3VE0A 4PJDA 3C09C 2V2XA 1PKQA 3IAGC 3B2VH 3B9KC 2QSCL 1PLGH 3U7YL 1E4WL 3GO1H 2Q76B 1J0KA 1NBYB 5IQ7H 1U8OA 2FECI 1C1EL 1HQRB 1LO0L 2JELH 2HFFA 1XGRB 2OTUA 4OSUH 1QYGH 1D5MA 4Z7VA 4E9LA 3WS6A 1WTGT 1I3UA 1MVUA 2JF1A 2BK8A 1V3KA 1FSKC 1MPAL 3IFLL 4NRYB 1EHXA 1IQWH 5CIPA 2WW8A 1VPOH 1CGSL 1YEFL 5INCB 3EJJX 3OX8A 4JG1H 5F7DA 3EO9H 3ARZA 1SYSA 3QUZA 2GUOB 4S0TD 4NQVB 2X10A 4XI5D 4XHJC 4OCXH 5L8JB 2GSIA 1C5DB 4N68A 5E2WH 1S7RB 3MOBL 3MO1A 3TM6A 3CK0L 3F7YA 4OJFL 2R0LH 3P73A 3QR2A 3QEGH 5CUSL 1RIVH 1UJ3B 3HE6B 2VDML 4JDZA 1OP5K 5JW3L 3CAFA 4RFNC 2YD4A 1CFBA 2DI9A 5I1AA 2PR4L 3LN4A 3VWJA 4I2XE 5D72H 2ORBL 2RGSA 1JHLH 2EXWC 2FIKB 2QBWA 2QLVB 2P5EB 1BIIA 3ALPA 4G6KL 3LKQA 5C0JA 3R0NA 3D25A 3VXRB 1KCRH 4PRNB 3D5OF 2OJEA 4AL8L 3KYNA 4XPGL 4JFYB 4XP9L 3PABA 3B43A 3G6DH 3D85B 1RJCA 3TNNB 5JW5A 5F44A 4BQCA 4MJ5A 2GAZB 1PSKH 1OAQH 1TENA 3IJSA 2W65A 4R96B 4GQ9L 4MNHB 4OIIH 3FRUA 3MROA 4C4KO 5TE7L 3HPLA 1RUQL 1C08A 4MNGA 5GGRA 3ARFD 5MEQB 4IRSD 3L3GA 1ZVYA 2Z92B 1Q9LA 2VZOA 4MAYA 4O51B 4W81A 2C1PA 2XACC 5B21A 5FYKL 3P4NB 1AHWA 1GPOH 4QXGH 1J8HB 4OZGB 1ES0A 4JFDE 3TO4C 43CAA 3CLFH 2Q6WB 1JUFA 3QIUA 1QSFA 4DGYL 4O2EB 4Z77A 4U7SA 4TQEH 4MA3A 1NKRA 4NNYB 3IDXH 1SQ2N 3MODL 4K3EH 4Y1AB 2K7QA 1TJGH 1HHIB 3FHQA 5E6ZA 3IU3A 3KLHC 5E9DE 3FT3B 2XG5A 5KN5B 4QCIB 3VD9A 5HGGS 3UTQB 3VRJA 3IJHB 3V0VA 1H8OA 2AVGA 3SN6N 4JAMA 1H5BC 3TNMB 1M7DA 1QKZL 4PIRF 1R24B 5HVHB 1E0OB 3K1KC 4MA1B 4NYLA 5JMRA 2EDEA 2YD8A 3UTPE 2H6PA 4Y4HC 4NZDA 3VMOA 4DK6A 4P9ML 4NWTH 4YXKH 4NO0B 4R2GC 1INQA 2V7NB 4MCYA 5K33A 3ZYIA 2FATH 5CJBA 3RWHB 2JB6A 4NQDE 3RVUD 1MCWW 3MRMA 4P59H 4ZFOB 3VW3H 3TBYA 3U4BL 4RZCA 1OQOA 3FOMB 3ARXA 4WUUA 3F65A 5LXGL 3BXNA 2Z91B 4MLSA 4ZXBC 2BNUA 3OKMB 3X13B 5HGDB 5CHNA 5C0CA 1CXLA 5L9DH 1EJ6A 3IDNA 4OZ4A 1UKTA 3Q48A 4PR5A 4R97B 1TTGA 1CU4L 4C4KT 2NLJB 4EI5C 3GUTB 3V4UL 1CLYL 3L3IA 2XWJB 1XGQA 5GGSY 5E8NB 4W4NA 4F15B 3VXUE 4NWUL 5C09D 3NBNA 1JMZA 4PJXF 5INDB 4UOW0 4PJHF 3ARBB 4WEBH 5EUOF 3QDGB 3IYLW 3DMMC 4RRPG 4L8BB 4P4KA 1QQDA 3PGDB 1N7ML 5E6IC 4WFGD 2IJ0C 1XF1A 1RI8A 4BFIA 4OI8A 4JRYA 4Y19B 3TH3T 2F54A 1KCVL 3EYSH 2BDNH 4QOKA 3PJSA 1H15A 2HFGL 1HHJB 3MACH 4WWKB 3VFWA 2EYRB 4YDLB 5DD6B 1MJ8L 3FQRB 4QRRB 2RCSH 4WFHE 3KLAB 3WFBL 4LGPB 5MEOA 3QQ4B 1FVEB 4QNPE 12E8L 5J13C 2PYEE 4KKAC 3VH8B 4H8WH 3WSQL 3VFRB 3H0TA 4LSRH 1K8IB 4GLRH 2OQJA 3KXFD 5I18H 4F7EB 4R8WL 4KUCD 2BNQE 3CX5J 5I1JL 5FYJU 3A6OA 4KJYA 5LGHH 2XWBB 5DZNA 3IFOB 4JREC 1U8HA 1INEL 3BJ91 4HMDA 4XMKL 3FQWB 2PW1B 4Z5RA 1U8KB 5T1LB 4ZFGL 3P4MA 5LCVL 3H2WA 1CLZL 4OM1H 2ILLA 4JR9L 1R3HA 3KJ6L 3MGAA 3ZHLA 2G5BB 3KPRA 4M4RA 1KCSL 4YO0A 4BQ6A 5DTFB 3OMZA 1FAIL 4NO5B 2HT4C 4NNXA 3MLZL 1VDGA 5KSUA 1P2CA 3RWIB 3HG1E 4R7DB 4RX4A 4HGWA 4I3RH 2VIRB 2QV2A 1CXIA 3TBSB 3RNQA 4CNIA 5CEXB 4GRWF 3LSOA 4ZQKB 3GKWL 4M62L 5F88A 4P5KB 5ITBL 3FZUC 1NGQL 4YHIB 4P23C 4XZUA 3JZ7A 5FO9B 1UXWB 2JCCE 3O2VL 4ISVB 1AHWC 1OVZA 5C0GA 3D0LB 1G7QB 1I7RB 3S4SB 4I5BB 2NYYC 1JTPA 3TP4A 3C8KA 5ITFB 3ULUL 5HHVL 2ICWB 3CZFA 3UYPA 1P6FA 3QIUC 4PJ8C 4PRDA 5I8KH 1BVKB 5HXMA 1S3KH 2ICEA 3MLRL 3QIBA 1KG0A 5DRXB 2D31B 4ORZC 3T2NH 5TQ0L 1A02N 3O11B 5EPMA 5D2NE 3RA7H 4NN7C 1BD2D 2C4FU 2YD3A 4N1CA 5F7EH 2ERJB 4JFFB 5C7XL 4JPWH 4LHQB 5IHBA 2JJVA 5IG7A 2BVTA 2W0LA 4QYOB 1MELA 3OGCA 3S7GA 1NGPL 5F96H 4YHZH 4ZUUB 5ID1A 2H26B 5I66B 3LPFA 1P7KB 3MV9D 3PDOB 1G6RL 2YOCA 4PRIA 5T1MB 3WEXB 4QGYA 1SJEA 3H7BB 4PGDB 4LIQH 1J9CT 5BJTB 1MVFA 2CO6B 2D03H 3HE7A 4X6CB 2MQ0A 5C9KA 5DEGA 2LAGB 5DEFB 4AIXA 2YWZA 4UNTA 2NY5H 2VUYA 2HFEB 4RWYH 2PXYA 4F8QA 1N0XL 1KTLA 3WKNA 3T2QA 1LD9A 4H8WC 5DVOA 3WLBB 4FXKB 3OAZK 3E0GA 1TZHA 4JHWH 4HAGA 1F5WA 5DSCB 1JF6A 1XEDA 2DQCL 4WHDA 3SE4A 5SX5K 4X9FA 4U4BA 3VFGH 1TVHA 2IANA 4QRTB 2JK5B 5IB2A 3TZVB 3HKFA 3SKMB 3NFPA 3QUKA 5GS2H 1IEAA 2V7HB 4N0UA 3LV3A 3SKJH 3QAZC 2A6KA 5C9JB 3QPXL 1OAYH 2R29L 3STZA 1AC6A 5ILTH 3WE6A 2OTWB 5IP4A 4P4RA 3P9MB 1X5ZA 5C2BH 3ULVL 1JWSA 4HUMB 4JG0H 5I76A 1Z9MA 3LRSA 4UTBL 3QPQC 3EYVA 5DUBA 4YQXL 5KAQF 1I4FA 4G6JH 1RZ7H 2AV1B 1A6VH 2DQTH 1JIBA 4FQ1L 3CLEL 2WZPD 1KNOA 1Z2KA 1G6RB 1MCEA 4YBLC 5IBTL 3EW3B 3VCLA 3FO1B 4Y7MA 3RNKB 5I1GH 1CFTB 1JN6A 2PW2B 1DDHB 3V5DB 3P0VH 2NX5E 5HSFA 5JNYA 3V5HA 2NY1B 1WFTA 2OSLB 2FX9L 2X4QB 4MAUH 1YEGH 2C3HA 5DJYB 1RZKH 1SBBA 4PV9B 1C5CH 4AEIH 2NY6B 2X89D 4KTDH 4UNUA 1T5XB 4WU7A 3ARVA 4KPHH 5JHLH 5HVFB 2EDLA 4CJ1A 3O41B 4X4MA 4G8EB 5L7XL 4UTAH 3C6LA 3FKUS 1YMHA 4I8DA 5CEZE 3BUYB 3AXLA 1TETH 1HZHH 2VYRE 4JO1H 5E1AA 4P3DB 4D0BB 1F6FB 3MPCA 2WBJA 3MJ8B 4L4VB 2YPKA 5JXED 1U2HA 3MRFB 4QY8B 1KPUB 4UILH 2VAJA 4UV4L 3CCHA 2J88H 1A7RL 3LOWA 1VFAA 4G80A 4F3FB 2GT9A 2VWEC 3G6AA 1Z9OA 3BGAA 2EYTA 2FJGA 3TESA 3BISA 4PY8J 4B53A 2CUMA 5I2IA 3BRFA 4G6FB 1VB9A 2E9BA 1JPTL 3B6SA 2AJXH 3VWKB 3CMOH 2J6EL 4X6FA 4UU9A 3TH2T 2ATKA 4G3YL 1A9EB 1V7MH 4DKFH 1HI6A 4JRXB 1OD7A 3GRWA 3KGRA 2NXZD 2HJLA 1D5XB 4PS4L 3BE1H 3BPOB 4HIEB 4H26A 1VEOA 2AK4B 4JN1H 2I9TB 3L1OL 1M6OA 2HJFA 5D1QD 1DBBH 5IR1B 25C8H 3O8XD 1UM6H 4JKPL 3RJQB 2ZUVA 3H42L 4R9HA 3QDAA 2FR4B 1EDQA 1MCCA 4HK0A 1N4XH 3VFUA 1WUNT 2B1AH 3DETC 1QHOA 4NOFA 5BV7L 1HN1A 1UQSB 1QSEA 4H0IA 1OHQA 3MGOA 4EUPB 1MFDH 3SBWA 4PREA 1NDMA 2F74A 3SGKA 5ADOL 1FCGA 4HUVB 3P30H 5IVXB 3CDCA 4LLWB 4Q2ZA 5JDJA 3QFJA 1YYLL 2P7TA 3QJFB 1JYWA 2R2CA 1A3RL 1AR1C 1D9KC 5HJ3A 1WSST 4EDXB 3FT4B 3T0WA 4DOHB 1CDGA 3CH1A 4F7PB 1S7VB 2DQGL 3KPQB 2EDKA 1MIML 1GGCH 5HHQA 4PJBF 5C86A 4KUZH 2Y6SD 5BMFH 1LWRA 4Y5VB 1XMWA 4U1LA 2R1XA 2GJZB 3FJTA 5TGBB 2Z93A 2W91A 1NAMA 1EFQA 1G7LB 1C5BL 1NUFA 2DN7A 2IPUK 4TPRL 1D6VH 1O7SA 1EVTC 4AM0B 4LCWA 3CSYB 2VOTA 3HZMB 1NJ9A 1BFVH 4EBQL 1I7ZA 1MFBH 5DURD 1RZKC 4Z95L 2D0HA 2HLAB 4HS8L 5J1TC 5I15H 4HPOL 4XWGL 3QCTL 5HD8C 1YC8A 5F8QC 3GRWH 4ACPA 2E7HA 3EDKA 2MFNA 3P4LA 4KRPC 3IETB 1KELH 3S96B 4KI5E 4ZDHB 4KK6D 4HSQA 5MENE 3VGEA 2DKSA 3W5MA 2YWYA 2VWEE 1DL7H 4K8RL 1PZ5B 1TZIA 4JZOA 5AAWA 4G9FA 5DO2D 3OAYK 3WJLC 5CWSA 4NNPL 1YEHL 3TCLB 5KSAC 3NA9H 5GS1C 5KVEH 2DWDA 2FL5A 3QHFL 1JHKH 3CNKA 5E5RB 1R0AH 4PJ9A 1PDKA 1KTKE 1ZLUK 3OKNB 5GS3A 3ZKSD 4HPYH 4XPAH 4CN1A 3O2DL 1NC2B 2APVA 1N64L 2HH0H 5L2KB 2IQAA 1CIUA 4BH7A 5BVJB 1NAMH 1TCRA 4PJXA 1FPTH 2VLRE 2IFFH 3TN0C 3Q5YA 4OCSL 1MCLA 1L0QA 1LQSR 4JDVA 1T21B 2XA8H 3HI5H 1BJMA 5MP6L 3SGEH 1W72A 1Q94A 3MFFB 3S3PA 4N8VA 2P5EE 4N5EC 1T2QL 3IF1A 4LOUC 1T0PB 5E8EA 2F8VA 2DQFB 3VXRE 3SHSA 3O6MH 5FK9A 3I02A 3LS4H 4PRPB 3UO1H 1EHLL 5ICZB 3C6LC 2AQ2A 3B2VL 1CE1L 1YPZB 2KQNA 2XQYK 3BWAA 3FB7B 4ZTOL 3PL6B 3VXSD 1CE6B 2NY2B 2X9WA 3M17B 4IRSA 3L5WB 5SV4A 4KHTH 2JELL 4GUPB 3CFKB 4WUKL 5CJQH 1QYGL 1KIPB 4M7KH 4ZOEA 2YPLB 4L29A 4OQTL 4XNYH 1CXFA 3KPTA 5EO9B 1DQLH 3UBXI 5J3HC 3DECA 2JTDA 1N5AA 5DVMA 4OZGE 1LEIA 3K4ZA 1QA9B 5HYJB 3IKCA 1FVDA 1EH9A 5FYJE 5KBNC 4RMRA 3W82A 5E2WL 1F2QA 1C12A 2EIZA 2PNDA 1Q9OB 2IALB 2R0LL 3MUHL 4KY1H 1AQDA 4Y1AE 3BO8B 3BP6B 3AMLA 5CLWA 3KAAA 3SO3C 4RMUA 5D72L 4Q9QL 4WHCA 5IW6B 3OKLB 3OTTA 5FYLH 2GK0B 4MD0A 1W72H 3I75A 4X9HA 2G5RA 2V5TA 5FFLA 2QQKH 2HRPH 3S34H 3SBWC 1AE6L 4LLQA 3SGKC 3T0EC 1R3JA 1FV1B 4FG6C 4HJJH 4HQQH 3M1BA 5IHLB 5J12B 3P77A 2NZ9D 1KCRL 4Z76B 3B4NA 1J5OH 3WNMA 1LEGA 1I85A 4UNVA 5TE4L 3EFDL 2AS5M 3BQUB 1KJ3L 1VFUA 1ITBB 1TVBA 4R90H 4X99A 5IOPA 4M8VA 3P9LA 2GITB 1OGTB 1WT5C 2DLHA 2IBZY 4KMTL 3QUYA 2B5IC 5HDLA 3GMPA 4HZLA 4KVNH 1TQCB 2J8UB 4OIIL 4OIBA 4Y2DB 3TJEH 3HFMH 3PWVA 2VXVH 4I0CC 1FLTX 3ROLA 3QFDB 5FYKE 4GG6B 4XNQA 3MJ6A 3RFZC 4J6RL 3VDAA 4GG8B 4QXGL 4O2FA 2DLFL 3L7FB 1RULL 4HXBL 1BFOA 4HKJB 4U1NB 5DJDA 1N59A 2MCPH 1FJ1A 5C09A 3SDXB 5C0AB 4DEPC 1AFVH 1QR1B 4M5YL 1FZMB 4FQHB 1B0WA 4G42B 1A0QL 1UM4H 4YHMH 3QCVH 5F9OH 1QLRB 3P4OB 4K3EL 4JPKL 2E6QA 3QDGE 1QPXA 3KS0J 1LK2B 2DM4A 3PV6A 2W0FA 4WHTB 4E5XB 1F90H 1CDBA 2D7TL 5JOPE 3ME0A 4AIZA 3IFPB 4NQSB 1LP9F 3GBLA 1DQQA 3SCMD 3ARDD 5FA4B 3DVNA 3VE0B 4PJDB 1S5IL 3P9WB 3UYRH 4Y19E 5F3BA 2V2XB 1PKQB 3I3BA 2P5WE 1FFRA 5I1DA 4L9DA 1FFNB 1M7IB 5E8OA 4YXKL 3B3IA 3GNML 4QRRE 3BN3B 3NPSB 1U8OB 1LO2L 3KXFA 2HFFB 3OZ9H 2OTUB 4EXKA 2G75A 1D5MB 4Z7VB 4XAKE 1HQ4A 5GIRA 3SKOA 1MVUB 3DIFA 1S78C 5CIPB 3VRLE 5I0ZA 5AYUH 4TN9A 5K9OA 1RAMA 3T1WA 3OX8B 5JIPA 2P44B 5F7DB 3QUZB 1SYSB 2ZSVA 3QCUH 5B8CC 4MA8L 5DEZA 4QGTA 2GSIB 3MO1B 4I0PC 3F7YB 3P73B 1RK0A 4JDZB 2DKUA 3W9DA 4LK4A 1QRND 2FHCA 3VWJB 5JW4N 3AC0A 3FCTA 5LAXA 5D5MA 4HS6A 4BK4A 4JKWA 3BKYH 1IT9H 4WEBL 5EA0H 3TYGH 4PGEA 3WNLA 3WFZA 2OBGA 5E8PA 1MIEL 1VKXB 4R6UA 1BIIB 4HFWA 3LKQB 5C0JB 3D25B 2IH3A 4YXLH 3L3KA 1HNFA 4ZO9A 4LF3A 2OJEB 3KYNB 3WIIH 3BPNC 1FC1A 2X1PA 4KKCC 2E8ZA 3BSZH 3DRQA 3PABB 4X80L 4KI1A 2BDNL 1GC1L 5JW5B 4WO4B 4QRPD 4LCCA 3GHBL 3MACL 4PLOB 4M43L 1X6LA 3ARYA 3IJSB 1BD2A 2X05A 1PKOA 1QBLL 3BP4A 3FRUB 3MROB 4N1HB 3S3SA 1XZ0A 4MNGB 1C08B 5GGRB 3L3GB 1Q9LB 4LSRL 3DJ9A 4MAYB 4IIQC 2C1PB 3RVTC 1AGDA 4JFFE 5DHVA 1HCFX 2Q1EA 1PY4A 2AJUH 5LGHL 5HDQH 43CAB 4Q6IA 5J6HA 1JUFB 1QSFB 1IM3A 4QHKJ 5EU3A 4P48A 4MA3B 3MRBA 3ZLQC 4Y8DC 1FP5A 3DUHA 3SQBA 2NY7L 1FYTD 3R8BB 4M7LL 3X12B 3RY4A 2FBOJ 4X6CE 3ARGD 2R15A 3VRJB 3IRZA 3V0VB 2IBZX 2BSRA 4I3RL 1UZ8A 2BMKA 4JAMB 5GZND 4YJZL 1M7DB 5J6GA 2IPTH 5SWSA 5EG6C 1FBIL 35C8H 4CU6A 2EDYA 1MCOH 1A6UH 4LLYA 2H6PB 2NW3A 5I8CB 2JB5H 1OOAA 4O58H 2ZOKA 4ZOCA 2YD6A 4NDMA 1INQB 3EFFA 4PP2A 4MCYB 2YRZA 3ULUE 1XGYH 3HB3C 1JI1A 1TJHL 3MRMB 2F58L 5I8KL 2VABB 4RZCB 3QIWC 4OFVA 3TT3H 3O45A 3DURA 3Q6GH 4QHMA 3BXNB 2GKIA 1JPST 2EE2A 1U9KA 1GOHA 5F7EL 5SX4I 1GGUA 5CHNB 5C0CB 5BRZE 2ZG1A 1B6DA 3O4OB 4K2UH 5DQ9A 2FCBA 2Q8BL 4G7VH 2DQEH 4APQC 1R3KA 1EAPA 4K7FA 3PHQA 3KR3H 4PR5B 2BERA 5F96L 3S36L 5CSGA 3FO9A 3NH7L 2MKWA 4GT7A 4TSAL 3L3IB 5GRUH 5IHUH 1KFAL 1PG7L 1IBGH 3MLSL 3O3AB 1XGQB 5C6TH 4B7IA 1OQXA 3LKNB 5CSBA 5E0QA 1M71A 2G60H 1ZT7A 5CSZA 2D03L 4HWBA 1H3WM 4I0KA 4ODTL 2FEEL 4P4KB 1QQDB 2X89A 3NGBB 2NY5L 1BLNA 2BSSB 3EOTH 3WN5A 4P5TC 4BFIB 4YLQT 2B8OT 2DMKA 4JRYB 3KHOA 2F54B 4X9BA 5A2KH 1WVZA 3G5XB 3PJSB 4QOKB 1H15B 1YN7A 3VFWB 4J3UA 1IFHL 4PJAF 4J4PC 5JXEA 5D2LA 4QTHA 1TNMA 3H0TB 3I50L 1FL3B 4HMCA 2OQJB 4L4VE 4P2OC 1K2DA 4AEHH 2Y5TA 4AEEA 1FYHB 5TFSL 3ULVE 2VLMD 3K8MA 5BV7C 3KNBB 4KJYB 2C4XA 5CD5D 1U8HB 5BCAA 4BYHA 1RFDH 4RFOH 3HN3A 4Z0BH 5EULV 5JHDD 3JV4A 5JZ7C 1YUHB 1G7MB 3TIDA 1NFKA 4P57A 3VRIA 5JORA 3BDYL 1R3HB 3CGTA 2DQTL 4RIRA 5KAQG 1HYSD 1A1NA 4JRXE 4YO0B 1LO4H 1GYAA 4ZUSA 3O8XA 4HKZA 3T65A 5CZVL 4NNXB 5MEPA 5KSUB 4NZUL 2AK4E 5I1GL 4O02H 3ARTA 3I6LD 3TWCL 4HWBH 5FHAL 3LS5L 4CMHB 1A3QA 3IB4A 3RNQB 3P0VL 4CNIB 2HKHH 1QEWB 5KZCD 4MAUL 2I5YH 5E5MA 1HSAA 5F88B 2XZZA 4H20L 3BP5A 5I30H 5DK3A 5E4EB 1BFSA 3LVEA 4FN0A 4QHNA 5T3XD 3NMEA 3V9FA 4D0DA 2ADFH 4XZUB 5IVXE 1ZVSA 1CL7L 5I73C 1T04A 1KC5H 2A74A 3TC9A 2CO7B 1EPFA 2VXSH 5DRNA 3C8KB 4XXCA 2IG2H 3KPSB 3CZFB 4DOHE 1F4AA 1WISA 1UXSB 2X4UA 3VGGA 1HH6A 1HZHL 2ICEB 1WLHA 2MPAH 3ALWA 4GO6B 1X7QB 3QIBB 1KG0B 5DRWA 4PGJA 2OXGA 2AGJH 5I9QB 4LRIC 5F6IB 4AK1A 5AG9A 1JI2A 2CDFA 4K8RC 4LLUA 5IG7B 1QR4A 1A6PA 3OGCB 3MBEB 2OR9L 2AP2A 2ESVD 3BI9X 3H9ZA 3O0RL 3O3EB 4HEME 4LRNH 5JIKA 3OJMB 4F33A 3H9HA 2NY4C 1DSFH 4CMMA 3CD4A 3VFNA 4K3JH 4ODVL 3PXJA 3QI9C 4XPHH 3OKOB 3D18A 2ZNWA 4PRIB 1HHHA 5DI8A 1SJEB 1V7ML 3TBWA 4CRPA 2P4AB 5ISZD 3HE7B 1XR9B 3QWRD 1S7WA 2EDQA 4M6AA 5DEGB 3U0WH 4JQIL 3GSVA 3GI8H 4ZTPH 4X8XA 4HT1H 4PJGF 2PXYB 4LSUL 1KTLB 3QRGL 1UM6L 2P46B 4HCRA 1LD9B 2ZPKL 4LNRA 3I9GL 3SDCC 1TZHB 1Q0YH 2B1AL 1IGIH 3QEUB 4NQED 2ZJSH 5DHYA 5ENWA 2VN4A 3RIAF 4X98A 3PP4H 1TVHB 5T33L 1Z9LA 2Z0BA 2IANB 1VEMA 2WSKA 5IB3A 5IB2B 1QFWL 3NCMA 1JGVH 3NFPB 1AJ7L 3QUKB 1ZLVH 1J18A 1IEAB 4LPWA 4N0UB 4OT1H 3LV3B 4F7MA 2A6KB 1VACA 5M7QA 2VLKD 5EOCH 3STZB 2VZUA 2BFVH 4FQIL 1KSRA 1GGCL 1ZA3A 3WE6B 3V7AE 5DD3H 4P4RB 1CIDA 5GRJH 4EXPX 5L2KE 1JWSB 3IRPX 3QUXD 3E2HB 5I76B 4HHAA 3HMXL 4NKIL 3DV4A 3LRSB 5BQ7B 3AMKA 2BXZA 3EYVB 5DUBB 4CKVX 1G7IA 1I4FB 4LQ1A 3MRRA 5FB8A 2R8SH 3GM0A 5JIHA 1BFVL 4IOFC 1KNOB 4PLJC 1CFVL 5DMIL 1LP9A 4I13B 5FOBB 3MA7A 2VTFA 3MLYH 4XVSL 4MMXC 1JN6B 2EH7H 3MRCA 4PRPE 4QEGA 5D96B 5JNYB 2VXTL 3V5HB 5L0QB 2LVEA 1YPZE 1S7TA 3CC5A 2VQUA 3NCFB 4HCRH 4D94A 4UAOC 1T66C 2EC9T 3ARPA 4PTUA 1H8SA 1GGIL 4NM8L 2YS4A 4HIHB 2LVCA 4G8GA 3PWJA 4HULB 4WU7B 1XFPA 3SGDH 3ZZ1A 4GMTL 5CZXD 4OF3A 2CPCA 2OK0H 1Z3GH 2YPLE 3QJHA 1RQ5A 5HHNB 1FNSL 4ZAKC 5FOJA 1BQLL 2PO6C 5KVEL 2QTEA 5T5NF 1GHFL 1YMHB 5DDHA 3AXLB 1XGTA 1KCLA 4J3SA 1JYNA 1QFPA 2AXGA 2WBJ