2EKSB

Crystal structure of humanized hyhel-10 fv-hen lysozyme complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
QVQLQESGPGLMKPSETLSLTCSVSGDSIRSDYWSWIRQPPGKGLEWIGYVSYSGSTYYNPSLKSRVTISVDTSKNRFSLKLNSVTAADTAVYYCARWDGDYWGQGILVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-LYSOZYME ANTIBODY FV REGION
publication title Critical contribution of VH-VL interaction to reshaping of an antibody: the case of humanization of anti-lysozyme antibody, HyHEL-10
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/hydrolase
total genus 24
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2007-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2eksB00
5I1GH 2VLRB 3PQYE 3RUGB 2VKXA 3AS2A 4RIRA 2GSGB 2VLME 4I0PA 4QRQA 1C5CH 1PQZA 1RZ8B 4HUVA 4WEUD 2EDEA 1B88A 2WZPD 4PP2B 4CU7A 1LO3H 5MEOB 1HZHL 4E41A 1EO7A 4FTVA 3MNWB 1MFBL 5E8NB 1UKTA 3EFFB 4PJGF 4X6DA 4MJIA 4P2RB 3O6KH 2LAAA 4G9FD 4YBHA 4W4OC 4N0FA 4K8RC 1K3IA 4NO2B 5DJYB 2ITCA 4JFFD 2D7TH 3VGAB 3HRPA 1C5DB 3CCHB 5D1ZC 4OZFA 4CVXB 2IH1B 1DBJH 1DFBL 2ADFH 2HLFC 1YEKL 2Y1VA 1FFOB 2P44B 1KOAA 5IBUB 2EDTA 2QQLH 1KJVA 5BRZB 1HHGB 1C5CL 1CT8A 1QHPA 4KU1A 2G5BB 2FGZA 2A6IB 3O4LE 3W82A 5K9KA 1TETL 3NFNA 5GRVL 4YDLC 4XCCH 1RUKH 5T1MA 3KPNA 3VG9C 3I2CH 4RDQG 2AJVL 3BP5B 1M05B 3GKWH 2QJDA 3DRQA 2RCSH 1T0PB 2NY6B 2CKBH 1MRFH 2P1YA 5HYQB 4JHBA 3G6DH 5C6PB 5BMFH 3ZKND 4QXTA 4BFBD 4UDUA 4X8XA 5CGTA 5C0BB 2XY2A 3MLUL 4ZNEE 3VFVB 3C5ZC 3GBLA 1JWUB 1A3LH 1PG7W 4JFDA 1QP1A 3HZKB 4G6ML 1S7SB 4ZFOA 1EPFA 2ADFL 5D7IE 2DYPD 4HWUA 3UAJD 5C71A 5E2TH 1FHGA 5GSVB 1T80A 4ZSOB 1LMKA 4ETQB 4XCCL 1MI5D 3MBEC 4XGZA 1BJ1J 5CEXB 2CK0H 3OGCA 1NCCL 1QR4A 4XX1G 2F8OA 2E9BA 3HRZA 5EC2B 1KPUB 4F8TA 5BZDB 3DWTA 1HHJB 1R3LB 1HH6B 3CD4A 4LKXA 2CR6A 3SGJA 1FYTE 3VD9A 4MAYB 4X80L 4RX4D 4LLMB 5E9DB 3B8SA 1VACA 2O61A 2ATPB 1SBBA 3H3KA 4ZAKB 1GOGA 5E2TL 1UJ3C 1PW3A 3VXMA 2ZOLA 4HEPG 1PLGH 3LCYA 2EZ0D 2XN9B 4HLJA 2A74A 5FO7B 3S4SB 5CSZA 5F6IC 3BMVA 4Y2DC 1A5FL 1MHEA 4MJ6B 1I8MB 1MCPL 4B7LA 1F4AA 1QVOB 5HHVH 2CK0L 1S5IH 4R7DB 4LBEA 4G8GD 3T09A 1PKQA 2DD8H 4PD4J 5EOTB 2F5BH 2NW2B 3KPOB 1P7QB 4KKNA 1CXKA 1ZT4B 3OZ9L 4QO1A 4HH8A 5IP4A 1OAQH 1U92B 1NEZG 4OF8A 3LIZL 2GK0A 1NH6A 1OLLA 4DKDC 1U3HC 1KG0B 3M17A 1NGZA 1TVHB 1WZLA 3IJSA 5F1OB 3D39A 3IDNB 2F53A 3ARXA 4ZFOL 1PLGL 3B3IB 5EO0A 3HCVB 1ORSB 1S9VB 3BDBA 3RWIA 5J1AB 2YPLE 4BQ9A 3DRTA 5F7WC 4HCRL 3K2UL 2PN5A 4KKCC 2B5IB 4YXKH 4E9LA 3LRSB 2AGJH 1YY9C 2VQ1A 3IU3B 5IFJB 8FABA 2D9CA 1FG2A 2F5BL 4XP6L 2CQVA 2IJ0C 5CD3A 3NABH 5A2FA 5GRXG 5K59E 1TJHL 2I24N 3JV6A 5IROC 5IIEA 3IDIA 2PF6A 1OP9A 4NJAH 4OZGE 1RJLB 4H1LH 4KMTL 4M48H 4O4YL 3RVVC 2DKSA 4QGTA 3AY4A 1RURL 1JPFB 4C56E 1GZPB 2GJJA 5EIIA 4HT1H 1GGIL 3T3PE 3GSUB 1LP9A 1WFTA 1XGPA 3IDGA 3MRQA 4RMTA 4HWZA 4XMLL 4APQB 3ZKXC 1F4YL 1EJ6A 1XF5A 5EA0L 3CFCL 2I26N 4BFEA 3MV11 4LLDA 4MHHG 3S96A 1ZK9A 2E5EA 4CMMA 2FEEI 3SDAC 2R8SH 1NGQH 2PTTB 4LLVA 3ROOB 2AGJL 4JRXA 4K7FB 2OQJB 3K2MC 1SY6A 3U7WH 1A1MA 3EYFB 5I1LB 3IKKA 1JUFB 3QULA 4L4VE 4PJ8D 1FFNB 2IPUG 3STLB 3U4EB 1U8NB 2DWEA 3V5KA 3U30C 5EZOH 3MNZA 1NCAH 1JGDB 4PJCE 4N9GB 4UQ2B 3H0TA 3QNYB 5JXEC 4FFZH 5IB3A 1DBKH 3P3YA 2UVFA 3F6IA 4M48L 2ZNWA 3SO3C 4GLRI 2FO4B 5DJZA 4PRBA 3KPSB 3U4BL 3UTSB 2WIIB 4WTXA 4FQLL 3VRIA 2E7HA 5FGCB 3W11D 1AE6H 1YEJH 4LQFH 4XP4H 3N0PB 3MMEB 4LVOC 4WO4C 2QQNL 4PTTA 5FV2A 3FT2A 1BBDH 2YWZA 5DT1L 3MV8D 4NZRL 1VDGA 4U0RC 4UTBL 5EU6A 3AM8A 1EUUA 1T5XA 5F89A 3U7WL 4L4JA 2BSSB 4PBXA 3IAPA 2WMPA 3GI9L 4J23A 1A7PL 1LO2H 1UYWH 4JO2H 1CZ8H 5KW9L 1EMTL 5DEGA 2ESVD 4Q9QL 3D3VB 4YDIL 3MOAH 1NCAL 1M6OA 3SDDD 1G1YA 2R1YB 5J11C 3QFJD 1MVFA 4XBGB 4KZDH 1V5JA 5DQJB 4FQQA 4JFYA 2NQCA 4BZ1L 3GSNB 3DSFL 1KXQE 3MUGA 3C8DA 1E4WL 4F15B 3RTQC 4A2MA 1ETZB 5H37G 4F58L 4MNGA 5HHXL 1MFDH 5MENE 3R06A 1FRGL 5D1XC 4K3GA 3MLVL 1OTUC 5IWLC 5L88H 2R9HC 2Z35B 3PWPA 1T03L 5BZWB 1NC2B 3DYPA 1EX0A 3OKMB 1SY6L 4P2RD 3B2UD 1N0XL 2L0DA 3S88L 4GXVH 5FECA 2IBBA 2D31B 1ZV5A 5FUCC 1JF1B 1HSBA 2BNQB 4M5ZH 4H88H 5DVKA 5TF0A 1E4XI 2LAGB 3BI9X 5T5NF 2EEBA 3WNLA 4RFOL 4DGVL 4L3CA 2BVOB 1F00I 4WHTA 2LQRA 2DOCA 4TPRH 4HPYL 5IM7A 2Q8BH 5E8PB 1WBYA 5FM5M 2WQRA 4IIQA 5D7KE 3T8XB 4F57L 1EJOL 2Y06L 4Q6IA 2Z9TA 3TBVB 1ED3B 1O7VA 2IH3B 1QKZH 2HVJB 4ZTPH 1CDUA 4XCNB 4UUJA 4WNQB 1J5OH 2NY6D 3F58H 1OF2B 4KTEH 1S9YB 3V6ZA 2PYEA 1H3XA 2VZVA 5C0BD 1NDMB 4JO3H 1JNHB 3T4YB 1IAOB 2Q20A 5IMKB 4IRZH 4M6NL 1UZ8A 4H88L 3LKOB 2H2PC 2R15A 3U0WL 4XH2A 5F21B 4JRWA 4CDHA 4OSUL 2CGRH 2YEZB 4FQ2L 1PY4A 4D2NA 4PLKC 9CGTA 4MD5A 2FH6A 3FQRB 4QXGL 3BYYA 1CGVA 4LRNH 4Y1AA 1CDJA 4WV1B 5BVJA 1CFTB 2A38A 1S78D 2WANA 3QUMB 5D2NA 1I3RA 3LZFH 2A9NH 4PJBB 4Z95H 1AQKH 3ABZA 1ZHBB 1YA5A 3GRWA 4JAMB 5DK0A 2A0LC 4IHOB 2EH7L 5DEZA 5JORB 1J5OL 5L9DL 4KTEL 1ZHLA 4NQSB 3HPJA 4DGYH 5ADPL 3O3DB 5I1DA 2IANA 2A77H 3GSVB 3RY4A 3QQ3B 5AWNL 2D7MA 3CVHA 4IRZL 4MAYD 2YSSA 1S7UB 3BRFA 1NCWL 3HNSH 5E9DD 3GZKA 4MXVF 3O3AA 1ACYL 4X5WB 4WW2B 5F6HJ 1A1NB 4M93B 3MGAA 4YDVA 4Z0XB 2ICCA 4ZAKD 1J8KA 3FQWB 3CFEA 3MROA 3KS0H 5E6ZA 4JPIB 2XN9D 3FN0L 1HYSD 4PRIB 1CN4A 4M7LH 5GGRY 4JFFE 1AFVH 2ARWA 2V2WB 3MODH 4HGKC 3GMNB 4OD1L 5H2BA 4M9PA 4Z95L 1LQSR 1B0RB 1XZ0A 1KIPB 2O93L 3BP6B 4P2QB 1YEFH 3KYOB 5F7EH 5IHZB 2NY4B 4KI5D 4PJXB 4YO0A 3WKNA 1M7IB 3IXTB 3SJVA 1P7QD 3GRWH 2X1QA 3D69B 3RIFK 5DO2D 3CSYB 4Z0BH 4UB0H 1MFNA 2EKSB 4XPTL 3RWDA 5GRUL 3LKSB 5JNYB 2E8YA 4TTGA 4Z8FL 5D70H 43CAA 5BV7H 3EYSL 2UWEB 3CVHH 5IBUG 4XXDB 1JP5A 3AS0A 3RIAF 5JW3L 1M71A 1DQJB 4OLYH 1AHWA 5EFIA 2ZUSA 4Z7VA 3BPNB 5HHOB 3OR7B 4H8WH 4JFQB 2GAZB 4HK3J 5H94B 1Z0NA 4ZD3H 3ARGA 5CEZH 5GPRA 3ULVD 2P8MB 1Z9OA 5J13B 3W9DA 4S1SL 3GRWL 1TLKA 1K5NB 3KHQA 4Z0BL 2HLAB 4LGSB 1E28A 5SWQB 4UOW0 2QSQA 2BRRH 3IF1A 2VYRE 5D70L 4QEGA 4EUPA 5MEQB 3CVHL 1BIHA 3KYKH 4P2OB 3MGOA 4NKQB 4U6YA 1EBPA 1QFWL 2AXJA 3NFSL 5ESAB 3JBG7 1ND0B 1A7NL 3MRKA 1NDGB 1YY8B 4HW6A 2ERJC 4PJGB 1VA9A 1NFIA 1OSZA 5D6DA 3OXRB 4APQD 3BW9B 15C8H 4KKLC 2E7LA 3CDGB 4AT6B 1EO8H 3X13A 4LCCC 4H8WL 5DR5H 1ROWA 1CLOL 1ZLUK 3V2AR 3V0AC 3CH8A 4U1SB 4CMHB 1ODAA 4JQIH 1WIUA 2W65B 1R6VA 3S97C 5CHNA 4D9LH 3BX7C 1AGDB 2IBGA 5DHVH 3O3UN 5IVXF 1FFRA 3CDCA 5LGHH 5IEKB 1DSFH 4XNYH 1MRDH 2X4TB 1OT1A 3F8UB 1XIWA 3DGGA 5E8DL 4FZ8L 4JY5L 2DQGL 3KYKL 3TA3A 4N8PA 2NY5H 3W9EA 3KPSD 5E56A 3HMWH 3QUZC 3S4SG 3I85A 4JO1L 4I3SH 5FK9B 1T2QH 3EUUA 2NY3C 3VXRE 1VERA 4KAQH 2X4RB 1X5IA 1DQMH 1EO8L 4NM4L 2NY2B 1EVTC 3ARDA 2OZ4L 3WKMH 5EORH 4L8CB 1EAPB 4AENA 5CLTA 1GC1H 4NQTA 3S36L 4HHAA 2YD5A 3MLZL 4NN6B 2AXFA 5M7QA 3IGAA 2AJSH 5JZ7D 4EXKA 3D3VD 1S7WB 3VFRA 4LSQH 1DUZA 4EDXB 1OAYH 5ANME 1HQ4A 2APVA 2D2OA 2ZUVA 3PIQA 4JVWA 1CE1L 4ZO7A 5D2LA 2DQHL 3VI4F 1DDHA 1HNGA 2H32A 1OARL 3SDYL 1UH4A 2A6JB 5DK2A 1RJZB 2X4QB 4KAQL 1LVEA 5E2JA 1DQML 4PJAA 3UZVB 2R29H 3WKML 5EORL 4Y5VA 1L7TH 4O2CB 2XWJB 3OB0K 4P9HC 1GC1L 5IT2H 3L9RB 4L29B 4JN1H 5EU4A 5MI0B 5IR1A 1C12B 5DDHA 3OKOB 1R3JB 2A6KB 1IEBB 4HJ0C 4ZUTA 3RVWD 2Y25A 3QCUH 2AJSL 4OUOA 4MNHB 2CJUL 4Y4HA 2D7PA 4NKDA 3LQAL 4KDWA 2ZSWA 4EI6B 3P30H 2E6QA 1YEDA 3CFBA 1XGTA 4QHKI 4KRLB 5FOJA 5DUBB 5IQ9B 4HXAL 3MLYH 2D9QB 3OMZA 2DBLH 3MR9A 2BNQD 5AZEH 4W6XB 4BH7A 2GTWB 1C7SA 4KQ4H 2AJ3A 2DJSA 5D8JH 2H32H 4OKVB 1L7TL 3K3QA 1F3RB 2YC1B 4ERSH 4L5FH 3T08A 4JN1L 2VL4A 2X4SA 3KPLB 3QG6A 2BRQA 3EYOB 3QHTC 4UIMA 1B3JA 2JK5B 4W4NA 2YA2A 1BFSA 3VRLF 3ZDXE 1K3ZA 2QEJA 4XXCA 2EE3A 2EDJA 3EO1A 1MFAL 5CBAB 2C3VA 5H8DA 1D5XB 5IHUH 2Y5TA 4E0RA 4F7MA 3BRDA 3SDCC 4MJ4A 2OI9B 2P43B 4K71B 3LQAC 4P5TA 1CVRA 1ZOXA 3CNKA 4J12A 2BOCA 2Y07L 1Q1JL 4LHQB 4YNYA 5E94A 4OLVL 1JRHL 5FA4A 2F5AL 2YOCA 1R5IA 4MQ7B 3SQBA 3CUPA 4Z7VF 4KK8C 4UILH 1W0WB 1ZLSH 5GRJH 5KAQG 3IFPA 1HN1A 1FV1B 4GFTB 3QFJE 3F7YA 3QEUA 3L3IB 2R23B 4ZTOL 5E2WH 2W9EL 3QWRA 5KVEH 5IOPB 4KV5F 3ES6B 3D0VA 5C0IA 4Z77B 1HI6A 3AC0A 4Y5XC 4NQXB 4KKAC 1CYGA 3WFEH 3CFKB 4PJ5A 3G6JA 1QSED 4RFNC 5I18L 4OLUH 4WDIA 2ZCLL 2JB6B 3FB5A 3VD3A 4LLWB 4U6VL 1HHKB 1ZLSL 3I50L 4NBXB 1U93A 4OCWL 3EDJA 1HQRB 3VXSA 1Q0XH 4HUXA 4NYLA 2ICES 4PRID 1NFKA 2VQUA 5I1HH 1G6RA 5E2WL 1KEML 3LEVL 3RWEB 1B6UA 4QOKB 1IM9D 1QSZA 3DECA 2VKWA 3UX9B 1LE9B 4P2QD 5TPWL 3NCFB 2IBZX 1U6AL 2VNCA 2NY4D 3R1GL 4N8CH 4JDVA 3V6OE 5FGBC 4OLUL 1MCEA 3TNMB 5EU5A 2GW5A 2FATL 5JTWA 2HRLA 4F33A 1I7ZB 1B4JH 4UQ3A 1MLBA 4GKSA 3NZHH 1DQLL 4PY8I 5C09A 4OV5A 1KLFA 3OB0H 4WJ5A 1WBZA 4HX1B 4NC2B 4MDIA 5TDPA 4ODHH 2VDKH 3HR5B 5JOFA 2RJMA 4CN6A 5I1HL 5I30L 2L7UA 3O0RH 5GGVH 3IFOA 4JKPL 4H5SA 5T1LA 4M02A 5HHOD 1N4XL 4GO6B 2I5YH 3SO5A 3QIBC 2RBLA 3BZDA 1G6RH 4ZUSA 2VDNL 2W60B 4N8CL 3WXVL 5HHPB 5J56B 2O5ZL 5D2LF 3GSOA 3K8MA 1XEDA 3QO1B 3STZA 3VFWB 4AM0B 3GB7A 5FA3B 4MB4A 4WI3A 4LASL 3TIDA 5CILL 4P2OD 5DA4A 4MMXC 3BP4B 1F4WL 3RGVC 3MV01 1V3JA 1WCQA 1UT9A 5GGVL 1T1WA 3QI9A 1AKJA 3BKYH 5IMLB 3MJGX 3HPLB 4QF1B 5DRXA 5GS2D 4HC1A 4X7DC 1CI5A 4GKNA 5TDOA 5B3JE 4HKBB 5LQBH 2R0ZL 2G2RB 2YD1A 3ZYZA 1G6RL 1ORQB 1MCRA 1SHMA 2PO6A 1MVUB 1BGXH 1FP5A 1KJ2H 4U2ZA 2P5EA 5SWZA 5LBSL 2Q1EA 3D0LA 2VIRB 4MSWA 1KV3A 5D9SA 1GXEA 4F9LC 5KSUA 4HWEL 5IBTL 3PWJB 1RU9H 2FWOB 3GI8H 5J9PA 3DYMA 4NRZB 5IBLC 2Q76A 3RBSA 3MV9B 3MACH 3BZFA 2DDQL 3ZT5A 4LSVH 3BZ4A 4KRPB 1ZVYA 2LTQB 3BKYL 2IF7A 1JWSB 2WM0A 3O45B 4FQ1H 2NY2D 5LQBL 1ONQB 1CR9L 3L5XH 5HYJB 2MKWA 5ESVB 1XF1A 1YEGH 3GUTB 3WFHA 5DVNA 3IJHA 2DQUH 2H9GB 3PHSA 3TYGH 1RULH 2ZOKB 5D1ZA 1XF2A 1WIPA 4GQ9H 2Q8AH 5C6WH 4G7VH 1AGCB 3G6AB 1RHFA 3KR3H 4PJ8C 4HV8A 1IGFL 1A0QH 1NLBL 2E9WA 1SM3L 1J87A 2R2HB 2EDXA 5HVWA 2FZ3A 2Q87A 1D5BB 1FZKB 1OY3B 1YJDH 4XTRD 2BJMH 1FZJB 1KPVB 2DIBA 5CINL 5KSBE 3OHXB 1UB6B 3HFML 3QH3A 4XVTH 4YHMH 1IGIH 3GEWB 3W11C 1FN4B 1NAMA 4GBXB 3CZJA 1RZKH 2DLFH 2JJTC 3NIGE 2ZG2A 4K3HA 3D18A 4M7JH 3SGKC 4JHWH 2KPNA 5FYKE 5GISH 3UMTA 4GRLC 2DQUL 4HC1L 2WUCH 3C5ZA 3EDDA 3G6JF 3U0TB 1DEDA 3BWAB 4K8RH 3ILPA 3C6LC 3CVIL 3AU1A 3HC3L 1NCDH 3MRDB 4KY1H 4HUWB 4N9OB 4QHMA 1WV7T 2JLLA 5B22A 3EIFA 4U1JA 1RY7B 4PV9A 3SDDC 3ZE0F 1UCBL 4OD2A 4O58L 3KYMA 2GJZB 4P3CH 1CLZL 1NFDE 3MRLB 2XQYK 4GAGH 4I4WB 3QUXB 1VADB 2PETA 3C2AH 3TEUA 4QRPB 2Z8WC 4YHML 2CK2A 1IZKA 4GAJH 3FB7B 1TZGL 4NN5B 3FQTA 5GJSL 3EJYC 2CLVA 2G60L 5ISZB 1I7TA 4M7JL 3S7GA 3HMXL 1BBJA 2JELH 2UZXB 1NAMH 3HKFA 2IPTL 2QQQA 4JFHD 4WUUB 4HS3B 4XCEA 3JWDL 1RK1A 4TNWK 4HF5H 1UQSA 1FNGB 1FDLL 4PJ9B 3QJHA 1U8MA 5J06A 1QHOA 3QXUA 5ICYB 5EBGA 4UNVA 3QDHA 3G5YB 5HDOA 1CGXA 4WFFD 1NMCB 3OKKB 4P3CL 5KSVB 4D8PA 4Y2DA 1R3HB 2Y23A 4KJPD 1KEGL 4FABL 4F2MA 1FFPA 1OGAE 4L3EA 3ULUE 4LF3B 2EDNA 3W0WA 4UNUA 5A2JH 1ZT1B 3GFUA 4AG4L 1Q9OA 5I1IL 3WJJC 3AREC 4M6OL 3HZVB 1MJJA 4O02H 4NDMA 3U6RB 2NTFA 3V6OC 2AV1B 4XCFL 1LDSA 1FIEA 2B1HL 3L3HB 4J1UB 5DD6A 4OFKA 1K4DB 4G8IA 3DX7B 4HF5L 3EYVB 1KLGA 4NZDA 4KROB 3AB0C 3UPRB 3VFOA 1XAUA 2OCFD 4LNVA 4CU6A 2KZ1B 2V5RA 2Q3AA 2KBGA 4WU7B 2VR4A 4J3UA 4YXHL 2ZSVA 2B4CC 3MRJB 1O0VA 5D4QA 1I9JH 4WWKA 4KVNH 5CFHA 1YC8A 4TYUA 1BVLA 3CMOH 3DBXA 4K3DH 4NNPL 5I8CA 4HKJA 5DJ2A 1Z3GL 5ICZA 1U8JA 1G7PA 1AD0A 4PJEE 1OPGH 5I2IB 1F4XL 1KYOK 2J4WH 4PJDA 4G7YH 3BPLC 4Z7OE 5IVXB 4LEXH 2JJSC 3QAZB 4GG8A 5HHMB 4PJIA 4MCYA 3VXNA 3D85B 4JM2C 3HE7A 2FLBT 2NX5A 4JGUA 5IROA 4FA8A 3DV6B 3KLSA 4TUKL 5J12B 4UTAL 3WE6B 1SYVB 5C0DB 5ENWB 2DTML 2CKNA 5E6IB 1RFDL 4D0BA 4CU8A 1I7UA 4Q97A 4RMWA 2MQCA 4ZOCA 2D4DA 3NPSB 1ITCA 1EFXA 4JN2A 1GHFH 1VFBA 1BLNA 4Z6AT 4U6XB 5EUOF 2NY0D 4YHZH 5J8OA 3WLBA 5C8JA 1RUMH 2V5TA 4L8SB 3REVB 2ICEB 4HLZH 4KK5D 4JM4H 4G7YL 2WSKA 4LEXL 2HVKA 3VGBA 5TE4L 3BIKA 2LV4A 4NWUL 5IFAH 3I6LD 1LEIA 1N0LA 1L9MA 1IGCH 3PJSB 1GAFL 1QBMH 1FCGA 4JRYE 1HHIB 4PRPE 3QCVH 1RUPL 4LCYB 4EZMA 1TTGA 4EN3B 4K9EL 2HT4D 4GKZA 5IQ7L 3VE0B 3O6FA 5I1AA 1T0NB 4LDLB 4YBQD 3LKQA 4DCQB 2VZOA 4I18B 1P5UA 1YYLH 4OZHE 1T89C 2N56A 3KPPB 1A22B 4Y16B 4X8JB 3O8XB 5FYKL 3TC9A 4TVPH 3WYRA 1CXEA 4MA3A 2DLGA 4YHKH 5I8EB 4YHZL 4IDJH 1EGJA 1T04B 1KNOB 4DEPB 3V8CA 4UINL 2F54B 3Q5YA 3FO2A 4JM4L 1LK3H 2OP4H 4HZLB 4HIEB 1TTFA 1TFHA 5CD5D 5I74B 3SQOH 3WL9A 5D96C 3PL6B 5D5MA 1QSEE 4HS6A 4EI5B 4NQEA 1A6ZA 1QBML 2HTKC 5D93B 3QCVL 3QR2A 4LSUH 3CU1A 1MCCA 5FEBA 1MF2H 4DN3H 2GY7B 4WIQA 1IGYA 1Z5LA 3P4NB 1A4KB 3JTSA 3L95B 5HGHB 4K9EC 2FDBP 4HBQA 5MEPA 3IETA 3HE6B 4Z7WF 1D9KB 3MPCA 1BEYH 2W0KA 5DJ6B 3GGWA 4KZEH 2IMMA 1QQDB 3MFGB 1TQCC 5A3ID 2WWKT 4MQTB 4IDJL 1TZIA 3LSOB 4NKMB 3CSBA 4D9QD 2DM3A 3I3EA 1ADQL 2Q7YA 3BN3B 1RVFH 3S5LB 4JANA 1EGJH 1WZMA 4KRPD 1IC5H 5BVPL 4ONHB 4LEOA 1MLCB 2P24B 3C60C 2OM5A 3ULUL 5HYJD 4NHUA 4M1GL 1XCTA 1T4KA 3L3DA 3IKCB 5CJXA 2CPCA 1M7DA 1D5MB 1QRNA 1OD9A 1DVFB 1T7VA 2W91A 3MBXH 4MD0A 4V1DA 5C0AB 5FYLE 4RFEB 4M62H 3ARBB 3BUTA 3FQNB 5E95B 4C54A 1BQSA 4HAGA 1VKXB 1BEYL 4LLQA 5JR1L 4JRYA 4P23C 3OAUL 4QRRE 5T33L 4U7KA 2HKHH 1JWMA 1PDKA 3SE3C 1FAIH 3ZL4L 3OQ3B 3T2NH 2EEAA 1A9BA 1WFUA 1XGRB 4WFGE 4G3YL 3RWJB 4RRPA 2O5YH 5E99H 2JCCE 1YEIH 4HQQL 3X3FH 4AQOA 5B39B 1BQLH 4BKLB 1J7VR 4ZOBA 4I48B 3TO4B 1QBAA 4GBXD 4F37K 4EVNB 5IFHH 2VXUH 3UO1H 5DFWH 3N06B 5EZLA 2X44D 3ULUC 1H0DA 1JPGB 4LOUD 5CBEA 1HXMB 3SBWA 3TVMC 4OT1H 3MRBB 1PYWA 3AXLA 1FVCA 4LIQH 2PXYA 4JR9H 3DTXA 5F9OH 4OFYA 2VE6A 3UBXB 5EC1A 4H26B 1J1OL 3UTPD 1QNZL 2P8PB 3ME0A 4P3WA 1NLDH 5T3ZH 3T2NL 5KS9E 1U8PA 3WHXB 4EDWL 4DN4L 3B9KB 5GQBA 1ULVA 2E9JA 3RZCC 3GSRB 3OAZK 3QUXD 2KQMA 2UZIL 2AEIT 4NUJA 2FO1A 2O5YL 1YEIL 4GG6E 5I1JH 2BVQB 4QRPD 3RX7A 3I6GB 4F15C 2EIEA 2GJ6B 5FCUL 4U1HB 4U1LA 2R1WB 3LN4A 3V0VA 2XIDA 6FABH 3DUHA 1J9CT 5ISZD 3U0PA 2DQTL 3NGBB 3FO1A 1P9MC 4WY7L 3TWCH 4TQEH 1JHLL 4LCWE 4C83B 5TE6H 1OAKH 1F90H 4MA7L 3Q48A 3QEHB 4JLRA 3WS6C 3EO0B 3NA9L 4M9OA 2GFBB 2H8PA 3I02B 1FZOB 3DX8A 1TCMA 3E1F1 1OLZA 5GHWL 5FHBH 2OYPA 1IC4H 5IEHB 3U7YL 1MRCL 3EO9H 4GUPB 4P46B 3BH9A 3MC0A 4DZ8B 5GGQL 5I0ZA 5HDBF 3D25B 5I1JL 4D94A 4UU9A 3Q6GH 1QSFE 1MWAB 3SDXA 4RGNB 2QTEA 2XPGA 3GMMB 3P0VH 4S11A 2VXVL 2E7CA 3RL2B 3SKJH 4N0CD 1I7RB 3KXFD 3MJ8B 2BXZA 1P7KA 4KROD 3VFNB 3EGSB 2H6PA 4LSTL 4WCYH 1L0XA 4PGEA 2WQ8A 3UTZB 4UDTB 1FSKB 5EZIH 1HILA 1TIUA 1C5BL 3MCG1 4X6CE 1ZT7A 2PTUA 1F5WA 2PNDA 2C7UB 3OJ2C 1P1ZB 5FOBB 4C55A 3JV4B 4LU5H 3VMPA 2IG2L 2DAVA 2IWGA 5BO1L 3NIDE 2NR6D 4JHAH 1KYOJ 3CX5K 4KPHL 1YUHB 4MGXA 1FVDB 2QR0A 1X5AA 3CFIC 4LPYA 5DHYA 2DQEH 3W5MA 1QR1A 2V2XB 3H7BB 3SKJL 4ZS7H 1FFQA 4DWHA 3PDOA 3CZFA 3RWHA 4Y5YC 1ZVSA 4GG6A 2VWEE 2CMRH 4JZJB 3DX6A 2DQCH 3D85D 3S37L 1J1PH 3I9GL 4L8DA 4KJWC 2MHAB 4S1DD 2Y5EA 4RA3A 3WDIA 4ZFZB 1F6FB 1KCUL 4FG6C 4FFYH 1EV2E 5FHAH 1JPST 2ZWLT 4G80B 5K9QI 1HDMA 3FKUS 4N1HB 4ELKA 4LU5L 5D7IF 1CD8A 5JPNA 3DIFB 3MRCA 3KNBA 2EKJA 4JPVL 5FYLL 4NHCL 1I1AD 1MH5A 1N7MH 3KPQA 1Q94A 4NQCE 5HYSB 1WZ1H 4DFHA 5I66B 4PRHB 4OLXL 3ZZ1A 2WWKO 2BMKB 2ARJQ 3LHPH 4ZS7L 3WIFA 4OIIH 4DGIH 2X41A 5D7JB 5EPMA 3DXAE 2CMRL 2DQFB 4G8FA 2DQCL 4N0RA 4Q0XH 5DQ9B 5LCVH 1YDPB 4KDTC 5TH2A 5DJXA 4EN3D 2PYFA 3PABA 1JV5B 1ZHNB 4K55A 4TOYH 5L8KB 2OL3L 3L3KA 1N26A 3G5VB 4TTDC 1EA9C 2NY4C 5DRZA 2Z92B 3OAZH 2ICWB 3UC0L 1ZA6B 1NCUA 5EO1B 1D5ZB 2AV7A 4XC1H 2GITA 1D6EB 4Y16D 3MA7A 5ALBH 1G9NC 2X70A 3V6FA 4X9HA 5JQ6H 3DUSB 4QT5A 1FORH 2X1WL 1I8KA 1W8NA 3OKDB 1WWBX 1DBAH 4AY0A 2F54D 4MXQC 1NMAL 1GGTA 3SE8H 2J8UE 1H8NA 4PB0H 4R7NA 3RRQA 3PL6D 3RVUD 2E8ZA 5SWSE 1SQ2N 5I16A 4EI5D 2HJKB 3ARFB 5CIPA 5D7SH 4M61A 3F12A 3LB6D 4NJ9H 1BM3H 4MS8D 2D7QA 4TOYL 4F3FB 1H3WM 3ZYIA 4AMKH 4O51A 3IS1X 5D72H 4OF5A 2WWMD 3VDCA 4FQPA 4D9RE 3HG1A 1EVUA 5A16B 1D9KD 3BAEL 3BJLA 4JEGB 3X14B 2FB4H 4JKWA 1Y6KR 4PRDB 2Q6WB 1Q0YH 3MLSL 3EBAA 5IG7B 2R2EA 1X5LA 1IL1A 3RZWA 4ZXBC 4Y4FA 3UDWA 2EYSA 3TN0B 5LWYH 4NO5B 5C0FA 4OZIA 2QSVA 1BFOA 3VW3H 4RAUB 4PRNB 4HPOH 1FL6B 4Y4KB 4X83A 1OB1A 1PY9A 3NCYS 4PB0L 3IVKB 4XWGH 1JN6B 2AJUH 4KQ3L 1XGUB 2JIXA 4GMTH 1B0GB 3GK8H 3TJEL 4AMKL 1N2RB 4BFIB 3LQZB 5CGMA 5D72L 1OCWL 5CIPH 5C0AD 4QTHB 3AAZB 3VFTA 3QUKB 4YZFE 2FL5B 1MREH 1U8KA 2VL5B 3N1MC 1G9MH 3DXAA 3BT2H 4G6KL 4P4KB 2FB4L 4OZGF 4R26H 5E8EB 2BSTA 3T0EB 4GW5B 3SDXF 3W2DH 2IPUK 2CDGB 1XFPA 4JZOB 1IAKB 1VCAA 4U6TA 4PLNC 5HYFA 2YKLL 5IW3A 3T3PF 5ID0A 5ECJE 3VXPA 3CH1A 5EBMA 2ATKB 3ET9F 4NC0B 1FE8H 1MUJB 2XNAA 5EU3A 5KANI 5I9QC 4P9HH 2E9IA 1JK8B 3T2PA 4X7EC 1TJGH 4KJYB 2AJUL 5JLZB 3TO4D 4LLYB 2NY2C 2ID5A 1X5JA 2MSPA 1RZGA 1U95A 3VXUB 2W0FA 5C70A 4PLOB 1G9ML 3FQUB 4NN6C 4RBPH 5CJQH 1NEZA 4PJCF 5BCAA 2W07A 4YXLL 2P7TA 1LO4L 2LVEA 2M1KA 1IC7L 2NXZC 1N6VA 2IQ9H 1NJ9B 5IMOB 1FVEA 5AZ2L 1IQWH 1CDCA 3DLQR 5FGRA 3SKNB 3RWGA 2AAVA 4DKEH 4PTUB 1IGMH 3UP1A 2CRMA 3SY0B 1X5GA 1OAZH 3KWWA 4XPAL 3T4AB 3GBNH 4R4ND 1TJGL 2I9LB 1QEWB 3S3JA 1LILA 4NIKB 4QHLB 4Y5XA 4NO0D 5D6CA 1JNLH 1INDH 1NGYA 2V5YA 4K3EH 1WK0A 5C08E 5HPOA 4NUGH 1MCSA 5DUML 5JDSB 3OKNB 4HMEA 1MFCH 5EUOB 1BAFH 2F74B 4P59H 3VFSA 2ZP0T 2VDRH 5JDJA 3C87A 5DD0H 3QNXA 1N59B 4HWBL 4HG4K 5ICXB 3GHEL 4YGVB 4YBLC 3QDGE 3HUJE 1MNUH 5L7XH 1WICA 2BDNL 3BD4A 3WNMA 1DBMH 4U0QB 1IGML 1N3NB 4P46D 1QFUL 1FNEA 1MI5A 2FYYA 4PR5A 3S5LG 4GSDL 5IVNA 3QDJE 2F19H 3I6KB 1NUDA 3B5TA 4HBCL 3IU4H 3O2WL 2ADJA 3RWCB 3C08L 4RGND 4TUOB 4YDLB 2X4NB 2YHGA 5C0CE 3VG9B 2HWZH 1YMMB 1EIBA 1E4XL 1BAFL 3QA3B 4P59L 3T2QA 1P2CA 2VDRL 1K6QH 4ORGA 4CAGA 4RX4A 2MPAL 2PW1B 3RL1A 3G08B 2CXKA 3TZVB 1BOYA 1INQB 1LD9A 2FX7H 3BPCB 3TFKD 4YH6A 3CXDH 4YHNA 2OI9C 2X05A 2AEQL 1IAMA 4NNXA 2IALA 2IGFH 2XZCH 4KJPC 3CX5J 3KVQA 2OMBA 4PREA 1F11A 4PJ7E 5TGBA 3M8OL 3V4PH 5E0QA 4L9LC 2IPKB 4PJHE 2F19L 5B39G 1NANI 1HSAB 1Z9LA 2YMXL 3H6JA 5DEFA 5JIIA 4G8GA 4Z7WB 1MJ7L 4UT7H 4KKBD 2PW2A 3QQNA 3UTPE 1BMGA 1XCQB 3TIEB 2UYLA 4XZUA 4M8QB 1E27A 3JZ7A 1K6QL 2XZQH 4NNYA 1OP3K 4YLQT 3CLFL 1IEAA 1X5YA 1P84K 4NRYA 3UBXG 1X6NA 3FJTA 4PUBL 5IB5B 4F80A 3ZKSD 3CXDL 3R4DA 4OZIF 5E2UL 4OAWA 3C8KB 5ITFA 2AQ2A 1HKLL 4RAVA 5DYOA 3LEYH 5CWSA 1UM6H 1FQ9C 4JHZA 5DD5H 1IFHH 1GRWA 4R96B 4IOFD 1TVBB 2CIIA 4HH9A 2C3HA 4L4TB 5JHDE 4TUJA 3GSXA 3FAXA 4ODXA 4OM1L 5E03A 1AXSA 1YECH 2HG5A 2XV6B 1KIQA 4PRHD 3PWUB 2QHRH 1MPAH 2HH0H 2WBJA 1RZJL 1BREA 5D7JD 1F13A 3EJZD 3RGHA 3F7VA 3QDJA 5K9OB 2XZQL 1T66C 5BOPA 3LEXB 3CSPA 2VJXA 2XFXB 3JTTA 5I6XC 4XNUH 3HZMA 2R4SL 1A9EB 1V7MH 5DRWA 2Y4SA 5F7DB 2X4OA 5MERA 2HN7A 4C57C 3NBNA 3N1GC 2OSLA 1DL7H 3BSZL 3LEYL 2BVYA 3Q5OA 5CEYA 2P46B 3U83A 1UM6L 4YIQA 2EDYA 1U3HB 2VDOH 5I8OL 5HJ3A 3KXFE 2DM2A 4HFUH 3KYNA 4N0UB 2NY0C 2YWYA 4OZFB 1CFQA 3B2VL 3FOMB 1EZVY 3FMGH 4J6RL 3BKJL 1YECL 4X9FA 5H37H 5T5FH 1YN7A 4KK5C 1NUNB 5DFTA 3LV3A 3MCKB 1KJVB 2HH0L 4NO3B 1ZS8B 2WW8A 4X98A 2FGWL 3WFZA 1T83C 2GCYB 2XACC 1RZJC 4ODSL 5MP6H 3VFPB 1MCWM 4C58B 3QIWC 5I75C 1V7ML 5DVMA 3UYOD 3FFDA 5BRZE 5CJOL 2HT4C 5K9JH 1BQUA 1UWEL 5IGXH 3GO1L 2X1PA 5ADOH 1OL0A 4LCIH 1YPZA 4I8DA 2ED9A 2LU4A 4UDUB 2DICA 5I73B 3N1FC 4KHTH 5E2VL 2JJTA 3OX8A 3IXAA 5I1EH 1IRAY 3TT3H 5GGUA 4V2BA 3TN0D 4ZFOB 1UXSB 3VXQA 3GJEB 3ZKXB 3MV8A 2BNUB 3BEVA 5T5FL 5AUMB 2M8XA 1DEEA 1RAMA 3MLRL 3GHBH 4PGCB 3RY5A 2I25N 5CD5C 2D03H 1C08A 2ESVA 3SDAB 4LHUB 5CMAA 4XAWH 4PV8B 4ENED 4YPGB 3B9VA 3EKCA 2ZUXA 3PQYB 5BQ7A 1TVDA 3BESR 3NOIA 4M7ZB 2VH5L 1S7VA 3U30B 3MV7E 4MXWH 5IB2B 4Z78A 3DETD 1KELL 1KIRA 3WN5A 3UTTA 4GAYA 4P4KD 1S7XB 3R0NA 5T3XD 4LKXB 2VLRA 1IT9L 3SO3B 3T0ED 3RUGA 4NBZB 3JWOH 2UUDK 1Z9MA 4LSRL 5I1EL 3FONB 3TT3L 2XRAH 2GSGA 3E6HB 3LY6A 1T7ZA 5GS0D 1RZ8A 5CUSL 5SX5K 5HYSG 1VACB 5DMGD 1V3LA 1I8LC 4X6EB 4LVOB 4WO4B 1TJIL 4PP2A 4JO4H 1RZ7H 1FAKT 3GHBL 5MEOA 2F8XC 1QBLH 1CIDA 1MIMH 1VPOL 3QISA 3MNWA 4HUUB 5E8NA 3EFFA 4U0RB 5DGQA 3MRNB 4P2RA 5HGDB 5HYIA 3JVGA 3UYRL 3BN9D 4NO2A 5DJYA 4PFEA 4QKXB 5FYJD 1CXHA 1C5DA 3CCHA 4MXWL 5C07E 3VXUD 4ZNCD 1MQKH 1GOFA 2IH1A 3WJJA 1MJ8H 5J11B 1FC2D 2FX8H 1DLFH 2H26B 2VZ3A 5SX4H 1G7LB 3O4LB 1FFOA 1XF3A 3M07A 1U3JA 3JWOL 4YHOH 4XC3H 4QXUH 1UFUA 5BRZA 4NZUL 1HHGA 4U3XA 4MZ2A 3K7UA 4KUZH 4LCUB 2G5BA 1JYNA 2A6IA 3OXSB 4JO4L 3M17B 3RTQB 3QIUD 2VLLA 5IVZB 4RGOL 3D9AH 3M1BB 2VLJE 2JF1A 4HXBH 4CJ1A 2CUMA 3BP5A 1M05A 4Y19E 2ADIB 3TV3L 3SE4A 4HKZB 4DZBA 4GBXC 5HYQA 4NCC1 5D7IB 2DJ4A 2NNAB 1EEYB 2ITDB 3MA9L 3VFVA 5C0RL 1JWUA 4LOUC 4HG4J 1MQKL 3HZKA 3DMMB 1S7SA 2VQ1B 2FX8L 4MDJB 4U6HB 4JG0L 3DUUB 5EULV 3PXHA 2B0SH 3WMSA 4YHOL 1D6VH 4QXUL 1ZGLP 3HC4L 2YN3A 5IESL 1MCHA 5GSVA 1YMHB 2JJSA 5IIEB 1ZEAL 3F7QA 3IDIB 3JUYA 1DE4B 3PGDB 3QUXC 4XNZB 2VB5A 4YE4H 5LKNA 3A67L 4JKLA 3D9AL 4A6YB 1DBBH 3K8LA 4LFHG 4HXBL 2J8OA 5B38B 1LDPL 3NZ8B 1FYTB 1XGPB 2X9YA 3O3EB 1XGYL 5EC2A 1KPUA 2WBKA 5BZDA 5DQDH 1UCTA 1RV6X 4JJ5B 1KTKE 2WUBL 1HHJA 1HH6A 5C0JB 1YMMD 1MCDA 1RMFH 3VGEA 3MGTA 5B4MD 1AIFB 4MAYA 1UWXK 2GHWB 3OPZL 3TH3T 4BQ8A 1U8QB 3RU8H 5E9DA 5I17B 2F58L 1A1MB 4RWHA 2YRLA 3DHJA 2ATPA 3E0GA 4RQQB 4FQXA 1D6VL 4ZAKA 2P5WD 4JFPB 3TZVD 1B2WL 2AKRA 3CK0L 4WRLA 2DL9A 2XN9A 1NMCC 5F1NB 5FO7A 2AK4E 5IB3B 3NN8A 2LFGA 1R0AH 1IGJB 4UIKH 1BD2E 4MJ6A 1I8MA 3V8OA 1DBBL 1A7OL 4LPXA 4RCAA 3CXHK 1QVOA 1CLCA 4MX7B 2L7JA 1AR1D 4R7DA 1K8DA 2GT9B 3Q1SH 3WNOA 1CGSH 1J86A 3BP7B 2EXWD 4PTTB 3IDYC 1J8HE 4M43H 5EOTA 2BHYA 4N0CC 2NW2A 4FXLA 3KPOA 3ZDXF 4WUKL 3MFFB 4P57B 1Q72H 1YPZF 2NTSP 1ZT4A 4F7TB 1P84J 4OQTA 1JPTL 1U92A 2YPLB 2UUDH 4P4RB 4YAQB 5LG1A 4ODVH 4U31A 1TVHA 3IDNA 4XP9L 5SX5H 3JUZA 5B8CC 3B3IA 3HCVA 3EDFA 5JW4Q 1ORSA 1S9VA 4OLWL 1V7NH 1FBIH 5DJCB 2APTA 1JBJA 3FAWA 1YNKL 3T77A 3RY6A 1NSNL 1FGVH 4MYWB 2AW2A 3BIAX 3Q1SL 3LRSA 4FNLL 4GRWE 5DC9B 3V5HB 3IU3A 4OZGB 5IFJA 1UXWB 4QWWD 2A1WL 2BNRE 3KPRE 2A9ML 1Q72L 2DKMA 4C56B 5DLMH 2VDMH 4JVPA 3GNMH 3SPVB 1MCWW 1BVZA 3BPOC 1RJLA 4XVJL 3N1QC 3S6CA 2CRIA 4R9HA 5FKAB 4MJID 1EEZB 1JPFA 4JCLA 1E4JA 1GZPA 1FO0L 4P9ML 2IMNA 1V7NL 3GSUA 3MCLH 2BSED 4APQA 1U3HD 5FECB 5I19L 4U1NB 2HFFA 1IKFL 1A6PA 4NC1E 2Z4QB 1NGXB 5C2UB 4L4VB 4YWGL 1I1AC 3C09B 2MOVA 1J0KA 1HK6A 5FDWB 4L8SC 3ROOA 4PJCB 4K7FA 2AK4A 2OQJA 4N90D 4KKCD 1WQVT 2R0KL 2OK0L 5AG8A 3SCMC 3EYFA 4MCZA 1BD2A 4WHTB 4X99B 5I1LA 4JFEE 1RIVL 3C5JB 4POUB 3STLA 3U4EA 1U8NA 4XBEL 3SE3A 3S35X 3GNML 3HI6L 1JGDA 5EZJB 3ULVH 4N9GA 4UQ2A 3QNYA 1KB5B 1WF5A 1I8IB 4RSVA 1AR2A 5AYUL 4Q6IB 4S1QL 2B20A 2ZPKH 4OQTL 3PF2A 1O7SA 1IMHC 3KPSA 4UUJB 3UTSA 1JTTA 3WO4B 3MCLL 5HHNB 4XVUD 4I18C 4FQIH 3MMEA 3RVVD 3V4UL 3BUYB 5C9JA 2W0PA 1DTUA 5FAAA 2ERJB 3FHAA 5CZVL 3NAAH 3P40A 1JGUH 1A7QH 3ARTA 4DEPC 4OCSL 3WFBH 5AD0B 4LKCB 2BSSA 3IDXL 4MD5B 3V5DB 5JUEH 3AROA 3ARPA 5I74C 1U91A 2AJZA 2IFFH 3SDAD 4ELME 3D3VA 1MOEA 3WIIH 4EI5C 3JWNC 3PV6B 1H9VA 2R1YA 3HR6A 3GMRB 2DMKA 3D1MC 4MS8C 1QG3A 4XBGA 3PQYD 3MQIA 5MENB 2VLMD 3GJFK 4HULB 1OGTB 5JXED 3GSNA 5I1KH 3HPJB 1D9KC 2RB8A 3FL7A 1I75A 4PJBE 1ETZA 3E6FB 1AJ7L 4PJFF 1U42A 4MB3A 1IZJA 5F88B 3QUZB 3CFDA 4QY8B 3MUY1 2NY3B 2XKNB 1HCFX 2Z35A 4M7LT 3E8UL 1URLA 1KFAL 3MLWL 1N64L 4P99A 5BZWA 3RAJH 3T3ME 4WTZG 1NC2A 1JHKL 5IV2B 1J1XL 3U9PH 5BS0E 4NQDE 4IRJA 2D31A 3BMWA 5HVFB 3BVNB 4PY8J 5IJKC 3NIFE 1PZ5B 4MA8L 1JF1A 2FLRT 2EYRB 3MLXH 2BNQA 1Q9WB 4JFEA 3TNNA 2DN7A 4PS4L 3O4LD 5KN5B 3GMPB 4XP5H 4G6AC 1ES0B 3C9NB 2BVOA 1XF4B 3GSNH 4I5BB 4E5XB 3LS4L 1XR9A 1FIGH 5E8PA 3CLEL 2HRPH 3OL2A 3RTQD 1F4HA 3D39D 3WHE0 3S9DB 3T8XA 3H9SE 3WBDA 3TBVA 5IW6A 1ED3A 2R9HD 2IH3A 4BSJA 3ZE2E 2HVJA 4B50A 2HJFB 3GM8A 1KCVL 1OF2A 2X7LB 4Q9RH 1OAXL 1I85A 2QADB 2VITB 2OXGA 4I9WE 4ALAH 4LPWA 1DQDL 2DLEA 3EJJX 1NDMA 1JNHA 3T4YA 3MJ7B 1IAOA 2R0WH 5IMKA 3DMMD 2FH8A 3WFDH 1T2JA 2VERN 3L3JB 3LKOA 3C5SB 3UTOA 4DTGL 4M4RA 1CXFA 1GVIA 1SMOA 2GSIB 3FO0L 3DARA 2YEZA 3PV7A 3W9DB 3X3GH 1HIMH 4Q58C 2BHUA 1OSPL 1JPSH 3FQRA 1BF2A 3GSNL 3HI5H 1FIGL 1MCOH 2FJFA 2YD8A 3BD5A 4MA1C 4WV1A 5KSBF 1CFTA 3EOTH 3TCLB 3WD5H 3QUMA 4L8BA 4EUPB 5F7NC 2QSCH 5JIKA 4JFOB 3BFOA 1BVKB 1RJYB 3NIGF 3VWJC 3MRKB 4PJBA 5C0NC 1JGVH 1ZHBA 4LHUG 1FYTD 4JAMA 4IHOA 3L1OH 2I60L 5T3XE 3BD3A 1PBYA 1F02I 4NQSA 4ALAL 3IAQA 1NCBH 4YHPB 5ILTH 4D3CH 2QSTA 25C8H 1KC5H 3O3DA 1KCSL 1WT5A 4JY6B 4O5LL 4AEHH 1KJMB 3GSVA 3QQ3A 3BISA 3SDCB 2Q7NA 3UJTH 1S7UA 2V2TB 3O9WB 3BDYH 4LSSL 4WW2A 4X5WA 1A1NA 3NTCL 4JFFB 5F8QC 3UZEA 5CHNB 1HIML 5L8JB 4Z0XA 4IMLB 1NFDF 3FQWA 5KOVC 3T1FA 2VAAB 3HI5L 1HEZB 4IM8A 4JPIA 1WLHA 1SJHA 5CCKL 4ISVB 4F9PA 4PRIA 3CXHJ 5TF1L 4YDJA 4BK5A 5TE7H 1BX2B 3UJIH 3DVGB 1G7IA 4P46C 4PLKD 2C4FU 2V2WA 4KK9D 3GMNA 1JGVL 1B0RA 1YQVH 1KIPA 3AFLA 3WNNA 4NKIL 3QUMH 3BP6A 2AEPL 2VXTL 4P2QA 3KYOA 1U8OB 3CPLB 5IHZA 4PJXA 3RA7H 1NCBL 5CP3A 4D3CL 5KTEH 1YNTB 3IXTA 3D69A 4NC1C 2BVEA 3CSYA 3A6OA 4E42B 2EKSA 5F3HB 1QA9B 3LKSA 4NWTH 4Z7UE 4RFNB 5AYQA 5JNYA 4WHYG 2UWEA 3P4LA 2AI0H 1MIEH 4XXDA 3DO3A 3QZWB 2RGSA 4JQXC 1DQJA 5TE7L 5FYJU 1JJUA 5HHOA 2FSEB 3OR7A 4DUXA 3MOBL 1LEGB 4JFQA 3ECBA 3H9HB 2GAZA 1MAMH 5H94A 1ZGLM 2JJUA 1MHCB 1IC1A 1PVHA 3V4VH 2P8MA 4XBPB 3BE1H 3LS5H 3UEZA 2HMIC 1DUYB 3WJLC 1K5NA 2DI7A 3G04B 2HLAA 3JSSA 4JZJC 4C56D 5KVGL 5SWQA 5CP3H 5CJ5A 5F97E 2OX5A 1SVZA 3ZHLA 4N68A 4AIZB 5MEQA 1NCNA 4IDLA 4FMKA 1G9NH 4P2OA 3E3QE 1MCIA 5H35B 5ESAA 1NDGA 4PJGA 4U49A 4YHIA 4GW4B 3QEGH 1FLRH 3CFBB 1CBVL 3BW9A 3TJHD 3PWLB 3CDGA 1PFCA 4AT6A 3RX8A 2OTPA 4L4VD 4IOFC 3MR9B 4XNQA 4YUEL 5B38G 4BH7B 4Z7OF 4LHJB 4U1SA 3V4VL 2Y9RT 4A2LA 1LO0L 1GJIA 4IRSA 2CR3A 1LEKB 2P5WE 7FABL 2W65A 2EECA 3VFGH 3INUL 3HS0B 3LS5L 5GGSA 1HHHB 3QIBB 5KOMC 2Q3ZA 3QG6B 1AGDA 2C1PB 5DJDB 1PSKL 4LNRB 2NXYB 2YR3A 4MLSA 1V3KA 2E27L 3VXRB 3ZTJG 2X4TA 4DOHE 1G0YR 3CFJA 4DQOH 3VFMA 2GIYA 4ZODA 2C3WA 4F7MB 4JB9H 1UZ6F 1HOCB 5FK9A 1UJTA 1FC1A 2X4RA 1KENL 4POYA 5HY9A 1B90A 2CH8A 4WGVB 4YFDB 1A4JB 2NCMA 4YNYB 4BK4A 5E94B 1H5BA 3RGVB 4URTB 4JCMA 3FB8B 3LKRA 4L8CA 1EAPA 5J6GA 4KKLD 5GS2H 1A6TB 5DC4B 5ANMB 4OZ4B 1WAAA 1S9XB 3TT1L 5L2KE 2G5RA 43C9A 1L0QA 2YXMA 2WK2A 1S7WA 4EDXA 4MQXD 3LRGA 1JE6A 1XR8B 3FFCE 3RFZC 3P2TA 3VD4A 3NH7H 3NCJH 3PNWA 4DQOL 5DTFA 5MEND 2DM4A 3QRFM 5IW1B 3L6FB 2VDLH 2A6JA 1P69B 1E4KA 2YD6A 3QRGH 1NL0L 4OUUB 4XMKL 4NZTH 2IAND 4G8EB 1I9RH 4R0LC 5LGJB 3ARZA 5I1CH 1R5WB 2XKSA 4O2CA 3TN0C 3BKCH 3L9RA 4L29A 3A6CH 4E41E 2YRZA 3BQUC 3CMGA 3OKOA 1U93B 2A6KA 4FTVE 1IEBA 4ZFGH 4H20H 3EOBB 4MJIE 4P3DA 4NYLB 4MNHA 1H8OA 1NBVL 3ZDZF 2EE9A 4LRIC 5HBBA 1R24B 4ENEC 4Z5RB 3NCJL 5DUBA 5IQ9A 4PJ8B 3WEXA 2H1PL 5CGYD 1FH5L 4IMKC 4BFGA 4S1RL 1HINH 2XQBH 2VDLL 4MZ3A 1KCRH 3DETC 1MELA 2J3SA 2GTWA 3P4OB 3ZSTA 1W0YT 4LSPH 4P4KC 2WIMA 4NZTL 3T0WA 2H2SC 4K94C 5D7KD 3IFLH 3PWNB 1F6AB 3LD8C 4UV7H 2P4AB 5I1CL 4OKVA 2YC1A 4G9DB 5GS0C 2XXCB 3KPLA 4QGYA 3B4NA 3EYOA 4OB5H 2BY2A 3HLAB 3S35L 5LJYH 2JK5A 1ACZA 4ZFGL 3S8WA 1JI1A 1EHNA 4H20L 4MDIB 4GRLB 1A2YB 5CBAA 1NAKL 2COQA 2VN7A 1SMAA 1D5XA 2UZYB 4U1MB 2QADD 4JFDE 2MCG1 3C6LB 4EQ3A 5GS1C 5DZOA 3RKDD 1NGWB 4ZUSB 4FQHB 3ARGD 3SDDB 4QCIB 4JPKH 1X4YA 3QFJB 3H42H 4G5ZH 1W0WA 4U1IB 4WWID 1BOGB 3ORJA 3DOSA 1I1RA 1FV1A 2JCCF 5T1DH 1A7RH 2HKFH 3L3IA 3TIDB 1U9KA 3QIUC 2MCPH 3GIZL 4IEFB 5EO9B 3S3SA 3TP4A 3LH2H 5IOPA 2R2CA 3ES6A 1P4LA 2VTFA 1T1WB 1QFPA 3QI9B 4Z77A 2HJLB 4GT7A 4N1CA 2XWBB 1Z0MA 2CKBA 1BQHB 1UM4H 4WEBH 1GPOH 3CFKA 1QLEL 1N6QH 3QQ4B 1F3DJ 5JW5B 4NN7B 5CLWA 1FPTL 1ZLVH 2JB6A 1S8DB 4W68A 3SDCD 3U48A 3ZDYE 3VRJB 4DUWA 2VISB 4LLWA 2C3XA 5KS9F 3O9WD 5ALCH 3VXME 5E1HB 3H42L 1HHKA 4G5ZL 2J88L 5T1KB 4ZG1A 2YXFA 2E6PA 3B9AA 4MSWB 5ACZB 4IJ3C 5HI4D 3AREB 5T1DL 5I1GL 4M1CC 4KK8D 1GGCH 1XIWD 3STBA 2GI7A 3ARQA 4CJ0A 1A6UH 1SYSB 1ZLWH 3ESUF 2YA1A 5I15H 2C1OB 2Q76B 4UI2A 3RWEA 2DQJH 3LH2L 4QOKA 1T3FA 4BQCA 1PKQE 3E3QC 3BZ4B 1LE9A 4QRTB 1LO3L 1QD0A 3AB0B 4WEBL 3ARDD 5IJVB 2CRYA 1N6QL 4NP4H 3TNMA 4EBQH 5DA0B 3C6SB 5B4MC 3O6KL 5HPMB 4DAGH 1QSVA 2P8LB 4CGTA 1QLRB 5F9JB 3D39E 2DQDH 4KKAD 3QUYC 4P2CG 2F53E 2D7TL 2XICA 4GS7C 3OAYK 3TZVC 4HX1A 5HDLA 2N7BA 1DBJL 3HR5A 4Q2ZA 1WAAF 2IFGA 2OR8A 3T0XA 1NMBH 2PCPB 2QQLL 5I15L 2Y36H 3BPLB 4NFDA 1VB9A 2RFXA 3P4MB 5FDYA 1X5FA 4JPWH 1AR1C 1I4FA 5DMYA 2BFVH 5F7FA 4M7KH 3V52H 2O5XH 2W60A 4JM2B 3MRGA 5EWIH 4IS6B 1RUKL 2EXWC 5HHPA 3LMJH 5D71H 3I2CL 3GKWL 4OV6F 3TBTB 4PJFB 3QO1A 2RCSL 2J5LC 3VFWA 4AM0A 2CKBL 5FA3A 1MRFL 3G6DL 4X6CF 5BMFL 1RZIB 7CGTA 4KI1A 3RHWF 3WO3B 1OD7A 3MZGB 3ILPB 4OCXH 5BOZG 1J0HA 1A3LL 1B4RA 2AQ1A 1LP9E 5I0DA 1CICC 3BP4A 4DK6A 3NIDF 2EDKA 1QLFB 4OD2B 3DGCR 3KYAA 5CJBA 3T04D 5IMLA 3HPLA 2VXQH 4QF1A 2V17H 5D1QC 1AI1H 2Y36L 2CLZB 4HKBA 5JOPD 4B5EA 4JRXE 3LDBB 2G2RA 5F93C 3MUZ1 3L7FB 1E6JH 2BFVL 4HIXH 5TJWK 1MVUA 4QWWC 2B39A 3LMJL 2CLVB 1I7TB 1MCJA 3QIBD 5JMOC 5GGVY 2VIRA 2NXYD 5LXGH 1A6WH 1G7QB 5GGTA 3VXRD 5DRNB 4I77H 4HIJA 3NFPB 3PWJA 4MJ2A 1BIIB 1PZUB 3PGCB 4H1LA 1U8MB 4I1NB 1CDGA 3AVEA 1JGLH 1XMWA 3MV9A 3RIAK 1UADC 4WUUE 4K3JH 4AH2B 3RWFA 3KJ4C 4P5TD 5JO5B 1JWSA 3O45A 3BGMB 1ONQA 3NMEA 2BVUA 3RGVD 5HYJA 5EU6E 5ESVA 1Q9OB 4PG2C 2RHEA 3GUTA 4HIXL 1AXIB 5D96B 2H9GA 5JXAH 4Q6YA 4HS8H 2XKUA 4YHLH 2FNBA 2ZOKA 4R8WH 3WUWB 1AGCA 1UH2A 5HHVL 2MFNA 4HUNB 2AK1H 3G6AA 1S5IL 3GMLB 5E08H 4YQXH 4WEMB 3KJ6H 5KSBB 4LDEB 4OCRH 2DD8L 2R2HA 4KRMB 4I77L 3F7PC 2DTSA 3I75A 3TPUA 1ITBB 3P11H 1D5BA 1FZKA 3WDJA 1JGLL 3O3BB 3QZWG 1FZJA 1TQCB 5GGTH 1KPVA 2Q86B 1OAQL 3OHXA 1UB6A 2XZAH 4K3JL 4MNGE 4XVUC 3TGXA 3P0YH 2F8VA 1ZVHA 3EFDH 5I73C 4GBXA 5GGRB 5IBLD 4HKJB 1AGFB 3PWPE 5HI5C 4NOFA 4Y89A 4KK6C 1U8JB 1MHPH 4V2CB 4ZPVB 1T20B 1G7PB 2J8UF 3DVFA 5JXAL 3U2SB 2CSPA 2VXSH 4GXUM 4HS8L 1UM5H 3C60B 3U0TA 3BWAA 5DGRA 2FECI 2YD2A 4TRPH 1NFDB 2AK1L 4KXZH 1AH1A 3TCXA 4YXKL 4YQXL 3MRDA 4HUWA 1JCKA 4OCRL 3U9UB 1KIUA 4W6YB 5SV3A 1R3IH 2G9HB 3MJ9A 1DN0B 2OR9H 2A73B 3OAYH 5L6YH 1T6VN 4AYFA 3MRLA 4HUKB 5KVFH 4I4WA 4P23B 3NABL 2GUOB 1VADA 4M7ZC 4NJAL 4QRPA 5HDQH 1T5WB 4RWYH 5HVHC 2EE2A 3FB7A 5ITBH 4X7CC 4ONFH 3SGJC 1U8IB 4LDOB 1DQQB 4HT1L 3D6GA 3QHFH 4HS3A 4WUUA 4R90H 5E00B 4TSCH 1FNGA 4PJ9A 4OCYH 1OGAB 4JQVA 3VXTB 4YEEA 4GRLD 1NGQL 2R8SL 4EIGB 1MQ8A 2PYEE 5BW7C 3TVMB 1CDIA 3G5YA 4J2XA 3OKKA 5ID1B 3C6LD 5KVFL 4R3SB 1R3HA 3MJ9H 4GKZB 4LF3A 5EZOL 1ZT1A 4OD3H 3O6FB 4ZOEA 4FFZL 3K4ZA 1BFVH 1DBKL 1RK0A 4P5KB 1I1FB 3RZCB 1FJ1B 4Y1AE 3VI4E 3U6RA 1I3VA 4ONFL 2AV1A 2FX9H 4L1DA 1P4IH 5D2NE 1AE6L 1YEJL 2RQ8A 3L3HA 4J1UA 4LQFL 4XP4L 1K4DA 4JDZB 4QHNB 3DX7A 3O81A 3EYVA 4OF7A 3DSNA 1TPXB 3EJYD 3FO2B 3UPRA 2VUOA 1BBDL 4NSKB 1BPVA 1WC7A 4WU7A 2R1XB 3QI9D 1AKJD 1KN4H 4CUCA 2BHZA 2ZUUA 2IANE 1UYWL 1LO2L 3MRJA 4JO2L 4LLUA 1CZ8L 1NBYB 2X5PA 4PJEB 1G7JB 3MOAL 4BQ6A 2VAJA 3DMMC 4ONGH 4N0YH 2PTVA 1KGCE 4KZDL 35C8H 5T1KD 5D7LE 5E5MB 5I2IA 4FQCH 5IVXA 3ARED 1CDYA 1TZIB 3MRRB 4DVRH 5CEZE 1C1EH 1A02N 4U05A 4XNZC 2XTJE 3D85A 1MFDL 4YK4C 2E3VA 2MKLC 3DV6A 4J3OC 2Z91B 3RI5F 3AY4C 4FS0A 5CKGA 3WE6A 1SYVA 5L88L 4JANB 5C0DA 1AC0A 5ENWA 1J05A 4QHUB 1J12A 1UACH 4M6MH 5E6IA 4LEOB 4GQPH 3ZTNH 4KTYA 1OWWA 4XP1H 3SJVE 2P48B 1IAIH 1A3RH 1MFEH 1QPPA 3VRLE 3PG2A 4NHUB 1T4KB 1JZ6A 3ZT6A 1T1ZB 2BOBB 1NANH 5DSCB 4ZFFB 3IYLW 4YEFA 3TBYB 4U6XA 5GJTH 4XRCB 4AZ8A 2A2QT 4GXVL 2EC9U 3P73B 1EEUA 1S7RB 2ORBH 3REVA 4LLQB 3UJJH 1QO3B 4JRYB 2ICEA 4PRPB 4PYGA 5FIEA 3T0BA 1JWMB 4M5ZL 4LAJH 5IF0B 4Z7VE 4EKXA 32C2B 3VMOA 2IQAB 4I0CC 1ZTXH 3ARSA 3VI3E 2RR3A 4XPBH 1HHIA 4HKXB 4KK9C 4OZHB 4LCYA 1RZFH 1WITA 4TPRL 4EN3A 2Q8BL 1QFWM 5L2JB 1UEYA 1UACL 3MRMB 4WU5B 2JTDA 4Y5YB 3VE0A 1NBQA 2SEBA 4JM2D 1P5VA 1IAIL 1T0NA 1N8ZB 4DCQA 4X4XB 4I18A 2VO5A 1QKZL 4CVZB 4Y16A 4X8JA 1H0DB 3O8XA 4ZTPL 5MHSE 3HC0A 3F58L 3SOBH 3AM8C 5I8EA 1R5VB 5DMJB 1QSEB 1T04A 3BHBB 3LN5B 1KNOA 4JO3L 2F54A 3DTXB 4MHHI 4PJ7F 4ZYKA 4GKOA 4ZO8A 4HZLA 4HIEA 1I9IH 2CGRL 3PL6A 1ZTXL 3CIQA 4EI5A 4LRNL 4BQBA 4XPHH 5D7LA 2DIJA 1MJUH 2AJYH 3CU7A 1OAUH 3P4NA 1H3PH 4XAKE 3LZFL 5HGHA 5DJ0B 1BQHG 2A9NL 3QXVA 3HE6A 1IM9B 1D9KA 1AQKL 4QRSB 2PR4H 5DJ6A 1QQDA 2EYTB 1Y18B 1FZMB 1X7QA 2BERA 4DGYL 4NKMA 2GJ6E 3LSOA 2IC2A 2HT3D 2H3NB 2UV3A 3GMQB 2OJZH 2VDPH 2A77L 2H8PB 5AAWA 5E6YA 1B0WA 1G7MB 4XPGH 3S5LA 1L4IA 3HNSL 5J7CC 3VDAA 4RMVA 1NC4B 5L8LB 4ONHA 3G9VA 1MLCA 2P24A 3TJHC 3FB6B 1CTOA 4WI4A 5B3NA 4YHYC 3B83A 3W0WD 4XPHL 4TSAH 1FL5B 3IKCA 4G6JH 4QRRB 3C09C 2AJYL 3O2VH 1D5MA 1J0ZA 1DVFA 4M7LL 5IJKA 5C0AA 4M5YH 1AFVL 1CF8H 2XPGB 4RFEA 2HTKD 3MODL 3ARBA 3FQNA 1VKXA 4FP8H 4Z76B 1FL3B 2PR4L 5AG9A 3ZYJA 3IDMA 1YEFL 1KTLB 5F7EL 2IBZY 2JCCB 5DHVA 4TSBH 2OL3B 2HFTA 5D2LE 1PGRB 4CW1B 1AP2B 2VLKE 3E2HB 4Q6IC 1XGRA 4LL9A 3K0WA 4DKFH 1CL7H 4PGEB 2VABB 2DLTA 5F7KC 3BXNB 4UB0L 3RWJA 3RNQB 5JA9A 4KH2A 4OFIA 4ZXBB 2B1AH 5FYKD 4PJAE 3WO4C 4AEFA 1S5HB 2R4RH 4ODTH 5BV7L 3DI2B 4I48A 3TO4A 4EVNA 2EE6A 2V7NB 1DLHB 1OVZA 2HP4A 4K7PX 3SKUD 2J1KA 4OLYL 1JPGA 1HXYB 1KTDB 1CF8L 1HXMA 5KS9B 3BKMH 3C60D 4RNRA 1AQDB 5DHYB 3FT4B 4NQVB 4U1GC 1YNLH 4ZD3L 3UBXA 3CZFB 4X7TB 4H26A 4G42B 3RWHB 1CGWA 4GG6B 2X9WA 1G6VK 4MQXC 2P8PA 4TVSa 4B0MM 5CEZL 3DX6B 5D2NC 1XGQB 2N7AA 3WHXA 4DKFL 4S2SB 3B9KA 3K81A 5JOPE 3QDAA 2J6EA 3OF6A 4P23D 3GSRA 4TNVF 1CVSC 2ZJSH 4RMRA 5DMKA 4HFWB 4NT6A 2BRRL 4XNMB 2BVQA 4J8RB 3I6GA 4UV4H 4LCWB 4ESKA 1P4BH 4LAQH 2GJ6A 1EFXD 4U1HA 5BV7C 2R1WA 5I9QB 2MQ3A 2CRZA 3L7EB 4U3HA 1KN2H 3OG4B 15C8L 4FOMA 3GMOA 5TQ0H 2H41A 4C83A 3T65B 4WFHE 3KS0J 5DR5L 2D4FA 3LPGA 1OGAD 2IAMB 2OMNA 3ULUD 3QEHA 4H8WC 3EO0A 2GFBA 5ACMA 3I02A 1FZOA 1ZKAA 3TBSB 3TVMD 2HFGH 4JQIL 1A1OB 1QSFB 4HK3N 1I1YB 1TENA 4FRWA 4D9LL 2XTJC 4FQJH 5CGYC 4GUPA 3SKOB 5LGHL 4DZ8A 2NXZB 2ZJSL 4KC3B 1DSFL 4XNYL 1MHHA 3THMH 3O6FD 3D25A 1MRDL 2J6EH 1MWAA 3RZCD 4LAQL 2NY5L 3GMMA 5DS8B 2AP2A 3HAEB 2GITB 2VLKA 2YPKB 2X9XA 3HMWL 4MJ5B 3EYQC 3RL2A 4I3SL 1T2QL 4J3WA 2D0GA 2NLJA 1KN2L 3K4AA 1I7RA 3MJ8A 4X6CB 1V05A 2EXYC 3HZYB 1BJ8A 1KPRB 4WW1B 3VFNA 5J6HB 3WUWG 3EGSA 5SX4I 1IKNA 2ZCKH 3UTZA 3PDGA 1Y6MR 1BP3B 1KCLA 2HFGL 1UENA 4KMQA 4PJ5E 3G6JE 5I16B 5EBWB 5EIQA 1AHWC 3MUHL 2EIZB 3P9LB 2C7UA 3EYUH 2QADC 1P1ZA 4H25B 5FOBA 2CDEB 3JV4A 3RKDC 4LSQL 3LPFA 4YBLB 1OAYL 3WDHA 1RHHB 3UPAA 3SKMB 3ARGC 4D0DB 3ZE0E 5EB9A 1YUHA 3WIHA 1FVDA 3VXSE 2BC4B 1CS6A 4PY7B 2FJGA 1LK2B 5ESQB 2V2XA 3DURA 2ZCHH 3H7BA 4PG9B 3RVXD 5FF6B 2HA1A 1MWAH 4YJZL 5GZND 4FZEH 2R29L 2XY1A 4JFZH 1G9EA 4GW1B 3ILQD 1G7HB 1GGUA 2XG4A 5IT2L 2MHAA 3IJYB 1OB1B 5CP7B 4ZFZA 5F7YC 1YN6B 5A43C 1GC1C 1GH7A 5IHLB 4G80A 5I71B 2XQYG 3QCUL 3MXWH 3O6MH 4NQCB 4XNXH 5SV4A 3SE9H 1OTSD 3DIFA 4U3CA 3AMKA 4MAUH 5C09E 3P30L 4BSWB 3H7LA 2VSDA 3DXAB 3O9WC 3MLYL 2CIKA 2MQ0A 5ABDE 4JRYD 4PRPD 2DBLL 4PRHA 2BSTB 1P53A 2BMKA 5AZEL 4L9LB 4XMPH 2KH2B 3FTGB 5FKPB 5HI4C 3WIHH 4RZCB 1QFOA 4KQ4L 5D7JA 5C1MB 2JE8A 1XIWC 2DQFA 5D8JL 4JFZL 1NBZB 3CH1B 1CQKA 2EDOA 5EU3B 5DQ9A 1YDPA 4ERSL 1AD9B 4L5FL 1OP5H 1JNNH 1JV5A 1ZHNA 3T1WA 4NPYB 3G5VA 3Q3GB 1WEJH 2Z92A 2ICWA 3MXWL 1P7HL 3ARDC 1ZA6A 2OBGA 1D5ZA 4G6FB 4KJWD 3OJDB 1JFQH 3FRPG 2EDBA 4OGZA 1D6EA 4FG6D 4UT9H 4P2YA 4EOWH 5IHUL 1RD6A 4MAUL 1RZGB 2EO1A 2J8UB 1KT2B 1JZ3A 3KLDA 5SWSB 3SGDH 4H0HB 4ZUWA 2PXYD 3OKDA 1QRKA 4Z7NE 2EO9A 1FVEB 2X4UB 3B6SB 1F8TH 4U1KB 4UILL 3SN6N 5GRJL 4MWFB 2HJKA 3ARFA 1GIGH 2JB5H 4BZ2H 1S3KH 1HCVA 4F3FA 1UWGH 1WEJL 3W39A 3I3BA 4M1DH 3L5WA 2P5EE 3D2UA 5SWZE 5KVEL 5I6XB 3QNZB 1VESA 4OI9A 1JGEB 5A16A 4JFXB 4Y5VC 1NGYB 4YR6B 3X14A 4UT9L 4OJFH 4PRDA 2Q6WA 2CUIA 5GRZA 1U8LA 4TTDD 5I8KH 4YX2H 5IG7A 1UA6H 4RISH 1D7FA 3WFEL 4ZOAA 1KJ3H 2DQIH 4NO5A 5INCB 2R56H 3WS3B 1F3JB 3IDJB 1A6AA 4RAUA 4PRNA 2XA8H 3LQMA 1FL6A 1R3KB 2NY0B 4Y4KA 1ZSDA 1NC4D 1AXTH 5FYLD 4HJJH 4YDKH 3IVKA 1H15B 1JN6A 1AC6A 2JJWA 4LRIA 3P0GB 4NRXA 2EDFA 4MXQD 4F7EB 1WTLA 5F1SA 1XGUA 3FO9A 1CGYA 4BZ2L 1Q0XL 1B0GA 1T21B 4QRRD 3VCLB 1RSFA 2R69H 5DI8B 3ZE1E 2F9BT 4BFIA 3QCTH 3LQZA 4QTHA 3GIVB 3AAZA 1T7WA 4XI5C 3QUKA 2FL5A 3WLWC 2VL5A 3QIWB 4WFGD 5I75B 4P4KA 1KJ2A 2R0LH 2XA3A 3T0EA 5I8KL 2A6DB 4GW5A 1UA6L 5HXMA 2NXYC 4ORGB 5FUOH 2CDGA 3G5XB 1KJ3L 2DQIL 4JZOA 1IAKA 4ZQKA 3VU2A 3U46B 4XPFH 2R56L 4XXCC 1T1XB 2ATKA 4U4BA 1B4JL 1MUJA 4ZXBD 1MY5A 3NZHL 1JK8A 1IEHA 5JPMA 4KJYA 3ULSA 4P5TC 3FRUB 3DV4B 1REIA 5JHLH 4LLYA 5TGBB 5GXBB 4ODHL 2VDKL 2NW3A 1MY7A 5FM5O 4IBLT 1MCFA 3GDBA 3O0RL 3VXUA 4IOIA 2VZ1A 1SBSH 1NGPH 3OKEB 3FZUC 2I5YL 1FNSH 3OTTA 3UTQB 2UYLB 3KPMA 2R39A 3WXWH 5I76B 4UNTA 3Q2CA 1NJ9A 5IMOA 3EW3B 1V3MA 4K94H 3IFNH 4PTUA 4WTWA 1O5DT 3SY0A 4I0KA 5C08B 5GS0H 4X6BB 1JVKA 4QYOB 2XZZA 4LCWD 1N5AB 2I9LA 1QEWA 5DWUH 1PJ9A 3V7AE 5JHLL 4PRAB 4HJGB 4QHLA 4ORZC 4OGXH 3L3GB 4JG1H 5IB1B 5JDSA 3O6LH 3OKNA 3QDGB 4HH9B 5EUOA 2F74A 3HUJB 1OOAA 3MRIB 4JZNB 4ELMF 2BP3A 4HMCA 2DMCA 1S9WB 4W4OA 5C6TH 5FYJH 3ROLB 1N59A 2Y6SD 2IAMD 1PG7H 1Q9KB 5ICXA 1C16B 2WBJB 5EOQH 4YGVA 3BZEB 1Q38A 4L4TE 3WXWL 5DMIH 1WIOA 4ZPTB 3QDJB 1JYXA 1BGXL 2OTWB 1QSFD 4L3EE 1KJ2L 4G43B 3W0WE 1L7IH 5EOCH 4EJ1C 1N3NA 2EDLA 1Z2KA 5DRWB 2HT2C 2NXZD 3VWKB 5C0CB 3H9YA 2B2XH 1TQBC 1UKSA 1WCBA 3I6KA 3MNVB 4K7PH 1RU9L 3GI8L 3RWCA 5CEYB 5DWUL 1FG9C 4TUOA 4KHXH 3ZHKA 2Z0BA 3MACL 4UAOB 2OS7A 2X4NA 2YD7A 2LABA 4LSVL 4F7PB 3WSQH 1YMMA 3QA3A 5DD3H 2VMFA 4FQ1L 4YFLF 3L5XL 1CFNA 2GTZB 1YEGL 3BGFC 2PW1A 4WENB 2BSRB 3G08A 4PJ7B 4X98B 4BH8B 1SEQH 1INQA 3BPCA 4PJHB 3TYGL 1RULL 1Q9LB 4GQ9L 2Q8AL 4G7VL 1DR9A 3D48R 2DWDB 3TYFB 3B43A 1L7IL 3KR3L 5EOCL 5HGAB 1A0QL 2AVGA 2WINB 2B2XL 2IPKA 2X6MA 3EOAB 3DVNB 1CU4H 1RUQH 3HG1D 5FB8B 1HSAA 4PJDE 1YJDL 2DF3A 4Z7WA 2I9TB 2BJML 4PJIE 3CSGA 3MBEA 1XCQA 3TIEA 3WSQL 4XVTL 5GGUB 1IGIL 1JHTA 5DD3L 4M8QA 2NX5E 1BJ1H 3ZE2F 1RZKL 2DLFL 1UC6A 5LAXB 4JHWL 5GISL 4HZAA 1HZHH 3RJDA 1U58B 5FYKU 2WUCL 2BCKB 3RVTD 4TVPE 1MFBH 3QI9C 5IB5A 2FJHA 4K8RL 3MTRA 3QDME 5JHDB 4MQSB 5C0EB 5ACLA 3HI1B 4NQCD 1CDHA 1NCDL 3FOLA 4KY1L 3F5WB 3QEQE 4FFWD 1KTRL 1UJ3A 4NN7C 1TVBA 1CU4L 2PO6C 1JMXA 2P49B 4L4TA 2YUXA 2ARJB 3DXAD 4GAGL 1DFBH 2VN4A 3Q0HA 1X3DA 4X4YB 3H3BC 1YEKH 3C2AL 1FNHA 3PWUA 5HDBE 1YJDC 3NPZB 1TCRA 2X2YA 4GAJL 4WTZA 2X1XR 3H3PH 5K9OA 2CO7B 1FNAA 3LEXA 1OT2A 2XFXA 5DZNA 1TETH 3IDYB 4WFEE 1RZKC 2JELL 2JJVA 1A9EA 1NAML 3PHQB 3KXFB 5F7DA 2AJVH 1HH9A 3DO7B 5J1SC 3JWDC 2YRPA 4G6FD 4J4PD 1CXIA 1U3HA 3ZKMC 5HSFA 4NFCA 3MLUH 5B8CB 2ILLA 4YPJA 4N0UA 4PG2A 4G6MH 5EOCJ 5SWSD 3FOMA 3HAEG 1XF3B 1J88A 3X11A 5D5ME 3MCKA 4R4BB 4NO3A 4OQ1A 1ZS8A 1QYGH 4NQEE 4WGWB 4ODWB 4O02L 3H3PL 5DJ8A 1TNMA 2GCYA 4D9RD 3VFPA 2VLLB 5GSRB 4ACPA 2GEEA 1OTTD 5J3HD 5IMMB 1NCCH 1T66D 1CK0H 4DZBB 3GM0A 3BPOB 5KJRH 1K8IB 3ETBF 1DQTA 4Z7UF 1WBXB 4HDIB 5F9AC 5DZLA 3O41B 2E7BA 4Z7QF 1I9JL 4PGDB 4X80H 4KVNL 1UXSA 3GJEA 2VOTA 3CMOL 2BNUA 4K3DL 3QDMA 5GS3A 5AUMA 1TITA 4PGCA 4OZFH 3QEQA 4HCRA 1QYGL 1I1AB 3SDAA 3MV7B 4HGWB 4LHUA 4W6WB 1OPGL 4RA0C 1ZXQA 1A5FH 2J4WL 4LIQE 1QRNE 4M6AA 4PV8A 5FUCE 1MCPH 4V1DE 3SCMB 4YPGA 3LDBC 3PQYA 1LNUB 3R8BB 5T3ZE 1CK0L 1F45A 5IB2A 3HB3D 3EZ8A 4MMZC 5KJRL 4AQ1B 3QIWD 5JXEA 2YUZA 3DVIA 3FCTB 4LGPB 4DFIA 1S7XA 1E6OH 5F1IB 4W81A 3RJQB 3FONA 3MGTB 3RNKA 4WI5A 2DI8A 3OZ9H 2CLRA 3E6HA 2HT3C 3V7MA 3LIZH 3LRHA 1FO0B 3RPIB 1GHFL 4X6EA 4FQXB 4WO4A 4ZO6A 3ZLQC 2AKRB 4Q7DA 3B9DA 3ISWA 3EOYG 4HUUA 1RUML 5C07B 3NN8B 3ARYA 3MRNA 5BW7A 5HGDA 1SJEB 4P5MB 4OGYH 1X6LA 4HCRH 3OR6A 3K2UH 4ZUUB 3D87B 3QJFB 4X0KB 3TH4T 5IFAL 1IGCL 1K8DB 3S3PA 1LO5B 4AIOA 1X44A 2VDQH 2H26A 3X17A 4RGMC 1E6OL 3MXVH 1G7LA 3O4LA 4XP6H 4FFVD 1S7QB 2VLJB 3S36X 1TJHH 2I27N 1YYLL 4Y19B 4LCUA 3UROR 1YEHH 3OXSA 3RTQA 4KMTH 4O4YH 4JDTH 4TVPL 5IVZA 4YHKL 5C08D 4MNQE 5D1XA 3M1BA 1RURH 4ZNEA 2MTPA 5IWLA 5E1AB 1GGIH 4WWKC 2ADIA 3R8QA 4XMLH 4HKZA 1ZWIA 3MO1B 1LK3L 2YBRB 4OGYL 1F4YH 2OP4L 2FIKB 5EA0H 3CFCH 5D7IA 3T77B 3SQOL 5BJTB 1H3UA 2NNAA 1EEYA 3QDGD 2ITDA 1VFAB 3AUVA 3DMMA 3MYJB 2VDQL 4JY4B 4LSUL 4MDJA 4U6HA 3KLHD 2W0LA 3MXVL 4ZUVB 3DUUA 4ONOA 1MF2L 4N8VB 4DN3L 2WBJD 4MVBD 1KXTB 2HYMA 5E5UB 3ARVA 4HIHA 2OLDA 3QDJD 3HHRB 3T2OA 1X5XA 3HE7C 1YMHA 3B8YA 4R4FH 4KZEL 1EHLH 1YEHL 4WHYH 1DE4A 3PGDA 1UEMA 2A83A 4JDTL 1SVCP 3PHOB 1TNNA 4A6YA 3VWKD 3SDXE 5C0CD 5B38A 3U4BH 4FQLH 1H3VA 3NZ8A 1FYTA 3O3EA 2QV2A 1ZANH 2HFFB 1RVFL 2QQNH 4JJ5A 2EDWA 1EGJL 5C0JA 1IC5L 4X6DF 3LKPA 5CZXC 1F58H 1AIFA 4PGBB 5E8OB 1K4CA 5DT1H 4NZRH 4UTBH 2AK4B 3L3OB 1U8QA 5I17A 5KSAB 3FT3B 1VFUA 3GI9H 4MCZB 1BD2B 5HI3C 1A7PH 4RQQA 5BXFB 2UVEA 3MBXL 5KW9H 1EMTH 3PXJA 4JFPA 4M62L 4Q9QH 4YDIH 3IS0X 5F1NA 2DBJA 4R4FL 1EHLL 2HKHL 1IGJA 5DXWA 1FAIL 1J8HB 3O6FC 2CO6B 5KG9B 3VH8B 1L6XA 4MA1B 4MX7A 3C2SA 4BZ1H 3DSFH 2GT9A 1ZANL 1E4WH 4ZS6C 3F7RA 4A6YH 4KGJA 3KPTA 3BP7A 5E99L 4F58H 5C9JB 5HHXH 3X3FL 3VWJB 1BQLL 1FRGH 3MLVH 3MFFA 1F58L 3ALXA 4MNQA 4P57A 4F7TA 4NKOB 5IFHL 1TPXC 1T03H 4NO0B 2VXUL 3UO1L 2YPLA 4P4RA 4YAQA 1JZ5A 5F44A 1U91B 2AJZB 1EXUB 3ZMRA 1X9QA 4RMUA 5IB4B 4YC2B 4OT1L 1SY6H 2BVTA 5JHDD 1N0XH 4LP4A 3ZTJH 2W59A 4LIQL 5DJCA 3S88H 4U7SA 1BZQK 4JR9L 5F9OL 4LMQI 4GRWB 3MRPB 3MREB 1MSPA 1KULA 1NLDL 4BM7A 5T3ZL 2BNRB 3KPRB 4QRUB 1EAJA 1AGEB 1PEZA 4NQUA 3UTTD 4CADB 2ZNXA 4A6YL 2VLRD 1T0MB 4RFOH 3V5HA 4OCNC 4OZGA 4DGVH 1UXWA 5HGBB 3RVXC 3P9MB 1Q8MA 3CFDB 1XH3B 3LKNB 5C86A 4F8QA 4XWOC 5GZNC 3FQXB 4HPYH 4C56A 6FABL 1RJCA 3SPVA 2X40A 3ILQC 4NGHH 4F57H 1EJOH 2Y06H 4KMLB 3QG7H 4XHJD 3TWCL 4TQEL 3REWB 5FKAA 1EEZA 4LVNB 1DJSA 2G75B 1HWGB 1AO7E 1CD1B 5TE6L 1JNJA 1OAKL 3ZDYF 1F90L 1GYAA 3K1DA 5CJXC 2W38A 1OTSC 4IRJB 4U1NA 2B7DT 2Z4QA 1NGXA 4CNIB 3CC5B 4L4VA 4M6NH 4JFEB 5FHBL 2YA0A 3U0WH 3TNNB 1IC4L 3EO9L 4OSUH 5FDWA 4PJCA 3MLTB 4FQ2H 1D5IH 1DANU 2NY1B 3Q6GL 5BRZD 4QXGH 4X99A 1UB5A 1XR9B 5EBLB 1GZQB 3C5JA 3P0VL 1X5ZA 3L5IA 5EZJA 2MNUA 4NGHL 1KB5A 1I8IA 3QG7L 3J7HA 5IW6B 3DNKA 3HG1E 2NZIA 2OJEB 4X5XB 4O2FB 2EH7H 5L9DH 5EUKB 1VFMA 1GCFA 4WCYL 5HHNA 3DX9B 5ADPH 5TDNA 2AXGA 5EZIL 2MJWA 3BUYA 1MAKA 4OZIE 5AWNH 3SBWC 3IB4A 4ELMB 1A3QA 1NCWH 2PXYC 1ACYH 4RBPK 5AD0A 4LKCA 2O26U 3EDKA 1D5IL 1K2DB 2CDFB 3V5DA 4JHAL 4LCCA 4XX1E 3EAKA 3OJVC 2FJFB 4X4ZA 3FN0H 1SEBB 2EIBA 3MV7D 2BVPB 4L8BB