2EL5A

Solution structure of the 18th zf-c2h2 domain from human zinc finger protein 268
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
42
structure length
42
Chain Sequence
GSSGSSGENPYECSECGKAFNRKDQLISHQRTHAGESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the 18th zf-C2H2 domain from human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2el5A01
2EMYA 2MDGA 4R2SA 1YUJA 2EL4A 4IS1C 4WSGA 2ADRA 1DGCA 2EMGA 2D9HA 2EM7A 2LV2A 2EOXA 2EM4A 2EOOA 1ZU1A 1AAYA 2DLQA 2EOHA 2EN8A 5KL6A 1YUIA 2MKNA 1P47A 2WBUA 1X6HA 1A1IA 3EPHA 1JK2A 2EMXA 2EM6A 5KL7A 1X3CA 2EPCA 3VHTB 1Z1BA 2EP3A 2EMIA 2EMZA 2YTNA 2EM0A 2EOEA 4R2EA 1B69A 2CSHA 2EN4A 2ENHA 4FK5C 1X6FA 2EPRA 1UN6B 2YRKA 3EPLA 4F2JC 2YTJA 4R2PA 1JK1A 2I13A 2EN2A 1X6EA 2YTQA 2YU5A 4R2DA 2DGCA 3UK3C 2EMAA 2NABA 1KJKA 1ZR9A 2EM2A 4F6NA 1G2FC 4R2RA 4R2QA 1G2DC 1YSAC 2EMHA 2A25A 4M9VC 2EORA 1UBDC 2EOSA 2WBSA 2GLIA 3M99B 2J7JA 2YTPA 2EPXA 2CT1A 2RSIA 2JPAA 2EM9A 2PRTA 2EM3A 2EOIA 2LCEA 1TF3A 2ENAA 5KL4A 2JP9A 2VRDA 2EOQA 2LO3A 2LVHA 1A1LA 2EOMA 2YSOA 5KL2A 2ENCA 2M9AA 1MEYC 4F6MA 2EMKA 2GHFA 5KL5A 4R2AA 2MKDA 2YU8A 2YTGA 1A1JA 1X5WA 4GZNC 2CTDA 2EPPA 2EM5A 2EPZA 3EPKA 2EOFA 3EPJA 1LLMC 2EL5A 1BB8A 4IJDA 4X9JA 2EL6A 2EQ0A 2R1FA 3MHHC 2ELZA 1WJPA 2YTEA 2WCC3 2EQ3A 1BBOA 2DRPA 2EMCA 2YSPA 2EN3A 2EMWA 2YTIA 2YTOA 1NCSA 1RMDA 1A1GA 2E72A 2WBTA 5KL3A 2YTDA 2EOZA 2EQ1A 2EN1A 2EOJA 2EMBA 2EPAA 2EOYA 1ZAAC 2YRHA 2DLKA 1A1FA 2EM8A 2EN6A 3MHSC 2ELYA 2BB8A 2RPCA 1A1KA 1TN9A 2YRMA 1A1HA 1TF6A 2DMIA 2HGHA 1F2IG 2EN7A 2LT7A 2EMFA 4R2CA 2EPUA 2YTFA 2EJ4A 2EE8A 2EMLA
chains in the Genus database with same CATH superfamily
4X65E 2L6MA 1PJQA 2MDGA 4DV3E 5A6JA 1MGTA 4ZYGA 3ZOQB 4F9CB 1EKZA 4WSPA 2D9HA 2EM7A 1WXRA 2EOXA 2EOOA 1N36E 1J26A 4HTGA 3KWRA 4O43A 4JI1E 2EOHA 1YUIA 4TUGA 3JAMC 2V83A 1P47A 4NXME 1X6HA 2N8XA 2JR1A 4DKKA 1Z1BA 2EMIA 2EOEA 4R03A 1UN6B 2YRKA 4L8NA 3LMLA 2Q8UA 2E1MA 1GQEA 4JI4E 2RSMA 2YTQA 4P7DA 2ZM6E 3ECRA 1ZR9A 4F6NA 2LJUA 4R2QA 1G2DC 4DUYE 1YSAC 2FGGA 4LU9A 1UBDC 3J81C 2GLIA 2EPXA 2YT4A 5IWAE 4DR4E 2JOXA 4J8ZA 2EM3A 2F8BA 4O4KA 4NZVA 2LVHA 1A1LA 4BC9A 2EOMA 5KL2A 2M9AA 1MEYC 2RQLA 3F6GA 2NUEA 5LL6R 2G7HA 3RMPA 2E5LE 1X5WA 4DR1E 2L3JA 2CTDA 4BS9A 3EPKA 3EPJA 2EPKX 2EWLA 4DMIA 3BIDA 3IWCA 1T4NA 4WPYA 3J80C 2WCC3 2EQ3A 2DRPA 4BC7A 2EN3A 4LTYA 4JYAE 4KZSA 2WBTA 2YTDA 1BBGA 3H09A 1ZAAC 2EOYA 5AC4A 2B9DA 5T6JA 2JVAA 1J5EE 4DR5E 2ELYA 4DV7E 4GEQB 2F4VE 2L2NA 3P1XA 2EPLX 2UUCE 4JI0E 1XNQE 1N34E 3ADIA 2EMLA 2R76A 4DV4E 2EPOA 2JWOA 2KHXA 4LF9E 2L2KB 2EL4A 4WSGA 1DGCA 2RS6A 4YHHE 1XNRE 1HNZE 1EH6A 4N4RB 1WHNA 1YYKA 1ZBTA 2LTRA 2NUFA 4OOGC 2DMYA 4LFAE 1A1IA 1STUA 3EPHA 2L3CA 1JK2A 3HPSA 3C4BA 2EPCA 4ZYDA 2EP3A 3J7AG 2EMZA 3DF6A 2M7QA 1B69A 2VE7C 3JTZA 2ENHA 4FK5C 4B3TE 4BBYA 3EPLA 2M1SA 1IMUA 1T39A 2DSYA 1DQ3A 2B3TB 2V89A 2JOBA 2DIXA 2LJHA 3ADGA 5AASA 4LFCE 2LRSA 4R2RA 2M4IA 1I94E 2LTSA 4M9VC 2EORA 3IWDA 2KONA 3C6KA 4ZYEA 4X64E 4KWYA 1PJTA 1RC7A 4R8OA 2JP9A 2EZ6A 2VRDA 3BBGA 2EOQA 2LO3A 4WXCA 4Q35B 5A2QC 4F6MA 2YZTA 4R2AA 2MKDA 2YTGA 4GZNC 2ODRD 4X62E 3K6QA 1YYWA 2MC5A 4F54A 2EPZA 1IQSA 3J7Yp 2L2MA 5AE2A 3HQ1A 2V88A 1IBLE 2JXPA 4NXNE 4X9JA 1QU6A 2LUPB 4M0VA 4MLQA 4BHCA 2UUBE 5IV8B 2EMWA 5ADZA 4RH8A 2LUQA 4DV2E 1RMDA 1A1GA 2I9IA 5LLQA 5TSEA 5KL3A 1UHZA 2EOJA 4WX9A 4O24A 3HXLA 2UU9E 1T4OA 2B7TA 2EM8A 4B3SE 2EN6A 3MSWA 2RPCA 1A1KA 1DI2A 1L4SA 2YRMA 1A1HA 4DR3E 2EN7A 4GKJE 2EPUA 2YTFA 4LF8E 1N33E 2EE8A 2KOUA 2HC5A 2L92A 4IS1C 3KZZA 5A6BD 4M30A 4LFBE 2EMGA 2LV2A 2EM4A 4Q28A 3BF2A 1ZU1A 2ODRC 4DV5E 2EPNA 3VYXA 2EN8A 5KL6A 4NHRA 2MKNA 5A6BA 1X48A 5A6KA 1X47A 2EMXA 2EM6A 1YFHA 3VHTB 1EH8A 1FJGE 2YTNA 4R2EA 2EM0A 4WFTA 3T1YE 2CSHA 3IWBA 5A69A 1PKPA 1YZ9A 3TQMA 4F9BB 2IHR1 2YTJA 4R2PA 2LMZA 1JK1A 1IBKE 2UXBE 4B3RE 4DR7E 2HJJA 2EN2A 1NEIA 1X6EA 5AE1A 2YU5A 4DV6E 4BHBA 3UK3C 3JU0A 1G2FC 1O0WA 2N3HA 1EH7A 2A25A 2UXCE 2EOSA 3M99B 1HNXE 3ADJA 5BR8E 3KZYA 2K4VA 2YWQA 5KL4A 4JI8E 2VQEE 4JI6E 2B7VA 2ENCA 4DUZE 2EMKA 3EQ1A 2NUGA 4DR6E 2YPNA 1FKAE 3HTXA 2EOFA 1SR9A 2K7IA 2V87A 1BB8A 2RTXA 4OX9E 2EQ0A 1KYQA 1WJPA 2UUAE 4M2ZA 2YSPA 2YTOA 1WRJA 1NCSA 2EOZA 1YPNA 2EN1A 2EMBA 2YRHA 2HHHE 2DB2A 1A1FA 1GTKA 3OTOE 5CFFE 1RQ0A 3MHSC 1SFEA 3C4TA 1WHQA 5DNYA 1TF6A 2DMIA 1F2IG 1T4LB 2UXDE 4R2CA 5A6AA 5FLXC 2LE2A 4JI3E 2EJ4A 1IQOA 2EMYA 5LMNE 3ADLA 4R2SA 4YY3E 4DV0E 1YUJA 5AE3A 3VYYA 2ADRA 2H36X 2MC6A 1PDAA 1PJSA 4BMJA 4KHPE 3THOB 4GKKE 4LF5E 2VQFE 3BGHA 4DR2E 1AAYA 2DLQA 2LBSB 1X49A 3FIGA 2V86A 1N32E 4X66E 2FTXB 4DV1E 1HNWE 2WBUA 4JI7E 5KL7A 1X3CA 1UILA 4RHBB 2WZOA 3LLHA 2FV4B 2EN4A 3OMLA 2NA2A 1X6FA 4WYQB 2EPRA 4HEIA 4F2JC 2V8QB 3THNA 2I13A 1T38A 3T1HE 5F3WA 2RS7A 2L8TA 4R2DA 2DGCA 3HPZA 2EMAA 4WXDA 2NABA 1KJKA 2EM2A 4P78A 1QNTA 2BBGA 2EMHA 4L5NC 2WBSA 2MDRA 2N3GA 2V85A 1N3GA 2J7JA 2YTPA 2CT1A 2RSIA 5IT9C 2JPAA 2EM9A 2PRTA 2EOIA 2LCEA 1TF3A 2CPNA 2ENAA 4O5GA 1GZ6A 2YSOA 4LF7E 2VF1A 3C6MA 2GHFA 5KL5A 4LF4E 2YU8A 1A1JA 3QG5C 4B3ME 3L00A 2EPPA 2EM5A 2JYAA 1LLMC 4MLVA 3AV0A 2EL5A 4AQYE 3AUZA 4IJDA 2EL6A 2R1FA 3MHHC 2ELZA 2YTEA 4TUIA 4LF6E 1ZBQA 1BBOA 2EMCA 3VK6A 3F6HA 4ZYHA 2YTIA 2E72A 4JV5E 4X8WA 5AC5A 2EQ1A 2EPAA 2DLKA 1YYOA 2GPIA 2L33A 1XMQE 4F9AB 2BB8A 4JI2E 5IXMB 1TN9A 1IBME 4K0KE 1AH5A 4JI5E 5LMUE 1XMOE 4I8OA 2HGHA 4BCAA 2LT7A 2EMFA 2EPMX 3DJWA 2JY9A 1HR0E
chains in the Genus database with same CATH topology
2EMYA 2MDGA 4R2SA 1YUJA 2EL4A 4IS1C 4WSGA 2ADRA 1DGCA 2EMGA 2D9HA 2EM7A 2LV2A 2EOXA 2EM4A 2EOOA 1ZU1A 1AAYA 2DLQA 2EOHA 2EN8A 5KL6A 1YUIA 2MKNA 1P47A 2WBUA 1X6HA 1A1IA 3EPHA 1JK2A 2EMXA 2EM6A 5KL7A 1X3CA 2EPCA 3VHTB 1Z1BA 2EP3A 2EMIA 2EMZA 2YTNA 2EM0A 2EOEA 4R2EA 1B69A 2CSHA 2EN4A 2ENHA 4FK5C 1X6FA 2EPRA 1UN6B 2YRKA 3EPLA 4F2JC 2YTJA 4R2PA 1JK1A 2I13A 2EN2A 1X6EA 2YTQA 2YU5A 4R2DA 2DGCA 3UK3C 2EMAA 2NABA 1KJKA 1ZR9A 2EM2A 4F6NA 1G2FC 4R2RA 4R2QA 1G2DC 1YSAC 2EMHA 2A25A 4M9VC 2EORA 1UBDC 2EOSA 2WBSA 2GLIA 3M99B 2J7JA 2YTPA 2EPXA 2CT1A 2RSIA 2JPAA 2EM9A 2PRTA 2EM3A 2EOIA 2LCEA 1TF3A 2ENAA 5KL4A 2JP9A 2VRDA 2EOQA 2LO3A 2LVHA 1A1LA 2EOMA 2YSOA 5KL2A 2ENCA 2M9AA 1MEYC 4F6MA 2EMKA 2GHFA 5KL5A 4R2AA 2MKDA 2YU8A 2YTGA 1A1JA 1X5WA 4GZNC 2CTDA 2EPPA 2EM5A 2EPZA 3EPKA 2EOFA 3EPJA 1LLMC 2EL5A 1BB8A 4IJDA 4X9JA 2EL6A 2EQ0A 2R1FA 3MHHC 2ELZA 1WJPA 2YTEA 2WCC3 2EQ3A 1BBOA 2DRPA 2EMCA 2YSPA 2EN3A 2EMWA 2YTIA 2YTOA 1NCSA 1RMDA 1A1GA 2E72A 2WBTA 5KL3A 2YTDA 2EOZA 2EQ1A 2EN1A 2EOJA 2EMBA 2EPAA 2EOYA 1ZAAC 2YRHA 2DLKA 1A1FA 2EM8A 2EN6A 3MHSC 2ELYA 2BB8A 2RPCA 1A1KA 1TN9A 2YRMA 1A1HA 1TF6A 2DMIA 2HGHA 1F2IG 2EN7A 2LT7A 2EMFA 4R2CA 2EPUA 2YTFA 2EJ4A 2EE8A 2EMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMY A;  2MDG A;  4R2S A;  1YUJ A;  2EL4 A;  4IS1 C;  4WSG A;  2ADR A;  1DGC A;  2EMG A;  2D9H A;  2EM7 A;  2LV2 A;  2EOX A;  2EM4 A;  2EOO A;  1ZU1 A;  1AAY A;  2DLQ A;  2EOH A;  2EN8 A;  5KL6 A;  1YUI A;  2MKN A;  1P47 A;  2WBU A;  1X6H A;  1A1I A;  3EPH A;  1JK2 A;  2EMX A;  2EM6 A;  5KL7 A;  1X3C A;  2EPC A;  3VHT B;  1Z1B A;  2EP3 A;  2EMI A;  2EMZ A;  2YTN A;  2EM0 A;  2EOE A;  4R2E A;  1B69 A;  2CSH A;  2EN4 A;  2ENH A;  4FK5 C;  1X6F A;  2EPR A;  1UN6 B;  2YRK A;  3EPL A;  4F2J C;  2YTJ A;  4R2P A;  1JK1 A;  2I13 A;  2EN2 A;  1X6E A;  2YTQ A;  2YU5 A;  4R2D A;  2DGC A;  3UK3 C;  2EMA A;  2NAB A;  1KJK A;  1ZR9 A;  2EM2 A;  4F6N A;  1G2F C;  4R2R A;  4R2Q A;  1G2D C;  1YSA C;  2EMH A;  2A25 A;  4M9V C;  2EOR A;  1UBD C;  2EOS A;  2WBS A;  2GLI A;  3M99 B;  2J7J A;  2YTP A;  2EPX A;  2CT1 A;  2RSI A;  2JPA A;  2EM9 A;  2PRT A;  2EM3 A;  2EOI A;  2LCE A;  1TF3 A;  2ENA A;  5KL4 A;  2JP9 A;  2VRD A;  2EOQ A;  2LO3 A;  2LVH A;  1A1L A;  2EOM A;  2YSO A;  5KL2 A;  2ENC A;  2M9A A;  1MEY C;  4F6M A;  2EMK A;  2GHF A;  5KL5 A;  4R2A A;  2MKD A;  2YU8 A;  2YTG A;  1A1J A;  1X5W A;  4GZN C;  2CTD A;  2EPP A;  2EM5 A;  2EPZ A;  3EPK A;  2EOF A;  3EPJ A;  1LLM C;  2EL5 A;  1BB8 A;  4IJD A;  4X9J A;  2EL6 A;  2EQ0 A;  2R1F A;  3MHH C;  2ELZ A;  1WJP A;  2YTE A;  2WCC 3;  2EQ3 A;  1BBO A;  2DRP A;  2EMC A;  2YSP A;  2EN3 A;  2EMW A;  2YTI A;  2YTO A;  1NCS A;  1RMD A;  1A1G A;  2E72 A;  2WBT A;  5KL3 A;  2YTD A;  2EOZ A;  2EQ1 A;  2EN1 A;  2EOJ A;  2EMB A;  2EPA A;  2EOY A;  1ZAA C;  2YRH A;  2DLK A;  1A1F A;  2EM8 A;  2EN6 A;  3MHS C;  2ELY A;  2BB8 A;  2RPC A;  1A1K A;  1TN9 A;  2YRM A;  1A1H A;  1TF6 A;  2DMI A;  2HGH A;  1F2I G;  2EN7 A;  2LT7 A;  2EMF A;  4R2C A;  2EPU A;  2YTF A;  2EJ4 A;  2EE8 A;  2EML A; 
#chains in the Genus database with same CATH topology
 4X65 E;  2L6M A;  1PJQ A;  2MDG A;  4DV3 E;  5A6J A;  1MGT A;  4ZYG A;  3ZOQ B;  4F9C B;  1EKZ A;  4WSP A;  2D9H A;  2EM7 A;  1WXR A;  2EOX A;  2EOO A;  1N36 E;  1J26 A;  4HTG A;  3KWR A;  4O43 A;  4JI1 E;  2EOH A;  1YUI A;  4TUG A;  3JAM C;  2V83 A;  1P47 A;  4NXM E;  1X6H A;  2N8X A;  2JR1 A;  4DKK A;  1Z1B A;  2EMI A;  2EOE A;  4R03 A;  1UN6 B;  2YRK A;  4L8N A;  3LML A;  2Q8U A;  2E1M A;  1GQE A;  4JI4 E;  2RSM A;  2YTQ A;  4P7D A;  2ZM6 E;  3ECR A;  1ZR9 A;  4F6N A;  2LJU A;  4R2Q A;  1G2D C;  4DUY E;  1YSA C;  2FGG A;  4LU9 A;  1UBD C;  3J81 C;  2GLI A;  2EPX A;  2YT4 A;  5IWA E;  4DR4 E;  2JOX A;  4J8Z A;  2EM3 A;  2F8B A;  4O4K A;  4NZV A;  2LVH A;  1A1L A;  4BC9 A;  2EOM A;  5KL2 A;  2M9A A;  1MEY C;  2RQL A;  3F6G A;  2NUE A;  5LL6 R;  2G7H A;  3RMP A;  2E5L E;  1X5W A;  4DR1 E;  2L3J A;  2CTD A;  4BS9 A;  3EPK A;  3EPJ A;  2EPK X;  2EWL A;  4DMI A;  3BID A;  3IWC A;  1T4N A;  4WPY A;  3J80 C;  2WCC 3;  2EQ3 A;  2DRP A;  4BC7 A;  2EN3 A;  4LTY A;  4JYA E;  4KZS A;  2WBT A;  2YTD A;  1BBG A;  3H09 A;  1ZAA C;  2EOY A;  5AC4 A;  2B9D A;  5T6J A;  2JVA A;  1J5E E;  4DR5 E;  2ELY A;  4DV7 E;  4GEQ B;  2F4V E;  2L2N A;  3P1X A;  2EPL X;  2UUC E;  4JI0 E;  1XNQ E;  1N34 E;  3ADI A;  2EML A;  2R76 A;  4DV4 E;  2EPO A;  2JWO A;  2KHX A;  4LF9 E;  2L2K B;  2EL4 A;  4WSG A;  1DGC A;  2RS6 A;  4YHH E;  1XNR E;  1HNZ E;  1EH6 A;  4N4R B;  1WHN A;  1YYK A;  1ZBT A;  2LTR A;  2NUF A;  4OOG C;  2DMY A;  4LFA E;  1A1I A;  1STU A;  3EPH A;  2L3C A;  1JK2 A;  3HPS A;  3C4B A;  2EPC A;  4ZYD A;  2EP3 A;  3J7A G;  2EMZ A;  3DF6 A;  2M7Q A;  1B69 A;  2VE7 C;  3JTZ A;  2ENH A;  4FK5 C;  4B3T E;  4BBY A;  3EPL A;  2M1S A;  1IMU A;  1T39 A;  2DSY A;  1DQ3 A;  2B3T B;  2V89 A;  2JOB A;  2DIX A;  2LJH A;  3ADG A;  5AAS A;  4LFC E;  2LRS A;  4R2R A;  2M4I A;  1I94 E;  2LTS A;  4M9V C;  2EOR A;  3IWD A;  2KON A;  3C6K A;  4ZYE A;  4X64 E;  4KWY A;  1PJT A;  1RC7 A;  4R8O A;  2JP9 A;  2EZ6 A;  2VRD A;  3BBG A;  2EOQ A;  2LO3 A;  4WXC A;  4Q35 B;  5A2Q C;  4F6M A;  2YZT A;  4R2A A;  2MKD A;  2YTG A;  4GZN C;  2ODR D;  4X62 E;  3K6Q A;  1YYW A;  2MC5 A;  4F54 A;  2EPZ A;  1IQS A;  3J7Y p;  2L2M A;  5AE2 A;  3HQ1 A;  2V88 A;  1IBL E;  2JXP A;  4NXN E;  4X9J A;  1QU6 A;  2LUP B;  4M0V A;  4MLQ A;  4BHC A;  2UUB E;  5IV8 B;  2EMW A;  5ADZ A;  4RH8 A;  2LUQ A;  4DV2 E;  1RMD A;  1A1G A;  2I9I A;  5LLQ A;  5TSE A;  5KL3 A;  1UHZ A;  2EOJ A;  4WX9 A;  4O24 A;  3HXL A;  2UU9 E;  1T4O A;  2B7T A;  2EM8 A;  4B3S E;  2EN6 A;  3MSW A;  2RPC A;  1A1K A;  1DI2 A;  1L4S A;  2YRM A;  1A1H A;  4DR3 E;  2EN7 A;  4GKJ E;  2EPU A;  2YTF A;  4LF8 E;  1N33 E;  2EE8 A;  2KOU A;  2HC5 A;  2L92 A;  4IS1 C;  3KZZ A;  5A6B D;  4M30 A;  4LFB E;  2EMG A;  2LV2 A;  2EM4 A;  4Q28 A;  3BF2 A;  1ZU1 A;  2ODR C;  4DV5 E;  2EPN A;  3VYX A;  2EN8 A;  5KL6 A;  4NHR A;  2MKN A;  5A6B A;  1X48 A;  5A6K A;  1X47 A;  2EMX A;  2EM6 A;  1YFH A;  3VHT B;  1EH8 A;  1FJG E;  2YTN A;  4R2E A;  2EM0 A;  4WFT A;  3T1Y E;  2CSH A;  3IWB A;  5A69 A;  1PKP A;  1YZ9 A;  3TQM A;  4F9B B;  2IHR 1;  2YTJ A;  4R2P A;  2LMZ A;  1JK1 A;  1IBK E;  2UXB E;  4B3R E;  4DR7 E;  2HJJ A;  2EN2 A;  1NEI A;  1X6E A;  5AE1 A;  2YU5 A;  4DV6 E;  4BHB A;  3UK3 C;  3JU0 A;  1G2F C;  1O0W A;  2N3H A;  1EH7 A;  2A25 A;  2UXC E;  2EOS A;  3M99 B;  1HNX E;  3ADJ A;  5BR8 E;  3KZY A;  2K4V A;  2YWQ A;  5KL4 A;  4JI8 E;  2VQE E;  4JI6 E;  2B7V A;  2ENC A;  4DUZ E;  2EMK A;  3EQ1 A;  2NUG A;  4DR6 E;  2YPN A;  1FKA E;  3HTX A;  2EOF A;  1SR9 A;  2K7I A;  2V87 A;  1BB8 A;  2RTX A;  4OX9 E;  2EQ0 A;  1KYQ A;  1WJP A;  2UUA E;  4M2Z A;  2YSP A;  2YTO A;  1WRJ A;  1NCS A;  2EOZ A;  1YPN A;  2EN1 A;  2EMB A;  2YRH A;  2HHH E;  2DB2 A;  1A1F A;  1GTK A;  3OTO E;  5CFF E;  1RQ0 A;  3MHS C;  1SFE A;  3C4T A;  1WHQ A;  5DNY A;  1TF6 A;  2DMI A;  1F2I G;  1T4L B;  2UXD E;  4R2C A;  5A6A A;  5FLX C;  2LE2 A;  4JI3 E;  2EJ4 A;  1IQO A;  2EMY A;  5LMN E;  3ADL A;  4R2S A;  4YY3 E;  4DV0 E;  1YUJ A;  5AE3 A;  3VYY A;  2ADR A;  2H36 X;  2MC6 A;  1PDA A;  1PJS A;  4BMJ A;  4KHP E;  3THO B;  4GKK E;  4LF5 E;  2VQF E;  3BGH A;  4DR2 E;  1AAY A;  2DLQ A;  2LBS B;  1X49 A;  3FIG A;  2V86 A;  1N32 E;  4X66 E;  2FTX B;  4DV1 E;  1HNW E;  2WBU A;  4JI7 E;  5KL7 A;  1X3C A;  1UIL A;  4RHB B;  2WZO A;  3LLH A;  2FV4 B;  2EN4 A;  3OML A;  2NA2 A;  1X6F A;  4WYQ B;  2EPR A;  4HEI A;  4F2J C;  2V8Q B;  3THN A;  2I13 A;  1T38 A;  3T1H E;  5F3W A;  2RS7 A;  2L8T A;  4R2D A;  2DGC A;  3HPZ A;  2EMA A;  4WXD A;  2NAB A;  1KJK A;  2EM2 A;  4P78 A;  1QNT A;  2BBG A;  2EMH A;  4L5N C;  2WBS A;  2MDR A;  2N3G A;  2V85 A;  1N3G A;  2J7J A;  2YTP A;  2CT1 A;  2RSI A;  5IT9 C;  2JPA A;  2EM9 A;  2PRT A;  2EOI A;  2LCE A;  1TF3 A;  2CPN A;  2ENA A;  4O5G A;  1GZ6 A;  2YSO A;  4LF7 E;  2VF1 A;  3C6M A;  2GHF A;  5KL5 A;  4LF4 E;  2YU8 A;  1A1J A;  3QG5 C;  4B3M E;  3L00 A;  2EPP A;  2EM5 A;  2JYA A;  1LLM C;  4MLV A;  3AV0 A;  2EL5 A;  4AQY E;  3AUZ A;  4IJD A;  2EL6 A;  2R1F A;  3MHH C;  2ELZ A;  2YTE A;  4TUI A;  4LF6 E;  1ZBQ A;  1BBO A;  2EMC A;  3VK6 A;  3F6H A;  4ZYH A;  2YTI A;  2E72 A;  4JV5 E;  4X8W A;  5AC5 A;  2EQ1 A;  2EPA A;  2DLK A;  1YYO A;  2GPI A;  2L33 A;  1XMQ E;  4F9A B;  2BB8 A;  4JI2 E;  5IXM B;  1TN9 A;  1IBM E;  4K0K E;  1AH5 A;  4JI5 E;  5LMU E;  1XMO E;  4I8O A;  2HGH A;  4BCA A;  2LT7 A;  2EMF A;  2EPM X;  3DJW A;  2JY9 A;  1HR0 E; 
#chains in the Genus database with same CATH homology
 2EMY A;  2MDG A;  4R2S A;  1YUJ A;  2EL4 A;  4IS1 C;  4WSG A;  2ADR A;  1DGC A;  2EMG A;  2D9H A;  2EM7 A;  2LV2 A;  2EOX A;  2EM4 A;  2EOO A;  1ZU1 A;  1AAY A;  2DLQ A;  2EOH A;  2EN8 A;  5KL6 A;  1YUI A;  2MKN A;  1P47 A;  2WBU A;  1X6H A;  1A1I A;  3EPH A;  1JK2 A;  2EMX A;  2EM6 A;  5KL7 A;  1X3C A;  2EPC A;  3VHT B;  1Z1B A;  2EP3 A;  2EMI A;  2EMZ A;  2YTN A;  2EM0 A;  2EOE A;  4R2E A;  1B69 A;  2CSH A;  2EN4 A;  2ENH A;  4FK5 C;  1X6F A;  2EPR A;  1UN6 B;  2YRK A;  3EPL A;  4F2J C;  2YTJ A;  4R2P A;  1JK1 A;  2I13 A;  2EN2 A;  1X6E A;  2YTQ A;  2YU5 A;  4R2D A;  2DGC A;  3UK3 C;  2EMA A;  2NAB A;  1KJK A;  1ZR9 A;  2EM2 A;  4F6N A;  1G2F C;  4R2R A;  4R2Q A;  1G2D C;  1YSA C;  2EMH A;  2A25 A;  4M9V C;  2EOR A;  1UBD C;  2EOS A;  2WBS A;  2GLI A;  3M99 B;  2J7J A;  2YTP A;  2EPX A;  2CT1 A;  2RSI A;  2JPA A;  2EM9 A;  2PRT A;  2EM3 A;  2EOI A;  2LCE A;  1TF3 A;  2ENA A;  5KL4 A;  2JP9 A;  2VRD A;  2EOQ A;  2LO3 A;  2LVH A;  1A1L A;  2EOM A;  2YSO A;  5KL2 A;  2ENC A;  2M9A A;  1MEY C;  4F6M A;  2EMK A;  2GHF A;  5KL5 A;  4R2A A;  2MKD A;  2YU8 A;  2YTG A;  1A1J A;  1X5W A;  4GZN C;  2CTD A;  2EPP A;  2EM5 A;  2EPZ A;  3EPK A;  2EOF A;  3EPJ A;  1LLM C;  2EL5 A;  1BB8 A;  4IJD A;  4X9J A;  2EL6 A;  2EQ0 A;  2R1F A;  3MHH C;  2ELZ A;  1WJP A;  2YTE A;  2WCC 3;  2EQ3 A;  1BBO A;  2DRP A;  2EMC A;  2YSP A;  2EN3 A;  2EMW A;  2YTI A;  2YTO A;  1NCS A;  1RMD A;  1A1G A;  2E72 A;  2WBT A;  5KL3 A;  2YTD A;  2EOZ A;  2EQ1 A;  2EN1 A;  2EOJ A;  2EMB A;  2EPA A;  2EOY A;  1ZAA C;  2YRH A;  2DLK A;  1A1F A;  2EM8 A;  2EN6 A;  3MHS C;  2ELY A;  2BB8 A;  2RPC A;  1A1K A;  1TN9 A;  2YRM A;  1A1H A;  1TF6 A;  2DMI A;  2HGH A;  1F2I G;  2EN7 A;  2LT7 A;  2EMF A;  4R2C A;  2EPU A;  2YTF A;  2EJ4 A;  2EE8 A;  2EML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...