2EL5A

Solution structure of the 18th zf-c2h2 domain from human zinc finger protein 268
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
42
structure length
42
Chain Sequence
GSSGSSGENPYECSECGKAFNRKDQLISHQRTHAGESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the 18th zf-C2H2 domain from human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2el5A01
2EOMA 1F2IG 1A1KA 2HGHA 2EN7A 2EL6A 2MKNA 2EOHA 4R2CA 2EMYA 1MEYC 2YTFA 2BB8A 1KJKA 3EPKA 2ELYA 1A1FA 2CT1A 2EL4A 1Z1BA 2EQ0A 2EM7A 2DRPA 2ENHA 1LLMC 4GZNC 1YUJA 2EN4A 2EPRA 2M9AA 2EPUA 2LO3A 2WBTA 4R2PA 2EM0A 2YRKA 2EN1A 2YSPA 2EOJA 1X6HA 2WCC3 2EMWA 2EQ1A 2EMBA 1ZU1A 2YTQA 2E72A 5KL3A 2YTOA 2YTEA 2EOOA 1A1JA 4R2QA 4R2RA 2EOEA 2EOQA 2EM8A 2EQ3A 5KL2A 1A1IA 1TN9A 2YRMA 2EPPA 2ENAA 2RPCA 2JP9A 3EPLA 2MKDA 2EP3A 1DGCA 2VRDA 1ZAAC 1UBDC 4F6MA 2YTJA 2YSOA 2EM3A 2DLKA 2EN2A 1NCSA 2EOSA 2EPZA 2EOZA 1A1GA 1X6FA 1G2DC 2WBUA 1TF6A 4M9VC 1X3CA 1X6EA 1ZR9A 2LVHA 2EM2A 2EMLA 2YTDA 4R2SA 2LT7A 4WSGA 2LV2A 2EN6A 2EJ4A 5KL4A 2GHFA 1G2FC 2EL5A 1UN6B 1B69A 2EMCA 2YTNA 3UK3C 2YRHA 3VHTB 2EMXA 1JK1A 2YTPA 2CSHA 2D9HA 2EM6A 2EN3A 2LCEA 1YUIA 4X9JA 2DGCA 2JPAA 2EMIA 2DLQA 4R2DA 2EOYA 2EORA 2A25A 3MHSC 3MHHC 2WBSA 5KL7A 2YTIA 2EMKA 1WJPA 4FK5C 2PRTA 2EOFA 1BB8A 1P47A 2EPCA 5KL5A 1JK2A 4R2EA 2EE8A 3EPHA 2EN8A 4F6NA 2R1FA 1X5WA 2EOXA 4R2AA 2EMGA 4F2JC 2EMHA 2EMZA 2ADRA 2EMAA 2ELZA 2EPXA 5KL6A 1YSAC 2YTGA 2EM5A 2YU8A 2NABA 1RMDA 2EM9A 2J7JA 2EOIA 3M99B 2MDGA 2I13A 1A1HA 3EPJA 2EMFA 4IJDA 2YU5A 2ENCA 2EM4A 1AAYA 4IS1C 2CTDA 2DMIA 2EPAA 1TF3A 1BBOA 2RSIA 2GLIA 1A1LA
chains in the Genus database with same CATH superfamily
4TUIA 4NHRA 4JV5E 1WHQA 5AE2A 4TUGA 4DR7E 1WXRA 1HNWE 2HGHA 4WXDA 4WX9A 2EN7A 2EMYA 1MEYC 2DSYA 2UXDE 2ELYA 4KWYA 2CT1A 2LUPB 1XMOE 2N8XA 2Q8UA 2EN4A 2JVAA 4JYAE 2RS6A 2EM0A 4ZYHA 4O4KA 2WCC3 4J8ZA 1ZU1A 2YTQA 1J5EE 2V86A 1L4SA 5A2QC 4R2QA 4R2RA 1T38A 2YRMA 1N3GA 2RPCA 4BHCA 2JP9A 4B3SE 5AC4A 2EP3A 3VYYA 1DGCA 2VRDA 2N3GA 1STUA 4LFCE 2EN2A 5IXMB 1IQSA 4KHPE 1X6FA 1G2DC 1TF6A 1X3CA 1X6EA 1N36E 4JI8E 4BS9A 3KZZA 1PJTA 4X8WA 2M4IA 3KWRA 3HXLA 1YYWA 1G2FC 4N4RB 4LF6E 3VHTB 1JK1A 1YUIA 4L5NC 4P78A 2RTXA 1QU6A 2K7IA 3C6MA 1RC7A 2UUAE 3MHSC 3MHHC 2GPIA 3ADJA 5KL7A 2HJJA 1IMUA 4DV4E 2EOFA 3LMLA 3JAMC 3HPZA 2WZOA 4WPYA 3VYXA 5LMUE 3IWDA 4BCAA 2EN8A 2LTSA 4DR4E 2EMHA 4B3ME 4HEIA 4F9BB 2DIXA 4DMIA 1YSAC 1YYKA 2EM5A 4KZSA 2LMZA 4I8OA 1RMDA 2EM9A 4DR3E 2MC6A 2YU5A 2E1MA 3IWCA 4HTGA 2VQFE 1AAYA 2EPAA 1TF3A 4LF5E 1BBOA 2RSIA 4R03A 5A6BA 3BGHA 2EWLA 1FKAE 5CFFE 2RSMA 2VF1A 1A1KA 5A6AA 3J80C 4O24A 3T1YE 3VK6A 3J81C 1UILA 4R2CA 2HC5A 2ODRC 3DJWA 2MDRA 4YHHE 2EL4A 2LJUA 3L00A 2ENHA 4JI7E 1LLMC 4GZNC 1IBME 1YUJA 2LE2A 3RMPA 1RQ0A 1X6HA 2YPNA 4JI0E 2E72A 2YTOA 2CPNA 1SFEA 2EOEA 5KL2A 2F4VE 2ENAA 1N32E 3HTXA 2UUCE 3C4BA 5A69A 1DI2A 1UBDC 2JR1A 3P1XA 2YTJA 2L2KB 3OTOE 3EQ1A 1GTKA 1NCSA 2EPZA 3AUZA 4X64E 2WBUA 4M9VC 4DV7E 4MLVA 2YTDA 5ADZA 2L2MA 4R2SA 1T4OA 4DKKA 5IWAE 4MLQA 1GQEA 2YTNA 3UK3C 1AH5A 2YRHA 2EMXA 4ZYDA 4F9CB 2YTPA 2EM6A 2D9HA 2EN3A 2JPAA 4L8NA 1MGTA 5TSEA 2EOYA 4WXCA 4P7DA 4NXME 2LJHA 2FV4B 3TQMA 4R8OA 1GZ6A 2YWQA 3OMLA 3T1HE 1WJPA 3QG5C 5T6JA 3H09A 5FLXC 5KL5A 1JK2A 4R2EA 3EPHA 2DB2A 5A6JA 4X66E 2F8BA 2KOUA 4F6NA 2UU9E 2R1FA 2I9IA 4LU9A 2EMZA 1X48A 3ECRA 2ELZA 2IHR1 2RS7A 1NEIA 4B3TE 3MSWA 2J7JA 2KHXA 2MDGA 4DUZE 1SR9A 1IQOA 2DMIA 1HR0E 2E5LE 4DV1E 4WSPA 2JYAA 1F2IG 4LF9E 4LF8E 4DV2E 4M30A 2BBGA 2ZM6E 3ADLA 4ZYEA 4K0KE 1DQ3A 4AQYE 1PDAA 4LFAE 2EL6A 3BBGA 4GEQB 1ZBTA 4WYQB 1X47A 4GKJE 2FGGA 5F3WA 3BIDA 4Q28A 3EPKA 2V83A 3ADIA 1Z1BA 2EM7A 1EH8A 1QNTA 3HPSA 5LLQA 2M9AA 2WBTA 4R2PA 2L33A 2G7HA 2EMWA 2EMBA 2M7QA 1XNRE 5KL3A 3FIGA 2EOOA 3F6GA 2N3HA 1BBGA 2FTXB 4X65E 4M2ZA 1IBLE 2EPLX 1EKZA 1N34E 3THNA 1YYOA 2NA2A 1ZAAC 3JTZA 4F6MA 4O43A 3ADGA 2EOZA 1EH6A 4BBYA 3KZYA 4O5GA 1A1GA 1WHNA 5AASA 1ZR9A 2LVHA 2V8QB 5AE1A 3DF6A 2EM2A 2EMLA 1I94E 1HNZE 4WSGA 4YY3E 5DNYA 2LV2A 2EN6A 2L2NA 2EJ4A 5KL4A 2EL5A 2VE7C 5IT9C 2EZ6A 2EMCA 4DV0E 2JOXA 2B3TB 3IWBA 2EPMX 2V89A 4R2DA 2EORA 2JXPA 2VQEE 4JI4E 4RH8A 4WFTA 1PJQA 1T39A 1XNQE 4F54A 2PRTA 4JI2E 1BB8A 1P47A 4DR6E 2EPCA 2L8TA 5BR8E 2M1SA 1X5WA 2EOXA 4F2JC 2EMGA 2KONA 2LUQA 3F6HA 2EMAA 2YTGA 1X49A 2NABA 3ZOQB 4DV6E 3J7Yp 3EPJA 2L6MA 2EMFA 4RHBB 4BC7A 3BF2A 4OX9E 4IS1C 4DV3E 2CTDA 1J26A 2EPNA 4JI5E 2GLIA 1A1LA 2UUBE 1PKPA 2EOMA 1WRJA 2B7VA 3K6QA 2LTRA 2L3CA 4DR5E 4NXNE 2LBSB 4Q35B 4JI6E 1PJSA 3HQ1A 2H36X 4NZVA 2MKNA 4DUYE 2EOHA 1YPNA 2L92A 2HHHE 5AE3A 2YTFA 1KYQA 2BB8A 1KJKA 2DMYA 4DV5E 1T4LB 1A1FA 1ZBQA 2YT4A 2EQ0A 2DRPA 4M0VA 5LMNE 2EPRA 2UXCE 2EPUA 2LO3A 2YRKA 2EN1A 2YSPA 2EOJA 4LFBE 2NUGA 2NUFA 4GKKE 2EQ1A 2UXBE 1HNXE 1A1JA 2YTEA 1A1IA 1TN9A 2EOQA 2EM8A 2EQ3A 5AC5A 4X62E 4JI1E 4JI3E 2EPPA 1N33E 5LL6R 3EPLA 4LF4E 2V85A 2R76A 2MKDA 3J7AG 2ODRD 2YSOA 4DR2E 2EM3A 2DLKA 4F9AB 2EOSA 2YZTA 1T4NA 4BMJA 2JOBA 4B3RE 1O0WA 2JWOA 2LT7A 1YZ9A 4ZYGA 2GHFA 1UN6B 1B69A 3AV0A 2DGCA 1EH7A 2CSHA 2LCEA 1IBKE 4X9JA 1YFHA 1UHZA 2EMIA 5IV8B 2DLQA 4BHBA 2A25A 2NUEA 2WBSA 2V88A 2YTIA 2EMKA 5A6BD 2B9DA 4FK5C 3JU0A 2LRSA 2MC5A 2EE8A 1XMQE 2RQLA 3C4TA 2JY9A 2K4VA 4BC9A 4R2AA 1FJGE 2ADRA 2EPKX 2EPXA 3C6KA 5KL6A 4LF7E 3LLHA 3THOB 2YU8A 2EOIA 3M99B 4LTYA 2I13A 1A1HA 5A6KA 2EPOA 4IJDA 2L3JA 2ENCA 2B7TA 2V87A 2EM4A 4OOGC 4DR1E
chains in the Genus database with same CATH topology
2EOMA 1F2IG 1A1KA 2HGHA 2EN7A 2EL6A 2MKNA 2EOHA 4R2CA 2EMYA 1MEYC 2YTFA 2BB8A 1KJKA 3EPKA 2ELYA 1A1FA 2CT1A 2EL4A 1Z1BA 2EQ0A 2EM7A 2DRPA 2ENHA 1LLMC 4GZNC 1YUJA 2EN4A 2EPRA 2M9AA 2EPUA 2LO3A 2WBTA 4R2PA 2EM0A 2YRKA 2EN1A 2YSPA 2EOJA 1X6HA 2WCC3 2EMWA 2EQ1A 2EMBA 1ZU1A 2YTQA 2E72A 5KL3A 2YTOA 2YTEA 2EOOA 1A1JA 4R2QA 4R2RA 2EOEA 2EOQA 2EM8A 2EQ3A 5KL2A 1A1IA 1TN9A 2YRMA 2EPPA 2ENAA 2RPCA 2JP9A 3EPLA 2MKDA 2EP3A 1DGCA 2VRDA 1ZAAC 1UBDC 4F6MA 2YTJA 2YSOA 2EM3A 2DLKA 2EN2A 1NCSA 2EOSA 2EPZA 2EOZA 1A1GA 1X6FA 1G2DC 2WBUA 1TF6A 4M9VC 1X3CA 1X6EA 1ZR9A 2LVHA 2EM2A 2EMLA 2YTDA 4R2SA 2LT7A 4WSGA 2LV2A 2EN6A 2EJ4A 5KL4A 2GHFA 1G2FC 2EL5A 1UN6B 1B69A 2EMCA 2YTNA 3UK3C 2YRHA 3VHTB 2EMXA 1JK1A 2YTPA 2CSHA 2D9HA 2EM6A 2EN3A 2LCEA 1YUIA 4X9JA 2DGCA 2JPAA 2EMIA 2DLQA 4R2DA 2EOYA 2EORA 2A25A 3MHSC 3MHHC 2WBSA 5KL7A 2YTIA 2EMKA 1WJPA 4FK5C 2PRTA 2EOFA 1BB8A 1P47A 2EPCA 5KL5A 1JK2A 4R2EA 2EE8A 3EPHA 2EN8A 4F6NA 2R1FA 1X5WA 2EOXA 4R2AA 2EMGA 4F2JC 2EMHA 2EMZA 2ADRA 2EMAA 2ELZA 2EPXA 5KL6A 1YSAC 2YTGA 2EM5A 2YU8A 2NABA 1RMDA 2EM9A 2J7JA 2EOIA 3M99B 2MDGA 2I13A 1A1HA 3EPJA 2EMFA 4IJDA 2YU5A 2ENCA 2EM4A 1AAYA 4IS1C 2CTDA 2DMIA 2EPAA 1TF3A 1BBOA 2RSIA 2GLIA 1A1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOM A;  1F2I G;  1A1K A;  2HGH A;  2EN7 A;  2EL6 A;  2MKN A;  2EOH A;  4R2C A;  2EMY A;  1MEY C;  2YTF A;  2BB8 A;  1KJK A;  3EPK A;  2ELY A;  1A1F A;  2CT1 A;  2EL4 A;  1Z1B A;  2EQ0 A;  2EM7 A;  2DRP A;  2ENH A;  1LLM C;  4GZN C;  1YUJ A;  2EN4 A;  2EPR A;  2M9A A;  2EPU A;  2LO3 A;  2WBT A;  4R2P A;  2EM0 A;  2YRK A;  2EN1 A;  2YSP A;  2EOJ A;  1X6H A;  2WCC 3;  2EMW A;  2EQ1 A;  2EMB A;  1ZU1 A;  2YTQ A;  2E72 A;  5KL3 A;  2YTO A;  2YTE A;  2EOO A;  1A1J A;  4R2Q A;  4R2R A;  2EOE A;  2EOQ A;  2EM8 A;  2EQ3 A;  5KL2 A;  1A1I A;  1TN9 A;  2YRM A;  2EPP A;  2ENA A;  2RPC A;  2JP9 A;  3EPL A;  2MKD A;  2EP3 A;  1DGC A;  2VRD A;  1ZAA C;  1UBD C;  4F6M A;  2YTJ A;  2YSO A;  2EM3 A;  2DLK A;  2EN2 A;  1NCS A;  2EOS A;  2EPZ A;  2EOZ A;  1A1G A;  1X6F A;  1G2D C;  2WBU A;  1TF6 A;  4M9V C;  1X3C A;  1X6E A;  1ZR9 A;  2LVH A;  2EM2 A;  2EML A;  2YTD A;  4R2S A;  2LT7 A;  4WSG A;  2LV2 A;  2EN6 A;  2EJ4 A;  5KL4 A;  2GHF A;  1G2F C;  2EL5 A;  1UN6 B;  1B69 A;  2EMC A;  2YTN A;  3UK3 C;  2YRH A;  3VHT B;  2EMX A;  1JK1 A;  2YTP A;  2CSH A;  2D9H A;  2EM6 A;  2EN3 A;  2LCE A;  1YUI A;  4X9J A;  2DGC A;  2JPA A;  2EMI A;  2DLQ A;  4R2D A;  2EOY A;  2EOR A;  2A25 A;  3MHS C;  3MHH C;  2WBS A;  5KL7 A;  2YTI A;  2EMK A;  1WJP A;  4FK5 C;  2PRT A;  2EOF A;  1BB8 A;  1P47 A;  2EPC A;  5KL5 A;  1JK2 A;  4R2E A;  2EE8 A;  3EPH A;  2EN8 A;  4F6N A;  2R1F A;  1X5W A;  2EOX A;  4R2A A;  2EMG A;  4F2J C;  2EMH A;  2EMZ A;  2ADR A;  2EMA A;  2ELZ A;  2EPX A;  5KL6 A;  1YSA C;  2YTG A;  2EM5 A;  2YU8 A;  2NAB A;  1RMD A;  2EM9 A;  2J7J A;  2EOI A;  3M99 B;  2MDG A;  2I13 A;  1A1H A;  3EPJ A;  2EMF A;  4IJD A;  2YU5 A;  2ENC A;  2EM4 A;  1AAY A;  4IS1 C;  2CTD A;  2DMI A;  2EPA A;  1TF3 A;  1BBO A;  2RSI A;  2GLI A;  1A1L A; 
#chains in the Genus database with same CATH topology
 4TUI A;  4NHR A;  4JV5 E;  1WHQ A;  5AE2 A;  4TUG A;  4DR7 E;  1WXR A;  1HNW E;  2HGH A;  4WXD A;  4WX9 A;  2EN7 A;  2EMY A;  1MEY C;  2DSY A;  2UXD E;  2ELY A;  4KWY A;  2CT1 A;  2LUP B;  1XMO E;  2N8X A;  2Q8U A;  2EN4 A;  2JVA A;  4JYA E;  2RS6 A;  2EM0 A;  4ZYH A;  4O4K A;  2WCC 3;  4J8Z A;  1ZU1 A;  2YTQ A;  1J5E E;  2V86 A;  1L4S A;  5A2Q C;  4R2Q A;  4R2R A;  1T38 A;  2YRM A;  1N3G A;  2RPC A;  4BHC A;  2JP9 A;  4B3S E;  5AC4 A;  2EP3 A;  3VYY A;  1DGC A;  2VRD A;  2N3G A;  1STU A;  4LFC E;  2EN2 A;  5IXM B;  1IQS A;  4KHP E;  1X6F A;  1G2D C;  1TF6 A;  1X3C A;  1X6E A;  1N36 E;  4JI8 E;  4BS9 A;  3KZZ A;  1PJT A;  4X8W A;  2M4I A;  3KWR A;  3HXL A;  1YYW A;  1G2F C;  4N4R B;  4LF6 E;  3VHT B;  1JK1 A;  1YUI A;  4L5N C;  4P78 A;  2RTX A;  1QU6 A;  2K7I A;  3C6M A;  1RC7 A;  2UUA E;  3MHS C;  3MHH C;  2GPI A;  3ADJ A;  5KL7 A;  2HJJ A;  1IMU A;  4DV4 E;  2EOF A;  3LML A;  3JAM C;  3HPZ A;  2WZO A;  4WPY A;  3VYX A;  5LMU E;  3IWD A;  4BCA A;  2EN8 A;  2LTS A;  4DR4 E;  2EMH A;  4B3M E;  4HEI A;  4F9B B;  2DIX A;  4DMI A;  1YSA C;  1YYK A;  2EM5 A;  4KZS A;  2LMZ A;  4I8O A;  1RMD A;  2EM9 A;  4DR3 E;  2MC6 A;  2YU5 A;  2E1M A;  3IWC A;  4HTG A;  2VQF E;  1AAY A;  2EPA A;  1TF3 A;  4LF5 E;  1BBO A;  2RSI A;  4R03 A;  5A6B A;  3BGH A;  2EWL A;  1FKA E;  5CFF E;  2RSM A;  2VF1 A;  1A1K A;  5A6A A;  3J80 C;  4O24 A;  3T1Y E;  3VK6 A;  3J81 C;  1UIL A;  4R2C A;  2HC5 A;  2ODR C;  3DJW A;  2MDR A;  4YHH E;  2EL4 A;  2LJU A;  3L00 A;  2ENH A;  4JI7 E;  1LLM C;  4GZN C;  1IBM E;  1YUJ A;  2LE2 A;  3RMP A;  1RQ0 A;  1X6H A;  2YPN A;  4JI0 E;  2E72 A;  2YTO A;  2CPN A;  1SFE A;  2EOE A;  5KL2 A;  2F4V E;  2ENA A;  1N32 E;  3HTX A;  2UUC E;  3C4B A;  5A69 A;  1DI2 A;  1UBD C;  2JR1 A;  3P1X A;  2YTJ A;  2L2K B;  3OTO E;  3EQ1 A;  1GTK A;  1NCS A;  2EPZ A;  3AUZ A;  4X64 E;  2WBU A;  4M9V C;  4DV7 E;  4MLV A;  2YTD A;  5ADZ A;  2L2M A;  4R2S A;  1T4O A;  4DKK A;  5IWA E;  4MLQ A;  1GQE A;  2YTN A;  3UK3 C;  1AH5 A;  2YRH A;  2EMX A;  4ZYD A;  4F9C B;  2YTP A;  2EM6 A;  2D9H A;  2EN3 A;  2JPA A;  4L8N A;  1MGT A;  5TSE A;  2EOY A;  4WXC A;  4P7D A;  4NXM E;  2LJH A;  2FV4 B;  3TQM A;  4R8O A;  1GZ6 A;  2YWQ A;  3OML A;  3T1H E;  1WJP A;  3QG5 C;  5T6J A;  3H09 A;  5FLX C;  5KL5 A;  1JK2 A;  4R2E A;  3EPH A;  2DB2 A;  5A6J A;  4X66 E;  2F8B A;  2KOU A;  4F6N A;  2UU9 E;  2R1F A;  2I9I A;  4LU9 A;  2EMZ A;  1X48 A;  3ECR A;  2ELZ A;  2IHR 1;  2RS7 A;  1NEI A;  4B3T E;  3MSW A;  2J7J A;  2KHX A;  2MDG A;  4DUZ E;  1SR9 A;  1IQO A;  2DMI A;  1HR0 E;  2E5L E;  4DV1 E;  4WSP A;  2JYA A;  1F2I G;  4LF9 E;  4LF8 E;  4DV2 E;  4M30 A;  2BBG A;  2ZM6 E;  3ADL A;  4ZYE A;  4K0K E;  1DQ3 A;  4AQY E;  1PDA A;  4LFA E;  2EL6 A;  3BBG A;  4GEQ B;  1ZBT A;  4WYQ B;  1X47 A;  4GKJ E;  2FGG A;  5F3W A;  3BID A;  4Q28 A;  3EPK A;  2V83 A;  3ADI A;  1Z1B A;  2EM7 A;  1EH8 A;  1QNT A;  3HPS A;  5LLQ A;  2M9A A;  2WBT A;  4R2P A;  2L33 A;  2G7H A;  2EMW A;  2EMB A;  2M7Q A;  1XNR E;  5KL3 A;  3FIG A;  2EOO A;  3F6G A;  2N3H A;  1BBG A;  2FTX B;  4X65 E;  4M2Z A;  1IBL E;  2EPL X;  1EKZ A;  1N34 E;  3THN A;  1YYO A;  2NA2 A;  1ZAA C;  3JTZ A;  4F6M A;  4O43 A;  3ADG A;  2EOZ A;  1EH6 A;  4BBY A;  3KZY A;  4O5G A;  1A1G A;  1WHN A;  5AAS A;  1ZR9 A;  2LVH A;  2V8Q B;  5AE1 A;  3DF6 A;  2EM2 A;  2EML A;  1I94 E;  1HNZ E;  4WSG A;  4YY3 E;  5DNY A;  2LV2 A;  2EN6 A;  2L2N A;  2EJ4 A;  5KL4 A;  2EL5 A;  2VE7 C;  5IT9 C;  2EZ6 A;  2EMC A;  4DV0 E;  2JOX A;  2B3T B;  3IWB A;  2EPM X;  2V89 A;  4R2D A;  2EOR A;  2JXP A;  2VQE E;  4JI4 E;  4RH8 A;  4WFT A;  1PJQ A;  1T39 A;  1XNQ E;  4F54 A;  2PRT A;  4JI2 E;  1BB8 A;  1P47 A;  4DR6 E;  2EPC A;  2L8T A;  5BR8 E;  2M1S A;  1X5W A;  2EOX A;  4F2J C;  2EMG A;  2KON A;  2LUQ A;  3F6H A;  2EMA A;  2YTG A;  1X49 A;  2NAB A;  3ZOQ B;  4DV6 E;  3J7Y p;  3EPJ A;  2L6M A;  2EMF A;  4RHB B;  4BC7 A;  3BF2 A;  4OX9 E;  4IS1 C;  4DV3 E;  2CTD A;  1J26 A;  2EPN A;  4JI5 E;  2GLI A;  1A1L A;  2UUB E;  1PKP A;  2EOM A;  1WRJ A;  2B7V A;  3K6Q A;  2LTR A;  2L3C A;  4DR5 E;  4NXN E;  2LBS B;  4Q35 B;  4JI6 E;  1PJS A;  3HQ1 A;  2H36 X;  4NZV A;  2MKN A;  4DUY E;  2EOH A;  1YPN A;  2L92 A;  2HHH E;  5AE3 A;  2YTF A;  1KYQ A;  2BB8 A;  1KJK A;  2DMY A;  4DV5 E;  1T4L B;  1A1F A;  1ZBQ A;  2YT4 A;  2EQ0 A;  2DRP A;  4M0V A;  5LMN E;  2EPR A;  2UXC E;  2EPU A;  2LO3 A;  2YRK A;  2EN1 A;  2YSP A;  2EOJ A;  4LFB E;  2NUG A;  2NUF A;  4GKK E;  2EQ1 A;  2UXB E;  1HNX E;  1A1J A;  2YTE A;  1A1I A;  1TN9 A;  2EOQ A;  2EM8 A;  2EQ3 A;  5AC5 A;  4X62 E;  4JI1 E;  4JI3 E;  2EPP A;  1N33 E;  5LL6 R;  3EPL A;  4LF4 E;  2V85 A;  2R76 A;  2MKD A;  3J7A G;  2ODR D;  2YSO A;  4DR2 E;  2EM3 A;  2DLK A;  4F9A B;  2EOS A;  2YZT A;  1T4N A;  4BMJ A;  2JOB A;  4B3R E;  1O0W A;  2JWO A;  2LT7 A;  1YZ9 A;  4ZYG A;  2GHF A;  1UN6 B;  1B69 A;  3AV0 A;  2DGC A;  1EH7 A;  2CSH A;  2LCE A;  1IBK E;  4X9J A;  1YFH A;  1UHZ A;  2EMI A;  5IV8 B;  2DLQ A;  4BHB A;  2A25 A;  2NUE A;  2WBS A;  2V88 A;  2YTI A;  2EMK A;  5A6B D;  2B9D A;  4FK5 C;  3JU0 A;  2LRS A;  2MC5 A;  2EE8 A;  1XMQ E;  2RQL A;  3C4T A;  2JY9 A;  2K4V A;  4BC9 A;  4R2A A;  1FJG E;  2ADR A;  2EPK X;  2EPX A;  3C6K A;  5KL6 A;  4LF7 E;  3LLH A;  3THO B;  2YU8 A;  2EOI A;  3M99 B;  4LTY A;  2I13 A;  1A1H A;  5A6K A;  2EPO A;  4IJD A;  2L3J A;  2ENC A;  2B7T A;  2V87 A;  2EM4 A;  4OOG C;  4DR1 E; 
#chains in the Genus database with same CATH homology
 2EOM A;  1F2I G;  1A1K A;  2HGH A;  2EN7 A;  2EL6 A;  2MKN A;  2EOH A;  4R2C A;  2EMY A;  1MEY C;  2YTF A;  2BB8 A;  1KJK A;  3EPK A;  2ELY A;  1A1F A;  2CT1 A;  2EL4 A;  1Z1B A;  2EQ0 A;  2EM7 A;  2DRP A;  2ENH A;  1LLM C;  4GZN C;  1YUJ A;  2EN4 A;  2EPR A;  2M9A A;  2EPU A;  2LO3 A;  2WBT A;  4R2P A;  2EM0 A;  2YRK A;  2EN1 A;  2YSP A;  2EOJ A;  1X6H A;  2WCC 3;  2EMW A;  2EQ1 A;  2EMB A;  1ZU1 A;  2YTQ A;  2E72 A;  5KL3 A;  2YTO A;  2YTE A;  2EOO A;  1A1J A;  4R2Q A;  4R2R A;  2EOE A;  2EOQ A;  2EM8 A;  2EQ3 A;  5KL2 A;  1A1I A;  1TN9 A;  2YRM A;  2EPP A;  2ENA A;  2RPC A;  2JP9 A;  3EPL A;  2MKD A;  2EP3 A;  1DGC A;  2VRD A;  1ZAA C;  1UBD C;  4F6M A;  2YTJ A;  2YSO A;  2EM3 A;  2DLK A;  2EN2 A;  1NCS A;  2EOS A;  2EPZ A;  2EOZ A;  1A1G A;  1X6F A;  1G2D C;  2WBU A;  1TF6 A;  4M9V C;  1X3C A;  1X6E A;  1ZR9 A;  2LVH A;  2EM2 A;  2EML A;  2YTD A;  4R2S A;  2LT7 A;  4WSG A;  2LV2 A;  2EN6 A;  2EJ4 A;  5KL4 A;  2GHF A;  1G2F C;  2EL5 A;  1UN6 B;  1B69 A;  2EMC A;  2YTN A;  3UK3 C;  2YRH A;  3VHT B;  2EMX A;  1JK1 A;  2YTP A;  2CSH A;  2D9H A;  2EM6 A;  2EN3 A;  2LCE A;  1YUI A;  4X9J A;  2DGC A;  2JPA A;  2EMI A;  2DLQ A;  4R2D A;  2EOY A;  2EOR A;  2A25 A;  3MHS C;  3MHH C;  2WBS A;  5KL7 A;  2YTI A;  2EMK A;  1WJP A;  4FK5 C;  2PRT A;  2EOF A;  1BB8 A;  1P47 A;  2EPC A;  5KL5 A;  1JK2 A;  4R2E A;  2EE8 A;  3EPH A;  2EN8 A;  4F6N A;  2R1F A;  1X5W A;  2EOX A;  4R2A A;  2EMG A;  4F2J C;  2EMH A;  2EMZ A;  2ADR A;  2EMA A;  2ELZ A;  2EPX A;  5KL6 A;  1YSA C;  2YTG A;  2EM5 A;  2YU8 A;  2NAB A;  1RMD A;  2EM9 A;  2J7J A;  2EOI A;  3M99 B;  2MDG A;  2I13 A;  1A1H A;  3EPJ A;  2EMF A;  4IJD A;  2YU5 A;  2ENC A;  2EM4 A;  1AAY A;  4IS1 C;  2CTD A;  2DMI A;  2EPA A;  1TF3 A;  1BBO A;  2RSI A;  2GLI A;  1A1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...