2ELCA

Crystal structure of ttha1842 from thermus thermophilus hb8
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
329
structure length
329
Chain Sequence
b'MDAVKKAILGEVLEEEEAYEVMRALMAGEVSPVRAAGLLVALSLRGERPHEIAAMARAMREAARPLRVHRRPLLDIVGTGGDGKGLMNLSTLAALVAAAGGVAVAKHGNRAASSRAGSADLLEALGVDLEAPPERVGEAIEELGFGFLFARVFHPAMRHVAPVRAELGVRTVFNLLGPLTNPAGADAYVLGVFSPEWLAPMAEALERLGARGLVVHGEGADELVLGENRVVEVGKGAYALTPEEVGLKRAPLEALKGGGPEENAALARRLLKGEEKGPLADAVALAAGAGFYAAGKTPSLKEGVALAREVLASGEAYLLLERYVAFLRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase
publication title Crystal structure of TTHA1842 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 116
structure length 329
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 2elcA01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 2elcA02
4N8QA 4N5VA 4X5BA 1UOUA 1KHDA 4OWUA 1ZVWA 1ZXYA 4X5AA 2WK5A 4X46A 4X5DA 4OWNA 5C2LA 4XR5A 4X59A 1AZYA 4MUOA 3R88A 1O17A 4LHMA 4N93A 4OWVA 4OWMA 3UU1A 4GA4A 5C1RA 4GTNA 4GKMA 3GBRA 4OWOA 1VQUA 4HKMA 4ZOFA 2DSJA 2WK6A 3R6CA 3H5QA 3QQSA 2TPTA 4GA6A 5BYTA 4YI7A 4ZTVA 1ZYKA 1KGZA 4IJ1A 1OTPA 4GA5A 3QR9A 4OWSA 4EADA 4X58A 4GIUA 4ZOKA 4OWQA 5BO2A 1BRWA 4X5EA 4EAFA 2J0FA 5BNEA 1V8GA 4M0RA 3TWPA 4X5CA 5BO3A 5EY3A 4YEKA 5EP8A 1GXBA 2GVQA 3QS8A 4ZOJA 2ELCA 3QSAA 4YYYA 2BPQA 5C7SA
chains in the Genus database with same CATH superfamily
4N8QA 1RRZA 4N5VA 4X5BA 1UOUA 1KHDA 4OWUA 1ZVWA 1ZXYA 4X5AA 2WK5A 4X46A 4X5DA 4OWNA 5C2LA 4XR5A 4X59A 1AZYA 4MUOA 3R88A 1O17A 4LHMA 4F3FC 4N93A 4OWVA 4OWMA 3UU1A 4GA4A 5C1RA 4GTNA 4GKMA 3GBRA 4OWOA 1VQUA 4HKMA 4ZOFA 2DSJA 2WK6A 3R6CA 3H5QA 3QQSA 2TPTA 4GA6A 1RF8B 5BYTA 4YI7A 4ZTVA 1ZYKA 1KGZA 4IJ1A 1OTPA 4GA5A 3QR9A 4OWSA 4EADA 4X58A 4GIUA 4ZOKA 4OWQA 5BO2A 1BRWA 4X5EA 4EAFA 2J0FA 5BNEA 1V8GA 4M0RA 3TWPA 4X5CA 5BO3A 5EY3A 4YEKA 5EP8A 1GXBA 2GVQA 3QS8A 4ZOJA 2ELCA 3QSAA 4YYYA 2BPQA 5C7SA
chains in the Genus database with same CATH topology
4N8QA 4N5VA 4X5BA 1UOUA 1KHDA 4OWUA 1ZVWA 1ZXYA 4X5AA 2WK5A 4X46A 4X5DA 4OWNA 5C2LA 4XR5A 4X59A 1AZYA 4MUOA 3R88A 1O17A 4LHMA 4N93A 4OWVA 4OWMA 3UU1A 4GA4A 5C1RA 4GTNA 4GKMA 3GBRA 4OWOA 1VQUA 4HKMA 4ZOFA 2DSJA 2WK6A 3R6CA 3H5QA 3QQSA 2TPTA 4GA6A 5BYTA 4YI7A 4ZTVA 1ZYKA 1KGZA 4IJ1A 1OTPA 4GA5A 3QR9A 4OWSA 4EADA 4X58A 4GIUA 4ZOKA 4OWQA 5BO2A 1BRWA 4X5EA 4EAFA 2J0FA 5BNEA 1V8GA 4M0RA 3TWPA 4X5CA 5BO3A 5EY3A 4YEKA 5EP8A 1GXBA 2GVQA 3QS8A 4ZOJA 2ELCA 3QSAA 4YYYA 2BPQA 5C7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N8Q A;  4N5V A;  4X5B A;  1UOU A;  1KHD A;  4OWU A;  1ZVW A;  1ZXY A;  4X5A A;  2WK5 A;  4X46 A;  4X5D A;  4OWN A;  5C2L A;  4XR5 A;  4X59 A;  1AZY A;  4MUO A;  3R88 A;  1O17 A;  4LHM A;  4N93 A;  4OWV A;  4OWM A;  3UU1 A;  4GA4 A;  5C1R A;  4GTN A;  4GKM A;  3GBR A;  4OWO A;  1VQU A;  4HKM A;  4ZOF A;  2DSJ A;  2WK6 A;  3R6C A;  3H5Q A;  3QQS A;  2TPT A;  4GA6 A;  5BYT A;  4YI7 A;  4ZTV A;  1ZYK A;  1KGZ A;  4IJ1 A;  1OTP A;  4GA5 A;  3QR9 A;  4OWS A;  4EAD A;  4X58 A;  4GIU A;  4ZOK A;  4OWQ A;  5BO2 A;  1BRW A;  4X5E A;  4EAF A;  2J0F A;  5BNE A;  1V8G A;  4M0R A;  3TWP A;  4X5C A;  5BO3 A;  5EY3 A;  4YEK A;  5EP8 A;  1GXB A;  2GVQ A;  3QS8 A;  4ZOJ A;  2ELC A;  3QSA A;  4YYY A;  2BPQ A;  5C7S A; 
#chains in the Genus database with same CATH topology
 4N8Q A;  1RRZ A;  4N5V A;  4X5B A;  1UOU A;  1KHD A;  4OWU A;  1ZVW A;  1ZXY A;  4X5A A;  2WK5 A;  4X46 A;  4X5D A;  4OWN A;  5C2L A;  4XR5 A;  4X59 A;  1AZY A;  4MUO A;  3R88 A;  1O17 A;  4LHM A;  4F3F C;  4N93 A;  4OWV A;  4OWM A;  3UU1 A;  4GA4 A;  5C1R A;  4GTN A;  4GKM A;  3GBR A;  4OWO A;  1VQU A;  4HKM A;  4ZOF A;  2DSJ A;  2WK6 A;  3R6C A;  3H5Q A;  3QQS A;  2TPT A;  4GA6 A;  1RF8 B;  5BYT A;  4YI7 A;  4ZTV A;  1ZYK A;  1KGZ A;  4IJ1 A;  1OTP A;  4GA5 A;  3QR9 A;  4OWS A;  4EAD A;  4X58 A;  4GIU A;  4ZOK A;  4OWQ A;  5BO2 A;  1BRW A;  4X5E A;  4EAF A;  2J0F A;  5BNE A;  1V8G A;  4M0R A;  3TWP A;  4X5C A;  5BO3 A;  5EY3 A;  4YEK A;  5EP8 A;  1GXB A;  2GVQ A;  3QS8 A;  4ZOJ A;  2ELC A;  3QSA A;  4YYY A;  2BPQ A;  5C7S A; 
#chains in the Genus database with same CATH homology
 4N8Q A;  4N5V A;  4X5B A;  1UOU A;  1KHD A;  4OWU A;  1ZVW A;  1ZXY A;  4X5A A;  2WK5 A;  4X46 A;  4X5D A;  4OWN A;  5C2L A;  4XR5 A;  4X59 A;  1AZY A;  4MUO A;  3R88 A;  1O17 A;  4LHM A;  4N93 A;  4OWV A;  4OWM A;  3UU1 A;  4GA4 A;  5C1R A;  4GTN A;  4GKM A;  3GBR A;  4OWO A;  1VQU A;  4HKM A;  4ZOF A;  2DSJ A;  2WK6 A;  3R6C A;  3H5Q A;  3QQS A;  2TPT A;  4GA6 A;  5BYT A;  4YI7 A;  4ZTV A;  1ZYK A;  1KGZ A;  4IJ1 A;  1OTP A;  4GA5 A;  3QR9 A;  4OWS A;  4EAD A;  4X58 A;  4GIU A;  4ZOK A;  4OWQ A;  5BO2 A;  1BRW A;  4X5E A;  4EAF A;  2J0F A;  5BNE A;  1V8G A;  4M0R A;  3TWP A;  4X5C A;  5BO3 A;  5EY3 A;  4YEK A;  5EP8 A;  1GXB A;  2GVQ A;  3QS8 A;  4ZOJ A;  2ELC A;  3QSA A;  4YYY A;  2BPQ A;  5C7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...