2ELJA

Solution structure of the swirm domain of baker's yeast transcriptional adapter 2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
GSSGSSGNMTISDIQHAPDYALLSNDEQQLCIQLKILPKPYLVLKEVMFRELLKTGGNLSKSACRELLNIDPIKANRIYDFFQSQNWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SWIRM domain of baker's yeast Transcriptional adapter 2
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Transcriptional adapter 2
total genus 19
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.780 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2eljA01
2AQEA 2ELJA 2AQFA 2CUJA 2DCEA
chains in the Genus database with same CATH superfamily
2KJCA 2AQEA 2D2WA 2HYJA 5C44J 4CA0A 1Z3YA 1S7AA 2EJRA 5K5RA 5HLIA 1HSTA 4JQFA 2JSCA 3BROA 4Y52J 3OIQA 1MMSA 4OIQF 3K1PA 3B02A 1S7EA 3CCRI 2HOAA 1SFOJ 4B47A 2A05A 3CMYA 2LRDA 3ZQHA 5LGTA 1EKEA 2BZTA 4ESBA 2F5CA 1WKMA 1XX5A 2KZVA 2FUG2 3CCUI 2GQQA 1F36A 1ZG3A 2OBPA 3VPRA 5K7HA 4XQFA 1P2FA 3RJPA 4XN3A 4CSWA 3HOSA 2P5VA 4XIDA 5ERIA 4M73A 1NHAA 4LG0A 1WJFA 3KP6A 4OWRB 2P6TA 2HOSA 5CKTA 3FXQA 1YFHA 1TQPA 2F5VA 2FQ3A 2LMDA 1Z3XA 2QQAA 4MHGA 4DBRA 4B48A 1YS6A 3T1BA 4HOBA 2XB5A 3JRCA 2E2HJ 1IN6A 2JA7J 1UJ8A 4I99C 4ETSA 5D5WB 2D45A 4Y4RA 2XV4S 3JR9A 4J01A 2D5VA 2VODA 4LGWA 4AVZA 5DUIA 3KYLA 2CQXA 2E5ZA 1VI0A 2KLOA 3RDIA 3V7CA 4RB2C 5IT9K 4UB8C 5D5XB 2L0KA 4C30A 3AL0C 4RM2A 2HZTA 2E36A 3ZP5A 1XSDA 3F8BA 3KFWX 3E0JB 4IJAA 2R7XA 1S6LA 2MH2A 2M4KA 4XLNF 2NXNB 2EA2A 3L2UA 1BI0A 3VFZA 1G8XA 1X3ZB 2M0MA 4BY7J 2FSWA 1MJ9A 2ECBA 3NWTA 1HC8A 2M3AA 2JRTA 3FMSA 4MQVA 1C0WA 4XMYA 1YI2I 2XDVA 3DLLF 1X2MA 1A6IA 1WQ2A 2KIQA 4ESJA 2WAEA 2G7HA 5B5EC 3L2CA 3GFLA 3CF5F 1RC9A 2HXIA 1XTAA 4EATA 1EH8A 1MBHA 5FKKA 1FBSA 1WWXA 3I53A 3IH2A 1T8IA 3CC7I 2CQNA 4UVAA 2IT0A 4BQAA 2KHMA 5J47A 1AHDP 1E17A 3K2AA 2ZSIB 3J7ZI 3HDDA 4IRIA 3C1DA 3AG3H 3OYFA 2IA0A 1R00A 5CVUA 1BIBA 2L01A 5E1ZB 1I3QJ 4IHVA 3QODA 2XF5A 2OQGA 3KPHA 1QO0D 1LEBA 2ZO4A 3BTLA 2WV0A 1WPKA 1BA5A 4F91B 1K83J 2DA6A 5L3DA 5M5WJ 4GFBA 1JKPC 2E2JJ 3BT9A 2VKHA 2DI3A 3HHHA 4G12A 4I0BA 1PUEE 2R7UA 2ETHA 2OU2A 3GTOJ 3J80Z 3OYKA 2VJ4A 3AL0B 4M9XA 1P4XA 1QZYA 1G3YA 2N8GA 1ON1A 5LLQA 4ZYDA 2GOMA 4ZTJA 2DTZA 4BBRJ 3I5UA 5F64A 3CDLA 2R7VA 4E7JA 2KIMA 3FKIJ 2PJPA 3TDUC 1VZ0A 1SFXA 1R1UA 2DLLA 3GUDA 1YHQI 1OCPA 4B3AA 2LP0A 1UHSA 3I59A 2EIMH 4GCVA 2W7NA 4DGWB 1WGXA 1X1DA 1B72A 1MSFC 3V7SA 3KE2A 5BQTA 5LHGA 4BEHA 3H5RA 4XKWA 3GCMA 3ZGKA 2DMTA 3CCEI 4G6QA 4AIJA 2CSOA 1X3WB 4AIDA 3LWFA 5A2QK 2XF7A 3N97A 2JA2A 3BR0A 2H6CA 4J19A 2MABA 2O8KA 3DBHB 2QYOA 2K5CA 3LSTA 2MD0A 3J7AO 2VE8A 2XGEA 1NG7A 2ZCWA 2W00A 4IRGA 2H27A 3RQIA 1Z7LA 2EZHA 3GXOA 2R5ZB 1ZARA 2PMZN 3A1YA 2LREA 1HA8A 3J7AY 4HLYA 1MDMB 2IS1A 2XF6A 3TOAA 3RSNA 5FKMA 2YU9J 3S1NJ 4MIMA 2R7QA 1ZG1A 2Y0SA 2Y31A 3HPGA 1RR8C 3BY6A 1D5VA 4A3EJ 2JTVA 3TDZC 4AIKA 3F21A 5FKLA 3S3MA 2NS8A 3ABTA 1Z6RA 1MNMC 3HG9A 4CDGA 3Q0VA 2DK5A 4BU2A 5JR3A 1EV7A 1F1ZA 3KETA 1T6SA 2QZ8A 3GFMA 1B6AA 1U5TC 2DW4A 4C9YA 2QVOA 1R7JA 1APLC 1WFXA 3NARA 4ZZDA 1BC7C 2EV5A 3QRFF 2Z16A 3JRFA 4A6EA 3RKXA 3S1QJ 5B1AH 2EZIA 2ZFWA 1LVKA 2PX9A 2VB6A 3HXLA 4HW0A 2C6YA 1Q1HA 2M0CA 1W7PB 2X51A 2Y69H 1ULYA 3IAS2 3WHBA 2BV6A 2M34A 1MBEA 4IHYA 5HLGA 2EIJH 1O7FA 1NH3A 2MBFA 3ZN1A 2COBA 2XPWA 4PJJA 2Q2EA 3DTKA 4HYEA 1XGMA 2DA4A 3NQOA 2UWMA 3N05A 3OOPA 2LDUA 5K7FA 1VNDA 3IH4A 1R5ID 2VI6A 2QCOA 4PGGA 3NEUA 1DU0A 3QPLA 1RKTA 3HIFA 3KLOA 2M1BA 1BR2A 2I5UA 4W97A 5IT9Z 1R23A 4N4NB 2EZKA 2RGVA 4CHUA 5E17F 2AQFA 2LTPA 1BL0A 4RS8A 4O3MA 1W5SA 1QVTA 2F4MB 4AD9A 4WWCA 4QIWN 4A3CJ 3ZMTA 1K61A 1U2WA 2ZSHB 3HSEA 3IHUA 1FOWA 4N9HA 1K79A 1BI3A 1E3HA 4F7ZA 2V9VA 3TP0A 3OOUA 3VDXA 4HDVA 3LQRA 5H6QA 2EFWA 1LEAA 2Q2EB 1QPMA 1G59A 2IGOA 2XHKA 1WJCA 2K02A 4NDLA 2UXXA 4IKFA 2GA1A 4PJMA 3S16J 2IXSA 4YIFA 2FBKA 4FX0A 5LHHA 2Y75A 3BG6A 1YJ9I 3BZ6A 2EFOA 4PK4A 3BTCA 4A5NA 1RNLA 5BS6A 2VONA 3OYAA 2ESHA 2F2EA 2IEKA 4RB1A 1HLVA 2LG4A 4MNUA 5ICCA 4AUXA 4KMFA 2KRHA 2CV1A 3BG9A 3RQ4A 2CV2A 3MN2A 1ZQ3P 2NNNA 1MD0A 3MKYB 1OCRH 5ILUA 4AC0A 1TTYA 2EBIA 1SD4A 4A3GJ 4XLAA 2PEXA 2JN6A 4A3IJ 4ZDPA 3MZHA 4LLLA 3GTJJ 3HGGA 2VL8A 3OWTA 1X4OA 2OPTA 5ILSA 2FNPA 5M5YJ 1YQAA 4A3JJ 1MBGA 2XAJA 2A5YB 1Z77A 1BIAA 2QSGX 1VQ6I 1GVDA 1X3UA 1TP4A 2AXLA 4A69C 2YX7A 3ELKA 1HW2A 4DYQA 3FMRA 2DOFA 5F08A 4G94A 5FFZA 2V1UA 2UZKA 3C2GA 2VKEA 2V9PA 1KU9A 1O3QA 2XAFA 1UCRA 2MGQA 1BOBA 3O2PE 4LJZF 1T33A 4LITA 3DLAA 4V2FA 2A6EF 1YO5C 1IG7A 5IP9J 1B1BA 5IOYA 2E1CA 3V8JA 3HOWJ 1D8KA 3FHNA 3CF2A 3HC7A 3Q3SA 4X0GA 1MMAA 2KQRA 2YSRA 2DA1A 1XG1A 2BY1A 4IO9F 2KISA 5E3OA 2FE3A 3V42A 2EINH 2L9SA 3LA7A 1QPIA 4M3GA 2VBZA 4AWXB 1TQMA 2O6GE 2MD5A 2VXDA 2DQRA 3S8PA 3EUKL 4I01A 2HEOA 1HDPA 4RB0A 3RKYA 2VOPA 2IA2A 2H8WA 1YTYA 2IGMA 2DDBA 2ZNYA 2VT3A 3PFIA 3KP3A 3K4LA 3ZMSA 3SJMA 5LGNA 1T0FA 1WRJA 4A3LJ 1S7OA 4DW6A 3F23A 1ZKGA 1QA6A 5BPIA 3HOZJ 2HDWA 3FXRA 4IXAA 4M9SA 1P4WA 4DYRA 5KNLA 2DYSH 4KISA 1IN8A 4I09A 2MA3A 3KEOA 5HS9A 2X9DA 4XRSG 3PQJA 1IW7F 3KZYA 2WBMA 3RTRA 3QYEA 1FYMA 1KONA 3F8CA 2DN0A 3DF8A 5EYRA 2RN7A 3R6SA 3FM5A 3LFUA 1IF1A 1V5GA 2D1VA 4JX6A 5EGOA 1LQ1A 1MMDA 3K70C 2STTA 4LB6B 2DU9A 3D5LA 3PJRA 2LY1A 3LSMA 1IV6A 2RAEA 2L5QA 2VJ5A 1L0OC 3HTUA 3I59B 3GWZA 4A0XA 2JJ7A 3JTGA 1U3EM 1HOMA 2K9MA 5J3LA 5C3EJ 3V8KA 4IRHA 4L9NA 3OS1A 1HW1A 2IA1A 3LSIA 5AONA 1P6RA 2HDCA 3WE2A 2M30A 2K9NA 3LSKA 5ICEA 1UMQA 2M8GX 2WTEA 2Z2SB 4EEFG 2L7KA 3DBRB 3F9KA 2L7ZA 4S0HB 5FKNA 2QWWA 1Z67A 2G9WA 2BVMA 1U0JA 2FQ4A 2VASA 2ZXWH 3E6BA 3CQZJ 1H88C 2IW5A 2MC3A 3ULQB 3COAC 4PZJA 1SFUA 1YIOA 3FISA 1IDYA 2UUZA 5KCMA 1HF0A 1XPXA 5IP6A 4RGSA 3V8LA 4HF0A 4IZZA 4II2A 1GXQA 2P7VB 3L9FA 2CGPA 5D8LB 1X1PA 2TRTA 3SZPA 2GA2A 2YU3A 3BZKA 3NWSA 1ENHA 2M45A 2GM4A 1TT5B 3T8RA 1I1SA 3WHCA 5EDNA 1R5HA 4CGZA 1JT6A 3JRIA 2HQNA 5J40A 5HDNA 1UZCA 2ZFUA 1W7PD 5TJJA 3WGIA 5E18F 3CCVI 2JA5J 3P9IA 2VPLA 3HKZN 2DO7A 3D5SC 4A3DJ 3HRMA 2B0LA 2VQGA 5E1XA 1TW3A 3AG4H 3F8FA 1IRXA 4HEA2 1I39A 3SQNA 1J7KA 3B73A 3EUAA 4F3QA 3S1RJ 3I58A 4I2OA 1XD7A 4BXFA 1LJ9A 2NVYJ 4GYIA 2EIKH 4OIPF 1SFEA 2CQ7A 3LSRA 3LNQA 4IHSA 1RPWA 1FX7A 2L4MA 3ZPLA 1RI7A 1W4MA 4N9IA 4ASNA 3FM3A 4C3HJ 5EZGA 1B4AA 2LF7A 2ELHA 3SYTA 3MQ0A 3BCBA 1ZRDA 4KN7X 2HI3A 4XRFA 3M4OJ 2EA4A 4ZYEA 1PJRA 2VE9A 1JI8A 5L3CA 3I71A 2H94A 2P4WA 4CCKA 2ZBKA 1FLIA 2XSJC 1GV5A 5JI6A 4B1RA 1EF4A 5CPRB 3K0LA 4IHXA 2ZJQF 4G7OF 1G3TA 2G7UA 3O8HA 2DMQA 2M87A 3U1DA 3U21A 5GPCA 2DMUA 3ZMVA 3UR3C 3FXOA 3PNYA 2ADUA 1U9NA 3MVPA 5FD5A 2GWRA 1V54H 2CU7A 4HZFA 4A93J 4O6JA 3E3VA 4OIRF 5JLXA 3BG7A 2NVXJ 4XM3A 2NVQJ 2JSPA 1Y8QB 5GPAA 5F04A 4YRVA 2E60A 2ELKA 2XKPA 4RM3A 4DJAA 3DEWA 5L3FA 1MBKA 1WJ5A 1WVRA 5FLXK 4KT6A 3IKVA 2KIUA 4FETA 4E7SA 3MCZA 2LC2A 4FTHA 3R61A 1IN4A 3S14J 3K4BA 4XL9A 4IPAA 4JP0A 4BY1J 1W0UA 3E5UA 3M8EA 3E1SA 4U7DA 5L3BA 3QOPA 2F4IA 2QKMB 1Y0UA 1E2XA 3I55I 5CVJA 1FMWA 4QSHA 2CW7A 3L2WA 1W1WE 2H09A 2WC2A 3OSFA 3TQNA 3TBIA 3S17J 1XC5A 1R22A 5HVQC 2DQLA 3PIOF 1Z6TA 1XGOA 3TMOA 1EH7A 4IEJA 2XGXA 4FE4A 1HSJA 2DA2A 4UB6C 2HKOA 5GP9A 3KLNA 2GZWA 3LAPA 2GXBA 5E79C 3QU3A 2QBYA 2R92J 4QLCU 3BOQA 3PSIA 3OV8A 4BS9A 3HOUJ 2LKSA 2L9VA 4R79A 2DA7A 3IUOA 4RDUA 1RR7A 4EGYA 4UV8A 4DZPA 1MBFA 5EEHA 5E3LA 4YEJA 3H3UA 1OCOH 3HYIA 4F93B 2EFNA 1U5TA 4ENKA 3ZQ7A 2ZJRF 2X4HA 3IAM2 4HNTA 2A07F 2J5OA 2VKDA 6PAXA 1ACIA 1DPRA 5DUKA 1ZGAA 2XASA 1IDZA 2Y30A 4LK0F 5HS7A 1SANA 4LIVA 1WSUA 4A3MJ 5BNGA 4YG2F 1O4XA 1VQNI 2XAQA 3MD2A 4BJTA 3CUQA 1SD7A 3MZ8A 3ABLH 3GYHX 5FRMA 3BLYA 2K27A 4KYWA 3PSFA 1B9MA 4X1EA 4XK4A 3JRAA 3CMAI 1FOXA 2A6HF 3I64A 3ECOA 1N25A 2FMYA 1U5TB 3GBGA 4W1UA 2MH9A 2E34A 4LB5A 4M6VA 3IWZA 5FD6A 2XSDC 2MLGA 4MTEA 4UXNA 1GLNA 4RAGA 3E5QA 3DEEA 1HCRA 4D0PA 3DWLE 3HKZA 4CZCA 2A68F 4I02A 2LKXA 5E8GA 4G7HF 2BW3B 2JPBA 3OYGA 3R0AA 3HRTA 1H89C 5J4YA 2NOGA 1T98A 4BE1A 4A3KJ 5IOZA 5GAHJ 1H0MA 4OIOF 4LOCA 1TQIA 2IVMA 3CC2I 1RIOH 4Q47A 3HJEA 3GTQJ 2ZNZA 4HQEA 1BR4A 1MW7A 1S72I 2QQBA 2DFIA 3ROUA 1A36A 3BWGA 3J7YJ 1TBXA 1QHHD 2VN2A 3DEUA 4JYKA 1ERDA 5HS8A 1WI9A 1AKHB 1ZLJA 3RKWA 1YE9A 1GT0C 5E3NA 1VQ8I 1F9NA 1K78A 2V79A 2QSFX 4G6TB 3Q9SA 3JRDA 1TWCJ 4ZYHA 3J81Z 2OQRA 4NQWB 4KITB 1HDDC 4YFKF 1IRFA 3PQKA 3HOVJ 3VSKA 3K69A 3W2VA 5M5XJ 4NHJA 2VXZA 3OMYA 5C4XJ 4CYCB 3G2BA 2L54A 2Q8KA 2M5WA 4PUSA 4S04A 1TWFJ 1CGPA 1MNDA 2CYYA 4L5EA 1BW6A 3CZ6A 3ONQA 3SEZA 1A04A 3CJNA 2LK2A 1XCVA 3R0JA 3ABKH 4RB3C 2DMNA 4LLGF 1AKHA 1MJAA 4XKBA 4EVIA 4WF2A 1YJNI 4RAYA 1DUXC 4GGGA 3J80K 3IH3A 4ZDLA 2K4BA 4KICA 2A5WA 2OA4A 3R4KA 2LBFB 3G6EI 1LNWA 1W5CC 1KU7A 1I1GA 4MO7A 4QTRA 3MWMA 3VYTB 2BHZA 2WAQA 3FXUA 3LA2A 5ILVA 3G1OA 4IVNA 1BBYA 1F4KA 2L9NA 2DFHA 4P5OA 4BAYA 3EPZA 4LG3A 2KDOA 2R7DA 3RPUD 1ZRCA 3F22A 5CLSA 4IL6C 1YJWI 3GEZA 3CLOA 1ZLKA 2NNYA 1Y39A 1XMAA 2MYSA 3S3OA 2ZMEC 4MTDA 1WZ2A 3BJAA 2E7WA 4LG0B 3SXYA 3CTAA 3HOTA 4U7BA 1ETXA 2KRCA 1YG2A 5LRRA 4GO1A 1HQCA 3K9TA 1XGNA 1XSVA 4PJ0C 4PJLA 3A4CA 4UVBA 1JGGA 2XROA 1SD6A 4KFCA 1OPCA 2E1NA 1IAWA 3A01B 1YRNB 2DBBA 3OYCA 3NAUA 1ZTRA 4X6AJ 1J2XA 4UVCA 1FEXA 2DOAA 4AU7A 2R7OA 4PJNA 5CJ9A 4B8XA 5KVRA 1S29A 5BMZA 3DXJF 2CG4A 1JKQC 1YX3A 3DPUA 2DMPA 3VSLA 4A0YA 3IWFA 4DQ2A 3QYBA 3ZQLA 1OJLA 2IGNA 2NAZA 4JBAA 3I4PA 2R7RA 5HODA 4HDUA 2VJIA 2F5EA 1OR7C 1KZHA 3WG7H 2R0QC 2XUBA 1ETWA 2HGCA 2R5YB 5HLTA 2A61A 3OR1C 4XLFA 5ICGA 3A01A 1LDKB 4CXFA 3H0DA 2L9RA 4XR6A 3JSOA 2IPQX 1D0XA 2IS4A 2A6TA 2CQQA 2Z3YA 5DEQA 3RZDJ 1M1EB 4ZDOA 1TW2A 2JK3A 5F0HA 4D1QA 4NC8A 1MMNA 2V6EA 4MEXF 1R1VA 4C2TA 2YR2A 3H3ZA 3HBLA 1VQ9I 3M9AA 4WX9A 2X6YA 4BQOA 2CUEA 1WH5A 3ZMZA 1XMXA 2DT6A 2VQCA 2DAOA 3WTSC 1GHCA 2ZXHA 3ESWB 1G3WA 3TW7A 4HA8A 2JQ7A 2V26A 3OYLA 2FXAA 4EJVA 3U2RA 4H0EA 3LQQA 4UV9A 2LY2A 1IRZA 1ZYRF 4NC7A 2W84A 2VBXA 1O57A 4YIIA 2QA4I 1KU2A 4QWQA 2JA6J 1FYKA 1HBXG 3EDPA 4CUGA 2QLZA 3G1LA 2EV0A 3I4MJ 4C2UA 3CJRB 4BJ5C 2PFBA 5KHDA 2MC4A 1VQPI 3CMMA 4RAZA 4RGRA 3FWEA 1KQ9A 1IV8A 2L2OA 3KZZA 4DYCA 1X2NA 3WU1B 4BDZA 4IOCF 3KEYA 1I50J 3GTLJ 3KYDB 1ITYA 2BY2A 5CQEA 3CCLI 4XSZF 4DZJA 4NBQA 4EGZA 5LRSA 1VQLI 4P9FA 1W5TA 2JZYA 3WTVC 2VUMJ 2EV6A 4JX4A 2Y9ZA 1VQ5I 5CYVA 1R58A 1B72B 5GAEJ 4V2GA 4D7NA 2Y48A 2DA3A 3SFIA 1HKSA 4EJOA 4YELA 1OYIA 2WB1N 2NOJB 4XLCA 3WTZA 2CV0A 1DPUA 4PCQA 4ENJA 1X1BA 3I56I 2ZMEB 2ZKZA 3ZQQA 3QWLA 1WJBA 4PFOA 2PMHA 4QPQA 1I5ZA 3CESA 3QU6A 2R3SA 2FNAA 2BHYA 1T08B 2R7WA 4Y7NJ 2WAFA 4I98B 2G0EA 1TT0A 4PFPA 4M3EA 3CDHA 2XIGA 3T8TA 1NK2P 3DQVC 2CUJA 2I10A 2PMUA 1DP3A 1LFBA 4LMYA 4E7ZA 4HNVA 5BPDA 2B9SA 2PJRA 2BBYA 2VIXA 3PM1A 1J59A 3TO7A 1FT9A 3G4SI 3H9QA 5FKOA 3O3KA 5J8CA 3P7NA 1U8RA 1GVJA 4RMNA 2HVRA 1UG2A 3BR1A 4EQQA 1XDUA 4G6DA 5L3GA 3LAJA 1W0TA 4JOMA 2KP6A 1MH3A 3L7WA 5EZHA 2RDPA 2ZMEA 1R5GA 1DDNA 4KN4X 1LB2A 2OTLI 4IHWA 4Q5SF 2JPCA 4HAMA 3VOEA 4U0WA 3W6KB 1KQ0A 3K10A 3HOYJ 2ZC2A 4BYYA 3E6MA 3ABUA 3HUGA 3LL7A 1TZLA 2KRFA 2XPUA 4EJUA 1SVOA 2OZUA 1PP8F 5DYMA 4CH7A 3ERED 4NUBA 1O3RA 3K4KA 3WTTC 1YS7A 2E1MC 3M8JA 3VYRB 1V5EA 4E7LA 1R9TJ 1DQUA 1W36D 1JJ6C 4C2MJ 2WB1A 2ACJA 2R7ZJ 3W2WA 2CFOA 1IGNA 3F6VA 4E7HA 1WJDA 4I76A 1Z1DA 4UY8I 4XRSA 3DPTA 3AG2H 3GF2A 1J0RA 4BACA 4M74A 4C3JJ 1MH4A 2ID6A 1UELB 1ETKA 4B44A 1JHHA 1DU6A 1Y6IA 3CUOA 2RQQA 1SFKA 2M7AA 2V1NA 1JE8A 2XC7A 5DTDA 3CP8A 2K3FA 1VQ7I 2H1LA 4M9ZA 9ANTA 1RUOA 2HXOA 1YX5A 2JVHA 2OAZA 1QHGA 3BJ6A 2DFFA 1IXSB 3F0CA 3A2KA 5E3MA 5H6RA 5J1YA 5BOXA 5FB2A 3CUQC 2AO9A 2CH0A 4KJZA 2BGCA 2ZB9A 3DCFA 2DJIA 3J81K 3KYCB 2FD5A 4P9UA 3HZJA 1Y0NA 2LY9A 3CUQB 3HM5A 3WU0A 3DBLB 3ZRGA 1WH7A 3S2WA 1P7IA 4EM2A 4U87A 3TL4X 4LLNA 4BBSJ 2GIZA 4XKVA 2YX4A 1GUUA 1A31A 3LOCA 2K85A 4G8XA 3S1MJ 1FOKA 3K7AJ 2WADA 3T5XA 2CFXA 2HFHA 5H20A 1S8NA 1BI2A 1ZREA 2NVUB 1QRYA 4F52A 3M3YJ 1MNEA 1MKMA 2YPRA 1OLTA 3MFKA 1S3JA 3ISPA 1W36C 4R8HA 3UNGC 2JUGA 4CYCA 3CDIA 2TDXA 3OIOA 3I3LA 3ML6A 1MZBA 1TNSA 1SC7A 2KIFA 1JHFA 1R36A 2VBYA 5B1BH 3SZGA 2Y9YA 1XB4A 2DDAA 2M9HA 4L5JA 4BL0B 3CMEI 3OYJA 2W25A 3WTWC 1KGSA 1KQ8A 3P9KA 1HXDA 2X1DA 4RLFA 2DT5A 4OAZA 2DPUA 1X19A 5JLWA 3I9V2 1GDTA 3EUHA 2UV1A 4CCJA 5EGOB 3JCUC 3IC7A 2J5PA 4N4OB 2JUCA 5E8IA 2XAHA 4EJWA 5F27A 4FISA 2QUFA 1T38A 4PSXA 1K4TA 3GTGJ 1V3FA 3H0GJ 3ZOBA 1K78B 1XDSA 2K3PA 3ABMH 4UUSB 2PG4A 1KA8A 1USTA 3H9GA 2L02A 1OCTC 2W4SA 3W2AA 4Y3OA 1HKQA 3PO2J 3EUHC 2CS3A 2E71A 3F3XA 3GW2A 5ED4A 3DU5A 1U6GA 5D6FA 1T0FC 5H2FC 3JTHA 1X4PA 1VQMI 3JW4A 1OISA 5ICFA 5DCMA 1P9QC 5GADJ 4ENNA 4PGHA 3I4NJ 3AKZA 2M4GA 3OS0A 2E35A 3CCSI 1ETQA 2RVCA 2WY7Q 1ZELA 3MKLA 4KDPA 1XMKA 3M7GA 1KU3A 5J4VA 4MFEA 2BW3A 2ELJA 2HYGD 4A3BJ 1O7LA 1VF9A 1B59A 3HRSA 2M8EA 2NS7A 2H8RA 2LF8A 1LFUP 2W1OA 3ERMA 3SDGA 1YW7A 4MGRA 3K6GA 1IRGA 3ZR8X 3KP2A 5CVRA 2DYRH 1PYVA 2CW0F 1J75A 4ZH4F 3BCAA 1FP2A 1J09A 1J9IA 2FU4A 2Q0OA 1MIJA 4DBQA 1NG6A 1OMIA 4Y17A 4BHCA 2XAUA 2GXAA 3SZTA 1FTTA 5IPAA 3IP4B 4OAYA 3BPXA 2HKXA 2P8TA 4IQ4A 1VTNC 4P96A 4ESFA 1EJ9A 2K9QA 3LSGA 4UNOA 3ZXSA 3AG1H 1FWZA 1RKWA 3QP5A 5JFRA 1UHMA 1UB9A 5CVIA 2DJNA 2EFPA 4XICA 4ENMA 5DM7F 1LDJA 4AYBN 1R1TA 2QENA 4OMZA 4AM3A 5F1JA 2DA5A 1RZ4A 1EA3A 4XOPA 5CVVA 1JUPA 4UUVA 2AS5F 1FIPA 1FJLA 2H6BA 3GFJA 4Q4ZF 2V1XA 4V19K 3DKXA 4BE2A 1ZR2A 5AIPA 2CUFA 2VQLA 1FSEA 4E4HA 4D5CA 3TO9A 4XNFA 3Q9VA 1CQTA 5TISC 4Q48A 1XGSA 3DP7A 5B66C 2LFBA 3H35A 1OR7A 1G3SA 2FRHA 2HYFA 3M8FA 2HQRA 4RLQA 3V7RA 3TEDA 2VKVA 5K7ZA 1LPQA 1UG0A 3VB2A 3WGGA 2ECCA 4F55A 1BJAA 2K9LA 1D1BA 3P5JA 3G73A 2HWVA 3EYYA 5A2QZ 4XBFA 2HOEA 2FJ1A 4XOTA 2CRGA 4BHBA 2NRAC 1WI3A 2WV1A 2BE5F 2HVSA 4KNYA 4QPOA 3S3NA 1OYYA 2IGKA 1SVLA 3ZMUA 2HPIA 2EQRA 1D1AA 3BTJA 2Z33A 1PVEA 4CCNA 5K5QA 3BG3A 4GXOA 4II3A 5DD4A 3OR2C 2QSHX 1T56A 2HOTA 3G71I 4ZJZA 3L2VA 3U1KA 3OYNA 4Y13A 2BY0A 2L7MP 1ZK8A 3K4MA 2DFEA 3OYBA 4Z2YA 4A2UA 3MKWB 2XGDA 4BNCA 1YRNA 4L5IA 4IX7A 1MGTA 3CCYA 2BXZA 4BUPA 2ISZA 2OTJI 3ASNH 4D5FA 3CD6I 5F6FA 2HTJA 5LHIA 2P7CB 1JXSA 1K6OA 2PJRB 1MJBA 4PDKA 4BE0A 4F92B 2MSYA 1ZGJA 3LA3A 3K1MA 1G4DA 4ZYAA 1V55H 3KP5A 5AIQA 1SAXA 1JUSA 3SEQA 3RYRA 2ZXIA 2V1DA 3CP2A 2E5NA 4L18B 2B63J 3GZ6A 3P9CA 5GAGJ 3SHFA 3IL2A 4KA4A 1TLHB 3K2ZA 1POGA 4M3BA 5D8KB 4YFXF 5F1RA 3D5RC 1I3AA 1P7JA 1JTXA 2MFZA 3KP7A 1BJZA 3GTPJ 4KIBA 1BOAA 3OIPA 3DFGA 3DU6A 3MMYB 4KT5C 3ZQIA 4WCGA 4A0ZA 3BPVA 1UAAA 3GX4X 4HLXA 3BQZA 1D0ZA 1HKTA 2CJJA 3FXJA 2XGCA 1ZN2A 3VYSB 3FX3A 1AA7A 2ICWG 2QEXI 2RKHA 2KFDA 4RGUA 1MSEC 2R7SA 3VODA 3WE3A 3HPHA 3VYUB 1BI1A 3MZYA 1D1CA 2EWNA 3I0TA 1R4MB 3QPTA 3F6OA 3BTIA 5M3FJ 4FASD 1FSHA 3I54A 3OL3A 5LGUA 2W48A 2BY3A 1UHWA 5EG0A 2P81A 3PNTA 1MMGA 4XLPF 3CCQI 3NRVA 1H8AC 2GXGA 3BDDA 2MLKA 3L00A 3DKWA 1LDDA 3E6CC 2JWTA 1QZZA 1K4SA 2R7TA 2BOLA 2NS0A 3PUBA 3C3WA 2CUZA 3E97A 2E19A 1Z21A 4MQ9F 3K1NA 2D1HA 4HX8A 1TWHJ 1Z05A 4N0BA 1JKRC 3M07A 4BKXA 4NB5A 3HL2A 3CJTB 4KIGA 3GLLA 3R60A 5JVGF 2QF7A 1FP1D 3OYMA 4OMYA 5EG0B 3VWBA 1JGSA 2MG4A 3WTYC 2RQPA 5KAFC 3CC4I 5E20A 1KYZA 3BR6A 3QAHA 3QOEA 2QBYB 3WU2C 3LMMA 3X2QH 4KMUX 4IF4A 2HS5A 2V7FA 3ASOH 2LNBA 4MFDA 4OU0A 5L3EA 2WA0A 4XKCA 5JHFA 5IYCJ 2CWEA 2DOEA 4FT8A 4B3XA 2ZJPF 3OY9A 4HF2A 2A3SA 3ZQCA 1IUFA 2FOKA 4FX4A 3EQLF 1A35A 5HNHA 4WXHA 5DDGA 1IXCA 4DNCA 4A5MA 5CQGA 1NK3P 2JRMA 3JAMZ 3VEPA 4CCLA 1WJEA 1FBQA 4XLHA 4A3FJ 3F72A 4JK1X 4BHPA 4P1WA 3H5AA 1ORKA 4FCYA 4NC6A 1FPQA 2HU9A 3D1NI 2HTSA 2QQ8A 2E1MB 2O7OA 3ZCOA 4DIQA 3N4MA 3FKJA 4I6ZA 2E2IJ 2VQHA 5HNFA 2K4JA 4BXXJ 3BQYA 1S9HA 2X6WA 2DT7B 3A0BC 3DTIA 4NNJA 2K40A 5EEGA 2HZDA 3TO6A 3OSGA 2Y0SN 2FX0A 2HPMA 4BH9A 2FBHA 3FXKA 2O3FA 4J00A 2LOOA 2O61A 3SDBA 2F6CA 2O03A 2PBIA 4HBLA 4EV0A 4E7IA 4L0YB 3S2DJ 3IRRA 1B9NA 5FLMJ 3OL4A 1FBUA 4L9JA 1ZRFA 1IN7A 1P4AA 2CW8A 1B8IB 1YOVB 5FLVA 4RA2A 2IJLA 3CLQA 4B09A 4WXCA 1ZGWA 1N77A 1FYLA 3V4GA 1I27A 1YYVA 2LKPA 3HEFA 2XVCA 2DCEA 3G3ZA 1L3LA 4PSWA 1R49A 2Y0MA 1Y8RB 1GXPA 2LSOA 4LIUA 1LE8A 2VBWA 5LFAA 3GZ5A 4HRIA 2KMUA 4GDFA 2YUSA 1D3YA 1QVUA 1Y1VJ 5D4RA 4HSTA 1Z0XA 3FBNB 4HX7A 4TV7A 5DD8A 3HOXJ 3TP3A 5DCMB 2IS2A 3RKQA 4HV5A 4CCOA 4XRMA 1DGWY 3C2HA 4RBOA 3HTSB 2CMPA 4GRIA 2L4AA 1IXRC 4EM1A 1SD5A 2F48A 3O6BB 3GTMJ 2O9LA 3MKZA 3WTUC 1V5FA 1Z91A 3BG5A 3FHZA 4DOZA 3KEQA 3PIPF 1XSXA 2WWYA 3L2RA 4RAFA 1ODDA 4HPQA 1LE8B 3H3VK 1R71A 2W24A 1TL8A 4ZC3A 2O8XA 4HF1A 4EJTA 1LFPA 4A6DA 1X1CA 3FXMA 2VOOA 2VPRA 2VLAA 2K9SA 4CZZA 3KZIC 1OYWA 1JUMA 1V4RA 1RUNA 1ZHFA 4M3DA 3QPSA 5EEAA 2OCEA 1QGPA 2QGUA 2X6OA 3JSPA 3A0HC 3HB9A 4EM0B 1O3TA 5KK1A 2P5KA 2LBFA 2JVGA 3GLXA 5E1WA 5D5VB 5FRNA 2O5RA 2V9KA 2EK5A 3HRUA 3CJQB 5TRDA 2R5YA 1NTCA 2H1KA 3BC8A 1OCZH 3FXLA 4E7KA 3F8NA 3ZQGA 1BC8C 1ETOA 1ETVA 4CO8A 5IP7J 4BGDA 2FEZA 5HDGA 3OYEA 1YW8A 2X85A 3WODF 5C4JJ 3CO6C 2X1CA 5J1UA 3GO5A 3O8GA 2BYVE 4L9TA 5D4SA 5FROA 4G7ZF 1IC8A 3M1EA 2HNHA 1DGRM 1P92A 2R7FA 3HSFA 2XRLA 3DTEA 2RNJA 5M3MJ 3RIRA 2RREA 2TCTA 2OV7A 4M72A 1ZG5A 4ITVA 3GZNB 1T2KA 3CO7C 3AAFA 2P0WA 1F5TA 3G1MA 2HVQA 4AYBA 4BXUA 2LR8A 1ONVA 2F5DA 3PL8A 4EMSA 1ZH5A 2IBDA 2ME6A 1TWAJ 5IY5H 2Z9OA 4UUSA 3M1CA 5J8FA 1IN5A 1LKXA 3FMQA 4M3FA 1SEUA 1OCCH 1BR1A 4CYDA 2XPVA 4P55A 3C18A 4ON0A 5LEJA 2PN6A 1XS9A 5J6XA 5B3SH 2Y2ZA 1UFMA 2EILH 4I0AA 1YLFA 1RRJA 3WG9A 1N75A 4XORA 5IYBJ 4KUMA 5LEKA 2JMWA 1G6NA 1IUYA 2E1OA 3T0YA 3JRBA 2IP2A 2BEOA 1QZEA 5HOOA 4U88A 2DTRA 2VJJA 4O5VA 3CCJI 2HDDA 3DV8A 4E6KG 3K4NA 1FMVA 5D5UB 1USSA 1VQ4I 2PI0A 2RV8A 2F4OB 4IQJA 2Z99A 1TNTA 1X1AA 4XLEA 4BJ6C 1RESA 5KAIC 3HHGA 3EYIA 4BQNA 3B6CA 2OC6A 4AIHA 1D5YA 1FC3A 1N78A 1STZA 1YITI 4L9VA 4WK8F 4HQMA 1A5JA 3KX2A 4AVPA 4JX5A 3ZQFA 1E3OC 2BXYA 1FNNA 3A02A 3W6JB 2XKOA 4IOAF 3KIOA 4BQQA 3H9JA 3H5NA 3JRGA 2JT1A 3WGHA 4ZTFA 3FIWA 3BZCA 3PUFA 4M71A 2FA5A 2LLKA 3FDYA 4FQGA 1R4NB 1VFCA 4K2EA 3KP4A 3BR3A 1T95A 3S32A 5F0CA 1YIJI 1KYWA 1IZ1A 1U8BA 1ZAOA 1K6YA 2ZXJA 1AU7A 1G2HA 1JTYA 3TOBA 1SMTA 2W85A 2OUMA 1JT0A 4GYGA 5FO5A 3IRQA 3FZVA 3F8MA 2L7FP 4ZZLA 3IV5A 1TC3C 2LH9A 2QKLB 2K86A 3AFHA 4CCMA 1YW9A 2IAIA 1U9OA 2Z1DA 3E7LA 3REOA 2HQAA 3TKYA 1X58A 2KKOA 3C2BA 3LSJA 4LFUA 5GTIC 2XAGA 2UXNA 3TW6A 2CQKA 4C3IJ 4HG2A 1QU3A 2LD5A 1EH6A 2GAUA 4ZYGA 2I8DA 3JRHA 2VC0A 2IS6A 3PFYA 1OFCX 1SVMA 5DM6F 1FIAA 5DV5A 2WAQN 2VC1A 1FOYA 2GLOA 2GIVA 1BW5A 3WTXC 1MBJA 2FF4A 4MEYF 4RGXA 1E3PA 1ZR4A 3E6DA 2M7BA 4BEHB 3LSHA 2X48A 3RCOA 3OYIA 1JJ8C 1LUJB 2ME0A 3BR2A 1U78A 1PUFB 3GMEA 1PP7U 2GBYA 1IO2A 2COMA 4WXDA 3BP8A 3JREA 3S2HJ 1SMYF 4U0VA 2WY8Q 3C7JA 1Y1WJ 1VQKI 2Q1ZB 2M2EA 5FFXA 3RI4A 2HR3A 1ON2A 2CO5A 1W7PA 3KCCA 4ANJA 3PNVA 2PMZA 2FMLA 5HDKA 3W3CA 5K1YA 2O0YA 2NYXA 4G9YA 1J5YA 3GVAA 1HW5A 3H36A 4D7MA 3TGNA 5IT3A 3JAMK 4OINF 2FOWA 1AWCA 2R93J 3FK7A 3HUGB 2R5ZA 5FGMA 2ZJ2A 4XN0A 1GV2A 2Z5UA 1OQYA 4HV6A 2P6SA 2DXIA 1T39A 2KL4A 3L1PA 3IKTA 2AHQA 1A6QA 4KIFA 1AOYA 5D6EA 3RPQA 1PUFA 4LD5A 1QNTA 2MW8A 4D9JA 1DP7P 1FTZA 1Q1VA 5LD2C 2ISYA 5TGTA 4MLOA 2IRFG 4IHTA 1D8JA 3BJOA 2XRNA 3S93A 3UKGA 1BM9A 3Q0UA 3OYHA 1LVAA 5FLXZ 3L2QA 3PO3J 4HNUA 1WCMJ 1Y56A 1H9GA 2AXTC 2DPDA 2W57A 2VT2A 1R6RA 4CICA 3QP6A 3FK6A 3GTKJ 1PDNC 2X1EA 3QQAA 3W6VA 3OS2A 1CF7B 2OCCH 3RYPA 4ABZA 3A03A 1RETA 2OZ6A 3QPHA 4S05A 3GFIA 3Q5FA 1Z7UA 3BR5A 4M6XA 2HQ5A 3LSPA 2E7XA 2LYCA 4R1HA 5GTHC 2EZLA 4XSXF 4L0ZB 3OYDA 3DPLC 4FE7A 3SFZA 3K70D 2KDZA 2LVSA 2V6CA 5DS9A 1JKOC 3HSRA 2PLYA 3ECHA 4U0YA 5EJCA 1H9TA 1QQIA 3E5XA 2F5FA 2ID3A 2X6XA 2EFQA 2KT0A 1CF7A 4HSRA 3LFKA 2K7LA 1MDMA 2XB0X 3DKYA 2YS9A 5F0FA 1F43A 4YIRX 1REPC 4FHTA 5J1RA 5FJ8J 5EF6A 3HGYA 2V4JC 1S5LC 3L09A 4B43A 2RC4A 3K4CA 2EPFA 3CCMI 3H92A 2PQ8A 4UHTA 2DODA 2GOXB 2KZGA 2KJBA 2ESNA 1BN5A 1D0YA 1XN7A 1ETYA 2OF7A 1WJAA 2EB7A 1IJWC 1B8IA 2X0LA 4HX4A 1I6XA 3EETA 1VQOI 4XONA 4LK1F 2QM3A 2EH3A 2FBIA 4H4KC 4NQWA 3RPUA 2B7EA 2NVTJ 2L3DA 4Z6YA 2P5LC 2JA8J 5DCFA 3ZMDA 2STWA 4OOIA 2A69F 2OJED 5JHUA 1Z9CA 1WHUA 1FZPB 4M6YA 4I7HA 1TWGJ 2R4GA 1XCBA 3QYFA 2BVLA 3ZN0A 1OKRA 2OD5A 1FY7A 4YFNF 5IYDJ 4E70A 1E0EA 2W82A 3D0SA 5JVTA 3B6AA 3FF5A 3MEXA 3K4JA 3H1CA 4Y33A 5LBQA 5K5OA 1I6HJ 2KPMA 5HLHA 4B4CA 1K7AA 2DK8A 3MAJA 4A12A 1QBJA 4BDYA 1O3SA 4Y15A 3S15J 3RZOJ 4UUTA 3FBIB 3Q0WA 2QQ9A 2RNGA 1SAUA 3U9GA
chains in the Genus database with same CATH topology
1DP3A 2AQEA 4E7ZA 4CA0A 1Z3YA 2PJRA 2VQHA 5HNFA 2VIXA 2ZFUA 1S9HA 4JQFA 2X6WA 2DT7B 3DTIA 4NNJA 2HZDA 3OIQA 3H9QA 2VPLA 3D5SC 2HPMA 4B47A 2LRDA 4RMNA 2HVRA 4J00A 2LOOA 2KZVA 2VQGA 4JOMA 2KP6A 2FUG2 3W2AA 3SDBA 1IRXA 2F6CA 4HEA2 4XQFA 4E7IA 4XN3A 4CSWA 3OL4A 3HOSA 4F3QA 3EUAA 3K10A 4BXFA 1WJFA 4OWRB 2CW8A 5CKTA 3LL7A 1TZLA 1N77A 2F5VA 1Z3XA 4DBRA 4B48A 4CH7A 2DCEA 4NUBA 3K4KA 4PSWA 2E1MC 3M8JA 4LIUA 3VYRB 5LFAA 1V5EA 4Y4RA 2KMUA 4J01A 4E7LA 4HRIA 1DQUA 4AVZA 1W36D 3SYTA 3KYLA 2WB1A 4HSTA 3BCBA 2E5ZA 2KLOA 3FBNB 3W2WA 2CFOA 4C30A 3AL0C 4E7HA 4RM2A 1WJDA 2IS2A 4CCOA 1DGWY 3DPTA 3C2HA 3E0JB 4BACA 2CMPA 1PJRA 4GRIA 2R7XA 1JI8A 1UELB 4CCKA 2M4KA 4B44A 1Y6IA 2XSJC 3L2UA 2RQQA 1SFKA 1G8XA 2M0MA 3MKZA 2M7AA 2V1NA 3NWTA 1V5FA 2XC7A 2M3AA 3CP8A 5CPRB 4XMYA 4DOZA 2XDVA 3L2RA 4HPQA 2WAEA 1YX5A 2JVHA 3U21A 1QHGA 4ZC3A 3A2KA 1LFPA 4EATA 1X1CA 3UR3C 2CH0A 3PNYA 2VLAA 4KJZA 2DJIA 2KHMA 3BG7A 2ZSIB 4XM3A 3ZRGA 2JSPA 4YRVA 4U87A 3TL4X 3OYFA 2E60A 4RM3A 4XKVA 4DJAA 3QODA 2XF5A 1WJ5A 2LBFA 2JVGA 4KT6A 4FETA 4E7SA 2WADA 5FRNA 2O5RA 2V9KA 2LC2A 3CJQB 3BC8A 4E7KA 3K4BA 4XL9A 4F52A 4F91B 3E1SA 1MNEA 4BGDA 1OLTA 2F4IA 2VKHA 2QKMB 3OYEA 2R7UA 2X85A 1W36C 3UNGC 2JUGA 2X1CA 1FMWA 2VJ4A 3I3LA 3OYKA 2CW7A 3AL0B 3L2WA 3TBIA 5FROA 5HVQC 2GOMA 4ZTJA 3TMOA 2HNHA 1DGRM 2R7VA 4E7JA 3DTEA 3SZGA 1VZ0A 2RREA 2OV7A 3PSIA 4BS9A 4ITVA 4BL0B 4R79A 3IUOA 3OYJA 2P0WA 2W7NA 4DGWB 2HVQA 1X1DA 2X1DA 4RLFA 4AYBA 4YEJA 4OAZA 4F93B 1X19A 3PL8A 3I9V2 4BEHA 3H5RA 2UV1A 4CCJA 4XKWA 4HNTA 3IAM2 3M1CA 2VKDA 4N4OB 3ZGKA 1LKXA 4PSXA 1BR1A 2K3PA 4LIVA 3H9GA 2XF7A 3MD2A 2W4SA 4BJTA 2JA2A 4Y3OA 3EUHC 2MABA 2CS3A 5FRMA 3BLYA 2K5CA 2MD0A 3DU5A 1NG7A 2W00A 3PSFA 1T0FC 1X4PA 1Z7LA 1N75A 4XORA 3A1YA 2LREA 1HA8A 3J7AY 2IS1A 1P9QC 2XF6A 3GBGA 3RSNA 3AKZA 2M4GA 3OS0A 2WY7Q 2R7QA 1ZELA 1GLNA 2Y0SA 3HPGA 3DEEA 5HOOA 3S3MA 2BW3A 2ELJA 2VJJA 3DWLE 3HKZA 4CZCA 4E6KG 3K4NA 1FMVA 3HG9A 2W1OA 4BU2A 4IQJA 1X1AA 4XLEA 2BW3B 4BJ6C 3OYGA 3K6GA 4BQNA 4C9YA 3ZR8X 2OC6A 1WFXA 4BE1A 1N78A 1PYVA 3BCAA 2Z16A 3KX2A 1J09A 4DBQA 1LVKA 1NG6A 2VB6A 1BR4A 3HXLA 1MW7A 2XAUA 3IP4B 3H9JA 3H5NA 4OAYA 4BQQA 3IAS2 2X51A 4ZTFA 4IQ4A 3FDYA 3LSGA 1QHHD 1T95A 3S32A 3ZXSA 1ERDA 4PJJA 3DTKA 1K6YA 2UWMA 3N05A 1YE9A 4G6TB 2OUMA 1EA3A 4XOPA 1BR2A 4NQWB 4KITB 4N4NB 2LH9A 2QKLB 3DKXA 4CCMA 3AFHA 3VSKA 2AQFA 4BE2A 2Z1DA 3W2VA 2HQAA 2VQLA 2VXZA 3OMYA 4E4HA 4XNFA 3G2BA 4PUSA 2ZSHB 4HG2A 1QU3A 1MNDA 3CZ6A 3H35A 2I8DA 3OOUA 3ONQA 3SEZA 3VDXA 2IS6A 3PFYA 2Q2EB 1G59A 2IGOA 4RLQA 4XKBA 1WJCA 1UG0A 4F55A 4IKFA 2K9LA 1D1BA 4PJMA 2IXSA 4ZDLA 2A5WA 3BG6A 2LBFB 4XOTA 4PK4A 3OYAA 2HVSA 2M7BA 4BEHB 3LSHA 4QPOA 3VYTB 3S3NA 2LG4A 3OYIA 3RCOA 2WAQA 2IGKA 2L9NA 2HPIA 2KRHA 2CV1A 4P5OA 3EPZA 3RQ4A 2WY8Q 2KDOA 1D1AA 4LG3A 2CV2A 2Q1ZB 3MKYB 3RPUD 4CCNA 4II3A 4ANJA 3OR2C 3PNVA 2PMZA 4XLAA 4ZJZA 3L2VA 4ZDPA 3W3CA 3OYNA 3K4MA 2MYSA 3OYBA 2VL8A 3OWTA 3S3OA 3MKWB 1X4OA 3HOTA 4U7BA 3HUGB 4IX7A 2KRCA 4XN0A 4BUPA 2DXIA 4PJLA 2KL4A 3A4CA 3OYCA 3C2GA 4D9JA 2DOAA 2PJRB 1BOBA 4AU7A 5LD2C 4LITA 5TGTA 3DLAA 4F92B 4MLOA 4BE0A 2R7OA 4PJNA 3S93A 4ZYAA 3OYHA 3FHNA 3CF2A 3HC7A 4X0GA 3L2QA 3SEQA 1YX3A 4HNUA 3DPUA 1MMAA 1Y56A 2ZXIA 3VSLA 3CP2A 2E5NA 2KQRA 1R6RA 3QYBA 2IGNA 3V42A 2X1EA 2L9SA 2R7RA 3OS2A 2VJIA 1OR7C 3D5RC 3S8PA 2VXDA 2MFZA 5HLTA 3EUKL 3OR1C 3OIPA 3DU6A 3MMYB 4XLFA 1LDKB 2LYCA 3H0DA 1UAAA 2IGMA 4XR6A 3OYDA 1D0ZA 1D0XA 2IS4A 3K4LA 2A6TA 3DPLC 3K70D 4ZDOA 3VYSB 2R7SA 1AA7A 4D1QA 4NC8A 1MMNA 2V6EA 3HPHA 2HDWA 3VYUB 4C2TA 1D1CA 2X6YA 4FASD 4BQOA 2X6XA 2DT6A 2VQCA 5KNLA 3OL3A 4KISA 2ZXHA 4HSRA 3PNTA 2V26A 3OYLA 1MMGA 3DKYA 2WBMA 3RTRA 3QYEA 2V4JC 1KONA 2LY2A 4B43A 3K4CA 3LFUA 4NC7A 1V5GA 1MMDA 3K70C 2R7TA 2GOXB 2BOLA 3PUBA 3D5LA 2CUZA 3PJRA 2LY1A 3LSMA 4CUGA 1Z21A 2L5QA 2VJ5A 1D0YA 2K9MA 1WJAA 4C2UA 3HL2A 3CJRB 4BJ5C 5KHDA 2MC4A 4XONA 3CMMA 3OS1A 3LSIA 2L2OA 3OYMA 4BDZA 3VWBA 3KEYA 3LSKA 4H4KC 2Z2SB 5CQEA 2L7KA 3F9KA 3QOEA 3LMMA 2V7FA 2WA0A 2BVMA 1U0JA 4XKCA 5JHFA 4B3XA 2VASA 3OY9A 2R4GA 3QYFA 2BVLA 5HNHA 4YELA 4XLCA 2NOJB 2CV0A 2UUZA 5KCMA 1E0EA 2W82A 1X1BA 3ZQQA 1WJBA 5CQGA 4PFOA 3K4JA 3CESA 4Y33A 4QPQA 4CCLA 2KPMA 1WJEA 4IZZA 4XLHA 4II2A 2R7WA 4P1WA 3H5AA 2WAFA 4BDYA 1TT0A 4PFPA 3NWSA 2HU9A 3FBIB 2RNGA 1SAUA 2E1MB 3DQVC 3ZCOA 4DIQA 2CUJA 3FKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQE A;  2ELJ A;  2AQF A;  2CUJ A;  2DCE A; 
#chains in the Genus database with same CATH topology
 2KJC A;  2AQE A;  2D2W A;  2HYJ A;  5C44 J;  4CA0 A;  1Z3Y A;  1S7A A;  2EJR A;  5K5R A;  5HLI A;  1HST A;  4JQF A;  2JSC A;  3BRO A;  4Y52 J;  3OIQ A;  1MMS A;  4OIQ F;  3K1P A;  3B02 A;  1S7E A;  3CCR I;  2HOA A;  1SFO J;  4B47 A;  2A05 A;  3CMY A;  2LRD A;  3ZQH A;  5LGT A;  1EKE A;  2BZT A;  4ESB A;  2F5C A;  1WKM A;  1XX5 A;  2KZV A;  2FUG 2;  3CCU I;  2GQQ A;  1F36 A;  1ZG3 A;  2OBP A;  3VPR A;  5K7H A;  4XQF A;  1P2F A;  3RJP A;  4XN3 A;  4CSW A;  3HOS A;  2P5V A;  4XID A;  5ERI A;  4M73 A;  1NHA A;  4LG0 A;  1WJF A;  3KP6 A;  4OWR B;  2P6T A;  2HOS A;  5CKT A;  3FXQ A;  1YFH A;  1TQP A;  2F5V A;  2FQ3 A;  2LMD A;  1Z3X A;  2QQA A;  4MHG A;  4DBR A;  4B48 A;  1YS6 A;  3T1B A;  4HOB A;  2XB5 A;  3JRC A;  2E2H J;  1IN6 A;  2JA7 J;  1UJ8 A;  4I99 C;  4ETS A;  5D5W B;  2D45 A;  4Y4R A;  2XV4 S;  3JR9 A;  4J01 A;  2D5V A;  2VOD A;  4LGW A;  4AVZ A;  5DUI A;  3KYL A;  2CQX A;  2E5Z A;  1VI0 A;  2KLO A;  3RDI A;  3V7C A;  4RB2 C;  5IT9 K;  4UB8 C;  5D5X B;  2L0K A;  4C30 A;  3AL0 C;  4RM2 A;  2HZT A;  2E36 A;  3ZP5 A;  1XSD A;  3F8B A;  3KFW X;  3E0J B;  4IJA A;  2R7X A;  1S6L A;  2MH2 A;  2M4K A;  4XLN F;  2NXN B;  2EA2 A;  3L2U A;  1BI0 A;  3VFZ A;  1G8X A;  1X3Z B;  2M0M A;  4BY7 J;  2FSW A;  1MJ9 A;  2ECB A;  3NWT A;  1HC8 A;  2M3A A;  2JRT A;  3FMS A;  4MQV A;  1C0W A;  4XMY A;  1YI2 I;  2XDV A;  3DLL F;  1X2M A;  1A6I A;  1WQ2 A;  2KIQ A;  4ESJ A;  2WAE A;  2G7H A;  5B5E C;  3L2C A;  3GFL A;  3CF5 F;  1RC9 A;  2HXI A;  1XTA A;  4EAT A;  1EH8 A;  1MBH A;  5FKK A;  1FBS A;  1WWX A;  3I53 A;  3IH2 A;  1T8I A;  3CC7 I;  2CQN A;  4UVA A;  2IT0 A;  4BQA A;  2KHM A;  5J47 A;  1AHD P;  1E17 A;  3K2A A;  2ZSI B;  3J7Z I;  3HDD A;  4IRI A;  3C1D A;  3AG3 H;  3OYF A;  2IA0 A;  1R00 A;  5CVU A;  1BIB A;  2L01 A;  5E1Z B;  1I3Q J;  4IHV A;  3QOD A;  2XF5 A;  2OQG A;  3KPH A;  1QO0 D;  1LEB A;  2ZO4 A;  3BTL A;  2WV0 A;  1WPK A;  1BA5 A;  4F91 B;  1K83 J;  2DA6 A;  5L3D A;  5M5W J;  4GFB A;  1JKP C;  2E2J J;  3BT9 A;  2VKH A;  2DI3 A;  3HHH A;  4G12 A;  4I0B A;  1PUE E;  2R7U A;  2ETH A;  2OU2 A;  3GTO J;  3J80 Z;  3OYK A;  2VJ4 A;  3AL0 B;  4M9X A;  1P4X A;  1QZY A;  1G3Y A;  2N8G A;  1ON1 A;  5LLQ A;  4ZYD A;  2GOM A;  4ZTJ A;  2DTZ A;  4BBR J;  3I5U A;  5F64 A;  3CDL A;  2R7V A;  4E7J A;  2KIM A;  3FKI J;  2PJP A;  3TDU C;  1VZ0 A;  1SFX A;  1R1U A;  2DLL A;  3GUD A;  1YHQ I;  1OCP A;  4B3A A;  2LP0 A;  1UHS A;  3I59 A;  2EIM H;  4GCV A;  2W7N A;  4DGW B;  1WGX A;  1X1D A;  1B72 A;  1MSF C;  3V7S A;  3KE2 A;  5BQT A;  5LHG A;  4BEH A;  3H5R A;  4XKW A;  3GCM A;  3ZGK A;  2DMT A;  3CCE I;  4G6Q A;  4AIJ A;  2CSO A;  1X3W B;  4AID A;  3LWF A;  5A2Q K;  2XF7 A;  3N97 A;  2JA2 A;  3BR0 A;  2H6C A;  4J19 A;  2MAB A;  2O8K A;  3DBH B;  2QYO A;  2K5C A;  3LST A;  2MD0 A;  3J7A O;  2VE8 A;  2XGE A;  1NG7 A;  2ZCW A;  2W00 A;  4IRG A;  2H27 A;  3RQI A;  1Z7L A;  2EZH A;  3GXO A;  2R5Z B;  1ZAR A;  2PMZ N;  3A1Y A;  2LRE A;  1HA8 A;  3J7A Y;  4HLY A;  1MDM B;  2IS1 A;  2XF6 A;  3TOA A;  3RSN A;  5FKM A;  2YU9 J;  3S1N J;  4MIM A;  2R7Q A;  1ZG1 A;  2Y0S A;  2Y31 A;  3HPG A;  1RR8 C;  3BY6 A;  1D5V A;  4A3E J;  2JTV A;  3TDZ C;  4AIK A;  3F21 A;  5FKL A;  3S3M A;  2NS8 A;  3ABT A;  1Z6R A;  1MNM C;  3HG9 A;  4CDG A;  3Q0V A;  2DK5 A;  4BU2 A;  5JR3 A;  1EV7 A;  1F1Z A;  3KET A;  1T6S A;  2QZ8 A;  3GFM A;  1B6A A;  1U5T C;  2DW4 A;  4C9Y A;  2QVO A;  1R7J A;  1APL C;  1WFX A;  3NAR A;  4ZZD A;  1BC7 C;  2EV5 A;  3QRF F;  2Z16 A;  3JRF A;  4A6E A;  3RKX A;  3S1Q J;  5B1A H;  2EZI A;  2ZFW A;  1LVK A;  2PX9 A;  2VB6 A;  3HXL A;  4HW0 A;  2C6Y A;  1Q1H A;  2M0C A;  1W7P B;  2X51 A;  2Y69 H;  1ULY A;  3IAS 2;  3WHB A;  2BV6 A;  2M34 A;  1MBE A;  4IHY A;  5HLG A;  2EIJ H;  1O7F A;  1NH3 A;  2MBF A;  3ZN1 A;  2COB A;  2XPW A;  4PJJ A;  2Q2E A;  3DTK A;  4HYE A;  1XGM A;  2DA4 A;  3NQO A;  2UWM A;  3N05 A;  3OOP A;  2LDU A;  5K7F A;  1VND A;  3IH4 A;  1R5I D;  2VI6 A;  2QCO A;  4PGG A;  3NEU A;  1DU0 A;  3QPL A;  1RKT A;  3HIF A;  3KLO A;  2M1B A;  1BR2 A;  2I5U A;  4W97 A;  5IT9 Z;  1R23 A;  4N4N B;  2EZK A;  2RGV A;  4CHU A;  5E17 F;  2AQF A;  2LTP A;  1BL0 A;  4RS8 A;  4O3M A;  1W5S A;  1QVT A;  2F4M B;  4AD9 A;  4WWC A;  4QIW N;  4A3C J;  3ZMT A;  1K61 A;  1U2W A;  2ZSH B;  3HSE A;  3IHU A;  1FOW A;  4N9H A;  1K79 A;  1BI3 A;  1E3H A;  4F7Z A;  2V9V A;  3TP0 A;  3OOU A;  3VDX A;  4HDV A;  3LQR A;  5H6Q A;  2EFW A;  1LEA A;  2Q2E B;  1QPM A;  1G59 A;  2IGO A;  2XHK A;  1WJC A;  2K02 A;  4NDL A;  2UXX A;  4IKF A;  2GA1 A;  4PJM A;  3S16 J;  2IXS A;  4YIF A;  2FBK A;  4FX0 A;  5LHH A;  2Y75 A;  3BG6 A;  1YJ9 I;  3BZ6 A;  2EFO A;  4PK4 A;  3BTC A;  4A5N A;  1RNL A;  5BS6 A;  2VON A;  3OYA A;  2ESH A;  2F2E A;  2IEK A;  4RB1 A;  1HLV A;  2LG4 A;  4MNU A;  5ICC A;  4AUX A;  4KMF A;  2KRH A;  2CV1 A;  3BG9 A;  3RQ4 A;  2CV2 A;  3MN2 A;  1ZQ3 P;  2NNN A;  1MD0 A;  3MKY B;  1OCR H;  5ILU A;  4AC0 A;  1TTY A;  2EBI A;  1SD4 A;  4A3G J;  4XLA A;  2PEX A;  2JN6 A;  4A3I J;  4ZDP A;  3MZH A;  4LLL A;  3GTJ J;  3HGG A;  2VL8 A;  3OWT A;  1X4O A;  2OPT A;  5ILS A;  2FNP A;  5M5Y J;  1YQA A;  4A3J J;  1MBG A;  2XAJ A;  2A5Y B;  1Z77 A;  1BIA A;  2QSG X;  1VQ6 I;  1GVD A;  1X3U A;  1TP4 A;  2AXL A;  4A69 C;  2YX7 A;  3ELK A;  1HW2 A;  4DYQ A;  3FMR A;  2DOF A;  5F08 A;  4G94 A;  5FFZ A;  2V1U A;  2UZK A;  3C2G A;  2VKE A;  2V9P A;  1KU9 A;  1O3Q A;  2XAF A;  1UCR A;  2MGQ A;  1BOB A;  3O2P E;  4LJZ F;  1T33 A;  4LIT A;  3DLA A;  4V2F A;  2A6E F;  1YO5 C;  1IG7 A;  5IP9 J;  1B1B A;  5IOY A;  2E1C A;  3V8J A;  3HOW J;  1D8K A;  3FHN A;  3CF2 A;  3HC7 A;  3Q3S A;  4X0G A;  1MMA A;  2KQR A;  2YSR A;  2DA1 A;  1XG1 A;  2BY1 A;  4IO9 F;  2KIS A;  5E3O A;  2FE3 A;  3V42 A;  2EIN H;  2L9S A;  3LA7 A;  1QPI A;  4M3G A;  2VBZ A;  4AWX B;  1TQM A;  2O6G E;  2MD5 A;  2VXD A;  2DQR A;  3S8P A;  3EUK L;  4I01 A;  2HEO A;  1HDP A;  4RB0 A;  3RKY A;  2VOP A;  2IA2 A;  2H8W A;  1YTY A;  2IGM A;  2DDB A;  2ZNY A;  2VT3 A;  3PFI A;  3KP3 A;  3K4L A;  3ZMS A;  3SJM A;  5LGN A;  1T0F A;  1WRJ A;  4A3L J;  1S7O A;  4DW6 A;  3F23 A;  1ZKG A;  1QA6 A;  5BPI A;  3HOZ J;  2HDW A;  3FXR A;  4IXA A;  4M9S A;  1P4W A;  4DYR A;  5KNL A;  2DYS H;  4KIS A;  1IN8 A;  4I09 A;  2MA3 A;  3KEO A;  5HS9 A;  2X9D A;  4XRS G;  3PQJ A;  1IW7 F;  3KZY A;  2WBM A;  3RTR A;  3QYE A;  1FYM A;  1KON A;  3F8C A;  2DN0 A;  3DF8 A;  5EYR A;  2RN7 A;  3R6S A;  3FM5 A;  3LFU A;  1IF1 A;  1V5G A;  2D1V A;  4JX6 A;  5EGO A;  1LQ1 A;  1MMD A;  3K70 C;  2STT A;  4LB6 B;  2DU9 A;  3D5L A;  3PJR A;  2LY1 A;  3LSM A;  1IV6 A;  2RAE A;  2L5Q A;  2VJ5 A;  1L0O C;  3HTU A;  3I59 B;  3GWZ A;  4A0X A;  2JJ7 A;  3JTG A;  1U3E M;  1HOM A;  2K9M A;  5J3L A;  5C3E J;  3V8K A;  4IRH A;  4L9N A;  3OS1 A;  1HW1 A;  2IA1 A;  3LSI A;  5AON A;  1P6R A;  2HDC A;  3WE2 A;  2M30 A;  2K9N A;  3LSK A;  5ICE A;  1UMQ A;  2M8G X;  2WTE A;  2Z2S B;  4EEF G;  2L7K A;  3DBR B;  3F9K A;  2L7Z A;  4S0H B;  5FKN A;  2QWW A;  1Z67 A;  2G9W A;  2BVM A;  1U0J A;  2FQ4 A;  2VAS A;  2ZXW H;  3E6B A;  3CQZ J;  1H88 C;  2IW5 A;  2MC3 A;  3ULQ B;  3COA C;  4PZJ A;  1SFU A;  1YIO A;  3FIS A;  1IDY A;  2UUZ A;  5KCM A;  1HF0 A;  1XPX A;  5IP6 A;  4RGS A;  3V8L A;  4HF0 A;  4IZZ A;  4II2 A;  1GXQ A;  2P7V B;  3L9F A;  2CGP A;  5D8L B;  1X1P A;  2TRT A;  3SZP A;  2GA2 A;  2YU3 A;  3BZK A;  3NWS A;  1ENH A;  2M45 A;  2GM4 A;  1TT5 B;  3T8R A;  1I1S A;  3WHC A;  5EDN A;  1R5H A;  4CGZ A;  1JT6 A;  3JRI A;  2HQN A;  5J40 A;  5HDN A;  1UZC A;  2ZFU A;  1W7P D;  5TJJ A;  3WGI A;  5E18 F;  3CCV I;  2JA5 J;  3P9I A;  2VPL A;  3HKZ N;  2DO7 A;  3D5S C;  4A3D J;  3HRM A;  2B0L A;  2VQG A;  5E1X A;  1TW3 A;  3AG4 H;  3F8F A;  1IRX A;  4HEA 2;  1I39 A;  3SQN A;  1J7K A;  3B73 A;  3EUA A;  4F3Q A;  3S1R J;  3I58 A;  4I2O A;  1XD7 A;  4BXF A;  1LJ9 A;  2NVY J;  4GYI A;  2EIK H;  4OIP F;  1SFE A;  2CQ7 A;  3LSR A;  3LNQ A;  4IHS A;  1RPW A;  1FX7 A;  2L4M A;  3ZPL A;  1RI7 A;  1W4M A;  4N9I A;  4ASN A;  3FM3 A;  4C3H J;  5EZG A;  1B4A A;  2LF7 A;  2ELH A;  3SYT A;  3MQ0 A;  3BCB A;  1ZRD A;  4KN7 X;  2HI3 A;  4XRF A;  3M4O J;  2EA4 A;  4ZYE A;  1PJR A;  2VE9 A;  1JI8 A;  5L3C A;  3I71 A;  2H94 A;  2P4W A;  4CCK A;  2ZBK A;  1FLI A;  2XSJ C;  1GV5 A;  5JI6 A;  4B1R A;  1EF4 A;  5CPR B;  3K0L A;  4IHX A;  2ZJQ F;  4G7O F;  1G3T A;  2G7U A;  3O8H A;  2DMQ A;  2M87 A;  3U1D A;  3U21 A;  5GPC A;  2DMU A;  3ZMV A;  3UR3 C;  3FXO A;  3PNY A;  2ADU A;  1U9N A;  3MVP A;  5FD5 A;  2GWR A;  1V54 H;  2CU7 A;  4HZF A;  4A93 J;  4O6J A;  3E3V A;  4OIR F;  5JLX A;  3BG7 A;  2NVX J;  4XM3 A;  2NVQ J;  2JSP A;  1Y8Q B;  5GPA A;  5F04 A;  4YRV A;  2E60 A;  2ELK A;  2XKP A;  4RM3 A;  4DJA A;  3DEW A;  5L3F A;  1MBK A;  1WJ5 A;  1WVR A;  5FLX K;  4KT6 A;  3IKV A;  2KIU A;  4FET A;  4E7S A;  3MCZ A;  2LC2 A;  4FTH A;  3R61 A;  1IN4 A;  3S14 J;  3K4B A;  4XL9 A;  4IPA A;  4JP0 A;  4BY1 J;  1W0U A;  3E5U A;  3M8E A;  3E1S A;  4U7D A;  5L3B A;  3QOP A;  2F4I A;  2QKM B;  1Y0U A;  1E2X A;  3I55 I;  5CVJ A;  1FMW A;  4QSH A;  2CW7 A;  3L2W A;  1W1W E;  2H09 A;  2WC2 A;  3OSF A;  3TQN A;  3TBI A;  3S17 J;  1XC5 A;  1R22 A;  5HVQ C;  2DQL A;  3PIO F;  1Z6T A;  1XGO A;  3TMO A;  1EH7 A;  4IEJ A;  2XGX A;  4FE4 A;  1HSJ A;  2DA2 A;  4UB6 C;  2HKO A;  5GP9 A;  3KLN A;  2GZW A;  3LAP A;  2GXB A;  5E79 C;  3QU3 A;  2QBY A;  2R92 J;  4QLC U;  3BOQ A;  3PSI A;  3OV8 A;  4BS9 A;  3HOU J;  2LKS A;  2L9V A;  4R79 A;  2DA7 A;  3IUO A;  4RDU A;  1RR7 A;  4EGY A;  4UV8 A;  4DZP A;  1MBF A;  5EEH A;  5E3L A;  4YEJ A;  3H3U A;  1OCO H;  3HYI A;  4F93 B;  2EFN A;  1U5T A;  4ENK A;  3ZQ7 A;  2ZJR F;  2X4H A;  3IAM 2;  4HNT A;  2A07 F;  2J5O A;  2VKD A;  6PAX A;  1ACI A;  1DPR A;  5DUK A;  1ZGA A;  2XAS A;  1IDZ A;  2Y30 A;  4LK0 F;  5HS7 A;  1SAN A;  4LIV A;  1WSU A;  4A3M J;  5BNG A;  4YG2 F;  1O4X A;  1VQN I;  2XAQ A;  3MD2 A;  4BJT A;  3CUQ A;  1SD7 A;  3MZ8 A;  3ABL H;  3GYH X;  5FRM A;  3BLY A;  2K27 A;  4KYW A;  3PSF A;  1B9M A;  4X1E A;  4XK4 A;  3JRA A;  3CMA I;  1FOX A;  2A6H F;  3I64 A;  3ECO A;  1N25 A;  2FMY A;  1U5T B;  3GBG A;  4W1U A;  2MH9 A;  2E34 A;  4LB5 A;  4M6V A;  3IWZ A;  5FD6 A;  2XSD C;  2MLG A;  4MTE A;  4UXN A;  1GLN A;  4RAG A;  3E5Q A;  3DEE A;  1HCR A;  4D0P A;  3DWL E;  3HKZ A;  4CZC A;  2A68 F;  4I02 A;  2LKX A;  5E8G A;  4G7H F;  2BW3 B;  2JPB A;  3OYG A;  3R0A A;  3HRT A;  1H89 C;  5J4Y A;  2NOG A;  1T98 A;  4BE1 A;  4A3K J;  5IOZ A;  5GAH J;  1H0M A;  4OIO F;  4LOC A;  1TQI A;  2IVM A;  3CC2 I;  1RIO H;  4Q47 A;  3HJE A;  3GTQ J;  2ZNZ A;  4HQE A;  1BR4 A;  1MW7 A;  1S72 I;  2QQB A;  2DFI A;  3ROU A;  1A36 A;  3BWG A;  3J7Y J;  1TBX A;  1QHH D;  2VN2 A;  3DEU A;  4JYK A;  1ERD A;  5HS8 A;  1WI9 A;  1AKH B;  1ZLJ A;  3RKW A;  1YE9 A;  1GT0 C;  5E3N A;  1VQ8 I;  1F9N A;  1K78 A;  2V79 A;  2QSF X;  4G6T B;  3Q9S A;  3JRD A;  1TWC J;  4ZYH A;  3J81 Z;  2OQR A;  4NQW B;  4KIT B;  1HDD C;  4YFK F;  1IRF A;  3PQK A;  3HOV J;  3VSK A;  3K69 A;  3W2V A;  5M5X J;  4NHJ A;  2VXZ A;  3OMY A;  5C4X J;  4CYC B;  3G2B A;  2L54 A;  2Q8K A;  2M5W A;  4PUS A;  4S04 A;  1TWF J;  1CGP A;  1MND A;  2CYY A;  4L5E A;  1BW6 A;  3CZ6 A;  3ONQ A;  3SEZ A;  1A04 A;  3CJN A;  2LK2 A;  1XCV A;  3R0J A;  3ABK H;  4RB3 C;  2DMN A;  4LLG F;  1AKH A;  1MJA A;  4XKB A;  4EVI A;  4WF2 A;  1YJN I;  4RAY A;  1DUX C;  4GGG A;  3J80 K;  3IH3 A;  4ZDL A;  2K4B A;  4KIC A;  2A5W A;  2OA4 A;  3R4K A;  2LBF B;  3G6E I;  1LNW A;  1W5C C;  1KU7 A;  1I1G A;  4MO7 A;  4QTR A;  3MWM A;  3VYT B;  2BHZ A;  2WAQ A;  3FXU A;  3LA2 A;  5ILV A;  3G1O A;  4IVN A;  1BBY A;  1F4K A;  2L9N A;  2DFH A;  4P5O A;  4BAY A;  3EPZ A;  4LG3 A;  2KDO A;  2R7D A;  3RPU D;  1ZRC A;  3F22 A;  5CLS A;  4IL6 C;  1YJW I;  3GEZ A;  3CLO A;  1ZLK A;  2NNY A;  1Y39 A;  1XMA A;  2MYS A;  3S3O A;  2ZME C;  4MTD A;  1WZ2 A;  3BJA A;  2E7W A;  4LG0 B;  3SXY A;  3CTA A;  3HOT A;  4U7B A;  1ETX A;  2KRC A;  1YG2 A;  5LRR A;  4GO1 A;  1HQC A;  3K9T A;  1XGN A;  1XSV A;  4PJ0 C;  4PJL A;  3A4C A;  4UVB A;  1JGG A;  2XRO A;  1SD6 A;  4KFC A;  1OPC A;  2E1N A;  1IAW A;  3A01 B;  1YRN B;  2DBB A;  3OYC A;  3NAU A;  1ZTR A;  4X6A J;  1J2X A;  4UVC A;  1FEX A;  2DOA A;  4AU7 A;  2R7O A;  4PJN A;  5CJ9 A;  4B8X A;  5KVR A;  1S29 A;  5BMZ A;  3DXJ F;  2CG4 A;  1JKQ C;  1YX3 A;  3DPU A;  2DMP A;  3VSL A;  4A0Y A;  3IWF A;  4DQ2 A;  3QYB A;  3ZQL A;  1OJL A;  2IGN A;  2NAZ A;  4JBA A;  3I4P A;  2R7R A;  5HOD A;  4HDU A;  2VJI A;  2F5E A;  1OR7 C;  1KZH A;  3WG7 H;  2R0Q C;  2XUB A;  1ETW A;  2HGC A;  2R5Y B;  5HLT A;  2A61 A;  3OR1 C;  4XLF A;  5ICG A;  3A01 A;  1LDK B;  4CXF A;  3H0D A;  2L9R A;  4XR6 A;  3JSO A;  2IPQ X;  1D0X A;  2IS4 A;  2A6T A;  2CQQ A;  2Z3Y A;  5DEQ A;  3RZD J;  1M1E B;  4ZDO A;  1TW2 A;  2JK3 A;  5F0H A;  4D1Q A;  4NC8 A;  1MMN A;  2V6E A;  4MEX F;  1R1V A;  4C2T A;  2YR2 A;  3H3Z A;  3HBL A;  1VQ9 I;  3M9A A;  4WX9 A;  2X6Y A;  4BQO A;  2CUE A;  1WH5 A;  3ZMZ A;  1XMX A;  2DT6 A;  2VQC A;  2DAO A;  3WTS C;  1GHC A;  2ZXH A;  3ESW B;  1G3W A;  3TW7 A;  4HA8 A;  2JQ7 A;  2V26 A;  3OYL A;  2FXA A;  4EJV A;  3U2R A;  4H0E A;  3LQQ A;  4UV9 A;  2LY2 A;  1IRZ A;  1ZYR F;  4NC7 A;  2W84 A;  2VBX A;  1O57 A;  4YII A;  2QA4 I;  1KU2 A;  4QWQ A;  2JA6 J;  1FYK A;  1HBX G;  3EDP A;  4CUG A;  2QLZ A;  3G1L A;  2EV0 A;  3I4M J;  4C2U A;  3CJR B;  4BJ5 C;  2PFB A;  5KHD A;  2MC4 A;  1VQP I;  3CMM A;  4RAZ A;  4RGR A;  3FWE A;  1KQ9 A;  1IV8 A;  2L2O A;  3KZZ A;  4DYC A;  1X2N A;  3WU1 B;  4BDZ A;  4IOC F;  3KEY A;  1I50 J;  3GTL J;  3KYD B;  1ITY A;  2BY2 A;  5CQE A;  3CCL I;  4XSZ F;  4DZJ A;  4NBQ A;  4EGZ A;  5LRS A;  1VQL I;  4P9F A;  1W5T A;  2JZY A;  3WTV C;  2VUM J;  2EV6 A;  4JX4 A;  2Y9Z A;  1VQ5 I;  5CYV A;  1R58 A;  1B72 B;  5GAE J;  4V2G A;  4D7N A;  2Y48 A;  2DA3 A;  3SFI A;  1HKS A;  4EJO A;  4YEL A;  1OYI A;  2WB1 N;  2NOJ B;  4XLC A;  3WTZ A;  2CV0 A;  1DPU A;  4PCQ A;  4ENJ A;  1X1B A;  3I56 I;  2ZME B;  2ZKZ A;  3ZQQ A;  3QWL A;  1WJB A;  4PFO A;  2PMH A;  4QPQ A;  1I5Z A;  3CES A;  3QU6 A;  2R3S A;  2FNA A;  2BHY A;  1T08 B;  2R7W A;  4Y7N J;  2WAF A;  4I98 B;  2G0E A;  1TT0 A;  4PFP A;  4M3E A;  3CDH A;  2XIG A;  3T8T A;  1NK2 P;  3DQV C;  2CUJ A;  2I10 A;  2PMU A;  1DP3 A;  1LFB A;  4LMY A;  4E7Z A;  4HNV A;  5BPD A;  2B9S A;  2PJR A;  2BBY A;  2VIX A;  3PM1 A;  1J59 A;  3TO7 A;  1FT9 A;  3G4S I;  3H9Q A;  5FKO A;  3O3K A;  5J8C A;  3P7N A;  1U8R A;  1GVJ A;  4RMN A;  2HVR A;  1UG2 A;  3BR1 A;  4EQQ A;  1XDU A;  4G6D A;  5L3G A;  3LAJ A;  1W0T A;  4JOM A;  2KP6 A;  1MH3 A;  3L7W A;  5EZH A;  2RDP A;  2ZME A;  1R5G A;  1DDN A;  4KN4 X;  1LB2 A;  2OTL I;  4IHW A;  4Q5S F;  2JPC A;  4HAM A;  3VOE A;  4U0W A;  3W6K B;  1KQ0 A;  3K10 A;  3HOY J;  2ZC2 A;  4BYY A;  3E6M A;  3ABU A;  3HUG A;  3LL7 A;  1TZL A;  2KRF A;  2XPU A;  4EJU A;  1SVO A;  2OZU A;  1PP8 F;  5DYM A;  4CH7 A;  3ERE D;  4NUB A;  1O3R A;  3K4K A;  3WTT C;  1YS7 A;  2E1M C;  3M8J A;  3VYR B;  1V5E A;  4E7L A;  1R9T J;  1DQU A;  1W36 D;  1JJ6 C;  4C2M J;  2WB1 A;  2ACJ A;  2R7Z J;  3W2W A;  2CFO A;  1IGN A;  3F6V A;  4E7H A;  1WJD A;  4I76 A;  1Z1D A;  4UY8 I;  4XRS A;  3DPT A;  3AG2 H;  3GF2 A;  1J0R A;  4BAC A;  4M74 A;  4C3J J;  1MH4 A;  2ID6 A;  1UEL B;  1ETK A;  4B44 A;  1JHH A;  1DU6 A;  1Y6I A;  3CUO A;  2RQQ A;  1SFK A;  2M7A A;  2V1N A;  1JE8 A;  2XC7 A;  5DTD A;  3CP8 A;  2K3F A;  1VQ7 I;  2H1L A;  4M9Z A;  9ANT A;  1RUO A;  2HXO A;  1YX5 A;  2JVH A;  2OAZ A;  1QHG A;  3BJ6 A;  2DFF A;  1IXS B;  3F0C A;  3A2K A;  5E3M A;  5H6R A;  5J1Y A;  5BOX A;  5FB2 A;  3CUQ C;  2AO9 A;  2CH0 A;  4KJZ A;  2BGC A;  2ZB9 A;  3DCF A;  2DJI A;  3J81 K;  3KYC B;  2FD5 A;  4P9U A;  3HZJ A;  1Y0N A;  2LY9 A;  3CUQ B;  3HM5 A;  3WU0 A;  3DBL B;  3ZRG A;  1WH7 A;  3S2W A;  1P7I A;  4EM2 A;  4U87 A;  3TL4 X;  4LLN A;  4BBS J;  2GIZ A;  4XKV A;  2YX4 A;  1GUU A;  1A31 A;  3LOC A;  2K85 A;  4G8X A;  3S1M J;  1FOK A;  3K7A J;  2WAD A;  3T5X A;  2CFX A;  2HFH A;  5H20 A;  1S8N A;  1BI2 A;  1ZRE A;  2NVU B;  1QRY A;  4F52 A;  3M3Y J;  1MNE A;  1MKM A;  2YPR A;  1OLT A;  3MFK A;  1S3J A;  3ISP A;  1W36 C;  4R8H A;  3UNG C;  2JUG A;  4CYC A;  3CDI A;  2TDX A;  3OIO A;  3I3L A;  3ML6 A;  1MZB A;  1TNS A;  1SC7 A;  2KIF A;  1JHF A;  1R36 A;  2VBY A;  5B1B H;  3SZG A;  2Y9Y A;  1XB4 A;  2DDA A;  2M9H A;  4L5J A;  4BL0 B;  3CME I;  3OYJ A;  2W25 A;  3WTW C;  1KGS A;  1KQ8 A;  3P9K A;  1HXD A;  2X1D A;  4RLF A;  2DT5 A;  4OAZ A;  2DPU A;  1X19 A;  5JLW A;  3I9V 2;  1GDT A;  3EUH A;  2UV1 A;  4CCJ A;  5EGO B;  3JCU C;  3IC7 A;  2J5P A;  4N4O B;  2JUC A;  5E8I A;  2XAH A;  4EJW A;  5F27 A;  4FIS A;  2QUF A;  1T38 A;  4PSX A;  1K4T A;  3GTG J;  1V3F A;  3H0G J;  3ZOB A;  1K78 B;  1XDS A;  2K3P A;  3ABM H;  4UUS B;  2PG4 A;  1KA8 A;  1UST A;  3H9G A;  2L02 A;  1OCT C;  2W4S A;  3W2A A;  4Y3O A;  1HKQ A;  3PO2 J;  3EUH C;  2CS3 A;  2E71 A;  3F3X A;  3GW2 A;  5ED4 A;  3DU5 A;  1U6G A;  5D6F A;  1T0F C;  5H2F C;  3JTH A;  1X4P A;  1VQM I;  3JW4 A;  1OIS A;  5ICF A;  5DCM A;  1P9Q C;  5GAD J;  4ENN A;  4PGH A;  3I4N J;  3AKZ A;  2M4G A;  3OS0 A;  2E35 A;  3CCS I;  1ETQ A;  2RVC A;  2WY7 Q;  1ZEL A;  3MKL A;  4KDP A;  1XMK A;  3M7G A;  1KU3 A;  5J4V A;  4MFE A;  2BW3 A;  2ELJ A;  2HYG D;  4A3B J;  1O7L A;  1VF9 A;  1B59 A;  3HRS A;  2M8E A;  2NS7 A;  2H8R A;  2LF8 A;  1LFU P;  2W1O A;  3ERM A;  3SDG A;  1YW7 A;  4MGR A;  3K6G A;  1IRG A;  3ZR8 X;  3KP2 A;  5CVR A;  2DYR H;  1PYV A;  2CW0 F;  1J75 A;  4ZH4 F;  3BCA A;  1FP2 A;  1J09 A;  1J9I A;  2FU4 A;  2Q0O A;  1MIJ A;  4DBQ A;  1NG6 A;  1OMI A;  4Y17 A;  4BHC A;  2XAU A;  2GXA A;  3SZT A;  1FTT A;  5IPA A;  3IP4 B;  4OAY A;  3BPX A;  2HKX A;  2P8T A;  4IQ4 A;  1VTN C;  4P96 A;  4ESF A;  1EJ9 A;  2K9Q A;  3LSG A;  4UNO A;  3ZXS A;  3AG1 H;  1FWZ A;  1RKW A;  3QP5 A;  5JFR A;  1UHM A;  1UB9 A;  5CVI A;  2DJN A;  2EFP A;  4XIC A;  4ENM A;  5DM7 F;  1LDJ A;  4AYB N;  1R1T A;  2QEN A;  4OMZ A;  4AM3 A;  5F1J A;  2DA5 A;  1RZ4 A;  1EA3 A;  4XOP A;  5CVV A;  1JUP A;  4UUV A;  2AS5 F;  1FIP A;  1FJL A;  2H6B A;  3GFJ A;  4Q4Z F;  2V1X A;  4V19 K;  3DKX A;  4BE2 A;  1ZR2 A;  5AIP A;  2CUF A;  2VQL A;  1FSE A;  4E4H A;  4D5C A;  3TO9 A;  4XNF A;  3Q9V A;  1CQT A;  5TIS C;  4Q48 A;  1XGS A;  3DP7 A;  5B66 C;  2LFB A;  3H35 A;  1OR7 A;  1G3S A;  2FRH A;  2HYF A;  3M8F A;  2HQR A;  4RLQ A;  3V7R A;  3TED A;  2VKV A;  5K7Z A;  1LPQ A;  1UG0 A;  3VB2 A;  3WGG A;  2ECC A;  4F55 A;  1BJA A;  2K9L A;  1D1B A;  3P5J A;  3G73 A;  2HWV A;  3EYY A;  5A2Q Z;  4XBF A;  2HOE A;  2FJ1 A;  4XOT A;  2CRG A;  4BHB A;  2NRA C;  1WI3 A;  2WV1 A;  2BE5 F;  2HVS A;  4KNY A;  4QPO A;  3S3N A;  1OYY A;  2IGK A;  1SVL A;  3ZMU A;  2HPI A;  2EQR A;  1D1A A;  3BTJ A;  2Z33 A;  1PVE A;  4CCN A;  5K5Q A;  3BG3 A;  4GXO A;  4II3 A;  5DD4 A;  3OR2 C;  2QSH X;  1T56 A;  2HOT A;  3G71 I;  4ZJZ A;  3L2V A;  3U1K A;  3OYN A;  4Y13 A;  2BY0 A;  2L7M P;  1ZK8 A;  3K4M A;  2DFE A;  3OYB A;  4Z2Y A;  4A2U A;  3MKW B;  2XGD A;  4BNC A;  1YRN A;  4L5I A;  4IX7 A;  1MGT A;  3CCY A;  2BXZ A;  4BUP A;  2ISZ A;  2OTJ I;  3ASN H;  4D5F A;  3CD6 I;  5F6F A;  2HTJ A;  5LHI A;  2P7C B;  1JXS A;  1K6O A;  2PJR B;  1MJB A;  4PDK A;  4BE0 A;  4F92 B;  2MSY A;  1ZGJ A;  3LA3 A;  3K1M A;  1G4D A;  4ZYA A;  1V55 H;  3KP5 A;  5AIQ A;  1SAX A;  1JUS A;  3SEQ A;  3RYR A;  2ZXI A;  2V1D A;  3CP2 A;  2E5N A;  4L18 B;  2B63 J;  3GZ6 A;  3P9C A;  5GAG J;  3SHF A;  3IL2 A;  4KA4 A;  1TLH B;  3K2Z A;  1POG A;  4M3B A;  5D8K B;  4YFX F;  5F1R A;  3D5R C;  1I3A A;  1P7J A;  1JTX A;  2MFZ A;  3KP7 A;  1BJZ A;  3GTP J;  4KIB A;  1BOA A;  3OIP A;  3DFG A;  3DU6 A;  3MMY B;  4KT5 C;  3ZQI A;  4WCG A;  4A0Z A;  3BPV A;  1UAA A;  3GX4 X;  4HLX A;  3BQZ A;  1D0Z A;  1HKT A;  2CJJ A;  3FXJ A;  2XGC A;  1ZN2 A;  3VYS B;  3FX3 A;  1AA7 A;  2ICW G;  2QEX I;  2RKH A;  2KFD A;  4RGU A;  1MSE C;  2R7S A;  3VOD A;  3WE3 A;  3HPH A;  3VYU B;  1BI1 A;  3MZY A;  1D1C A;  2EWN A;  3I0T A;  1R4M B;  3QPT A;  3F6O A;  3BTI A;  5M3F J;  4FAS D;  1FSH A;  3I54 A;  3OL3 A;  5LGU A;  2W48 A;  2BY3 A;  1UHW A;  5EG0 A;  2P81 A;  3PNT A;  1MMG A;  4XLP F;  3CCQ I;  3NRV A;  1H8A C;  2GXG A;  3BDD A;  2MLK A;  3L00 A;  3DKW A;  1LDD A;  3E6C C;  2JWT A;  1QZZ A;  1K4S A;  2R7T A;  2BOL A;  2NS0 A;  3PUB A;  3C3W A;  2CUZ A;  3E97 A;  2E19 A;  1Z21 A;  4MQ9 F;  3K1N A;  2D1H A;  4HX8 A;  1TWH J;  1Z05 A;  4N0B A;  1JKR C;  3M07 A;  4BKX A;  4NB5 A;  3HL2 A;  3CJT B;  4KIG A;  3GLL A;  3R60 A;  5JVG F;  2QF7 A;  1FP1 D;  3OYM A;  4OMY A;  5EG0 B;  3VWB A;  1JGS A;  2MG4 A;  3WTY C;  2RQP A;  5KAF C;  3CC4 I;  5E20 A;  1KYZ A;  3BR6 A;  3QAH A;  3QOE A;  2QBY B;  3WU2 C;  3LMM A;  3X2Q H;  4KMU X;  4IF4 A;  2HS5 A;  2V7F A;  3ASO H;  2LNB A;  4MFD A;  4OU0 A;  5L3E A;  2WA0 A;  4XKC A;  5JHF A;  5IYC J;  2CWE A;  2DOE A;  4FT8 A;  4B3X A;  2ZJP F;  3OY9 A;  4HF2 A;  2A3S A;  3ZQC A;  1IUF A;  2FOK A;  4FX4 A;  3EQL F;  1A35 A;  5HNH A;  4WXH A;  5DDG A;  1IXC A;  4DNC A;  4A5M A;  5CQG A;  1NK3 P;  2JRM A;  3JAM Z;  3VEP A;  4CCL A;  1WJE A;  1FBQ A;  4XLH A;  4A3F J;  3F72 A;  4JK1 X;  4BHP A;  4P1W A;  3H5A A;  1ORK A;  4FCY A;  4NC6 A;  1FPQ A;  2HU9 A;  3D1N I;  2HTS A;  2QQ8 A;  2E1M B;  2O7O A;  3ZCO A;  4DIQ A;  3N4M A;  3FKJ A;  4I6Z A;  2E2I J;  2VQH A;  5HNF A;  2K4J A;  4BXX J;  3BQY A;  1S9H A;  2X6W A;  2DT7 B;  3A0B C;  3DTI A;  4NNJ A;  2K40 A;  5EEG A;  2HZD A;  3TO6 A;  3OSG A;  2Y0S N;  2FX0 A;  2HPM A;  4BH9 A;  2FBH A;  3FXK A;  2O3F A;  4J00 A;  2LOO A;  2O61 A;  3SDB A;  2F6C A;  2O03 A;  2PBI A;  4HBL A;  4EV0 A;  4E7I A;  4L0Y B;  3S2D J;  3IRR A;  1B9N A;  5FLM J;  3OL4 A;  1FBU A;  4L9J A;  1ZRF A;  1IN7 A;  1P4A A;  2CW8 A;  1B8I B;  1YOV B;  5FLV A;  4RA2 A;  2IJL A;  3CLQ A;  4B09 A;  4WXC A;  1ZGW A;  1N77 A;  1FYL A;  3V4G A;  1I27 A;  1YYV A;  2LKP A;  3HEF A;  2XVC A;  2DCE A;  3G3Z A;  1L3L A;  4PSW A;  1R49 A;  2Y0M A;  1Y8R B;  1GXP A;  2LSO A;  4LIU A;  1LE8 A;  2VBW A;  5LFA A;  3GZ5 A;  4HRI A;  2KMU A;  4GDF A;  2YUS A;  1D3Y A;  1QVU A;  1Y1V J;  5D4R A;  4HST A;  1Z0X A;  3FBN B;  4HX7 A;  4TV7 A;  5DD8 A;  3HOX J;  3TP3 A;  5DCM B;  2IS2 A;  3RKQ A;  4HV5 A;  4CCO A;  4XRM A;  1DGW Y;  3C2H A;  4RBO A;  3HTS B;  2CMP A;  4GRI A;  2L4A A;  1IXR C;  4EM1 A;  1SD5 A;  2F48 A;  3O6B B;  3GTM J;  2O9L A;  3MKZ A;  3WTU C;  1V5F A;  1Z91 A;  3BG5 A;  3FHZ A;  4DOZ A;  3KEQ A;  3PIP F;  1XSX A;  2WWY A;  3L2R A;  4RAF A;  1ODD A;  4HPQ A;  1LE8 B;  3H3V K;  1R71 A;  2W24 A;  1TL8 A;  4ZC3 A;  2O8X A;  4HF1 A;  4EJT A;  1LFP A;  4A6D A;  1X1C A;  3FXM A;  2VOO A;  2VPR A;  2VLA A;  2K9S A;  4CZZ A;  3KZI C;  1OYW A;  1JUM A;  1V4R A;  1RUN A;  1ZHF A;  4M3D A;  3QPS A;  5EEA A;  2OCE A;  1QGP A;  2QGU A;  2X6O A;  3JSP A;  3A0H C;  3HB9 A;  4EM0 B;  1O3T A;  5KK1 A;  2P5K A;  2LBF A;  2JVG A;  3GLX A;  5E1W A;  5D5V B;  5FRN A;  2O5R A;  2V9K A;  2EK5 A;  3HRU A;  3CJQ B;  5TRD A;  2R5Y A;  1NTC A;  2H1K A;  3BC8 A;  1OCZ H;  3FXL A;  4E7K A;  3F8N A;  3ZQG A;  1BC8 C;  1ETO A;  1ETV A;  4CO8 A;  5IP7 J;  4BGD A;  2FEZ A;  5HDG A;  3OYE A;  1YW8 A;  2X85 A;  3WOD F;  5C4J J;  3CO6 C;  2X1C A;  5J1U A;  3GO5 A;  3O8G A;  2BYV E;  4L9T A;  5D4S A;  5FRO A;  4G7Z F;  1IC8 A;  3M1E A;  2HNH A;  1DGR M;  1P92 A;  2R7F A;  3HSF A;  2XRL A;  3DTE A;  2RNJ A;  5M3M J;  3RIR A;  2RRE A;  2TCT A;  2OV7 A;  4M72 A;  1ZG5 A;  4ITV A;  3GZN B;  1T2K A;  3CO7 C;  3AAF A;  2P0W A;  1F5T A;  3G1M A;  2HVQ A;  4AYB A;  4BXU A;  2LR8 A;  1ONV A;  2F5D A;  3PL8 A;  4EMS A;  1ZH5 A;  2IBD A;  2ME6 A;  1TWA J;  5IY5 H;  2Z9O A;  4UUS A;  3M1C A;  5J8F A;  1IN5 A;  1LKX A;  3FMQ A;  4M3F A;  1SEU A;  1OCC H;  1BR1 A;  4CYD A;  2XPV A;  4P55 A;  3C18 A;  4ON0 A;  5LEJ A;  2PN6 A;  1XS9 A;  5J6X A;  5B3S H;  2Y2Z A;  1UFM A;  2EIL H;  4I0A A;  1YLF A;  1RRJ A;  3WG9 A;  1N75 A;  4XOR A;  5IYB J;  4KUM A;  5LEK A;  2JMW A;  1G6N A;  1IUY A;  2E1O A;  3T0Y A;  3JRB A;  2IP2 A;  2BEO A;  1QZE A;  5HOO A;  4U88 A;  2DTR A;  2VJJ A;  4O5V A;  3CCJ I;  2HDD A;  3DV8 A;  4E6K G;  3K4N A;  1FMV A;  5D5U B;  1USS A;  1VQ4 I;  2PI0 A;  2RV8 A;  2F4O B;  4IQJ A;  2Z99 A;  1TNT A;  1X1A A;  4XLE A;  4BJ6 C;  1RES A;  5KAI C;  3HHG A;  3EYI A;  4BQN A;  3B6C A;  2OC6 A;  4AIH A;  1D5Y A;  1FC3 A;  1N78 A;  1STZ A;  1YIT I;  4L9V A;  4WK8 F;  4HQM A;  1A5J A;  3KX2 A;  4AVP A;  4JX5 A;  3ZQF A;  1E3O C;  2BXY A;  1FNN A;  3A02 A;  3W6J B;  2XKO A;  4IOA F;  3KIO A;  4BQQ A;  3H9J A;  3H5N A;  3JRG A;  2JT1 A;  3WGH A;  4ZTF A;  3FIW A;  3BZC A;  3PUF A;  4M71 A;  2FA5 A;  2LLK A;  3FDY A;  4FQG A;  1R4N B;  1VFC A;  4K2E A;  3KP4 A;  3BR3 A;  1T95 A;  3S32 A;  5F0C A;  1YIJ I;  1KYW A;  1IZ1 A;  1U8B A;  1ZAO A;  1K6Y A;  2ZXJ A;  1AU7 A;  1G2H A;  1JTY A;  3TOB A;  1SMT A;  2W85 A;  2OUM A;  1JT0 A;  4GYG A;  5FO5 A;  3IRQ A;  3FZV A;  3F8M A;  2L7F P;  4ZZL A;  3IV5 A;  1TC3 C;  2LH9 A;  2QKL B;  2K86 A;  3AFH A;  4CCM A;  1YW9 A;  2IAI A;  1U9O A;  2Z1D A;  3E7L A;  3REO A;  2HQA A;  3TKY A;  1X58 A;  2KKO A;  3C2B A;  3LSJ A;  4LFU A;  5GTI C;  2XAG A;  2UXN A;  3TW6 A;  2CQK A;  4C3I J;  4HG2 A;  1QU3 A;  2LD5 A;  1EH6 A;  2GAU A;  4ZYG A;  2I8D A;  3JRH A;  2VC0 A;  2IS6 A;  3PFY A;  1OFC X;  1SVM A;  5DM6 F;  1FIA A;  5DV5 A;  2WAQ N;  2VC1 A;  1FOY A;  2GLO A;  2GIV A;  1BW5 A;  3WTX C;  1MBJ A;  2FF4 A;  4MEY F;  4RGX A;  1E3P A;  1ZR4 A;  3E6D A;  2M7B A;  4BEH B;  3LSH A;  2X48 A;  3RCO A;  3OYI A;  1JJ8 C;  1LUJ B;  2ME0 A;  3BR2 A;  1U78 A;  1PUF B;  3GME A;  1PP7 U;  2GBY A;  1IO2 A;  2COM A;  4WXD A;  3BP8 A;  3JRE A;  3S2H J;  1SMY F;  4U0V A;  2WY8 Q;  3C7J A;  1Y1W J;  1VQK I;  2Q1Z B;  2M2E A;  5FFX A;  3RI4 A;  2HR3 A;  1ON2 A;  2CO5 A;  1W7P A;  3KCC A;  4ANJ A;  3PNV A;  2PMZ A;  2FML A;  5HDK A;  3W3C A;  5K1Y A;  2O0Y A;  2NYX A;  4G9Y A;  1J5Y A;  3GVA A;  1HW5 A;  3H36 A;  4D7M A;  3TGN A;  5IT3 A;  3JAM K;  4OIN F;  2FOW A;  1AWC A;  2R93 J;  3FK7 A;  3HUG B;  2R5Z A;  5FGM A;  2ZJ2 A;  4XN0 A;  1GV2 A;  2Z5U A;  1OQY A;  4HV6 A;  2P6S A;  2DXI A;  1T39 A;  2KL4 A;  3L1P A;  3IKT A;  2AHQ A;  1A6Q A;  4KIF A;  1AOY A;  5D6E A;  3RPQ A;  1PUF A;  4LD5 A;  1QNT A;  2MW8 A;  4D9J A;  1DP7 P;  1FTZ A;  1Q1V A;  5LD2 C;  2ISY A;  5TGT A;  4MLO A;  2IRF G;  4IHT A;  1D8J A;  3BJO A;  2XRN A;  3S93 A;  3UKG A;  1BM9 A;  3Q0U A;  3OYH A;  1LVA A;  5FLX Z;  3L2Q A;  3PO3 J;  4HNU A;  1WCM J;  1Y56 A;  1H9G A;  2AXT C;  2DPD A;  2W57 A;  2VT2 A;  1R6R A;  4CIC A;  3QP6 A;  3FK6 A;  3GTK J;  1PDN C;  2X1E A;  3QQA A;  3W6V A;  3OS2 A;  1CF7 B;  2OCC H;  3RYP A;  4ABZ A;  3A03 A;  1RET A;  2OZ6 A;  3QPH A;  4S05 A;  3GFI A;  3Q5F A;  1Z7U A;  3BR5 A;  4M6X A;  2HQ5 A;  3LSP A;  2E7X A;  2LYC A;  4R1H A;  5GTH C;  2EZL A;  4XSX F;  4L0Z B;  3OYD A;  3DPL C;  4FE7 A;  3SFZ A;  3K70 D;  2KDZ A;  2LVS A;  2V6C A;  5DS9 A;  1JKO C;  3HSR A;  2PLY A;  3ECH A;  4U0Y A;  5EJC A;  1H9T A;  1QQI A;  3E5X A;  2F5F A;  2ID3 A;  2X6X A;  2EFQ A;  2KT0 A;  1CF7 A;  4HSR A;  3LFK A;  2K7L A;  1MDM A;  2XB0 X;  3DKY A;  2YS9 A;  5F0F A;  1F43 A;  4YIR X;  1REP C;  4FHT A;  5J1R A;  5FJ8 J;  5EF6 A;  3HGY A;  2V4J C;  1S5L C;  3L09 A;  4B43 A;  2RC4 A;  3K4C A;  2EPF A;  3CCM I;  3H92 A;  2PQ8 A;  4UHT A;  2DOD A;  2GOX B;  2KZG A;  2KJB A;  2ESN A;  1BN5 A;  1D0Y A;  1XN7 A;  1ETY A;  2OF7 A;  1WJA A;  2EB7 A;  1IJW C;  1B8I A;  2X0L A;  4HX4 A;  1I6X A;  3EET A;  1VQO I;  4XON A;  4LK1 F;  2QM3 A;  2EH3 A;  2FBI A;  4H4K C;  4NQW A;  3RPU A;  2B7E A;  2NVT J;  2L3D A;  4Z6Y A;  2P5L C;  2JA8 J;  5DCF A;  3ZMD A;  2STW A;  4OOI A;  2A69 F;  2OJE D;  5JHU A;  1Z9C A;  1WHU A;  1FZP B;  4M6Y A;  4I7H A;  1TWG J;  2R4G A;  1XCB A;  3QYF A;  2BVL A;  3ZN0 A;  1OKR A;  2OD5 A;  1FY7 A;  4YFN F;  5IYD J;  4E70 A;  1E0E A;  2W82 A;  3D0S A;  5JVT A;  3B6A A;  3FF5 A;  3MEX A;  3K4J A;  3H1C A;  4Y33 A;  5LBQ A;  5K5O A;  1I6H J;  2KPM A;  5HLH A;  4B4C A;  1K7A A;  2DK8 A;  3MAJ A;  4A12 A;  1QBJ A;  4BDY A;  1O3S A;  4Y15 A;  3S15 J;  3RZO J;  4UUT A;  3FBI B;  3Q0W A;  2QQ9 A;  2RNG A;  1SAU A;  3U9G A; 
#chains in the Genus database with same CATH homology
 1DP3 A;  2AQE A;  4E7Z A;  4CA0 A;  1Z3Y A;  2PJR A;  2VQH A;  5HNF A;  2VIX A;  2ZFU A;  1S9H A;  4JQF A;  2X6W A;  2DT7 B;  3DTI A;  4NNJ A;  2HZD A;  3OIQ A;  3H9Q A;  2VPL A;  3D5S C;  2HPM A;  4B47 A;  2LRD A;  4RMN A;  2HVR A;  4J00 A;  2LOO A;  2KZV A;  2VQG A;  4JOM A;  2KP6 A;  2FUG 2;  3W2A A;  3SDB A;  1IRX A;  2F6C A;  4HEA 2;  4XQF A;  4E7I A;  4XN3 A;  4CSW A;  3OL4 A;  3HOS A;  4F3Q A;  3EUA A;  3K10 A;  4BXF A;  1WJF A;  4OWR B;  2CW8 A;  5CKT A;  3LL7 A;  1TZL A;  1N77 A;  2F5V A;  1Z3X A;  4DBR A;  4B48 A;  4CH7 A;  2DCE A;  4NUB A;  3K4K A;  4PSW A;  2E1M C;  3M8J A;  4LIU A;  3VYR B;  5LFA A;  1V5E A;  4Y4R A;  2KMU A;  4J01 A;  4E7L A;  4HRI A;  1DQU A;  4AVZ A;  1W36 D;  3SYT A;  3KYL A;  2WB1 A;  4HST A;  3BCB A;  2E5Z A;  2KLO A;  3FBN B;  3W2W A;  2CFO A;  4C30 A;  3AL0 C;  4E7H A;  4RM2 A;  1WJD A;  2IS2 A;  4CCO A;  1DGW Y;  3DPT A;  3C2H A;  3E0J B;  4BAC A;  2CMP A;  1PJR A;  4GRI A;  2R7X A;  1JI8 A;  1UEL B;  4CCK A;  2M4K A;  4B44 A;  1Y6I A;  2XSJ C;  3L2U A;  2RQQ A;  1SFK A;  1G8X A;  2M0M A;  3MKZ A;  2M7A A;  2V1N A;  3NWT A;  1V5F A;  2XC7 A;  2M3A A;  3CP8 A;  5CPR B;  4XMY A;  4DOZ A;  2XDV A;  3L2R A;  4HPQ A;  2WAE A;  1YX5 A;  2JVH A;  3U21 A;  1QHG A;  4ZC3 A;  3A2K A;  1LFP A;  4EAT A;  1X1C A;  3UR3 C;  2CH0 A;  3PNY A;  2VLA A;  4KJZ A;  2DJI A;  2KHM A;  3BG7 A;  2ZSI B;  4XM3 A;  3ZRG A;  2JSP A;  4YRV A;  4U87 A;  3TL4 X;  3OYF A;  2E60 A;  4RM3 A;  4XKV A;  4DJA A;  3QOD A;  2XF5 A;  1WJ5 A;  2LBF A;  2JVG A;  4KT6 A;  4FET A;  4E7S A;  2WAD A;  5FRN A;  2O5R A;  2V9K A;  2LC2 A;  3CJQ B;  3BC8 A;  4E7K A;  3K4B A;  4XL9 A;  4F52 A;  4F91 B;  3E1S A;  1MNE A;  4BGD A;  1OLT A;  2F4I A;  2VKH A;  2QKM B;  3OYE A;  2R7U A;  2X85 A;  1W36 C;  3UNG C;  2JUG A;  2X1C A;  1FMW A;  2VJ4 A;  3I3L A;  3OYK A;  2CW7 A;  3AL0 B;  3L2W A;  3TBI A;  5FRO A;  5HVQ C;  2GOM A;  4ZTJ A;  3TMO A;  2HNH A;  1DGR M;  2R7V A;  4E7J A;  3DTE A;  3SZG A;  1VZ0 A;  2RRE A;  2OV7 A;  3PSI A;  4BS9 A;  4ITV A;  4BL0 B;  4R79 A;  3IUO A;  3OYJ A;  2P0W A;  2W7N A;  4DGW B;  2HVQ A;  1X1D A;  2X1D A;  4RLF A;  4AYB A;  4YEJ A;  4OAZ A;  4F93 B;  1X19 A;  3PL8 A;  3I9V 2;  4BEH A;  3H5R A;  2UV1 A;  4CCJ A;  4XKW A;  4HNT A;  3IAM 2;  3M1C A;  2VKD A;  4N4O B;  3ZGK A;  1LKX A;  4PSX A;  1BR1 A;  2K3P A;  4LIV A;  3H9G A;  2XF7 A;  3MD2 A;  2W4S A;  4BJT A;  2JA2 A;  4Y3O A;  3EUH C;  2MAB A;  2CS3 A;  5FRM A;  3BLY A;  2K5C A;  2MD0 A;  3DU5 A;  1NG7 A;  2W00 A;  3PSF A;  1T0F C;  1X4P A;  1Z7L A;  1N75 A;  4XOR A;  3A1Y A;  2LRE A;  1HA8 A;  3J7A Y;  2IS1 A;  1P9Q C;  2XF6 A;  3GBG A;  3RSN A;  3AKZ A;  2M4G A;  3OS0 A;  2WY7 Q;  2R7Q A;  1ZEL A;  1GLN A;  2Y0S A;  3HPG A;  3DEE A;  5HOO A;  3S3M A;  2BW3 A;  2ELJ A;  2VJJ A;  3DWL E;  3HKZ A;  4CZC A;  4E6K G;  3K4N A;  1FMV A;  3HG9 A;  2W1O A;  4BU2 A;  4IQJ A;  1X1A A;  4XLE A;  2BW3 B;  4BJ6 C;  3OYG A;  3K6G A;  4BQN A;  4C9Y A;  3ZR8 X;  2OC6 A;  1WFX A;  4BE1 A;  1N78 A;  1PYV A;  3BCA A;  2Z16 A;  3KX2 A;  1J09 A;  4DBQ A;  1LVK A;  1NG6 A;  2VB6 A;  1BR4 A;  3HXL A;  1MW7 A;  2XAU A;  3IP4 B;  3H9J A;  3H5N A;  4OAY A;  4BQQ A;  3IAS 2;  2X51 A;  4ZTF A;  4IQ4 A;  3FDY A;  3LSG A;  1QHH D;  1T95 A;  3S32 A;  3ZXS A;  1ERD A;  4PJJ A;  3DTK A;  1K6Y A;  2UWM A;  3N05 A;  1YE9 A;  4G6T B;  2OUM A;  1EA3 A;  4XOP A;  1BR2 A;  4NQW B;  4KIT B;  4N4N B;  2LH9 A;  2QKL B;  3DKX A;  4CCM A;  3AFH A;  3VSK A;  2AQF A;  4BE2 A;  2Z1D A;  3W2V A;  2HQA A;  2VQL A;  2VXZ A;  3OMY A;  4E4H A;  4XNF A;  3G2B A;  4PUS A;  2ZSH B;  4HG2 A;  1QU3 A;  1MND A;  3CZ6 A;  3H35 A;  2I8D A;  3OOU A;  3ONQ A;  3SEZ A;  3VDX A;  2IS6 A;  3PFY A;  2Q2E B;  1G59 A;  2IGO A;  4RLQ A;  4XKB A;  1WJC A;  1UG0 A;  4F55 A;  4IKF A;  2K9L A;  1D1B A;  4PJM A;  2IXS A;  4ZDL A;  2A5W A;  3BG6 A;  2LBF B;  4XOT A;  4PK4 A;  3OYA A;  2HVS A;  2M7B A;  4BEH B;  3LSH A;  4QPO A;  3VYT B;  3S3N A;  2LG4 A;  3OYI A;  3RCO A;  2WAQ A;  2IGK A;  2L9N A;  2HPI A;  2KRH A;  2CV1 A;  4P5O A;  3EPZ A;  3RQ4 A;  2WY8 Q;  2KDO A;  1D1A A;  4LG3 A;  2CV2 A;  2Q1Z B;  3MKY B;  3RPU D;  4CCN A;  4II3 A;  4ANJ A;  3OR2 C;  3PNV A;  2PMZ A;  4XLA A;  4ZJZ A;  3L2V A;  4ZDP A;  3W3C A;  3OYN A;  3K4M A;  2MYS A;  3OYB A;  2VL8 A;  3OWT A;  3S3O A;  3MKW B;  1X4O A;  3HOT A;  4U7B A;  3HUG B;  4IX7 A;  2KRC A;  4XN0 A;  4BUP A;  2DXI A;  4PJL A;  2KL4 A;  3A4C A;  3OYC A;  3C2G A;  4D9J A;  2DOA A;  2PJR B;  1BOB A;  4AU7 A;  5LD2 C;  4LIT A;  5TGT A;  3DLA A;  4F92 B;  4MLO A;  4BE0 A;  2R7O A;  4PJN A;  3S93 A;  4ZYA A;  3OYH A;  3FHN A;  3CF2 A;  3HC7 A;  4X0G A;  3L2Q A;  3SEQ A;  1YX3 A;  4HNU A;  3DPU A;  1MMA A;  1Y56 A;  2ZXI A;  3VSL A;  3CP2 A;  2E5N A;  2KQR A;  1R6R A;  3QYB A;  2IGN A;  3V42 A;  2X1E A;  2L9S A;  2R7R A;  3OS2 A;  2VJI A;  1OR7 C;  3D5R C;  3S8P A;  2VXD A;  2MFZ A;  5HLT A;  3EUK L;  3OR1 C;  3OIP A;  3DU6 A;  3MMY B;  4XLF A;  1LDK B;  2LYC A;  3H0D A;  1UAA A;  2IGM A;  4XR6 A;  3OYD A;  1D0Z A;  1D0X A;  2IS4 A;  3K4L A;  2A6T A;  3DPL C;  3K70 D;  4ZDO A;  3VYS B;  2R7S A;  1AA7 A;  4D1Q A;  4NC8 A;  1MMN A;  2V6E A;  3HPH A;  2HDW A;  3VYU B;  4C2T A;  1D1C A;  2X6Y A;  4FAS D;  4BQO A;  2X6X A;  2DT6 A;  2VQC A;  5KNL A;  3OL3 A;  4KIS A;  2ZXH A;  4HSR A;  3PNT A;  2V26 A;  3OYL A;  1MMG A;  3DKY A;  2WBM A;  3RTR A;  3QYE A;  2V4J C;  1KON A;  2LY2 A;  4B43 A;  3K4C A;  3LFU A;  4NC7 A;  1V5G A;  1MMD A;  3K70 C;  2R7T A;  2GOX B;  2BOL A;  3PUB A;  3D5L A;  2CUZ A;  3PJR A;  2LY1 A;  3LSM A;  4CUG A;  1Z21 A;  2L5Q A;  2VJ5 A;  1D0Y A;  2K9M A;  1WJA A;  4C2U A;  3HL2 A;  3CJR B;  4BJ5 C;  5KHD A;  2MC4 A;  4XON A;  3CMM A;  3OS1 A;  3LSI A;  2L2O A;  3OYM A;  4BDZ A;  3VWB A;  3KEY A;  3LSK A;  4H4K C;  2Z2S B;  5CQE A;  2L7K A;  3F9K A;  3QOE A;  3LMM A;  2V7F A;  2WA0 A;  2BVM A;  1U0J A;  4XKC A;  5JHF A;  4B3X A;  2VAS A;  3OY9 A;  2R4G A;  3QYF A;  2BVL A;  5HNH A;  4YEL A;  4XLC A;  2NOJ B;  2CV0 A;  2UUZ A;  5KCM A;  1E0E A;  2W82 A;  1X1B A;  3ZQQ A;  1WJB A;  5CQG A;  4PFO A;  3K4J A;  3CES A;  4Y33 A;  4QPQ A;  4CCL A;  2KPM A;  1WJE A;  4IZZ A;  4XLH A;  4II2 A;  2R7W A;  4P1W A;  3H5A A;  2WAF A;  4BDY A;  1TT0 A;  4PFP A;  3NWS A;  2HU9 A;  3FBI B;  2RNG A;  1SAU A;  2E1M B;  3DQV C;  3ZCO A;  4DIQ A;  2CUJ A;  3FKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...