2ELJA

Solution structure of the swirm domain of baker's yeast transcriptional adapter 2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
GSSGSSGNMTISDIQHAPDYALLSNDEQQLCIQLKILPKPYLVLKEVMFRELLKTGGNLSKSACRELLNIDPIKANRIYDFFQSQNWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SWIRM domain of baker's yeast Transcriptional adapter 2
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Transcriptional adapter 2
total genus 19
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.780 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2eljA01
2DCEA 2AQFA 2AQEA 2ELJA 2CUJA
chains in the Genus database with same CATH superfamily
3CJTB 3H5NA 4I2OA 2UZKA 2WA0A 1I3QJ 1T33A 2FBKA 3S1MJ 5HVQC 4I7HA 5F1RA 3FMRA 2IS6A 2CQ7A 3RKYA 3RQIA 2QCOA 1L0OC 2BHYA 3ESWB 3GMEA 3RPQA 5F04A 2BVLA 5J47A 3VYUB 1JKQC 2VBWA 1MJBA 3F6OA 3MKZA 3OYNA 1LJ9A 2KPMA 1XGMA 1YFHA 2W57A 4M9SA 5HDKA 1PVEA 1TTYA 2P7VB 2KT0A 2LFBA 2YR2A 5F27A 4I0AA 4HW0A 3WE3A 2VIXA 4LG3A 4NQWB 2HOTA 1LUJB 1KYZA 1ZRFA 2P6SA 2MH2A 2R7UA 2UXNA 2LF8A 5EEAA 3CDIA 3MCZA 1J09A 1XGNA 3S1NJ 1UFMA 5L3EA 4S04A 4NDLA 3BY6A 3KE2A 1Z91A 1UJ8A 3M1CA 4RM2A 1FYLA 2AS5F 3ELKA 3WTWC 1N78A 5TISC 4EGZA 2Y31A 1HSJA 1LDDA 5CVRA 2ELHA 3JAMZ 2EFWA 2EJRA 2L7KA 5GTHC 3DEEA 5GPAA 2Y69H 1NK2P 2FE3A 3OOPA 4IX7A 1UELB 1USSA 1OJLA 3F21A 4WX9A 1Y0NA 1BJZA 3EUKL 1WJAA 1MH3A 2JVGA 3I53A 4BBSJ 4HG2A 3OYKA 3L2WA 1B8IB 2DOFA 3ZR8X 4RA2A 1T98A 1FBUA 4B3XA 4IHYA 2IGNA 1V4RA 2F5DA 4S05A 1H0MA 2BEOA 4CCMA 2E7WA 2V1UA 3OYJA 2CW7A 2K86A 3H9QA 1AA7A 3TO7A 4BHPA 1W7PD 2K9QA 5DYMA 1OLTA 2HOSA 2OZUA 3CCYA 2ZXWH 3DWLE 4CICA 3ASNH 4BACA 4K2EA 3B6AA 1JTYA 5CJ9A 2K4BA 1SVMA 2LREA 4HSRA 1HW5A 4OIOF 2EIKH 3TKYA 1WI9A 1QBJA 4YEJA 4LOCA 2O8KA 2W00A 2L9RA 3GWZA 1FY7A 3IH2A 2VBYA 3BTIA 2LOOA 2EFQA 5GADJ 3PUFA 2MC3A 5BS6A 2GOXB 2VQCA 2XROA 3HDDA 3WU2C 1DU6A 2A5YB 1O7LA 3OS1A 1QPMA 2VPRA 5CVIA 1YS7A 3LQQA 4V2GA 4C3IJ 3MKYB 4BHBA 3A2KA 5GAEJ 1MMDA 2EZIA 3OL3A 2ZFUA 4MFDA 2M45A 5FLXK 2HPIA 5BNGA 1WH7A 1MW7A 1YJWI 4LMYA 3H3ZA 1YRNA 3ERMA 2JRTA 4U7BA 3E6BA 5FJ8J 1BI2A 3LFUA 1G3YA 5FKLA 2DN0A 2ICWG 4XN0A 2IA0A 4RB3C 3RZOJ 1O57A 1WI3A 5E3NA 4HOBA 5A2QZ 3HC7A 3FXKA 4Y3OA 2E2JJ 2CW8A 2STTA 5BMZA 1RUNA 1QZEA 4AIJA 3ZMDA 4CYCB 3M1EA 2KL4A 5FO5A 2OZ6A 5KVRA 4F55A 4DYCA 1YHQI 3BCBA 2R7XA 1V5FA 1GV2A 5IPAA 3ECOA 4OWRB 4HV5A 1B59A 2X1EA 3HZJA 1G3WA 3OYHA 2X85A 3H36A 4C9YA 2AHQA 2XGEA 4CSWA 4MFEA 5H6RA 4Y4RA 5EYRA 3OYLA 1CF7A 3MAJA 4B8XA 2L7FP 2JN6A 5F0FA 2F6CA 1WWXA 2HGCA 5D5XB 3I3LA 2L3DA 2MD0A 3ABLH 3O2PE 5EGOA 1BN5A 2JRMA 5CKTA 3TOBA 1LE8A 5D4SA 2D2WA 1BOBA 1VNDA 2O0YA 3BCAA 1OR7C 5DM6F 1YJNI 5L3GA 5IP7J 2VXZA 1BI1A 2LC2A 1WKMA 4JX6A 1M1EB 5FKKA 4JYKA 1P7JA 3VSLA 1XSXA 4PDKA 3EDPA 2RREA 1SFKA 2EB7A 2MGQA 2UXXA 1Z1DA 2LP0A 2WAFA 1JKPC 3O8HA 3HPGA 1XS9A 4BEHA 4A3IJ 2MC4A 5F08A 3RTRA 1JHFA 2CUJA 3EPZA 1S7EA 3OYEA 2QM3A 2JA5J 3MN2A 3EETA 1GHCA 2ZBKA 1I6XA 3H35A 3HPHA 3OR1C 5IYDJ 4JOMA 2X48A 1S72I 2DDBA 3S16J 2CUFA 1MZBA 2X6WA 3QODA 5KHDA 2FU4A 2FMLA 3RKQA 2OV7A 2JQ7A 3BR1A 1HSTA 2P6TA 1X3WB 3LQRA 1WCMJ 4LG0A 3HIFA 1OISA 3KFWX 1T2KA 3KEQA 3IKTA 2ZXIA 2VI6A 3MZ8A 3ZMVA 3R0JA 3TP3A 3ZQGA 3E6CC 1VQPI 1X3UA 2NAZA 2EPFA 1SD6A 2DDAA 1PUEE 2GA1A 3MWMA 1Y56A 2QBYB 2JA7J 3JCUC 2IW5A 3M7GA 1WJFA 2EIMH 2QSGX 1DP7P 3JTGA 1HC8A 1PYVA 4A12A 4WXDA 3HJEA 3CUQC 3P9KA 3TO9A 2IXSA 4A3CJ 2KRFA 1S29A 1TWGJ 2COMA 3QPSA 3LL7A 1HKTA 1WJBA 3RIRA 5FLVA 2K4JA 2FNAA 2ZB9A 1KA8A 4D5CA 1GVDA 5L3BA 2WAQA 3MZYA 4A69C 2VJ4A 4RGUA 2CH0A 4LFUA 5E20A 5HNFA 3JW4A 1U0JA 3SYTA 2PI0A 3CJNA 2RDPA 3PJRA 4E7SA 2VT3A 3M8EA 5ICFA 5J8CA 1X1BA 1ZLKA 3G3ZA 3QPLA 1IG7A 3TBIA 4II3A 4FHTA 4L9NA 1BW6A 1MMNA 2QSHX 1S3JA 1E3HA 4A3KJ 1P4WA 2Q0OA 2RV8A 2KRCA 4DZPA 1UG0A 2XAUA 1CQTA 1J75A 2JA6J 2CUZA 4LLLA 1AKHA 2YSRA 3JRBA 1PP7U 3NRVA 1NTCA 1XTAA 3R61A 5L3CA 4KYWA 2BV6A 1B9NA 1RRJA 2Y30A 4A0XA 5CYVA 1EA3A 2HTJA 5IT3A 4DYQA 2R7ZJ 3OWTA 3KP7A 4GDFA 1IAWA 5EF6A 1K6YA 4KT5C 3JSPA 2Z99A 2OAZA 4HLXA 3GYHX 1YIJI 5IOZA 2MH9A 2V9KA 3S93A 5D8LB 4YELA 1ZR4A 2RKHA 2HVSA 3I59B 2DXIA 4M3BA 2BHZA 3SXYA 5B66C 3OR2C 1RKTA 1BL0A 4NNJA 4KDPA 2M87A 3B6CA 1O7FA 1D0XA 4ZZLA 3KP6A 2EFOA 1R4MB 3JRIA 5K5OA 1FSEA 5GAGJ 3L1PA 1IV6A 1HDDC 3I64A 3KYDB 4JK1X 5LGNA 1IUYA 1ZREA 5LHGA 3RPUA 2ZJQF 3Q0WA 1A6IA 2WV1A 4IHTA 4CDGA 4EEFG 4BAYA 3QQAA 1MIJA 2XF7A 2M7AA 3I4PA 2M30A 1SMTA 1LPQA 1LQ1A 3M8JA 3WGIA 4MTEA 4BJTA 1FEXA 5DS9A 2ZJ2A 4ZZDA 2Z33A 1RIOH 3R0AA 3HL2A 4Y33A 3G1MA 3KYLA 2ID6A 2DMQA 5J1UA 2BXYA 1UAAA 1J0RA 4A93J 3W6VA 1C0WA 3AL0C 4ZC3A 3ZQQA 1B72B 3OIQA 4IL6C 3N97A 2WAEA 4D7MA 3QYFA 4OOIA 4YIFA 1LE8B 3BJAA 3HKZN 2EWNA 2ELJA 4JBAA 3O6BB 1ZGJA 2GXGA 4FTHA 2Y9ZA 1BIBA 3ZOBA 1IGNA 4XLHA 4UV9A 3FXOA 3HOWJ 1ETOA 2STWA 4UUSA 2L7MP 5JHFA 2E1CA 2DMTA 2ZKZA 2ADUA 1FP2A 4B09A 4QPOA 1IN8A 3K70C 4E6KG 1MBGA 3H9GA 1ETVA 1GDTA 4LK0F 2KDOA 3LA7A 4QTRA 3E5QA 3HGGA 4XIDA 2R7SA 4CCKA 1DP3A 2X6OA 4IRGA 1HBXG 3E1SA 5HS7A 2WBMA 3FKIJ 1FWZA 2RC4A 2NNYA 2XSDC 3GTLJ 2P5KA 4EGYA 2G9WA 5LRRA 4YIRX 4U88A 1R1VA 2PG4A 1EKEA 4M9ZA 1IN4A 2HU9A 3K10A 4KICA 5K7FA 1P9QC 1ZK8A 2RVCA 4AIHA 1F36A 1PJRA 1IN6A 4CZZA 3T0YA 2LY9A 3L00A 2ZJPF 3DU5A 1XCBA 1JHHA 3V7CA 4ESFA 4OIPF 4LIVA 3HRSA 3ZQLA 4MQVA 4I02A 4WXHA 3OMYA 2CSOA 3ZQIA 3DKYA 4O3MA 1E3OC 2DBBA 1XPXA 4YFNF 3K1NA 2K3FA 2RNJA 3WE2A 5TRDA 1S5LC 1FC3A 3LSTA 3CCJI 2A69F 2HWVA 5IT9K 5HOOA 2KMUA 3W6KB 3E5XA 1OYYA 5CVUA 4IKFA 5C4XJ 3CC7I 2PFBA 3O3KA 3VYSB 3CC2I 2I8DA 4UVAA 3LSGA 5KCMA 3IP4B 1IRZA 4WK8F 4Y7NJ 5JLWA 3G71I 3JTHA 3SFIA 1OCPA 1V5GA 3QOPA 1O3QA 3E5UA 2V79A 2F4MB 3OL4A 4M3GA 2X6YA 3P9IA 3ZCOA 1H89C 2K9LA 1V5EA 4ZDPA 3LWFA 1HQCA 4BNCA 2TRTA 2HXOA 2IA1A 1Y39A 1HDPA 2M4GA 1A31A 3U1KA 4L9VA 2L5QA 2F4IA 2MLGA 4P9FA 4QIWN 3JRDA 5D5UB 4JQFA 5ILVA 2W1OA 5DCMB 2WWYA 2E71A 2CQKA 3P5JA 5C44J 5HLGA 3DBLB 2DFIA 2KLOA 4XKCA 1TW3A 4HPQA 5EG0A 5LHIA 1ZG1A 4FASD 5IOYA 1XSVA 2B9SA 1DQUA 3DTIA 2BY1A 4PK4A 1P4AA 4CH7A 4LB5A 2BYVE 5M3FJ 3ZMZA 2ZSHB 3KP2A 2IGMA 4XICA 4BQNA 3DQVC 2HOAA 2K85A 1Z3XA 1JUSA 3RYPA 3SZGA 3H0GJ 2VOOA 5EZGA 1G2HA 3C1DA 1R5GA 1ZRDA 1V54H 3F8FA 4N4OB 4HDUA 2XB0X 3KYCB 5KK1A 3KZYA 3ZQFA 4HQMA 4CCJA 1ZR2A 3BTLA 2CQQA 3E6MA 2PEXA 3N05A 3W2WA 3PSFA 4IF4A 5LGTA 3NARA 3PQJA 5CVJA 2LVSA 4M3EA 2V4JC 3CCQI 1YIOA 1HF0A 2VE8A 3LFKA 3GXOA 4XM3A 2E60A 2MFZA 2FXAA 1LVKA 5HODA 2QBYA 2VASA 1PDNC 3T1BA 5IY5H 5DUIA 3KPHA 1B6AA 3CCMI 1YLFA 4OAYA 4UB6C 1MKMA 3RJPA 1JKOC 1XMAA 3SJMA 2OQRA 3VB2A 2IS4A 2RAEA 2Q2EA 2XAQA 2XC7A 1O3TA 2M0MA 2E36A 4GCVA 5C4JJ 4C30A 1KONA 1K78A 1SD7A 2DCEA 1G3SA 3CUOA 2LG4A 4AC0A 2H09A 4A2UA 1YS6A 2E5ZA 5TJJA 3CQZJ 2IJLA 4XKWA 1BW5A 1JT6A 2QZ8A 5EDNA 3HOXJ 1K4SA 3B73A 2IBDA 1X4OA 3I56I 2DTRA 4JP0A 4XONA 2GWRA 4JX4A 4XKBA 1G8XA 1U2WA 2Y0SN 3F9KA 4M71A 2OQGA 2RNGA 3WU1B 3L09A 1KQ9A 3EUAA 3BR0A 3FKJA 4RLFA 5AIQA 1DUXC 4ETSA 2E1OA 4IXAA 3CCLI 4OIQF 2OUMA 4A3LJ 2LNBA 1W7PB 1HW1A 4WCGA 3W3CA 5GAHJ 4A5NA 5HDNA 3B02A 3FXUA 1RR7A 3CJQB 2V6CA 3L7WA 2Q1ZB 1TQMA 3CLOA 5IYCJ 3J7ZI 1OFCX 4PGHA 4PJMA 4HF2A 4XLNF 5KAFC 4UUSB 2XAFA 1FBSA 2M4KA 2E19A 1EJ9A 3ZMSA 3COAC 4NC8A 1KGSA 4EM1A 3SZPA 3JRCA 1H88C 2JSCA 5A2QK 3RYRA 4HF1A 1AHDP 4IHWA 3VPRA 3IHUA 3QP6A 4DZJA 1O3SA 2KIMA 1Z6TA 1OCRH 3V7RA 3K4CA 3RQ4A 4IJAA 4B44A 2IS1A 2G7HA 3A01B 3TOAA 4J01A 1YX3A 1XN7A 2E5NA 4XL9A 2UUZA 2YUSA 2ISZA 4CCLA 1VQ5I 1YJ9I 3H1CA 1YX5A 3E6DA 3S3MA 1R5HA 3K0LA 1REPC 3GTPJ 3M9AA 2HOEA 3BLYA 3IUOA 1S8NA 2JUGA 2XF5A 1ETYA 2CS3A 3HHGA 3K6GA 4AD9A 3CDLA 2XASA 3EQLF 2EFPA 1QZYA 2ID3A 3F8CA 5CQEA 1IO2A 4AM3A 2BGCA 1Y1VJ 1JT0A 1FPQA 1TWCJ 5E3MA 4A3DJ 2VUMJ 1BOAA 3HUGB 4UXNA 1MJ9A 3I59A 1ZAOA 1X58A 1XX5A 3NEUA 3D5RC 2A3SA 2DMPA 4A0ZA 1V3FA 2VQHA 3RPUD 3JSOA 1FOYA 2GBYA 5L3DA 4V19K 4HRIA 1ETXA 1YOVB 2V26A 3K1MA 5DCFA 5BQTA 4EVIA 3FXQA 3ZMTA 4C2TA 3PO3J 5GTIC 1I50J 1WJCA 2XDVA 5IYBJ 4DNCA 2A6TA 2RGVA 3HHHA 1OR7A 3E3VA 3FK6A 4AVPA 2A68F 4RDUA 1SAUA 1R1UA 2LF7A 1R7JA 3H5AA 4DIQA 2GM4A 3DTEA 4FETA 2COBA 4DJAA 3TMOA 4L5IA 4LB6B 2O5RA 3S15J 2EZKA 2VQLA 4XLEA 1Y8QB 2Y0SA 1AOYA 3L2UA 4LK1F 4M3DA 3D1NI 4RM3A 1IDYA 2QQ9A 3HTSB 4A3FJ 3SEQA 4Y52J 4N9IA 2BW3B 2FQ3A 1WJDA 2P5VA 4EM2A 1DDNA 1IXCA 4IRIA 2LH9A 2FD5A 3R4KA 1XMXA 2DLLA 5K7ZA 4IHVA 3K4LA 4KIBA 1JGSA 1FNNA 1DPRA 2AQEA 2L02A 3QYEA 3MFKA 1OCTC 1D1CA 4Q48A 2OC6A 3SDGA 3WTSC 5E17F 3FWEA 3WTTC 2R7RA 1MGTA 3VSKA 3V8JA 4GYIA 2FMYA 4E7ZA 3D0SA 3QAHA 1SAXA 2M9HA 3TL4X 2XPWA 1B9MA 2FOWA 1MBHA 1RPWA 3IKVA 1TW2A 2O03A 1N77A 2UWMA 2A5WA 3HTUA 2VONA 1JJ8C 1MMAA 1T39A 3NQOA 1WFXA 3GTKJ 1ZH5A 2DK5A 2KJBA 3KLNA 2E1MB 1VF9A 3U2RA 5BPIA 4HQEA 2XV4S 4KISA 2LSOA 4FE4A 1LNWA 2DU9A 2IP2A 3KP4A 1FYKA 2ZNZA 3BTJA 1W0TA 1TC3C 1R23A 1ETKA 2CGPA 2VT2A 3WHBA 5FKNA 5H6QA 1I1GA 2OJED 3KETA 3HM5A 4E7JA 3W2VA 3FHZA 1IZ1A 2ISYA 2LD5A 1XGSA 5DTDA 1JI8A 3S1RJ 3GTGJ 2L4MA 1WSUA 1HXDA 2F5VA 3GF2A 1ZG5A 1D1BA 2NNNA 3BR3A 2LMDA 2PMUA 2QENA 3CF5F 2HKOA 2VE9A 4MHGA 5KAIC 2GLOA 1EF4A 3FM5A 4WXCA 1FTZA 1Y1WJ 1PUFA 2E7XA 2EFNA 1ETQA 4HBLA 4Z6YA 1D3YA 3A0BC 3MKLA 3OYFA 3L2QA 2IVMA 1RR8C 3DBHB 3DPLC 1BC8C 2HTSA 1Q1HA 3LNQA 5J6XA 2R5ZB 2A61A 2TCTA 4A0YA 5JHUA 4HDVA 1DU0A 2J5PA 4G9YA 4ANJA 3S17J 3LOCA 2GXBA 3IAM2 9ANTA 1OCOH 2JA8J 3FBNB 2ZFWA 1GVJA 3EUHA 2GA2A 3LAJA 1U8RA 1ERDA 2GOMA 4KMUX 3AG2H 2WC2A 1JGGA 3KZZA 1J2XA 4UNOA 2HVRA 4BS9A 2BZTA 1BR1A 1I27A 1NG7A 2EBIA 4PSWA 2IA2A 4F92B 2DK8A 2JVHA 4XBFA 1QRYA 3OS0A 3GUDA 3TGNA 1FT9A 2D1HA 5DUKA 3WTYC 2VL8A 2R92J 4CA0A 3S2WA 1OMIA 1U3EM 2JK3A 3HOUJ 4BYYA 5J1YA 1R9TJ 2MBFA 5JI6A 3FM3A 4A5MA 3CCVI 1Z0XA 2M2EA 2WTEA 3M4OJ 3GZNB 2LR8A 4ZJZA 2YX7A 1XDUA 2FSWA 3H92A 1XG1A 2N8GA 1NHAA 1APLC 2H1KA 1W1WE 4R1HA 1B1BA 2PJRA 4Z2YA 3RKWA 4EJTA 2XKOA 3GVAA 1IUFA 4P5OA 1IF1A 1SEUA 2R0QC 1UHWA 3LSKA 5BOXA 3CZ6A 2DI3A 2L9VA 3DFGA 2LY1A 1D5YA 3U21A 1QA6A 4CO8A 1Z7UA 2YU3A 4A3MJ 6PAXA 3IAS2 1VQLI 4RAFA 2VOPA 4WWCA 4Q5SF 4A6DA 3OOUA 1RKWA 4FCYA 1QQIA 1HW2A 1WJEA 4ZYEA 2EK5A 2KISA 4XNFA 1TNTA 3RZDJ 3FIWA 1MNMC 1RETA 4RLQA 3C2HA 4ZDLA 1K6OA 5E79C 2K02A 1QHGA 4BY7J 3RCOA 2XAGA 4HEA2 1LEAA 3GFJA 3PM1A 1DGWY 1Z05A 2GAUA 3FISA 2JSPA 4PJJA 2R5YA 4DQ2A 4NQWA 1S7AA 3CF2A 4L5EA 2LBFB 3MKWB 3I0TA 5M3MJ 4BE0A 1WVRA 1N75A 4XOTA 4PFPA 3TW6A 2M8EA 3DLAA 4XORA 5FROA 4LD5A 3LAPA 2FRHA 2K7LA 1JE8A 2PMHA 4Q4ZF 2W24A 4GFBA 1QO0D 2KHMA 3A4CA 3CESA 3ABUA 4HNUA 3FXMA 3M8FA 1K7AA 3GCMA 1IRGA 1SFXA 1I3AA 2WB1N 4IO9F 3IWFA 2CQNA 1P2FA 4LGWA 5LBQA 2OCEA 3GX4X 1Z6RA 3HSEA 4F3QA 1FBQA 3BTCA 4X0GA 3CJRB 3BDDA 3KP3A 4KFCA 5B5EC 3OYBA 3M3YJ 1USTA 2DT6A 2DOAA 4CUGA 4FX4A 4LLNA 1KQ8A 1ORKA 2LKPA 4RBOA 1N25A 2X51A 3DU6A 3G2BA 5LEKA 3K4BA 3FXLA 5JVGF 1VZ0A 4BL0B 3ZP5A 1W36C 2DODA 4HNVA 4F91B 3F3XA 3IV5A 1TP4A 1IXRC 1S6LA 2HQ5A 2V9PA 4J00A 3F0CA 3QPTA 4XK4A 2XUBA 3DXJF 3EUHC 3DF8A 4XLFA 4EMSA 3PFIA 1MBEA 1J5YA 2XRNA 3CLQA 4PSXA 4HLYA 4NC6A 4GO1A 4A3BJ 1E0EA 3G1OA 4D1QA 3IRRA 1W5SA 1GV5A 3ABKH 3DBRB 2D45A 4ZYAA 1RUOA 1MMSA 1MBFA 1FYMA 1ZQ3P 3I55I 1W36D 2MD5A 3OYAA 4XSZF 5ICGA 4BE2A 2HFHA 1DGRM 4F52A 3PUBA 3H9JA 2AO9A 2HDWA 5EZHA 2FBIA 4M9XA 4PJNA 1R5ID 3RI4A 2ACJA 1LDJA 2X9DA 4U0VA 5TGTA 5B1AH 3NAUA 3KIOA 2VBZA 3BQZA 2IEKA 3H3UA 2PMZN 2VB6A 4EJWA 1S9HA 1R49A 3SQNA 2QWWA 1ZKGA 2EH3A 2KQRA 3PSIA 2LRDA 1V55H 4UUVA 2QGUA 3VDXA 4YIIA 5KNLA 1L3LA 3DEWA 1DPUA 2JTVA 2DJIA 2WV0A 4E7LA 2NVTJ 3DLLF 2DT5A 3GLLA 1OYWA 5ICCA 1Z67A 1STZA 4TV7A 4I98B 2IAIA 4LITA 1RC9A 1BC7C 4EM0B 2GIVA 2HQNA 1BM9A 3J7YJ 3BG3A 4CYCA 1YRNB 3WTZA 2NVYJ 4M72A 3PIOF 4BU2A 1RESA 2VKDA 4MIMA 3FHNA 5E1XA 2H8WA 1YE9A 3LSPA 3CCRI 1B4AA 3OIPA 3U9GA 3IRQA 4G7OF 3K4JA 1Y8RB 5DD4A 2WB1A 4DBRA 2GXAA 1U5TA 3AFHA 1E17A 3GTMJ 2KJCA 3L9FA 2IT0A 3QRFF 1ACIA 4HAMA 2QVOA 1QVTA 2WAQN 4N0BA 2XRLA 3EYYA 3HOTA 3W2AA 2DO7A 3TEDA 5FLXZ 2CV0A 2F2EA 2Y75A 4EQQA 3TO6A 1R71A 3MQ0A 2P7CB 3IH3A 4P96A 2CYYA 3Q9SA 2KDZA 2DYRH 2E35A 2K9MA 2ME6A 1U9OA 4QWQA 3WU0A 3ZGKA 2FA5A 2M34A 4PFOA 2BBYA 4I01A 2QUFA 4DYRA 4WF2A 3CO7C 3BR2A 2NS7A 1OPCA 2XAHA 3ABTA 1JUMA 5FLMJ 2G7UA 3DCFA 3FMQA 4MGRA 2DA6A 3GFIA 4UHTA 2Z16A 3LA3A 4M73A 4F93B 4AIKA 1QPIA 1A5JA 3IWZA 3GFLA 2JMWA 3FZVA 3D5SC 4L9TA 2BXZA 4N9HA 5E1WA 1JJ6C 2P0WA 2R7DA 5HLIA 5EGOB 1X1PA 2JJ7A 2VKEA 3AG3H 1KZHA 3E0JB 3WODF 3FXJA 4EATA 3N4MA 2AXLA 4OIRF 5FB2A 1GLNA 1IRXA 2NRAC 1OKRA 2K9NA 5LRSA 3GW2A 3I4MJ 3F22A 2QQ8A 2V1XA 3VWBA 2OTJI 1R6RA 4RGXA 5IP6A 4ENKA 2IRFG 1SFOJ 4KT6A 4FISA 1IC8A 3F8BA 3UNGC 1FP1D 2HKXA 3KLOA 3LMMA 3PQKA 4IOAF 2NVXJ 5J8FA 1GXPA 3J7AO 1XB4A 1ZG3A 1TZLA 5F1JA 3GEZA 5ILSA 5IP9J 2HQRA 5IT9Z 2L2OA 1H8AC 1VQ9I 1D8KA 2FNPA 4Y17A 5DV5A 5E3OA 3I4NJ 4H4KC 4PUSA 1J59A 5CLSA 1IRFA 1LDKB 1KQ0A 3QWLA 2Y0MA 1VFCA 2R7QA 4C2MJ 2CU7A 1ZARA 2EILH 3H5RA 5AONA 3BG5A 4OMZA 3WTXC 2CO5A 1KU7A 1ON1A 1MNEA 1U9NA 4II2A 5L3FA 2DA5A 4B4CA 2EZLA 4LG0B 4XQFA 1ENHA 1Y6IA 3I5UA 4XLCA 5ERIA 1EH7A 3UR3C 1A35A 5HS9A 2LYCA 1SC7A 3NWTA 4B43A 2DJNA 1X1AA 2VKHA 5E8GA 3CMMA 3R60A 3ZN0A 1U78A 1UCRA 1AWCA 2XKPA 1IN5A 2Z5UA 1MSFC 3BROA 1RI7A 2D1VA 4C3JJ 1FIPA 3OYDA 4XMYA 2DPUA 2W7NA 4YFKF 3DKWA 1TLHB 2E2IJ 3OV8A 3A0HC 1IXSB 3ROUA 4BGDA 4IHXA 2Y2ZA 5M5XJ 4NHJA 3ZPLA 2DTZA 3TP0A 4RS8A 1BIAA 2I5UA 2NYXA 4U0WA 4KITB 2HI3A 4D9JA 2KP6A 3DV8A 3GZ5A 2PX9A 2L01A 3MVPA 4AYBA 4IEJA 4ZTJA 2YPRA 1WJ5A 3X2QH 5JLXA 2R5ZA 3PO2J 2EV5A 1A04A 2ZMEA 3PNTA 3H0DA 1I6HJ 4RGRA 2QA4I 1GXQA 4MLOA 3LSRA 4ESJA 4RAZA 5EJCA 5FD5A 4KNYA 2D5VA 2K40A 3F23A 4E7IA 3K1PA 3BZCA 4XLPF 1P4XA 3FK7A 3HKZA 3NWSA 3CUQA 4M6XA 5B3SH 4MQ9F 2O7OA 4E7KA 2DMUA 1VQMI 2NS0A 1T0FA 4QLCU 3RDIA 3SDBA 3S3OA 2DAOA 2OBPA 3RKXA 1T0FC 1UZCA 2P8TA 2L4AA 2Y48A 2HNHA 1FLIA 2A6EF 3F8NA 2ZJRF 1W0UA 2DPDA 1FMWA 1X4PA 2RQPA 2CV2A 2ME0A 2CRGA 2O3FA 4F7ZA 1K4TA 3R6SA 2W4SA 3FBIB 2E1NA 1F5TA 3BJOA 2XAJA 3MZHA 2QSFX 4UVCA 1OQYA 4Y15A 2IGOA 3MEXA 2C6YA 5E3LA 4ZYHA 5FRMA 2X1DA 3DEUA 3RSNA 2QEXI 2KIUA 1QZZA 2M1BA 5D8KB 3HOZJ 2F4OB 3MMYB 3VODA 1TQPA 4BQAA 5ILUA 3V42A 4DW6A 1T08B 5J1RA 1IJWC 3G73A 1AU7A 4JX5A 4MNUA 5FKOA 3Q5FA 2R5YB 3BT9A 3Q9VA 4LIUA 2LBFA 4XOPA 3BPVA 3G1LA 1HA8A 2L54A 2ZC2A 2ZO4A 2JA2A 1B72A 2PQ8A 1T6SA 1XMKA 3VFZA 2L7ZA 1HOMA 2Q8KA 2G0EA 1YI2I 4W97A 1QHHD 1ZGAA 2GZWA 2GQQA 1MMGA 2BOLA 3T8TA 5K1YA 1SVLA 2LKSA 3AAFA 2VC0A 3TW7A 1XSDA 4B1RA 5JFRA 1JUPA 4PGGA 3LA2A 3K69A 1MNDA 2X0LA 4U7DA 4BXFA 1H9TA 1WZ2A 2FJ1A 3HRTA 2HR3A 2R7TA 1QGPA 2F48A 1ONVA 1X19A 2XGCA 4EJVA 3I58A 2F5EA 4P55A 4DOZA 2H27A 1MDMB 3FX3A 2R93J 2HXIA 2YS9A 4XRSA 5B1BH 4HX8A 3U1DA 4CGZA 1I1SA 2DYSH 4KIGA 4OINF 1Y0UA 4DGWB 3CP2A 1QU3A 2XIGA 3GTQJ 1JXSA 2EIJH 2HQAA 1VTNC 2PJPA 2HVQA 1XGOA 4XRMA 3F8MA 2VLAA 2DMNA 2NS8A 4A6EA 4CXFA 4XLAA 2MG4A 2HYJA 3K4NA 3LSMA 4X1EA 2VXDA 3W6JB 3BC8A 2W48A 2M3AA 1K83J 2KZGA 2EA4A 4D5FA 4D7NA 5CPRB 3AL0B 3Q0VA 1UMQA 1OCZH 2XGDA 3KP5A 2BY3A 2DA3A 1YW9A 3QOEA 1SFUA 2JPCA 3J80Z 1AKHB 4L18B 4KN4X 4ZH4F 1MBKA 1R58A 4FE7A 3P7NA 2H6CA 3WGHA 3S8PA 4BXUA 2UV1A 1YYVA 3PL8A 4ON0A 1UHSA 2DT7B 3IC7A 2ECCA 2MSYA 2NVUB 4RMNA 4XRFA 1HLVA 3V8LA 5GPCA 2X1CA 2CG4A 5D6FA 5BPDA 1W7PA 3OY9A 2V1DA 3HRUA 3ONQA 2HPMA 4RB1A 4HZFA 4L9JA 3ZQ7A 5E18F 4ZTFA 4YRVA 4G12A 2CW0F 5FKMA 1W5CC 2HYGD 1WPKA 3A1YA 5DEQA 4CYDA 4NB5A 4AU7A 5K5RA 4ENMA 1X3ZB 4GYGA 2QKMB 4IVNA 3LSJA 1F43A 4AWXB 2ESNA 1D8JA 1TNSA 2FX0A 3D5LA 1R4NB 3HYIA 4BHCA 2XVCA 4G6DA 4LLGF 4BJ6C 3G6EI 5EG0B 3ZQCA 3ZXSA 1U5TB 2WY7Q 5D6EA 4FT8A 2HDDA 3KEYA 3CO6C 2W85A 3O8GA 2H94A 4HX4A 3VYRB 3JRGA 2JWTA 2R7OA 4G6QA 2QKLB 2LTPA 3FF5A 2V7FA 2Z9OA 1FIAA 2ELKA 1E2XA 2CWEA 2LLKA 1LFPA 1WH5A 2LDUA 5EEGA 3MD2A 2FF4A 3K70D 4CHUA 2VODA 3I71A 3E97A 1P7IA 3C2GA 2Z1DA 4KA4A 2BY0A 2IS2A 4BUPA 1VQ6I 5DCMA 2L9SA 2VC1A 4IRHA 3C2BA 3LSIA 3ISPA 2ESHA 5D5WB 2ZCWA 3I54A 1LB2A 4CCOA 4CCNA 3K4KA 1S7OA 1P92A 3KX2A 3TDZC 3TQNA 5HS8A 3S1QJ 3HG9A 2MW8A 2BVMA 1T95A 3PNYA 3OSFA 1HKSA 2DOEA 1ZELA 4XSXF 4BDYA 2LKXA 5DM7F 1G4DA 1ZLJA 2M0CA 2ZMEB 4KJZA 4DBQA 4IOCF 3JAMK 3KZIC 3F72A 3ML6A 2A07F 5HLTA 4NC7A 2EV0A 1QVUA 2XSJC 1T56A 3A03A 5E1ZB 4O6JA 1TL8A 2H6BA 3CUQB 4H0EA 2KIQA 4HYEA 4UB8C 2O9LA 1ZN2A 3K9TA 3VEPA 4XKVA 2WY8Q 2EINH 4R8HA 2OPTA 4QSHA 4W1UA 3M07A 1H9GA 4XRSG 1KU2A 1FOWA 2P4WA 4PJ0C 3GBGA 1KU9A 2Z3YA 3BG6A 4G6TB 3QYBA 3VOEA 3ABMH 4E70A 4BXXJ 2DFEA 2Q2EB 1NK3P 3WG7H 3CC4I 1UHMA 2VBXA 2DFFA 2R4GA 1G59A 3T5XA 4HA8A 2PLYA 3SZTA 4J19A 2ZMEC 3L2VA 3H3VK 2JPBA 1Z77A 5M5WJ 3WGGA 4XN3A 4ASNA 2B7EA 4KN7X 4PCQA 4ZYDA 4RB2C 3GZ6A 1R22A 4N4NB 4BKXA 2DW4A 3FXRA 2HDCA 4IHSA 1J7KA 2OCCH 3IH4A 1MJAA 4CZCA 1IV8A 1ETWA 4BDZA 4R79A 2RN7A 1D5VA 1F9NA 1BA5A 3C7JA 4G7ZF 1ZTRA 2NXNB 3OYIA 1IN7A 2TDXA 3AG1H 3L2RA 1MDMA 5AIPA 1ZRCA 1K78B 2EV6A 2MLKA 2W25A 3V8KA 1ITYA 5F0HA 3SEZA 4KMFA 2CQXA 1VI0A 2L0KA 3BG7A 3QP5A 3HBLA 2HS5A 4GGGA 1Z21A 1ON2A 3CMYA 4MEYF 3OYMA 1HKQA 1X1DA 1T38A 3DPUA 1YQAA 3BZKA 3ZQHA 3KEOA 1K79A 2R7VA 3DKXA 5ED4A 1F4KA 2A6HF 5F0CA 1YITI 1ZYRF 2VJIA 2NVQJ 1SFEA 1UG2A 1U5TC 5FFXA 2ZXJA 2H8RA 1XDSA 1VQ4I 2XHKA 3JR9A 4RGSA 1MBJA 3F6VA 1KYWA 3HSFA 3GTOJ 4AVZA 2OD5A 5D4RA 4HV6A 2O61A 3OYGA 2HZTA 5FD6A 3BR5A 4PJLA 1X1CA 5K5QA 4RAYA 1OCCH 3CP8A 3JRHA 2XB5A 1FTTA 4AIDA 1TWHJ 5FGMA 2V9VA 4C2UA 1BR2A 2FEZA 5J4YA 4I0BA 2CV1A 1TT0A 3BZ6A 1VQ8I 5HNHA 1U8BA 4UY8I 1W4MA 1NG6A 2I10A 2PBIA 3EYIA 4IQ4A 4D0PA 4G8XA 3PIPF 2R7FA 5HDGA 1JTXA 1POGA 1GT0C 2K9SA 4KUMA 2YU9J 2B0LA 2LK2A 3HRMA 5K7HA 1VQKI 2DA4A 2HZDA 4E4HA 1X2MA 4ENJA 2QQBA 3K2AA 1EV7A 3SFZA 4L0YB 1PP8F 3DTKA 2PMZA 3ASOH 2K3PA 4B48A 3C18A 4GRIA 4IPAA 2EQRA 2VKVA 3OYCA 5FFZA 2FQ4A 2V1NA 2VN2A 4ABZA 2XPUA 2VPLA 4L0ZB 4BQQA 2ETHA 2E2HJ 3HUGA 3ECHA 2AXTC 3AG4H 4B3AA 1T8IA 5LLQA 2DFHA 2ZNYA 2F5CA 3BG9A 2W82A 5F6FA 2R3SA 2IGKA 3KCCA 2RQQA 2KIFA 4XR6A 2AQFA 4S0HB 4ESBA 4FX0A 2B63J 4HF0A 3AKZA 2XGXA 3VYTB 1TQIA 3REOA 4EJOA 1IDZA 1SMYF 2O8XA 3BOQA 2IPQX 1FOKA 1R36A 4RB0A 2BW3A 4HX7A 1Q1VA 3OSGA 5F64A 4M3FA 2K5CA 4ZYGA 4E7HA 3HOYJ 1VQOI 2MYSA 5J40A 3JREA 3HOSA 3ZMUA 2X6XA 3HOVJ 2XPVA 2KRHA 5JR3A 1YG2A 2EZHA 5H20A 5LGUA 3ERED 2PJRB 2X4HA 5GP9A 1BI0A 2V6EA 1GUUA 3IL2A 4I09A 2FUG2 1XC5A 2P5LC 4A3GJ 4I76A 4I99C 5J3LA 3J7AY 1B8IA 4B47A 1NH3A 2O6GE 2Y9YA 4BH9A 4BJ5C 2QLZA 1LFBA 1BJAA 2DQRA 3J81Z 1RNLA 5LEJA 3T8RA 4AUXA 2CMPA 5LD2C 1Z3YA 1WQ2A 2OU2A 4G7HF 1WRJA 1FSHA 3Q3SA 3ULQB 2A05A 3V7SA 4NUBA 4U0YA 1CF7B 2M7BA 4BEHB 1P6RA 3WG9A 3OS2A 2WADA 2JUCA 2DA7A 4BQOA 3UKGA 4PZJA 1X2NA 4OU0A 1WHUA 4ITVA 1MSEC 2QQAA 2DA1A 2DA2A 1MD0A 3BP8A 3S3NA 3L2CA 3HGYA 2R7WA 5FRNA 1TBXA 1LVAA 1SD4A 2YX4A 1XD7A 1F1ZA 1YO5C 2M5WA 3GLXA 2HYFA 5LHHA 5E8IA 3JRAA 1LEBA 1ODDA 3CMEI 1YTYA 3P9CA 2H1LA 1UB9A 4O5VA 2QF7A 1QNTA 3ZRGA 1TWFJ 4A3JJ 4BY1J 2EA2A 5D5VB 4QPQA 4X6AJ 1EH6A 3Q0UA 4FQGA 3SHFA 5JVTA 5CQGA 4P1WA 5EEHA 3E7LA 4RAGA 1LFUP 1E3PA 4UUTA 4BE1A 4IQJA 3S14J 3WTUC 3FMSA 3GFMA 4MEXF 1FJLA 1D1AA 2QYOA 3A02A 3C3WA 3QU3A 3JRFA 2FBHA 2W84A 2XF6A 4UVBA 5DD8A 1SD5A 2K27A 4Y13A 1BI3A 5H2FC 2E34A 2E1MC 3A01A 3CCEI 1TT5B 4M6YA 4ZDOA 1EH8A 3FDYA 3J81K 4MO7A 2CFXA 2NOJB 4I6ZA 2CUEA 3CCSI 2OTLI 1FZPB 1HCRA 1WGXA 3BWGA 5DDGA 1G6NA 1FMVA 2VJ5A 2MA3A 1A6QA 2BY2A 1BR4A 4GXOA 1IW7F 2DQLA 1J9IA 1O4XA 2M8GX 1JKRC 4YG2F 3PNVA 4G94A 1YW7A 3PFYA 3BQYA 1XCVA 5ICEA 2ZSIB 1TWAJ 4ENNA 4P9UA 4MTDA 4IZZA 2Z2SB 4EJUA 3CMAI 1I39A 2KKOA 2ZXHA 3CD6I 4UV8A 2OA4A 1OYIA 1SANA 5HLHA 3DPTA 1W5TA 2CFOA 5CVVA 1VQNI 1ZGWA 2HEOA 1KU3A 1U6GA 3I9V2 5J4VA 2PN6A 2LY2A 3CCUI 4U87A 3CTAA 5C3EJ 1YW8A 1D0ZA 1ULYA 4M6VA 4HSTA 1A36A 2MABA 1MH4A 4L5JA 3DP7A 4BBRJ 4Q47A 1PUFB 3BJ6A 3K7AJ 3ZN1A 1LKXA 3BR6A 4OAZA 4V2FA 4C3HJ 4A3EJ 3HXLA 3K4MA 2OF7A 3TDUC 3S2DJ 1G3TA 3V4GA 3BPXA 3J80K 3QPHA 3WHCA 2P81A 4KIFA 1FX7A 1Z9CA 1I5ZA 1ZHFA 1R1TA 3LSHA 1R00A 3GO5A 2F5FA 3WTVC 2VQGA 3S2HJ 4LJZF 2CJJA 3G4SI 3S32A 1VQ7I 2JT1A 4EV0A 2NOGA 2ECBA 3OIOA 3HSRA 2KZVA 3HB9A 1RZ4A 1SVOA 2GIZA 2KFDA 2J5OA 5M5YJ 2FOKA 4AYBN 3HEFA 1Z7LA 3CDHA 3K2ZA 3GTJJ 1O3RA 5LFAA 1BBYA 2JZYA 4M74A 2L9NA 1FOXA 4HNTA 2VJJA 1D0YA 3QU6A 4NBQA 1K61A 2BE5F 1CGPA 4YFXF 4OMYA
chains in the Genus database with same CATH topology
3IAS2 3H5NA 3OMYA 2WA0A 3QOEA 3DKYA 3OOUA 5HVQC 2IS6A 1WJEA 4XNFA 3S8PA 2UV1A 3PL8A 4RLQA 3C2HA 4ZDLA 2DT7B 2BVLA 3VYUB 4RMNA 1QHGA 5HOOA 2KMUA 3RCOA 2X1CA 4HEA2 3MKZA 3OYNA 2KPMA 1DGWY 3OY9A 4IKFA 2JSPA 3ONQA 4PJJA 2HPMA 3VYSB 2I8DA 3CF2A 3LSGA 2LBFB 3MKWB 4BE0A 4ZTFA 5KCMA 4YRVA 1N75A 2VIXA 3IP4B 4PFPA 4LG3A 4NQWB 4XOTA 3DLAA 4XORA 5FROA 3A1YA 2R7UA 4AU7A 2QKMB 1J09A 2KHMA 3A4CA 3CESA 1V5GA 4HNUA 3OL4A 3D5LA 2X6YA 3M1CA 4RM2A 3ZCOA 4BJ6C 2K9LA 1V5EA 4ZDPA 3ZXSA 2WY7Q 1N78A 4F3QA 3KEYA 4X0GA 3CJRB 3VYRB 3OYBA 2M4GA 2R7OA 2QKLB 2DT6A 2DOAA 4CUGA 2L5QA 2F4IA 2V7FA 2X51A 3DU6A 3G2BA 1LFPA 2L7KA 3DEEA 3K4BA 3MD2A 4JQFA 4IX7A 1VZ0A 4BL0B 1UELB 2W1OA 3K70D 1W36C 3C2GA 2Z1DA 4F91B 4XKCA 2KLOA 3EUKL 2IS2A 4BUPA 1WJAA 2L9SA 2JVGA 4HG2A 4HPQA 3LSIA 3OYKA 3L2WA 4J00A 3ZR8X 4XLFA 3EUHC 4FASD 4B3XA 4CCOA 2IGNA 4PSXA 1DQUA 3DTIA 1E0EA 4CCNA 3K4KA 4PK4A 4D1QA 4CH7A 3KX2A 4ZYAA 4CCMA 3OYJA 2CW7A 1W36D 3HG9A 2ZSHB 3H9QA 1AA7A 2BVMA 1T95A 2IGMA 3PNYA 4BQNA 1OLTA 3DQVC 3OYAA 3SZGA 1Z3XA 4BE2A 3DWLE 4BDYA 1ZELA 1DGRM 4F52A 3PUBA 4BACA 3H9JA 2LREA 4KJZA 2HDWA 4HSRA 4DBQA 4N4OB 4PJNA 4YEJA 2W00A 5TGTA 4NC7A 4CCJA 5HLTA 2XSJC 2VB6A 1S9HA 2LOOA 3N05A 3W2WA 3PSFA 2KQRA 3PSIA 2LRDA 3VDXA 2V4JC 2GOXB 2VQCA 5KNLA 2DJIA 4XM3A 3OS1A 4E7LA 2E60A 2MFZA 4XKVA 2WY8Q 1LVKA 4LITA 2VASA 3MKYB 3GBGA 3A2KA 3BG6A 1MMDA 3QYBA 4G6TB 3OL3A 2Q2EB 2ZFUA 4OAYA 2HPIA 4BU2A 2VKDA 3FHNA 1MW7A 2IS4A 2XC7A 1YE9A 2M0MA 4U7BA 2R4GA 3OIPA 1G59A 4C30A 1KONA 3LFUA 3K4JA 2DCEA 2LG4A 4DBRA 2WB1A 3L2VA 2E5ZA 4XN0A 3AFHA 4XN3A 4XKWA 1X4OA 3HC7A 4Y3OA 2CW8A 4N4NB 4XONA 3HOTA 3W2AA 4XKBA 1G8XA 2CV0A 4CZCA 3F9KA 4BDZA 4R79A 2KL4A 2RNGA 4F55A 3EUAA 3BCBA 3FKJA 4RLFA 2R7XA 3OYIA 1V5FA 4OWRB 3L2RA 2K9MA 2X1EA 2OUMA 3ZGKA 2X85A 3OYHA 4C9YA 4PFOA 3W3CA 3SEZA 4CSWA 3BG7A 3CJQB 1Z21A 4Y4RA 3OYLA 3OYMA 2Q1ZB 1X1DA 3DPUA 2R7VA 4PJMA 3DKXA 2F6CA 2Z16A 4F93B 3I3LA 2MD0A 2M4KA 2VJIA 5CKTA 3D5SC 4NC8A 1BOBA 3BCAA 1OR7C 2P0WA 2VXZA 2LC2A 4AVZA 3OYGA 4PJLA 1X1CA 3CP8A 3E0JB 3VSLA 3K4CA 3RQ4A 4B44A 2IS1A 2RREA 1SFKA 4J01A 1YX3A 4EATA 4XL9A 2E5NA 2UUZA 4C2UA 1BR2A 2WAFA 4CCLA 1GLNA 1IRXA 1YX5A 3HPGA 2CV1A 4BEHA 1TT0A 2MC4A 5HNHA 3RTRA 3S3MA 1NG6A 2CUJA 4IQ4A 3EPZA 3VWBA 1R6RA 3OYEA 3BLYA 3IUOA 3H35A 3HPHA 3OR1C 2JUGA 2XF5A 4JOMA 4KT6A 2CS3A 3K6GA 2HZDA 4E4HA 5CQEA 3LMMA 3UNGC 2X6WA 3QODA 5KHDA 2PMZA 3DTKA 2K3PA 2OV7A 1TZLA 4B48A 4GRIA 3HUGB 3OYCA 2L2OA 2V1NA 2VPLA 4BQQA 4H4KC 4PUSA 2ZXIA 3D5RC 1LDKB 2VQHA 3RPUD 4HRIA 2V26A 2R7QA 2W82A 1Y56A 2IGKA 3H5RA 2RQQA 4XR6A 1WJFA 2AQFA 4C2TA 1WJCA 2XDVA 3AKZA 3VYTB 1MNEA 2A6TA 1PYVA 4II2A 2IXSA 4XQFA 1Y6IA 1SAUA 2BW3A 4XLCA 3UR3C 3H5AA 3LL7A 4DIQA 1WJBA 2LYCA 3DTEA 3NWTA 4FETA 2K5CA 4DJAA 4E7HA 4B43A 3TMOA 2MYSA 3HOSA 1X1AA 2VKHA 2O5RA 2WAQA 2VJ4A 2X6XA 3CMMA 2CH0A 2KRHA 2VQLA 4XLEA 5HNFA 1U0JA 3SYTA 2Y0SA 2PJRB 3PJRA 4E7SA 3L2UA 2V6EA 3OYDA 4XMYA 4RM3A 2FUG2 1X1BA 2W7NA 3SEQA 3TBIA 4II3A 3J7AY 1MMNA 4B47A 4BJ5C 2BW3B 4BGDA 1WJDA 2KRCA 2LH9A 1UG0A 2XAUA 3K4LA 4KITB 4D9JA 2CUZA 2KP6A 2CMPA 4AYBA 1Z3YA 5LD2C 2AQEA 4ZTJA 3QYEA 4NUBA 1WJ5A 1D1CA 2OC6A 2M7BA 4BEHB 3OS2A 2WADA 2R7RA 3VSKA 4BQOA 4E7ZA 3PNTA 4ITVA 3TL4X 1EA3A 3H0DA 3S3NA 2R7WA 4MLOA 5FRNA 3OWTA 1N77A 2UWMA 2A5WA 4E7IA 1MMAA 1K6YA 1WFXA 3ZRGA 3HKZA 3NWSA 2V9KA 3S93A 2E1MB 4YELA 4E7KA 4QPQA 2HVSA 2DXIA 5CQGA 3SDBA 3S3OA 4P1WA 3OR2C 4KISA 1T0FC 4NNJA 4BE1A 2HNHA 1D0XA 4IQJA 1FMWA 1X4PA 2CV2A 2W4SA 3FBIB 1D1AA 2XF6A 2IGOA 2E1MC 4E7JA 4ZDOA 3W2VA 3FDYA 5FRMA 2X1DA 2XF7A 2M7AA 2NOJB 1JI8A 3RSNA 3M8JA 1FMVA 2F5VA 2VJ5A 4BJTA 1BR4A 1D1BA 3MMYB 3PNVA 3HL2A 3V42A 4Y33A 3KYLA 3PFYA 1UAAA 2ZSIB 3AL0C 4LIUA 4ZC3A 2Z2SB 4IZZA 3ZQQA 3OYFA 2LBFA 4XOPA 1HA8A 3OIQA 3L2QA 2ZXHA 3DPLC 2WAEA 3QYFA 3DPTA 2JA2A 2CFOA 4ANJA 2ELJA 3IAM2 3I9V2 2LY2A 4U87A 1QHHD 3FBNB 1MMGA 1D0ZA 2BOLA 2GOMA 1ERDA 4HSTA 2MABA 4XLHA 5JHFA 1MNDA 2HVRA 4BS9A 1BR1A 4BXFA 1LKXA 4OAZA 4QPOA 1NG7A 3HXLA 3K4MA 3K70C 4PSWA 4E6KG 2R7TA 4F92B 3H9GA 2JVHA 3OS0A 1X19A 2KDOA 2R7SA 4CCKA 4DOZA 2VL8A 1DP3A 3LSHA 4CA0A 2VQGA 3S32A 3E1SA 2WBMA 4ZJZA 2KZVA 4DGWB 1QU3A 3CP2A 2HQAA 1Z7LA 2HVQA 2HU9A 2PJRA 3K10A 1P9QC 2VLAA 4P5OA 5LFAA 1PJRA 4XLAA 2L9NA 4HNTA 3LSKA 3K4NA 2VJJA 3LSMA 1D0YA 2VXDA 3CZ6A 3BC8A 2M3AA 2LY1A 3DU5A 3U21A 5CPRB 3AL0B 4LIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DCE A;  2AQF A;  2AQE A;  2ELJ A;  2CUJ A; 
#chains in the Genus database with same CATH topology
 3CJT B;  3H5N A;  4I2O A;  2UZK A;  2WA0 A;  1I3Q J;  1T33 A;  2FBK A;  3S1M J;  5HVQ C;  4I7H A;  5F1R A;  3FMR A;  2IS6 A;  2CQ7 A;  3RKY A;  3RQI A;  2QCO A;  1L0O C;  2BHY A;  3ESW B;  3GME A;  3RPQ A;  5F04 A;  2BVL A;  5J47 A;  3VYU B;  1JKQ C;  2VBW A;  1MJB A;  3F6O A;  3MKZ A;  3OYN A;  1LJ9 A;  2KPM A;  1XGM A;  1YFH A;  2W57 A;  4M9S A;  5HDK A;  1PVE A;  1TTY A;  2P7V B;  2KT0 A;  2LFB A;  2YR2 A;  5F27 A;  4I0A A;  4HW0 A;  3WE3 A;  2VIX A;  4LG3 A;  4NQW B;  2HOT A;  1LUJ B;  1KYZ A;  1ZRF A;  2P6S A;  2MH2 A;  2R7U A;  2UXN A;  2LF8 A;  5EEA A;  3CDI A;  3MCZ A;  1J09 A;  1XGN A;  3S1N J;  1UFM A;  5L3E A;  4S04 A;  4NDL A;  3BY6 A;  3KE2 A;  1Z91 A;  1UJ8 A;  3M1C A;  4RM2 A;  1FYL A;  2AS5 F;  3ELK A;  3WTW C;  1N78 A;  5TIS C;  4EGZ A;  2Y31 A;  1HSJ A;  1LDD A;  5CVR A;  2ELH A;  3JAM Z;  2EFW A;  2EJR A;  2L7K A;  5GTH C;  3DEE A;  5GPA A;  2Y69 H;  1NK2 P;  2FE3 A;  3OOP A;  4IX7 A;  1UEL B;  1USS A;  1OJL A;  3F21 A;  4WX9 A;  1Y0N A;  1BJZ A;  3EUK L;  1WJA A;  1MH3 A;  2JVG A;  3I53 A;  4BBS J;  4HG2 A;  3OYK A;  3L2W A;  1B8I B;  2DOF A;  3ZR8 X;  4RA2 A;  1T98 A;  1FBU A;  4B3X A;  4IHY A;  2IGN A;  1V4R A;  2F5D A;  4S05 A;  1H0M A;  2BEO A;  4CCM A;  2E7W A;  2V1U A;  3OYJ A;  2CW7 A;  2K86 A;  3H9Q A;  1AA7 A;  3TO7 A;  4BHP A;  1W7P D;  2K9Q A;  5DYM A;  1OLT A;  2HOS A;  2OZU A;  3CCY A;  2ZXW H;  3DWL E;  4CIC A;  3ASN H;  4BAC A;  4K2E A;  3B6A A;  1JTY A;  5CJ9 A;  2K4B A;  1SVM A;  2LRE A;  4HSR A;  1HW5 A;  4OIO F;  2EIK H;  3TKY A;  1WI9 A;  1QBJ A;  4YEJ A;  4LOC A;  2O8K A;  2W00 A;  2L9R A;  3GWZ A;  1FY7 A;  3IH2 A;  2VBY A;  3BTI A;  2LOO A;  2EFQ A;  5GAD J;  3PUF A;  2MC3 A;  5BS6 A;  2GOX B;  2VQC A;  2XRO A;  3HDD A;  3WU2 C;  1DU6 A;  2A5Y B;  1O7L A;  3OS1 A;  1QPM A;  2VPR A;  5CVI A;  1YS7 A;  3LQQ A;  4V2G A;  4C3I J;  3MKY B;  4BHB A;  3A2K A;  5GAE J;  1MMD A;  2EZI A;  3OL3 A;  2ZFU A;  4MFD A;  2M45 A;  5FLX K;  2HPI A;  5BNG A;  1WH7 A;  1MW7 A;  1YJW I;  4LMY A;  3H3Z A;  1YRN A;  3ERM A;  2JRT A;  4U7B A;  3E6B A;  5FJ8 J;  1BI2 A;  3LFU A;  1G3Y A;  5FKL A;  2DN0 A;  2ICW G;  4XN0 A;  2IA0 A;  4RB3 C;  3RZO J;  1O57 A;  1WI3 A;  5E3N A;  4HOB A;  5A2Q Z;  3HC7 A;  3FXK A;  4Y3O A;  2E2J J;  2CW8 A;  2STT A;  5BMZ A;  1RUN A;  1QZE A;  4AIJ A;  3ZMD A;  4CYC B;  3M1E A;  2KL4 A;  5FO5 A;  2OZ6 A;  5KVR A;  4F55 A;  4DYC A;  1YHQ I;  3BCB A;  2R7X A;  1V5F A;  1GV2 A;  5IPA A;  3ECO A;  4OWR B;  4HV5 A;  1B59 A;  2X1E A;  3HZJ A;  1G3W A;  3OYH A;  2X85 A;  3H36 A;  4C9Y A;  2AHQ A;  2XGE A;  4CSW A;  4MFE A;  5H6R A;  4Y4R A;  5EYR A;  3OYL A;  1CF7 A;  3MAJ A;  4B8X A;  2L7F P;  2JN6 A;  5F0F A;  2F6C A;  1WWX A;  2HGC A;  5D5X B;  3I3L A;  2L3D A;  2MD0 A;  3ABL H;  3O2P E;  5EGO A;  1BN5 A;  2JRM A;  5CKT A;  3TOB A;  1LE8 A;  5D4S A;  2D2W A;  1BOB A;  1VND A;  2O0Y A;  3BCA A;  1OR7 C;  5DM6 F;  1YJN I;  5L3G A;  5IP7 J;  2VXZ A;  1BI1 A;  2LC2 A;  1WKM A;  4JX6 A;  1M1E B;  5FKK A;  4JYK A;  1P7J A;  3VSL A;  1XSX A;  4PDK A;  3EDP A;  2RRE A;  1SFK A;  2EB7 A;  2MGQ A;  2UXX A;  1Z1D A;  2LP0 A;  2WAF A;  1JKP C;  3O8H A;  3HPG A;  1XS9 A;  4BEH A;  4A3I J;  2MC4 A;  5F08 A;  3RTR A;  1JHF A;  2CUJ A;  3EPZ A;  1S7E A;  3OYE A;  2QM3 A;  2JA5 J;  3MN2 A;  3EET A;  1GHC A;  2ZBK A;  1I6X A;  3H35 A;  3HPH A;  3OR1 C;  5IYD J;  4JOM A;  2X48 A;  1S72 I;  2DDB A;  3S16 J;  2CUF A;  1MZB A;  2X6W A;  3QOD A;  5KHD A;  2FU4 A;  2FML A;  3RKQ A;  2OV7 A;  2JQ7 A;  3BR1 A;  1HST A;  2P6T A;  1X3W B;  3LQR A;  1WCM J;  4LG0 A;  3HIF A;  1OIS A;  3KFW X;  1T2K A;  3KEQ A;  3IKT A;  2ZXI A;  2VI6 A;  3MZ8 A;  3ZMV A;  3R0J A;  3TP3 A;  3ZQG A;  3E6C C;  1VQP I;  1X3U A;  2NAZ A;  2EPF A;  1SD6 A;  2DDA A;  1PUE E;  2GA1 A;  3MWM A;  1Y56 A;  2QBY B;  2JA7 J;  3JCU C;  2IW5 A;  3M7G A;  1WJF A;  2EIM H;  2QSG X;  1DP7 P;  3JTG A;  1HC8 A;  1PYV A;  4A12 A;  4WXD A;  3HJE A;  3CUQ C;  3P9K A;  3TO9 A;  2IXS A;  4A3C J;  2KRF A;  1S29 A;  1TWG J;  2COM A;  3QPS A;  3LL7 A;  1HKT A;  1WJB A;  3RIR A;  5FLV A;  2K4J A;  2FNA A;  2ZB9 A;  1KA8 A;  4D5C A;  1GVD A;  5L3B A;  2WAQ A;  3MZY A;  4A69 C;  2VJ4 A;  4RGU A;  2CH0 A;  4LFU A;  5E20 A;  5HNF A;  3JW4 A;  1U0J A;  3SYT A;  2PI0 A;  3CJN A;  2RDP A;  3PJR A;  4E7S A;  2VT3 A;  3M8E A;  5ICF A;  5J8C A;  1X1B A;  1ZLK A;  3G3Z A;  3QPL A;  1IG7 A;  3TBI A;  4II3 A;  4FHT A;  4L9N A;  1BW6 A;  1MMN A;  2QSH X;  1S3J A;  1E3H A;  4A3K J;  1P4W A;  2Q0O A;  2RV8 A;  2KRC A;  4DZP A;  1UG0 A;  2XAU A;  1CQT A;  1J75 A;  2JA6 J;  2CUZ A;  4LLL A;  1AKH A;  2YSR A;  3JRB A;  1PP7 U;  3NRV A;  1NTC A;  1XTA A;  3R61 A;  5L3C A;  4KYW A;  2BV6 A;  1B9N A;  1RRJ A;  2Y30 A;  4A0X A;  5CYV A;  1EA3 A;  2HTJ A;  5IT3 A;  4DYQ A;  2R7Z J;  3OWT A;  3KP7 A;  4GDF A;  1IAW A;  5EF6 A;  1K6Y A;  4KT5 C;  3JSP A;  2Z99 A;  2OAZ A;  4HLX A;  3GYH X;  1YIJ I;  5IOZ A;  2MH9 A;  2V9K A;  3S93 A;  5D8L B;  4YEL A;  1ZR4 A;  2RKH A;  2HVS A;  3I59 B;  2DXI A;  4M3B A;  2BHZ A;  3SXY A;  5B66 C;  3OR2 C;  1RKT A;  1BL0 A;  4NNJ A;  4KDP A;  2M87 A;  3B6C A;  1O7F A;  1D0X A;  4ZZL A;  3KP6 A;  2EFO A;  1R4M B;  3JRI A;  5K5O A;  1FSE A;  5GAG J;  3L1P A;  1IV6 A;  1HDD C;  3I64 A;  3KYD B;  4JK1 X;  5LGN A;  1IUY A;  1ZRE A;  5LHG A;  3RPU A;  2ZJQ F;  3Q0W A;  1A6I A;  2WV1 A;  4IHT A;  4CDG A;  4EEF G;  4BAY A;  3QQA A;  1MIJ A;  2XF7 A;  2M7A A;  3I4P A;  2M30 A;  1SMT A;  1LPQ A;  1LQ1 A;  3M8J A;  3WGI A;  4MTE A;  4BJT A;  1FEX A;  5DS9 A;  2ZJ2 A;  4ZZD A;  2Z33 A;  1RIO H;  3R0A A;  3HL2 A;  4Y33 A;  3G1M A;  3KYL A;  2ID6 A;  2DMQ A;  5J1U A;  2BXY A;  1UAA A;  1J0R A;  4A93 J;  3W6V A;  1C0W A;  3AL0 C;  4ZC3 A;  3ZQQ A;  1B72 B;  3OIQ A;  4IL6 C;  3N97 A;  2WAE A;  4D7M A;  3QYF A;  4OOI A;  4YIF A;  1LE8 B;  3BJA A;  3HKZ N;  2EWN A;  2ELJ A;  4JBA A;  3O6B B;  1ZGJ A;  2GXG A;  4FTH A;  2Y9Z A;  1BIB A;  3ZOB A;  1IGN A;  4XLH A;  4UV9 A;  3FXO A;  3HOW J;  1ETO A;  2STW A;  4UUS A;  2L7M P;  5JHF A;  2E1C A;  2DMT A;  2ZKZ A;  2ADU A;  1FP2 A;  4B09 A;  4QPO A;  1IN8 A;  3K70 C;  4E6K G;  1MBG A;  3H9G A;  1ETV A;  1GDT A;  4LK0 F;  2KDO A;  3LA7 A;  4QTR A;  3E5Q A;  3HGG A;  4XID A;  2R7S A;  4CCK A;  1DP3 A;  2X6O A;  4IRG A;  1HBX G;  3E1S A;  5HS7 A;  2WBM A;  3FKI J;  1FWZ A;  2RC4 A;  2NNY A;  2XSD C;  3GTL J;  2P5K A;  4EGY A;  2G9W A;  5LRR A;  4YIR X;  4U88 A;  1R1V A;  2PG4 A;  1EKE A;  4M9Z A;  1IN4 A;  2HU9 A;  3K10 A;  4KIC A;  5K7F A;  1P9Q C;  1ZK8 A;  2RVC A;  4AIH A;  1F36 A;  1PJR A;  1IN6 A;  4CZZ A;  3T0Y A;  2LY9 A;  3L00 A;  2ZJP F;  3DU5 A;  1XCB A;  1JHH A;  3V7C A;  4ESF A;  4OIP F;  4LIV A;  3HRS A;  3ZQL A;  4MQV A;  4I02 A;  4WXH A;  3OMY A;  2CSO A;  3ZQI A;  3DKY A;  4O3M A;  1E3O C;  2DBB A;  1XPX A;  4YFN F;  3K1N A;  2K3F A;  2RNJ A;  3WE2 A;  5TRD A;  1S5L C;  1FC3 A;  3LST A;  3CCJ I;  2A69 F;  2HWV A;  5IT9 K;  5HOO A;  2KMU A;  3W6K B;  3E5X A;  1OYY A;  5CVU A;  4IKF A;  5C4X J;  3CC7 I;  2PFB A;  3O3K A;  3VYS B;  3CC2 I;  2I8D A;  4UVA A;  3LSG A;  5KCM A;  3IP4 B;  1IRZ A;  4WK8 F;  4Y7N J;  5JLW A;  3G71 I;  3JTH A;  3SFI A;  1OCP A;  1V5G A;  3QOP A;  1O3Q A;  3E5U A;  2V79 A;  2F4M B;  3OL4 A;  4M3G A;  2X6Y A;  3P9I A;  3ZCO A;  1H89 C;  2K9L A;  1V5E A;  4ZDP A;  3LWF A;  1HQC A;  4BNC A;  2TRT A;  2HXO A;  2IA1 A;  1Y39 A;  1HDP A;  2M4G A;  1A31 A;  3U1K A;  4L9V A;  2L5Q A;  2F4I A;  2MLG A;  4P9F A;  4QIW N;  3JRD A;  5D5U B;  4JQF A;  5ILV A;  2W1O A;  5DCM B;  2WWY A;  2E71 A;  2CQK A;  3P5J A;  5C44 J;  5HLG A;  3DBL B;  2DFI A;  2KLO A;  4XKC A;  1TW3 A;  4HPQ A;  5EG0 A;  5LHI A;  1ZG1 A;  4FAS D;  5IOY A;  1XSV A;  2B9S A;  1DQU A;  3DTI A;  2BY1 A;  4PK4 A;  1P4A A;  4CH7 A;  4LB5 A;  2BYV E;  5M3F J;  3ZMZ A;  2ZSH B;  3KP2 A;  2IGM A;  4XIC A;  4BQN A;  3DQV C;  2HOA A;  2K85 A;  1Z3X A;  1JUS A;  3RYP A;  3SZG A;  3H0G J;  2VOO A;  5EZG A;  1G2H A;  3C1D A;  1R5G A;  1ZRD A;  1V54 H;  3F8F A;  4N4O B;  4HDU A;  2XB0 X;  3KYC B;  5KK1 A;  3KZY A;  3ZQF A;  4HQM A;  4CCJ A;  1ZR2 A;  3BTL A;  2CQQ A;  3E6M A;  2PEX A;  3N05 A;  3W2W A;  3PSF A;  4IF4 A;  5LGT A;  3NAR A;  3PQJ A;  5CVJ A;  2LVS A;  4M3E A;  2V4J C;  3CCQ I;  1YIO A;  1HF0 A;  2VE8 A;  3LFK A;  3GXO A;  4XM3 A;  2E60 A;  2MFZ A;  2FXA A;  1LVK A;  5HOD A;  2QBY A;  2VAS A;  1PDN C;  3T1B A;  5IY5 H;  5DUI A;  3KPH A;  1B6A A;  3CCM I;  1YLF A;  4OAY A;  4UB6 C;  1MKM A;  3RJP A;  1JKO C;  1XMA A;  3SJM A;  2OQR A;  3VB2 A;  2IS4 A;  2RAE A;  2Q2E A;  2XAQ A;  2XC7 A;  1O3T A;  2M0M A;  2E36 A;  4GCV A;  5C4J J;  4C30 A;  1KON A;  1K78 A;  1SD7 A;  2DCE A;  1G3S A;  3CUO A;  2LG4 A;  4AC0 A;  2H09 A;  4A2U A;  1YS6 A;  2E5Z A;  5TJJ A;  3CQZ J;  2IJL A;  4XKW A;  1BW5 A;  1JT6 A;  2QZ8 A;  5EDN A;  3HOX J;  1K4S A;  3B73 A;  2IBD A;  1X4O A;  3I56 I;  2DTR A;  4JP0 A;  4XON A;  2GWR A;  4JX4 A;  4XKB A;  1G8X A;  1U2W A;  2Y0S N;  3F9K A;  4M71 A;  2OQG A;  2RNG A;  3WU1 B;  3L09 A;  1KQ9 A;  3EUA A;  3BR0 A;  3FKJ A;  4RLF A;  5AIQ A;  1DUX C;  4ETS A;  2E1O A;  4IXA A;  3CCL I;  4OIQ F;  2OUM A;  4A3L J;  2LNB A;  1W7P B;  1HW1 A;  4WCG A;  3W3C A;  5GAH J;  4A5N A;  5HDN A;  3B02 A;  3FXU A;  1RR7 A;  3CJQ B;  2V6C A;  3L7W A;  2Q1Z B;  1TQM A;  3CLO A;  5IYC J;  3J7Z I;  1OFC X;  4PGH A;  4PJM A;  4HF2 A;  4XLN F;  5KAF C;  4UUS B;  2XAF A;  1FBS A;  2M4K A;  2E19 A;  1EJ9 A;  3ZMS A;  3COA C;  4NC8 A;  1KGS A;  4EM1 A;  3SZP A;  3JRC A;  1H88 C;  2JSC A;  5A2Q K;  3RYR A;  4HF1 A;  1AHD P;  4IHW A;  3VPR A;  3IHU A;  3QP6 A;  4DZJ A;  1O3S A;  2KIM A;  1Z6T A;  1OCR H;  3V7R A;  3K4C A;  3RQ4 A;  4IJA A;  4B44 A;  2IS1 A;  2G7H A;  3A01 B;  3TOA A;  4J01 A;  1YX3 A;  1XN7 A;  2E5N A;  4XL9 A;  2UUZ A;  2YUS A;  2ISZ A;  4CCL A;  1VQ5 I;  1YJ9 I;  3H1C A;  1YX5 A;  3E6D A;  3S3M A;  1R5H A;  3K0L A;  1REP C;  3GTP J;  3M9A A;  2HOE A;  3BLY A;  3IUO A;  1S8N A;  2JUG A;  2XF5 A;  1ETY A;  2CS3 A;  3HHG A;  3K6G A;  4AD9 A;  3CDL A;  2XAS A;  3EQL F;  2EFP A;  1QZY A;  2ID3 A;  3F8C A;  5CQE A;  1IO2 A;  4AM3 A;  2BGC A;  1Y1V J;  1JT0 A;  1FPQ A;  1TWC J;  5E3M A;  4A3D J;  2VUM J;  1BOA A;  3HUG B;  4UXN A;  1MJ9 A;  3I59 A;  1ZAO A;  1X58 A;  1XX5 A;  3NEU A;  3D5R C;  2A3S A;  2DMP A;  4A0Z A;  1V3F A;  2VQH A;  3RPU D;  3JSO A;  1FOY A;  2GBY A;  5L3D A;  4V19 K;  4HRI A;  1ETX A;  1YOV B;  2V26 A;  3K1M A;  5DCF A;  5BQT A;  4EVI A;  3FXQ A;  3ZMT A;  4C2T A;  3PO3 J;  5GTI C;  1I50 J;  1WJC A;  2XDV A;  5IYB J;  4DNC A;  2A6T A;  2RGV A;  3HHH A;  1OR7 A;  3E3V A;  3FK6 A;  4AVP A;  2A68 F;  4RDU A;  1SAU A;  1R1U A;  2LF7 A;  1R7J A;  3H5A A;  4DIQ A;  2GM4 A;  3DTE A;  4FET A;  2COB A;  4DJA A;  3TMO A;  4L5I A;  4LB6 B;  2O5R A;  3S15 J;  2EZK A;  2VQL A;  4XLE A;  1Y8Q B;  2Y0S A;  1AOY A;  3L2U A;  4LK1 F;  4M3D A;  3D1N I;  4RM3 A;  1IDY A;  2QQ9 A;  3HTS B;  4A3F J;  3SEQ A;  4Y52 J;  4N9I A;  2BW3 B;  2FQ3 A;  1WJD A;  2P5V A;  4EM2 A;  1DDN A;  1IXC A;  4IRI A;  2LH9 A;  2FD5 A;  3R4K A;  1XMX A;  2DLL A;  5K7Z A;  4IHV A;  3K4L A;  4KIB A;  1JGS A;  1FNN A;  1DPR A;  2AQE A;  2L02 A;  3QYE A;  3MFK A;  1OCT C;  1D1C A;  4Q48 A;  2OC6 A;  3SDG A;  3WTS C;  5E17 F;  3FWE A;  3WTT C;  2R7R A;  1MGT A;  3VSK A;  3V8J A;  4GYI A;  2FMY A;  4E7Z A;  3D0S A;  3QAH A;  1SAX A;  2M9H A;  3TL4 X;  2XPW A;  1B9M A;  2FOW A;  1MBH A;  1RPW A;  3IKV A;  1TW2 A;  2O03 A;  1N77 A;  2UWM A;  2A5W A;  3HTU A;  2VON A;  1JJ8 C;  1MMA A;  1T39 A;  3NQO A;  1WFX A;  3GTK J;  1ZH5 A;  2DK5 A;  2KJB A;  3KLN A;  2E1M B;  1VF9 A;  3U2R A;  5BPI A;  4HQE A;  2XV4 S;  4KIS A;  2LSO A;  4FE4 A;  1LNW A;  2DU9 A;  2IP2 A;  3KP4 A;  1FYK A;  2ZNZ A;  3BTJ A;  1W0T A;  1TC3 C;  1R23 A;  1ETK A;  2CGP A;  2VT2 A;  3WHB A;  5FKN A;  5H6Q A;  1I1G A;  2OJE D;  3KET A;  3HM5 A;  4E7J A;  3W2V A;  3FHZ A;  1IZ1 A;  2ISY A;  2LD5 A;  1XGS A;  5DTD A;  1JI8 A;  3S1R J;  3GTG J;  2L4M A;  1WSU A;  1HXD A;  2F5V A;  3GF2 A;  1ZG5 A;  1D1B A;  2NNN A;  3BR3 A;  2LMD A;  2PMU A;  2QEN A;  3CF5 F;  2HKO A;  2VE9 A;  4MHG A;  5KAI C;  2GLO A;  1EF4 A;  3FM5 A;  4WXC A;  1FTZ A;  1Y1W J;  1PUF A;  2E7X A;  2EFN A;  1ETQ A;  4HBL A;  4Z6Y A;  1D3Y A;  3A0B C;  3MKL A;  3OYF A;  3L2Q A;  2IVM A;  1RR8 C;  3DBH B;  3DPL C;  1BC8 C;  2HTS A;  1Q1H A;  3LNQ A;  5J6X A;  2R5Z B;  2A61 A;  2TCT A;  4A0Y A;  5JHU A;  4HDV A;  1DU0 A;  2J5P A;  4G9Y A;  4ANJ A;  3S17 J;  3LOC A;  2GXB A;  3IAM 2;  9ANT A;  1OCO H;  2JA8 J;  3FBN B;  2ZFW A;  1GVJ A;  3EUH A;  2GA2 A;  3LAJ A;  1U8R A;  1ERD A;  2GOM A;  4KMU X;  3AG2 H;  2WC2 A;  1JGG A;  3KZZ A;  1J2X A;  4UNO A;  2HVR A;  4BS9 A;  2BZT A;  1BR1 A;  1I27 A;  1NG7 A;  2EBI A;  4PSW A;  2IA2 A;  4F92 B;  2DK8 A;  2JVH A;  4XBF A;  1QRY A;  3OS0 A;  3GUD A;  3TGN A;  1FT9 A;  2D1H A;  5DUK A;  3WTY C;  2VL8 A;  2R92 J;  4CA0 A;  3S2W A;  1OMI A;  1U3E M;  2JK3 A;  3HOU J;  4BYY A;  5J1Y A;  1R9T J;  2MBF A;  5JI6 A;  3FM3 A;  4A5M A;  3CCV I;  1Z0X A;  2M2E A;  2WTE A;  3M4O J;  3GZN B;  2LR8 A;  4ZJZ A;  2YX7 A;  1XDU A;  2FSW A;  3H92 A;  1XG1 A;  2N8G A;  1NHA A;  1APL C;  2H1K A;  1W1W E;  4R1H A;  1B1B A;  2PJR A;  4Z2Y A;  3RKW A;  4EJT A;  2XKO A;  3GVA A;  1IUF A;  4P5O A;  1IF1 A;  1SEU A;  2R0Q C;  1UHW A;  3LSK A;  5BOX A;  3CZ6 A;  2DI3 A;  2L9V A;  3DFG A;  2LY1 A;  1D5Y A;  3U21 A;  1QA6 A;  4CO8 A;  1Z7U A;  2YU3 A;  4A3M J;  6PAX A;  3IAS 2;  1VQL I;  4RAF A;  2VOP A;  4WWC A;  4Q5S F;  4A6D A;  3OOU A;  1RKW A;  4FCY A;  1QQI A;  1HW2 A;  1WJE A;  4ZYE A;  2EK5 A;  2KIS A;  4XNF A;  1TNT A;  3RZD J;  3FIW A;  1MNM C;  1RET A;  4RLQ A;  3C2H A;  4ZDL A;  1K6O A;  5E79 C;  2K02 A;  1QHG A;  4BY7 J;  3RCO A;  2XAG A;  4HEA 2;  1LEA A;  3GFJ A;  3PM1 A;  1DGW Y;  1Z05 A;  2GAU A;  3FIS A;  2JSP A;  4PJJ A;  2R5Y A;  4DQ2 A;  4NQW A;  1S7A A;  3CF2 A;  4L5E A;  2LBF B;  3MKW B;  3I0T A;  5M3M J;  4BE0 A;  1WVR A;  1N75 A;  4XOT A;  4PFP A;  3TW6 A;  2M8E A;  3DLA A;  4XOR A;  5FRO A;  4LD5 A;  3LAP A;  2FRH A;  2K7L A;  1JE8 A;  2PMH A;  4Q4Z F;  2W24 A;  4GFB A;  1QO0 D;  2KHM A;  3A4C A;  3CES A;  3ABU A;  4HNU A;  3FXM A;  3M8F A;  1K7A A;  3GCM A;  1IRG A;  1SFX A;  1I3A A;  2WB1 N;  4IO9 F;  3IWF A;  2CQN A;  1P2F A;  4LGW A;  5LBQ A;  2OCE A;  3GX4 X;  1Z6R A;  3HSE A;  4F3Q A;  1FBQ A;  3BTC A;  4X0G A;  3CJR B;  3BDD A;  3KP3 A;  4KFC A;  5B5E C;  3OYB A;  3M3Y J;  1UST A;  2DT6 A;  2DOA A;  4CUG A;  4FX4 A;  4LLN A;  1KQ8 A;  1ORK A;  2LKP A;  4RBO A;  1N25 A;  2X51 A;  3DU6 A;  3G2B A;  5LEK A;  3K4B A;  3FXL A;  5JVG F;  1VZ0 A;  4BL0 B;  3ZP5 A;  1W36 C;  2DOD A;  4HNV A;  4F91 B;  3F3X A;  3IV5 A;  1TP4 A;  1IXR C;  1S6L A;  2HQ5 A;  2V9P A;  4J00 A;  3F0C A;  3QPT A;  4XK4 A;  2XUB A;  3DXJ F;  3EUH C;  3DF8 A;  4XLF A;  4EMS A;  3PFI A;  1MBE A;  1J5Y A;  2XRN A;  3CLQ A;  4PSX A;  4HLY A;  4NC6 A;  4GO1 A;  4A3B J;  1E0E A;  3G1O A;  4D1Q A;  3IRR A;  1W5S A;  1GV5 A;  3ABK H;  3DBR B;  2D45 A;  4ZYA A;  1RUO A;  1MMS A;  1MBF A;  1FYM A;  1ZQ3 P;  3I55 I;  1W36 D;  2MD5 A;  3OYA A;  4XSZ F;  5ICG A;  4BE2 A;  2HFH A;  1DGR M;  4F52 A;  3PUB A;  3H9J A;  2AO9 A;  2HDW A;  5EZH A;  2FBI A;  4M9X A;  4PJN A;  1R5I D;  3RI4 A;  2ACJ A;  1LDJ A;  2X9D A;  4U0V A;  5TGT A;  5B1A H;  3NAU A;  3KIO A;  2VBZ A;  3BQZ A;  2IEK A;  3H3U A;  2PMZ N;  2VB6 A;  4EJW A;  1S9H A;  1R49 A;  3SQN A;  2QWW A;  1ZKG A;  2EH3 A;  2KQR A;  3PSI A;  2LRD A;  1V55 H;  4UUV A;  2QGU A;  3VDX A;  4YII A;  5KNL A;  1L3L A;  3DEW A;  1DPU A;  2JTV A;  2DJI A;  2WV0 A;  4E7L A;  2NVT J;  3DLL F;  2DT5 A;  3GLL A;  1OYW A;  5ICC A;  1Z67 A;  1STZ A;  4TV7 A;  4I98 B;  2IAI A;  4LIT A;  1RC9 A;  1BC7 C;  4EM0 B;  2GIV A;  2HQN A;  1BM9 A;  3J7Y J;  3BG3 A;  4CYC A;  1YRN B;  3WTZ A;  2NVY J;  4M72 A;  3PIO F;  4BU2 A;  1RES A;  2VKD A;  4MIM A;  3FHN A;  5E1X A;  2H8W A;  1YE9 A;  3LSP A;  3CCR I;  1B4A A;  3OIP A;  3U9G A;  3IRQ A;  4G7O F;  3K4J A;  1Y8R B;  5DD4 A;  2WB1 A;  4DBR A;  2GXA A;  1U5T A;  3AFH A;  1E17 A;  3GTM J;  2KJC A;  3L9F A;  2IT0 A;  3QRF F;  1ACI A;  4HAM A;  2QVO A;  1QVT A;  2WAQ N;  4N0B A;  2XRL A;  3EYY A;  3HOT A;  3W2A A;  2DO7 A;  3TED A;  5FLX Z;  2CV0 A;  2F2E A;  2Y75 A;  4EQQ A;  3TO6 A;  1R71 A;  3MQ0 A;  2P7C B;  3IH3 A;  4P96 A;  2CYY A;  3Q9S A;  2KDZ A;  2DYR H;  2E35 A;  2K9M A;  2ME6 A;  1U9O A;  4QWQ A;  3WU0 A;  3ZGK A;  2FA5 A;  2M34 A;  4PFO A;  2BBY A;  4I01 A;  2QUF A;  4DYR A;  4WF2 A;  3CO7 C;  3BR2 A;  2NS7 A;  1OPC A;  2XAH A;  3ABT A;  1JUM A;  5FLM J;  2G7U A;  3DCF A;  3FMQ A;  4MGR A;  2DA6 A;  3GFI A;  4UHT A;  2Z16 A;  3LA3 A;  4M73 A;  4F93 B;  4AIK A;  1QPI A;  1A5J A;  3IWZ A;  3GFL A;  2JMW A;  3FZV A;  3D5S C;  4L9T A;  2BXZ A;  4N9H A;  5E1W A;  1JJ6 C;  2P0W A;  2R7D A;  5HLI A;  5EGO B;  1X1P A;  2JJ7 A;  2VKE A;  3AG3 H;  1KZH A;  3E0J B;  3WOD F;  3FXJ A;  4EAT A;  3N4M A;  2AXL A;  4OIR F;  5FB2 A;  1GLN A;  1IRX A;  2NRA C;  1OKR A;  2K9N A;  5LRS A;  3GW2 A;  3I4M J;  3F22 A;  2QQ8 A;  2V1X A;  3VWB A;  2OTJ I;  1R6R A;  4RGX A;  5IP6 A;  4ENK A;  2IRF G;  1SFO J;  4KT6 A;  4FIS A;  1IC8 A;  3F8B A;  3UNG C;  1FP1 D;  2HKX A;  3KLO A;  3LMM A;  3PQK A;  4IOA F;  2NVX J;  5J8F A;  1GXP A;  3J7A O;  1XB4 A;  1ZG3 A;  1TZL A;  5F1J A;  3GEZ A;  5ILS A;  5IP9 J;  2HQR A;  5IT9 Z;  2L2O A;  1H8A C;  1VQ9 I;  1D8K A;  2FNP A;  4Y17 A;  5DV5 A;  5E3O A;  3I4N J;  4H4K C;  4PUS A;  1J59 A;  5CLS A;  1IRF A;  1LDK B;  1KQ0 A;  3QWL A;  2Y0M A;  1VFC A;  2R7Q A;  4C2M J;  2CU7 A;  1ZAR A;  2EIL H;  3H5R A;  5AON A;  3BG5 A;  4OMZ A;  3WTX C;  2CO5 A;  1KU7 A;  1ON1 A;  1MNE A;  1U9N A;  4II2 A;  5L3F A;  2DA5 A;  4B4C A;  2EZL A;  4LG0 B;  4XQF A;  1ENH A;  1Y6I A;  3I5U A;  4XLC A;  5ERI A;  1EH7 A;  3UR3 C;  1A35 A;  5HS9 A;  2LYC A;  1SC7 A;  3NWT A;  4B43 A;  2DJN A;  1X1A A;  2VKH A;  5E8G A;  3CMM A;  3R60 A;  3ZN0 A;  1U78 A;  1UCR A;  1AWC A;  2XKP A;  1IN5 A;  2Z5U A;  1MSF C;  3BRO A;  1RI7 A;  2D1V A;  4C3J J;  1FIP A;  3OYD A;  4XMY A;  2DPU A;  2W7N A;  4YFK F;  3DKW A;  1TLH B;  2E2I J;  3OV8 A;  3A0H C;  1IXS B;  3ROU A;  4BGD A;  4IHX A;  2Y2Z A;  5M5X J;  4NHJ A;  3ZPL A;  2DTZ A;  3TP0 A;  4RS8 A;  1BIA A;  2I5U A;  2NYX A;  4U0W A;  4KIT B;  2HI3 A;  4D9J A;  2KP6 A;  3DV8 A;  3GZ5 A;  2PX9 A;  2L01 A;  3MVP A;  4AYB A;  4IEJ A;  4ZTJ A;  2YPR A;  1WJ5 A;  3X2Q H;  5JLX A;  2R5Z A;  3PO2 J;  2EV5 A;  1A04 A;  2ZME A;  3PNT A;  3H0D A;  1I6H J;  4RGR A;  2QA4 I;  1GXQ A;  4MLO A;  3LSR A;  4ESJ A;  4RAZ A;  5EJC A;  5FD5 A;  4KNY A;  2D5V A;  2K40 A;  3F23 A;  4E7I A;  3K1P A;  3BZC A;  4XLP F;  1P4X A;  3FK7 A;  3HKZ A;  3NWS A;  3CUQ A;  4M6X A;  5B3S H;  4MQ9 F;  2O7O A;  4E7K A;  2DMU A;  1VQM I;  2NS0 A;  1T0F A;  4QLC U;  3RDI A;  3SDB A;  3S3O A;  2DAO A;  2OBP A;  3RKX A;  1T0F C;  1UZC A;  2P8T A;  2L4A A;  2Y48 A;  2HNH A;  1FLI A;  2A6E F;  3F8N A;  2ZJR F;  1W0U A;  2DPD A;  1FMW A;  1X4P A;  2RQP A;  2CV2 A;  2ME0 A;  2CRG A;  2O3F A;  4F7Z A;  1K4T A;  3R6S A;  2W4S A;  3FBI B;  2E1N A;  1F5T A;  3BJO A;  2XAJ A;  3MZH A;  2QSF X;  4UVC A;  1OQY A;  4Y15 A;  2IGO A;  3MEX A;  2C6Y A;  5E3L A;  4ZYH A;  5FRM A;  2X1D A;  3DEU A;  3RSN A;  2QEX I;  2KIU A;  1QZZ A;  2M1B A;  5D8K B;  3HOZ J;  2F4O B;  3MMY B;  3VOD A;  1TQP A;  4BQA A;  5ILU A;  3V42 A;  4DW6 A;  1T08 B;  5J1R A;  1IJW C;  3G73 A;  1AU7 A;  4JX5 A;  4MNU A;  5FKO A;  3Q5F A;  2R5Y B;  3BT9 A;  3Q9V A;  4LIU A;  2LBF A;  4XOP A;  3BPV A;  3G1L A;  1HA8 A;  2L54 A;  2ZC2 A;  2ZO4 A;  2JA2 A;  1B72 A;  2PQ8 A;  1T6S A;  1XMK A;  3VFZ A;  2L7Z A;  1HOM A;  2Q8K A;  2G0E A;  1YI2 I;  4W97 A;  1QHH D;  1ZGA A;  2GZW A;  2GQQ A;  1MMG A;  2BOL A;  3T8T A;  5K1Y A;  1SVL A;  2LKS A;  3AAF A;  2VC0 A;  3TW7 A;  1XSD A;  4B1R A;  5JFR A;  1JUP A;  4PGG A;  3LA2 A;  3K69 A;  1MND A;  2X0L A;  4U7D A;  4BXF A;  1H9T A;  1WZ2 A;  2FJ1 A;  3HRT A;  2HR3 A;  2R7T A;  1QGP A;  2F48 A;  1ONV A;  1X19 A;  2XGC A;  4EJV A;  3I58 A;  2F5E A;  4P55 A;  4DOZ A;  2H27 A;  1MDM B;  3FX3 A;  2R93 J;  2HXI A;  2YS9 A;  4XRS A;  5B1B H;  4HX8 A;  3U1D A;  4CGZ A;  1I1S A;  2DYS H;  4KIG A;  4OIN F;  1Y0U A;  4DGW B;  3CP2 A;  1QU3 A;  2XIG A;  3GTQ J;  1JXS A;  2EIJ H;  2HQA A;  1VTN C;  2PJP A;  2HVQ A;  1XGO A;  4XRM A;  3F8M A;  2VLA A;  2DMN A;  2NS8 A;  4A6E A;  4CXF A;  4XLA A;  2MG4 A;  2HYJ A;  3K4N A;  3LSM A;  4X1E A;  2VXD A;  3W6J B;  3BC8 A;  2W48 A;  2M3A A;  1K83 J;  2KZG A;  2EA4 A;  4D5F A;  4D7N A;  5CPR B;  3AL0 B;  3Q0V A;  1UMQ A;  1OCZ H;  2XGD A;  3KP5 A;  2BY3 A;  2DA3 A;  1YW9 A;  3QOE A;  1SFU A;  2JPC A;  3J80 Z;  1AKH B;  4L18 B;  4KN4 X;  4ZH4 F;  1MBK A;  1R58 A;  4FE7 A;  3P7N A;  2H6C A;  3WGH A;  3S8P A;  4BXU A;  2UV1 A;  1YYV A;  3PL8 A;  4ON0 A;  1UHS A;  2DT7 B;  3IC7 A;  2ECC A;  2MSY A;  2NVU B;  4RMN A;  4XRF A;  1HLV A;  3V8L A;  5GPC A;  2X1C A;  2CG4 A;  5D6F A;  5BPD A;  1W7P A;  3OY9 A;  2V1D A;  3HRU A;  3ONQ A;  2HPM A;  4RB1 A;  4HZF A;  4L9J A;  3ZQ7 A;  5E18 F;  4ZTF A;  4YRV A;  4G12 A;  2CW0 F;  5FKM A;  1W5C C;  2HYG D;  1WPK A;  3A1Y A;  5DEQ A;  4CYD A;  4NB5 A;  4AU7 A;  5K5R A;  4ENM A;  1X3Z B;  4GYG A;  2QKM B;  4IVN A;  3LSJ A;  1F43 A;  4AWX B;  2ESN A;  1D8J A;  1TNS A;  2FX0 A;  3D5L A;  1R4N B;  3HYI A;  4BHC A;  2XVC A;  4G6D A;  4LLG F;  4BJ6 C;  3G6E I;  5EG0 B;  3ZQC A;  3ZXS A;  1U5T B;  2WY7 Q;  5D6E A;  4FT8 A;  2HDD A;  3KEY A;  3CO6 C;  2W85 A;  3O8G A;  2H94 A;  4HX4 A;  3VYR B;  3JRG A;  2JWT A;  2R7O A;  4G6Q A;  2QKL B;  2LTP A;  3FF5 A;  2V7F A;  2Z9O A;  1FIA A;  2ELK A;  1E2X A;  2CWE A;  2LLK A;  1LFP A;  1WH5 A;  2LDU A;  5EEG A;  3MD2 A;  2FF4 A;  3K70 D;  4CHU A;  2VOD A;  3I71 A;  3E97 A;  1P7I A;  3C2G A;  2Z1D A;  4KA4 A;  2BY0 A;  2IS2 A;  4BUP A;  1VQ6 I;  5DCM A;  2L9S A;  2VC1 A;  4IRH A;  3C2B A;  3LSI A;  3ISP A;  2ESH A;  5D5W B;  2ZCW A;  3I54 A;  1LB2 A;  4CCO A;  4CCN A;  3K4K A;  1S7O A;  1P92 A;  3KX2 A;  3TDZ C;  3TQN A;  5HS8 A;  3S1Q J;  3HG9 A;  2MW8 A;  2BVM A;  1T95 A;  3PNY A;  3OSF A;  1HKS A;  2DOE A;  1ZEL A;  4XSX F;  4BDY A;  2LKX A;  5DM7 F;  1G4D A;  1ZLJ A;  2M0C A;  2ZME B;  4KJZ A;  4DBQ A;  4IOC F;  3JAM K;  3KZI C;  3F72 A;  3ML6 A;  2A07 F;  5HLT A;  4NC7 A;  2EV0 A;  1QVU A;  2XSJ C;  1T56 A;  3A03 A;  5E1Z B;  4O6J A;  1TL8 A;  2H6B A;  3CUQ B;  4H0E A;  2KIQ A;  4HYE A;  4UB8 C;  2O9L A;  1ZN2 A;  3K9T A;  3VEP A;  4XKV A;  2WY8 Q;  2EIN H;  4R8H A;  2OPT A;  4QSH A;  4W1U A;  3M07 A;  1H9G A;  4XRS G;  1KU2 A;  1FOW A;  2P4W A;  4PJ0 C;  3GBG A;  1KU9 A;  2Z3Y A;  3BG6 A;  4G6T B;  3QYB A;  3VOE A;  3ABM H;  4E70 A;  4BXX J;  2DFE A;  2Q2E B;  1NK3 P;  3WG7 H;  3CC4 I;  1UHM A;  2VBX A;  2DFF A;  2R4G A;  1G59 A;  3T5X A;  4HA8 A;  2PLY A;  3SZT A;  4J19 A;  2ZME C;  3L2V A;  3H3V K;  2JPB A;  1Z77 A;  5M5W J;  3WGG A;  4XN3 A;  4ASN A;  2B7E A;  4KN7 X;  4PCQ A;  4ZYD A;  4RB2 C;  3GZ6 A;  1R22 A;  4N4N B;  4BKX A;  2DW4 A;  3FXR A;  2HDC A;  4IHS A;  1J7K A;  2OCC H;  3IH4 A;  1MJA A;  4CZC A;  1IV8 A;  1ETW A;  4BDZ A;  4R79 A;  2RN7 A;  1D5V A;  1F9N A;  1BA5 A;  3C7J A;  4G7Z F;  1ZTR A;  2NXN B;  3OYI A;  1IN7 A;  2TDX A;  3AG1 H;  3L2R A;  1MDM A;  5AIP A;  1ZRC A;  1K78 B;  2EV6 A;  2MLK A;  2W25 A;  3V8K A;  1ITY A;  5F0H A;  3SEZ A;  4KMF A;  2CQX A;  1VI0 A;  2L0K A;  3BG7 A;  3QP5 A;  3HBL A;  2HS5 A;  4GGG A;  1Z21 A;  1ON2 A;  3CMY A;  4MEY F;  3OYM A;  1HKQ A;  1X1D A;  1T38 A;  3DPU A;  1YQA A;  3BZK A;  3ZQH A;  3KEO A;  1K79 A;  2R7V A;  3DKX A;  5ED4 A;  1F4K A;  2A6H F;  5F0C A;  1YIT I;  1ZYR F;  2VJI A;  2NVQ J;  1SFE A;  1UG2 A;  1U5T C;  5FFX A;  2ZXJ A;  2H8R A;  1XDS A;  1VQ4 I;  2XHK A;  3JR9 A;  4RGS A;  1MBJ A;  3F6V A;  1KYW A;  3HSF A;  3GTO J;  4AVZ A;  2OD5 A;  5D4R A;  4HV6 A;  2O61 A;  3OYG A;  2HZT A;  5FD6 A;  3BR5 A;  4PJL A;  1X1C A;  5K5Q A;  4RAY A;  1OCC H;  3CP8 A;  3JRH A;  2XB5 A;  1FTT A;  4AID A;  1TWH J;  5FGM A;  2V9V A;  4C2U A;  1BR2 A;  2FEZ A;  5J4Y A;  4I0B A;  2CV1 A;  1TT0 A;  3BZ6 A;  1VQ8 I;  5HNH A;  1U8B A;  4UY8 I;  1W4M A;  1NG6 A;  2I10 A;  2PBI A;  3EYI A;  4IQ4 A;  4D0P A;  4G8X A;  3PIP F;  2R7F A;  5HDG A;  1JTX A;  1POG A;  1GT0 C;  2K9S A;  4KUM A;  2YU9 J;  2B0L A;  2LK2 A;  3HRM A;  5K7H A;  1VQK I;  2DA4 A;  2HZD A;  4E4H A;  1X2M A;  4ENJ A;  2QQB A;  3K2A A;  1EV7 A;  3SFZ A;  4L0Y B;  1PP8 F;  3DTK A;  2PMZ A;  3ASO H;  2K3P A;  4B48 A;  3C18 A;  4GRI A;  4IPA A;  2EQR A;  2VKV A;  3OYC A;  5FFZ A;  2FQ4 A;  2V1N A;  2VN2 A;  4ABZ A;  2XPU A;  2VPL A;  4L0Z B;  4BQQ A;  2ETH A;  2E2H J;  3HUG A;  3ECH A;  2AXT C;  3AG4 H;  4B3A A;  1T8I A;  5LLQ A;  2DFH A;  2ZNY A;  2F5C A;  3BG9 A;  2W82 A;  5F6F A;  2R3S A;  2IGK A;  3KCC A;  2RQQ A;  2KIF A;  4XR6 A;  2AQF A;  4S0H B;  4ESB A;  4FX0 A;  2B63 J;  4HF0 A;  3AKZ A;  2XGX A;  3VYT B;  1TQI A;  3REO A;  4EJO A;  1IDZ A;  1SMY F;  2O8X A;  3BOQ A;  2IPQ X;  1FOK A;  1R36 A;  4RB0 A;  2BW3 A;  4HX7 A;  1Q1V A;  3OSG A;  5F64 A;  4M3F A;  2K5C A;  4ZYG A;  4E7H A;  3HOY J;  1VQO I;  2MYS A;  5J40 A;  3JRE A;  3HOS A;  3ZMU A;  2X6X A;  3HOV J;  2XPV A;  2KRH A;  5JR3 A;  1YG2 A;  2EZH A;  5H20 A;  5LGU A;  3ERE D;  2PJR B;  2X4H A;  5GP9 A;  1BI0 A;  2V6E A;  1GUU A;  3IL2 A;  4I09 A;  2FUG 2;  1XC5 A;  2P5L C;  4A3G J;  4I76 A;  4I99 C;  5J3L A;  3J7A Y;  1B8I A;  4B47 A;  1NH3 A;  2O6G E;  2Y9Y A;  4BH9 A;  4BJ5 C;  2QLZ A;  1LFB A;  1BJA A;  2DQR A;  3J81 Z;  1RNL A;  5LEJ A;  3T8R A;  4AUX A;  2CMP A;  5LD2 C;  1Z3Y A;  1WQ2 A;  2OU2 A;  4G7H F;  1WRJ A;  1FSH A;  3Q3S A;  3ULQ B;  2A05 A;  3V7S A;  4NUB A;  4U0Y A;  1CF7 B;  2M7B A;  4BEH B;  1P6R A;  3WG9 A;  3OS2 A;  2WAD A;  2JUC A;  2DA7 A;  4BQO A;  3UKG A;  4PZJ A;  1X2N A;  4OU0 A;  1WHU A;  4ITV A;  1MSE C;  2QQA A;  2DA1 A;  2DA2 A;  1MD0 A;  3BP8 A;  3S3N A;  3L2C A;  3HGY A;  2R7W A;  5FRN A;  1TBX A;  1LVA A;  1SD4 A;  2YX4 A;  1XD7 A;  1F1Z A;  1YO5 C;  2M5W A;  3GLX A;  2HYF A;  5LHH A;  5E8I A;  3JRA A;  1LEB A;  1ODD A;  3CME I;  1YTY A;  3P9C A;  2H1L A;  1UB9 A;  4O5V A;  2QF7 A;  1QNT A;  3ZRG A;  1TWF J;  4A3J J;  4BY1 J;  2EA2 A;  5D5V B;  4QPQ A;  4X6A J;  1EH6 A;  3Q0U A;  4FQG A;  3SHF A;  5JVT A;  5CQG A;  4P1W A;  5EEH A;  3E7L A;  4RAG A;  1LFU P;  1E3P A;  4UUT A;  4BE1 A;  4IQJ A;  3S14 J;  3WTU C;  3FMS A;  3GFM A;  4MEX F;  1FJL A;  1D1A A;  2QYO A;  3A02 A;  3C3W A;  3QU3 A;  3JRF A;  2FBH A;  2W84 A;  2XF6 A;  4UVB A;  5DD8 A;  1SD5 A;  2K27 A;  4Y13 A;  1BI3 A;  5H2F C;  2E34 A;  2E1M C;  3A01 A;  3CCE I;  1TT5 B;  4M6Y A;  4ZDO A;  1EH8 A;  3FDY A;  3J81 K;  4MO7 A;  2CFX A;  2NOJ B;  4I6Z A;  2CUE A;  3CCS I;  2OTL I;  1FZP B;  1HCR A;  1WGX A;  3BWG A;  5DDG A;  1G6N A;  1FMV A;  2VJ5 A;  2MA3 A;  1A6Q A;  2BY2 A;  1BR4 A;  4GXO A;  1IW7 F;  2DQL A;  1J9I A;  1O4X A;  2M8G X;  1JKR C;  4YG2 F;  3PNV A;  4G94 A;  1YW7 A;  3PFY A;  3BQY A;  1XCV A;  5ICE A;  2ZSI B;  1TWA J;  4ENN A;  4P9U A;  4MTD A;  4IZZ A;  2Z2S B;  4EJU A;  3CMA I;  1I39 A;  2KKO A;  2ZXH A;  3CD6 I;  4UV8 A;  2OA4 A;  1OYI A;  1SAN A;  5HLH A;  3DPT A;  1W5T A;  2CFO A;  5CVV A;  1VQN I;  1ZGW A;  2HEO A;  1KU3 A;  1U6G A;  3I9V 2;  5J4V A;  2PN6 A;  2LY2 A;  3CCU I;  4U87 A;  3CTA A;  5C3E J;  1YW8 A;  1D0Z A;  1ULY A;  4M6V A;  4HST A;  1A36 A;  2MAB A;  1MH4 A;  4L5J A;  3DP7 A;  4BBR J;  4Q47 A;  1PUF B;  3BJ6 A;  3K7A J;  3ZN1 A;  1LKX A;  3BR6 A;  4OAZ A;  4V2F A;  4C3H J;  4A3E J;  3HXL A;  3K4M A;  2OF7 A;  3TDU C;  3S2D J;  1G3T A;  3V4G A;  3BPX A;  3J80 K;  3QPH A;  3WHC A;  2P81 A;  4KIF A;  1FX7 A;  1Z9C A;  1I5Z A;  1ZHF A;  1R1T A;  3LSH A;  1R00 A;  3GO5 A;  2F5F A;  3WTV C;  2VQG A;  3S2H J;  4LJZ F;  2CJJ A;  3G4S I;  3S32 A;  1VQ7 I;  2JT1 A;  4EV0 A;  2NOG A;  2ECB A;  3OIO A;  3HSR A;  2KZV A;  3HB9 A;  1RZ4 A;  1SVO A;  2GIZ A;  2KFD A;  2J5O A;  5M5Y J;  2FOK A;  4AYB N;  3HEF A;  1Z7L A;  3CDH A;  3K2Z A;  3GTJ J;  1O3R A;  5LFA A;  1BBY A;  2JZY A;  4M74 A;  2L9N A;  1FOX A;  4HNT A;  2VJJ A;  1D0Y A;  3QU6 A;  4NBQ A;  1K61 A;  2BE5 F;  1CGP A;  4YFX F;  4OMY A; 
#chains in the Genus database with same CATH homology
 3IAS 2;  3H5N A;  3OMY A;  2WA0 A;  3QOE A;  3DKY A;  3OOU A;  5HVQ C;  2IS6 A;  1WJE A;  4XNF A;  3S8P A;  2UV1 A;  3PL8 A;  4RLQ A;  3C2H A;  4ZDL A;  2DT7 B;  2BVL A;  3VYU B;  4RMN A;  1QHG A;  5HOO A;  2KMU A;  3RCO A;  2X1C A;  4HEA 2;  3MKZ A;  3OYN A;  2KPM A;  1DGW Y;  3OY9 A;  4IKF A;  2JSP A;  3ONQ A;  4PJJ A;  2HPM A;  3VYS B;  2I8D A;  3CF2 A;  3LSG A;  2LBF B;  3MKW B;  4BE0 A;  4ZTF A;  5KCM A;  4YRV A;  1N75 A;  2VIX A;  3IP4 B;  4PFP A;  4LG3 A;  4NQW B;  4XOT A;  3DLA A;  4XOR A;  5FRO A;  3A1Y A;  2R7U A;  4AU7 A;  2QKM B;  1J09 A;  2KHM A;  3A4C A;  3CES A;  1V5G A;  4HNU A;  3OL4 A;  3D5L A;  2X6Y A;  3M1C A;  4RM2 A;  3ZCO A;  4BJ6 C;  2K9L A;  1V5E A;  4ZDP A;  3ZXS A;  2WY7 Q;  1N78 A;  4F3Q A;  3KEY A;  4X0G A;  3CJR B;  3VYR B;  3OYB A;  2M4G A;  2R7O A;  2QKL B;  2DT6 A;  2DOA A;  4CUG A;  2L5Q A;  2F4I A;  2V7F A;  2X51 A;  3DU6 A;  3G2B A;  1LFP A;  2L7K A;  3DEE A;  3K4B A;  3MD2 A;  4JQF A;  4IX7 A;  1VZ0 A;  4BL0 B;  1UEL B;  2W1O A;  3K70 D;  1W36 C;  3C2G A;  2Z1D A;  4F91 B;  4XKC A;  2KLO A;  3EUK L;  2IS2 A;  4BUP A;  1WJA A;  2L9S A;  2JVG A;  4HG2 A;  4HPQ A;  3LSI A;  3OYK A;  3L2W A;  4J00 A;  3ZR8 X;  4XLF A;  3EUH C;  4FAS D;  4B3X A;  4CCO A;  2IGN A;  4PSX A;  1DQU A;  3DTI A;  1E0E A;  4CCN A;  3K4K A;  4PK4 A;  4D1Q A;  4CH7 A;  3KX2 A;  4ZYA A;  4CCM A;  3OYJ A;  2CW7 A;  1W36 D;  3HG9 A;  2ZSH B;  3H9Q A;  1AA7 A;  2BVM A;  1T95 A;  2IGM A;  3PNY A;  4BQN A;  1OLT A;  3DQV C;  3OYA A;  3SZG A;  1Z3X A;  4BE2 A;  3DWL E;  4BDY A;  1ZEL A;  1DGR M;  4F52 A;  3PUB A;  4BAC A;  3H9J A;  2LRE A;  4KJZ A;  2HDW A;  4HSR A;  4DBQ A;  4N4O B;  4PJN A;  4YEJ A;  2W00 A;  5TGT A;  4NC7 A;  4CCJ A;  5HLT A;  2XSJ C;  2VB6 A;  1S9H A;  2LOO A;  3N05 A;  3W2W A;  3PSF A;  2KQR A;  3PSI A;  2LRD A;  3VDX A;  2V4J C;  2GOX B;  2VQC A;  5KNL A;  2DJI A;  4XM3 A;  3OS1 A;  4E7L A;  2E60 A;  2MFZ A;  4XKV A;  2WY8 Q;  1LVK A;  4LIT A;  2VAS A;  3MKY B;  3GBG A;  3A2K A;  3BG6 A;  1MMD A;  3QYB A;  4G6T B;  3OL3 A;  2Q2E B;  2ZFU A;  4OAY A;  2HPI A;  4BU2 A;  2VKD A;  3FHN A;  1MW7 A;  2IS4 A;  2XC7 A;  1YE9 A;  2M0M A;  4U7B A;  2R4G A;  3OIP A;  1G59 A;  4C30 A;  1KON A;  3LFU A;  3K4J A;  2DCE A;  2LG4 A;  4DBR A;  2WB1 A;  3L2V A;  2E5Z A;  4XN0 A;  3AFH A;  4XN3 A;  4XKW A;  1X4O A;  3HC7 A;  4Y3O A;  2CW8 A;  4N4N B;  4XON A;  3HOT A;  3W2A A;  4XKB A;  1G8X A;  2CV0 A;  4CZC A;  3F9K A;  4BDZ A;  4R79 A;  2KL4 A;  2RNG A;  4F55 A;  3EUA A;  3BCB A;  3FKJ A;  4RLF A;  2R7X A;  3OYI A;  1V5F A;  4OWR B;  3L2R A;  2K9M A;  2X1E A;  2OUM A;  3ZGK A;  2X85 A;  3OYH A;  4C9Y A;  4PFO A;  3W3C A;  3SEZ A;  4CSW A;  3BG7 A;  3CJQ B;  1Z21 A;  4Y4R A;  3OYL A;  3OYM A;  2Q1Z B;  1X1D A;  3DPU A;  2R7V A;  4PJM A;  3DKX A;  2F6C A;  2Z16 A;  4F93 B;  3I3L A;  2MD0 A;  2M4K A;  2VJI A;  5CKT A;  3D5S C;  4NC8 A;  1BOB A;  3BCA A;  1OR7 C;  2P0W A;  2VXZ A;  2LC2 A;  4AVZ A;  3OYG A;  4PJL A;  1X1C A;  3CP8 A;  3E0J B;  3VSL A;  3K4C A;  3RQ4 A;  4B44 A;  2IS1 A;  2RRE A;  1SFK A;  4J01 A;  1YX3 A;  4EAT A;  4XL9 A;  2E5N A;  2UUZ A;  4C2U A;  1BR2 A;  2WAF A;  4CCL A;  1GLN A;  1IRX A;  1YX5 A;  3HPG A;  2CV1 A;  4BEH A;  1TT0 A;  2MC4 A;  5HNH A;  3RTR A;  3S3M A;  1NG6 A;  2CUJ A;  4IQ4 A;  3EPZ A;  3VWB A;  1R6R A;  3OYE A;  3BLY A;  3IUO A;  3H35 A;  3HPH A;  3OR1 C;  2JUG A;  2XF5 A;  4JOM A;  4KT6 A;  2CS3 A;  3K6G A;  2HZD A;  4E4H A;  5CQE A;  3LMM A;  3UNG C;  2X6W A;  3QOD A;  5KHD A;  2PMZ A;  3DTK A;  2K3P A;  2OV7 A;  1TZL A;  4B48 A;  4GRI A;  3HUG B;  3OYC A;  2L2O A;  2V1N A;  2VPL A;  4BQQ A;  4H4K C;  4PUS A;  2ZXI A;  3D5R C;  1LDK B;  2VQH A;  3RPU D;  4HRI A;  2V26 A;  2R7Q A;  2W82 A;  1Y56 A;  2IGK A;  3H5R A;  2RQQ A;  4XR6 A;  1WJF A;  2AQF A;  4C2T A;  1WJC A;  2XDV A;  3AKZ A;  3VYT B;  1MNE A;  2A6T A;  1PYV A;  4II2 A;  2IXS A;  4XQF A;  1Y6I A;  1SAU A;  2BW3 A;  4XLC A;  3UR3 C;  3H5A A;  3LL7 A;  4DIQ A;  1WJB A;  2LYC A;  3DTE A;  3NWT A;  4FET A;  2K5C A;  4DJA A;  4E7H A;  4B43 A;  3TMO A;  2MYS A;  3HOS A;  1X1A A;  2VKH A;  2O5R A;  2WAQ A;  2VJ4 A;  2X6X A;  3CMM A;  2CH0 A;  2KRH A;  2VQL A;  4XLE A;  5HNF A;  1U0J A;  3SYT A;  2Y0S A;  2PJR B;  3PJR A;  4E7S A;  3L2U A;  2V6E A;  3OYD A;  4XMY A;  4RM3 A;  2FUG 2;  1X1B A;  2W7N A;  3SEQ A;  3TBI A;  4II3 A;  3J7A Y;  1MMN A;  4B47 A;  4BJ5 C;  2BW3 B;  4BGD A;  1WJD A;  2KRC A;  2LH9 A;  1UG0 A;  2XAU A;  3K4L A;  4KIT B;  4D9J A;  2CUZ A;  2KP6 A;  2CMP A;  4AYB A;  1Z3Y A;  5LD2 C;  2AQE A;  4ZTJ A;  3QYE A;  4NUB A;  1WJ5 A;  1D1C A;  2OC6 A;  2M7B A;  4BEH B;  3OS2 A;  2WAD A;  2R7R A;  3VSK A;  4BQO A;  4E7Z A;  3PNT A;  4ITV A;  3TL4 X;  1EA3 A;  3H0D A;  3S3N A;  2R7W A;  4MLO A;  5FRN A;  3OWT A;  1N77 A;  2UWM A;  2A5W A;  4E7I A;  1MMA A;  1K6Y A;  1WFX A;  3ZRG A;  3HKZ A;  3NWS A;  2V9K A;  3S93 A;  2E1M B;  4YEL A;  4E7K A;  4QPQ A;  2HVS A;  2DXI A;  5CQG A;  3SDB A;  3S3O A;  4P1W A;  3OR2 C;  4KIS A;  1T0F C;  4NNJ A;  4BE1 A;  2HNH A;  1D0X A;  4IQJ A;  1FMW A;  1X4P A;  2CV2 A;  2W4S A;  3FBI B;  1D1A A;  2XF6 A;  2IGO A;  2E1M C;  4E7J A;  4ZDO A;  3W2V A;  3FDY A;  5FRM A;  2X1D A;  2XF7 A;  2M7A A;  2NOJ B;  1JI8 A;  3RSN A;  3M8J A;  1FMV A;  2F5V A;  2VJ5 A;  4BJT A;  1BR4 A;  1D1B A;  3MMY B;  3PNV A;  3HL2 A;  3V42 A;  4Y33 A;  3KYL A;  3PFY A;  1UAA A;  2ZSI B;  3AL0 C;  4LIU A;  4ZC3 A;  2Z2S B;  4IZZ A;  3ZQQ A;  3OYF A;  2LBF A;  4XOP A;  1HA8 A;  3OIQ A;  3L2Q A;  2ZXH A;  3DPL C;  2WAE A;  3QYF A;  3DPT A;  2JA2 A;  2CFO A;  4ANJ A;  2ELJ A;  3IAM 2;  3I9V 2;  2LY2 A;  4U87 A;  1QHH D;  3FBN B;  1MMG A;  1D0Z A;  2BOL A;  2GOM A;  1ERD A;  4HST A;  2MAB A;  4XLH A;  5JHF A;  1MND A;  2HVR A;  4BS9 A;  1BR1 A;  4BXF A;  1LKX A;  4OAZ A;  4QPO A;  1NG7 A;  3HXL A;  3K4M A;  3K70 C;  4PSW A;  4E6K G;  2R7T A;  4F92 B;  3H9G A;  2JVH A;  3OS0 A;  1X19 A;  2KDO A;  2R7S A;  4CCK A;  4DOZ A;  2VL8 A;  1DP3 A;  3LSH A;  4CA0 A;  2VQG A;  3S32 A;  3E1S A;  2WBM A;  4ZJZ A;  2KZV A;  4DGW B;  1QU3 A;  3CP2 A;  2HQA A;  1Z7L A;  2HVQ A;  2HU9 A;  2PJR A;  3K10 A;  1P9Q C;  2VLA A;  4P5O A;  5LFA A;  1PJR A;  4XLA A;  2L9N A;  4HNT A;  3LSK A;  3K4N A;  2VJJ A;  3LSM A;  1D0Y A;  2VXD A;  3CZ6 A;  3BC8 A;  2M3A A;  2LY1 A;  3DU5 A;  3U21 A;  5CPR B;  3AL0 B;  4LIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...