2ELJA

Solution structure of the swirm domain of baker's yeast transcriptional adapter 2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
GSSGSSGNMTISDIQHAPDYALLSNDEQQLCIQLKILPKPYLVLKEVMFRELLKTGGNLSKSACRELLNIDPIKANRIYDFFQSQNWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional adapter 2
publication title Solution structure of the SWIRM domain of baker's yeast Transcriptional adapter 2
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 19
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.780 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2eljA01
2CUJA 2DCEA 2AQFA 2ELJA 2AQEA
chains in the Genus database with same CATH superfamily
1ETKA 3HDDA 2K86A 5K1YA 4XRFA 2GOXB 2IBDA 2DAOA 1S29A 1O3SA 5H6QA 2W57A 4V2GA 1HF0A 2W24A 3KP6A 3P5JA 1H9TA 3RTRA 2L4MA 5H2FC 4KUMA 1PP8F 3RYRA 2QA4I 4UY8I 5F0CA 4KDPA 2M4GA 4PJJA 4R79A 3BR2A 2H1LA 3OSFA 2EFPA 4JBAA 2AXTC 1D8KA 3GFIA 4MNUA 2P7CB 1ZR4A 3BR1A 3V8KA 4BDZA 4WWCA 1IUYA 2DK8A 3G73A 3GTMJ 3GLLA 2IVMA 2RGVA 1P4XA 2XSJC 5CVIA 4LB6B 2M3AA 3ZN0A 2MFZA 2OQGA 4E70A 3Q0UA 1N78A 1LFUP 4UV8A 1YE9A 5BPDA 2MABA 4BEHA 3U21A 2XF5A 3A03A 5EF6A 2PLYA 2GA1A 3TMOA 2H8RA 3D0SA 4XSXF 4OIRF 3F22A 3V7SA 4IZZA 5J1YA 4XICA 2LK2A 4J19A 2TCTA 2FNAA 3WTUC 2EIMH 1H8AC 1T8IA 3RZOJ 1GHCA 4OIOF 1YYVA 2V6EA 4GGGA 1X1AA 5D6FA 5DDGA 5LLQA 1I3AA 1USSA 4XKCA 4NB5A 2BY0A 2BHYA 4HA8A 3JRAA 5FKKA 4AYBA 2KZGA 1TWGJ 2HQRA 2LY9A 5K7HA 2PEXA 2BE5F 3IAM2 3BJ6A 3GZNB 4K2EA 5GP9A 3MAJA 2HTJA 2NS8A 5ICCA 1GDTA 2R92J 1FSHA 1R22A 2JA6J 4RGRA 2CUZA 3EYYA 1GLNA 3CCSI 1BC8C 1G3YA 3E7LA 1NK3P 1U9OA 3HPHA 4B47A 3MEXA 1HDDC 2W82A 4LLLA 3QAHA 4HBLA 1YW8A 2N8GA 1EF4A 4PSXA 3GW2A 2ZXWH 3IUOA 1GVDA 1MNDA 1H88C 3BC8A 3VODA 1ZG5A 3VYSB 4I01A 2E19A 1L3LA 3VFZA 2H27A 4A3BJ 3MWMA 1FX7A 2E7XA 4XRSG 1TP4A 2JA5J 3H5NA 2ZSHB 2DBBA 4EMSA 1M1EB 2BXYA 4PGHA 5ICFA 1ZARA 2QYOA 5FLXK 4FASD 2M87A 3R6SA 3RKQA 4ZYAA 1V54H 1X3WB 3A01B 4PJMA 1LVAA 1TZLA 4IF4A 3OYLA 5IP7J 2E1CA 5L3FA 4E7KA 3TEDA 4M6YA 3F21A 4M9XA 2PFBA 2F4OB 3QPHA 3HOYJ 4C30A 2BYVE 1GXPA 3C2BA 1FP2A 4ZDPA 2MSYA 1FBSA 1ODDA 1RZ4A 4N0BA 3V8JA 1HKSA 1X3UA 1E0EA 1YO5C 2OV7A 2XRLA 4BQOA 2MH2A 3VWBA 5K7FA 4EGYA 5FKOA 1JUPA 2VIXA 3PNVA 1Y1WJ 2KLOA 4ZZDA 1B59A 2M8EA 3IRRA 1F43A 1V5FA 1ETYA 3MQ0A 1UAAA 1ETQA 3RCOA 5JFRA 4E7ZA 3DEWA 2JTVA 3ABUA 2F2EA 2LNBA 1YS7A 4RS8A 1Z6TA 5E17F 1IRZA 3D5LA 5D8LB 3RYPA 5A2QZ 1AOYA 5D5UB 4PZJA 1FIPA 1JUMA 2RVCA 2L9VA 1F9NA 2A5WA 5JVGF 3HOZJ 4G94A 5B1BH 4NHJA 1AKHB 3BZCA 1HQCA 1S3JA 1Y56A 5BPIA 4KN4X 1VQPI 3HHHA 1BW5A 2IS4A 3KCCA 1LEAA 3K4BA 5DD8A 3AL0C 2DMPA 5BNGA 1QO0D 1R1TA 3OL3A 4UUVA 2AS5F 1X1PA 5DYMA 3K10A 2KJCA 3WTWC 2XKOA 3G1LA 3CCVI 4XLPF 3QPTA 1RR8C 4BYYA 3WTZA 4D5CA 2R7QA 2KPMA 4XORA 4DBQA 3OIOA 4EVIA 2DDAA 2GIZA 3A01A 3ABMH 4F7ZA 2ELJA 1N77A 4YG2F 5LEKA 1MSEC 2B63J 3J81K 1ZREA 4JP0A 5E18F 1T0FA 2M1BA 1OYIA 3FK7A 4CXFA 3HOXJ 3BZKA 1YLFA 2JPCA 3GFMA 3Q0VA 5HDGA 2JWTA 4XOTA 3PIPF 3H0GJ 5LBQA 4CYDA 4A3MJ 2EV0A 2UXXA 2KRCA 1I1GA 1N75A 2XGXA 4AM3A 2HVQA 3KE2A 1DPRA 1T56A 3KLNA 5KVRA 4A3GJ 4PFOA 4CCKA 4CYCB 1MMGA 4G7HF 4XLAA 2M7BA 3OS2A 3BTIA 4EM2A 3H9QA 2STWA 5LGNA 3LAJA 3PO3J 4P96A 1IUFA 3RKXA 5FD5A 4EGZA 2ESNA 2E1OA 2O03A 3E6CC 4AIJA 3GCMA 5EG0B 2L01A 2BW3B 4Q47A 3GTLJ 2E71A 1QRYA 3EUAA 3KP4A 3L2UA 4EM1A 3HRTA 1AKHA 2V4JC 3DBLB 1OCPA 3U2RA 1JKQC 2DMQA 3KZZA 1MDMB 5J6XA 2QBYB 4A6EA 2CW0F 3ZOBA 4HSRA 2MC4A 2VKEA 1A5JA 5F08A 3FMRA 1VZ0A 3I64A 1Z77A 5EEGA 3IHUA 2GAUA 5FB2A 1IG7A 1MJAA 4BDYA 4B48A 3PJRA 4X6AJ 4L5JA 4A5MA 4LK0F 2LR8A 2YX4A 3CCRI 5E8IA 5E1XA 4OAZA 3ZCOA 2HXOA 2DMUA 4RGUA 1MMNA 2CV2A 4XRSA 4A3DJ 4D1QA 3GVAA 2E5ZA 3IL2A 1KU7A 3JAMK 4E7LA 5KAFC 4RAGA 4M74A 2OZ6A 2L7ZA 1ZGAA 1H0MA 5L3EA 4BHPA 3JRGA 3J7AY 3JRHA 2MG4A 3QYFA 2X48A 3VB2A 2V1UA 5D4RA 4HNTA 2EFNA 1FJLA 1ZLJA 1S5LC 4LIVA 3B6CA 3CESA 5F27A 3OIPA 1W1WE 5GPCA 3CO6C 2FX0A 5IOZA 4CYCA 1XDSA 2F5CA 1K78B 3CP2A 1WCMJ 2ZNZA 2CV1A 2DTRA 4XBFA 1T39A 5E79C 1MJ9A 2W7NA 1GUUA 1Z3XA 3EPZA 2K9SA 5K5RA 1WKMA 3P7NA 2R7RA 2WAQA 3A2KA 5EG0A 3AAFA 2DT5A 1CF7B 2F5FA 5IT3A 3GYHX 1HLVA 2VQGA 1IN5A 1X3ZB 2HOTA 3ABKH 4CHUA 1QVTA 2HQNA 3KEOA 1TNSA 5EDNA 2DN0A 3FXJA 2QBYA 5BMZA 3S16J 1LNWA 2F5VA 4XIDA 2HXIA 1FP1D 1MJBA 3COAC 3CTAA 2VJ5A 1I39A 4ENMA 2KISA 5J4VA 1MBGA 4PSWA 4OU0A 3VSLA 2WB1A 4XN3A 3D1NI 3GEZA 1R6RA 2E2IJ 5M5XJ 4TV7A 2BOLA 4PJLA 5CVUA 1FPQA 5ILUA 1AWCA 2LTPA 2GXAA 3UR3C 3H9GA 1UJ8A 3I56I 2YSRA 3J7YJ 4IRIA 2MLGA 2KMUA 2X4HA 2VE9A 4KYWA 3ROUA 2HR3A 2LKXA 2DOEA 1JUSA 4ZDLA 4CCMA 4A3KJ 1WJ5A 4BE0A 1LB2A 3BPXA 5CKTA 1A04A 4B3XA 4H4KC 1G6NA 2GXBA 3J80K 1Z7UA 3L2QA 2DO7A 1VQ6I 4I0AA 1FOXA 2O6GE 2K4BA 2CH0A 3DPLC 3U1DA 4B43A 2XROA 3CD6I 1Y0NA 3K69A 5M3MJ 2DYSH 4YRVA 2Q2EB 1WJDA 1K78A 2LF7A 4Y17A 1D3YA 2D2WA 1WH5A 2V26A 2MA3A 4HNUA 2E2JJ 2AQEA 3K70D 1YFHA 3IV5A 3AG4H 1KZHA 3RSNA 1AA7A 3U1KA 2K5CA 3VYTB 2OTLI 1E3PA 1CF7A 2CJJA 5JHFA 4ZJZA 3CMYA 5AONA 5B3SH 2X85A 3J7AO 2VOPA 1WJCA 4PDKA 1YS6A 4I76A 1OPCA 4R8HA 1BI3A 1RESA 3SDBA 4KITB 2UZKA 1K4SA 1TWFJ 2AO9A 1JGSA 1NG7A 1LDKB 1YX5A 3PNYA 3LNQA 3BG9A 2ISYA 3OL4A 3W3CA 2PMZA 2JK3A 4IKFA 3ECHA 1WZ2A 4P1WA 3DTKA 2CYYA 4BQAA 1FBUA 4DGWB 2W84A 4ABZA 1HW1A 1YITI 3DPTA 1KYZA 4B09A 3BWGA 2PQ8A 1U8BA 1OCRH 1VQLI 3L7WA 4KICA 4HDVA 3CUQC 1F4KA 2PN6A 1GT0C 1Q1VA 3LSRA 4L0YB 2Z2SB 5LGUA 1SEUA 2JA8J 1EV7A 3O8GA 3V42A 2WV1A 4BS9A 1QPMA 2HYJA 3JRFA 3HHGA 2CUFA 3E6DA 2P0WA 4XN0A 1OQYA 3RZDJ 4IXAA 1QHGA 1DP7P 1UHWA 1KU2A 3LSKA 4LG0A 2A05A 3H0DA 3GFLA 1ITYA 5AIQA 4E4HA 1O3RA 4FISA 1BW6A 2COBA 1HW5A 3LQQA 4W97A 2O8XA 3B02A 4IL6C 4BKXA 3ZQHA 2V9PA 1IN4A 5CQEA 4E7IA 3JRCA 5HVQC 4NQWB 1R00A 4ZYEA 1IAWA 1X1CA 2Q2EA 4HZFA 2QLZA 2GZWA 3ZQFA 4U0VA 1K83J 4A69C 2HVRA 2E35A 4Y4RA 1AU7A 2OU2A 1KQ8A 4IOCF 1MMDA 2WA0A 2EFQA 1T95A 2QQBA 3SZPA 3JTHA 1BIAA 2BVLA 3ZQLA 1JKRC 3CMMA 5DD4A 2VL8A 5BQTA 2JPBA 3RQ4A 4WXHA 4I2OA 3RPUA 2R3SA 2EH3A 2Z16A 2YR2A 3OOUA 3GXOA 1WHUA 3HYIA 2HS5A 3OYGA 2L54A 3I3LA 4Q5SF 2HGCA 3W6VA 1IO2A 4GXOA 3GFJA 2QGUA 1MW7A 2K9QA 4BL0B 4RB0A 3AFHA 4U7DA 4IHXA 3DTIA 3GZ5A 4J00A 2R0QC 2JRTA 1EH7A 5F6FA 5GAGJ 5K5QA 2GOMA 2Y0SN 2ESHA 3WTSC 1IXCA 1MBJA 1X4OA 2ECBA 2TRTA 3VDXA 5K7ZA 1RRJA 1ZLKA 1T08B 3BTLA 2M9HA 2ZJ2A 2ZC2A 4PGGA 2WADA 5CLSA 2WY8Q 2XV4S 4D0PA 5HOOA 2BZTA 1D0YA 3PFIA 1ZHFA 3ZMUA 2A69F 4S05A 3M7GA 3IH2A 3K9TA 2PI0A 1J59A 1B6AA 2EIJH 4ZYHA 1BJZA 3ISPA 1SFEA 2BVMA 2XGCA 2ZCWA 3S8PA 2DYRH 1XTAA 3H9JA 4UVAA 3ONQA 1F1ZA 4I6ZA 2BGCA 3HKZN 3S32A 1YQAA 4DBRA 4ITVA 3PUFA 5HLGA 5DCMB 3DCFA 3MZ8A 4AUXA 2KHMA 4HG2A 3PIOF 3F8MA 2KP6A 4NBQA 2YUSA 5E3MA 3T8RA 4NQWA 3L2WA 4L0ZB 4F55A 1K79A 4WF2A 4AVZA 2R7XA 4A0ZA 5DM7F 3JRDA 4A5NA 1L0OC 3BLYA 1Z91A 2HNHA 3CF2A 2QQ9A 2RV8A 1RKTA 2VBYA 3MD2A 1D5VA 2UXNA 3MKWB 2HDWA 2YX7A 2CQNA 2LOOA 4F52A 4C3JJ 3FBIB 1IN7A 4DNCA 4XLFA 4II3A 3JCUC 2JT1A 3BDDA 5L3BA 3I4MJ 1RC9A 3KETA 3OS1A 4ENKA 3CC4I 3AL0B 3WU1B 1FZPB 4MLOA 1HCRA 2HZTA 1SD6A 1XCBA 3GO5A 3K4NA 2V6CA 4XONA 2IS6A 1I50J 2XGEA 1O4XA 5KCMA 3F23A 3CMAI 1QU3A 1VNDA 4Q4ZF 3CC7I 2KIFA 1ZELA 3NRVA 2KIQA 5EZHA 2EPFA 3L09A 2DJIA 1FMWA 5IYDJ 3TOBA 4C2UA 4G7ZF 4IVNA 3OYDA 5IP6A 3T0YA 3LSMA 1W0UA 4HF2A 4HF1A 1QHHD 2UV1A 2NRAC 2XVCA 3S3OA 1RR7A 2DA5A 3HB9A 1YIOA 4JK1X 5E8GA 5EJCA 1V3FA 3FMQA 3HEFA 3LAPA 3R0JA 4MQ9F 4CUGA 4FX4A 2ECCA 1DU6A 4IX7A 1P2FA 1I3QJ 2O7OA 2ME0A 1ULYA 4Y15A 1SMTA 3K1MA 5CQGA 1LVKA 1G3SA 5ED4A 4DZPA 1ZYRF 1J2XA 2X6YA 2CGPA 4JOMA 2FMLA 2WAFA 5GADJ 3WG9A 1YOVB 1IW7F 4WXDA 3F72A 4Y13A 3C7JA 3ZQGA 4F91B 3DBHB 2Y2ZA 5CPRB 1SFUA 1WJAA 1TNTA 3R60A 2VQHA 2F6CA 3CDIA 2VT3A 3T5XA 4XSZF 2OJED 2EZKA 3FXMA 4KMUX 3ZPLA 1MD0A 2OBPA 2ZKZA 3DQVC 3TDUC 4P5OA 3G2BA 3DKXA 1EKEA 3KP2A 4ENJA 1XS9A 4KFCA 2DFIA 4U7BA 2DW4A 3K7AJ 3CDLA 3H1CA 1HKTA 3ESWB 5EEAA 5FLMJ 5F04A 2IP2A 1UCRA 2A61A 2IA2A 1X1BA 3O2PE 4B1RA 5F0HA 3CCMI 1U5TC 4GFBA 5K5OA 4O5VA 2NS0A 3IKTA 5HLIA 3OOPA 4NC8A 2LY1A 2E1MC 4IHWA 2GQQA 3GTPJ 2X6OA 1SAUA 5FFZA 2TDXA 4DZJA 3RPQA 1Y8QB 2VUMJ 3ASOH 1J7KA 4EEFG 1IN6A 4PJ0C 4BAYA 4Z6YA 3N4MA 1XSDA 4AIDA 5IYBJ 4F92B 3WTVC 3GTGJ 1BN5A 1OR7A 1UB9A 2I8DA 4MQVA 3SHFA 2F5DA 2KRFA 3QPSA 1FBQA 1R5HA 6PAXA 4FCYA 3H3UA 2ZJPF 2KT0A 1FOYA 1HOMA 4XM3A 1JE8A 1TL8A 5M5WJ 3BCBA 2ISZA 2LD5A 1OJLA 2Y48A 2V79A 4N9IA 2EFOA 2QCOA 3IH4A 2BEOA 3VYUB 4M3GA 1QA6A 4FHTA 1ZRFA 3K4CA 3HJEA 1GV2A 2NVTJ 2VJ4A 2Y9YA 2I5UA 3IWFA 4ZDOA 3FISA 4AVPA 2RKHA 1ZKGA 4XLNF 2L7MP 2JSPA 2DT6A 1WSUA 3SFIA 2XAFA 4G6TB 2KIUA 4BXXJ 4HLXA 2FUG2 2MYSA 2IEKA 3IKVA 5A2QK 4BHBA 3CLOA 4GCVA 2ZJQF 2GIVA 4FQGA 4XMYA 4BY1J 1FYLA 1K7AA 2ADUA 3GWZA 5BS6A 3PQKA 5D4SA 4NC6A 3W2AA 4AWXB 3OWTA 4BXUA 4DIQA 2RNGA 1I6HJ 4ESBA 2OQRA 4IPAA 1S6LA 3HRMA 1I5ZA 4XKWA 2OAZA 2MD0A 1IN8A 3EUKL 4MEYF 2PMUA 4KISA 1HC8A 3E0JB 1EA3A 3S1RJ 4MEXF 2IS1A 3VEPA 3ERED 2JZYA 2WY7Q 3ERMA 5LRSA 2JRMA 2BY2A 1TLHB 2H6BA 3IAS2 5HLTA 2K40A 3A0BC 1Y8RB 4I7HA 2CV0A 3MMYB 1V5EA 5FO5A 1ZN2A 4DYQA 2VXZA 3DU5A 1D1BA 2J5PA 3H92A 1VQ4I 1YRNB 4AU7A 4CCOA 2DK5A 2Y69H 2GWRA 2XPVA 1TWHJ 3CZ6A 4CO8A 1I1SA 3N97A 2HTSA 2L02A 4RAFA 3F8BA 4CICA 1MBKA 4OIQF 3K4LA 3GZ6A 2LLKA 4BNCA 4L5EA 3DEUA 1TQMA 2D1VA 2MH9A 5FLXZ 2GM4A 3R4KA 1R23A 2EILH 1U3EM 3HTUA 5DTDA 2JN6A 2VQCA 1EH8A 4UV9A 2RNJA 4NC7A 3HRUA 5HS9A 1A6IA 2OCEA 4HV5A 1NTCA 2KJBA 3DV8A 4CCNA 4L9NA 2R7TA 1BOAA 1FY7A 4B8XA 5J3LA 2G0EA 5C3EJ 5LHIA 4LFUA 1KQ0A 1LUJB 3TOAA 3ML6A 4E6KG 5HLHA 2XB5A 4A3CJ 4U0WA 1XSVA 1OCOH 3ZMVA 3GTKJ 4ZH4F 3H35A 4RM3A 2VPRA 4UUTA 3V7CA 2RDPA 1DPUA 1O57A 4F3QA 1MBFA 3C2HA 4BGDA 2FF4A 1KA8A 4AIHA 2VI6A 1IRXA 1JTYA 4BQQA 2EV5A 4QLCU 4GRIA 5HDKA 2HDCA 4LOCA 4C2TA 4M9SA 3HSRA 5CYVA 3RQIA 2FMYA 1F5TA 1ONVA 1MNMC 3DPUA 1R49A 1TT5B 2QENA 3EQLF 3GTOJ 2CS3A 3FF5A 2V7FA 3BJOA 2A07F 2E60A 1W7PD 3DEEA 1TQPA 1Z9CA 3CUQB 5LHGA 5FRNA 1FNNA 3LSPA 1BA5A 3I55I 3PFYA 3CF5F 1J0RA 5IOYA 3S93A 2RQQA 4NUBA 1Z05A 4XL9A 1YJ9I 1YRNA 5J1UA 2EA2A 4AYBN 3OSGA 2L3DA 2FJ1A 1SFXA 4YFNF 5HS8A 2A6TA 2R93J 3OR1C 3S1QJ 1HW2A 4BQNA 3DKWA 4AIKA 4GDFA 2EBIA 4BUPA 1XGOA 1SAXA 3F8CA 2CUEA 4MFEA 4IEJA 2P4WA 2OPTA 4G12A 2EV6A 2LY2A 3E5QA 3FIWA 1G59A 3HSEA 1R4NB 3GMEA 1MMSA 3M3YJ 3M8EA 1DDNA 1PVEA 4YEJA 2LRDA 4CGZA 2RREA 2A6HF 2W48A 2PJRB 1UZCA 3QOPA 4RAYA 1JI8A 1D1CA 1WI3A 2P5KA 5IYCJ 2D1HA 5H6RA 3HL2A 2R7ZJ 3ZN1A 4BU2A 4A3IJ 3IC7A 3GLXA 2DCEA 1KQ9A 1XX5A 3WTXC 3BJAA 2Q1ZB 3AG2H 2FE3A 5LD2C 5JI6A 1CQTA 1W5CC 2DFFA 3FMSA 1B9MA 1EJ9A 2H1KA 4HOBA 3ZMDA 1T38A 3OS0A 2X1DA 2E34A 2ELHA 3ZRGA 3DBRB 3VPRA 5D5XB 3BQYA 3KLOA 2BBYA 1RNLA 3HSFA 4JX4A 2XAJA 3CCQI 3QU6A 3KP5A 3WTTC 2UUZA 5HODA 4DJAA 2M5WA 2FQ4A 5EZGA 3DWLE 5IT9Z 2M2EA 3K0LA 3H3VK 3TO6A 3C18A 1QZEA 3RIRA 4C2MJ 1TQIA 1U2WA 3HTSB 5ILSA 1WWXA 3SEZA 1S7AA 1ZG3A 3H5RA 4LIUA 2VLAA 1UG0A 5IY5H 2FBHA 3JREA 2JUGA 2BW3A 2XB0X 4WXCA 2P8TA 2YS9A 1BI0A 4DQ2A 3HOSA 3I4NJ 1D1AA 3F6OA 2OF7A 2ZJRF 2QM3A 1MDMA 1D0ZA 5L3GA 3JW4A 5HS7A 3OYHA 5FFXA 4L9JA 2XF6A 1J09A 2OA4A 2H94A 3GUDA 1GVJA 4NDLA 3S3MA 4CZZA 1B4AA 2OC6A 4EM0B 1SC7A 1IJWC 3TP3A 1A31A 3J7ZI 3ZMSA 4UVCA 4IO9F 5LEJA 2G7HA 4A3FJ 1XMAA 2JVGA 3O8HA 2PJRA 3FXKA 2VODA 2YU3A 5J1RA 3H36A 5LGTA 4P9FA 2EZIA 1TC3C 4U88A 1K6OA 3PUBA 3RI4A 2HPMA 1XPXA 3CC2I 2O61A 2ELKA 3MKLA 4DYRA 2HWVA 4IOAF 2IXSA 4X1EA 4XKVA 3JTGA 3VSKA 1R1UA 4XR6A 5FROA 3WE2A 1U0JA 3A4CA 4HQEA 2DI3A 1E17A 2VONA 1W4MA 1XCVA 2L9SA 3KPHA 1Z21A 3FK6A 1O3QA 4UHTA 5E1WA 1WJEA 1VFCA 1VQ5I 4M72A 2O0YA 4YIRX 4OMZA 5EYRA 4EATA 2CO5A 1VQ9I 1QNTA 2XIGA 3C2GA 3OYFA 3FXUA 3EUHC 3SYTA 2JUCA 4E7HA 1RETA 1OKRA 3M9AA 4PK4A 2YPRA 1JKPC 4RMNA 3HG9A 3LSJA 2EFWA 3HRSA 3OR2C 3LMMA 4A6DA 1ON2A 1J5YA 1P6RA 4QSHA 3GF2A 2HQAA 2Y0MA 1TBXA 4LB5A 1ZAOA 2K02A 1KONA 3LSTA 3TGNA 2O3FA 2X6XA 2L7FP 5E20A 4JYKA 1IF1A 5ILVA 1ZGWA 4WK8F 3CJQB 4OWRB 2NNYA 2DA1A 1DGWY 3LL7A 1Z3YA 3DU6A 3CLQA 3OYNA 5FD6A 3QP5A 3BG7A 3P9CA 2DMTA 3OIQA 2R7SA 3QQAA 1R58A 2F48A 4KT6A 1VQMI 4EJVA 3ZQIA 3ECOA 3HUGB 1SVMA 4XQFA 1Y6IA 2G7UA 1S8NA 3E6MA 2QF7A 3CDHA 3HOUJ 3NAUA 2K27A 4ESFA 2X51A 2EA4A 2EZHA 3KP7A 2OCCH 1XDUA 1HA8A 1R5ID 1JJ6C 5ERIA 2IA1A 1LDDA 4HX8A 2DOFA 3M1CA 5J8FA 2DPUA 1UHSA 5L3CA 3WODF 1PJRA 1U5TB 3RKYA 2XPUA 5KK1A 4LLGF 3WTYC 2E1MB 2GA2A 3WU0A 3LSIA 2L9RA 4N4NB 2MC3A 4LJZF 2O9LA 4KIBA 5CVRA 2GXGA 2CWEA 2VT2A 2P81A 4E7SA 5EGOB 3S3NA 2GLOA 5FLVA 1GV5A 3K1PA 1ZRDA 1TW3A 1APLC 1UG2A 2DA7A 2NAZA 4YIFA 5GTHC 4V2FA 2P7VB 3KZYA 1SFOJ 3RDIA 3M07A 4OINF 1V4RA 1K4TA 2OZUA 4ZTFA 1MH3A 2M34A 1JT6A 2VC0A 1OCTC 2D5VA 1ZK8A 2VKVA 1W5SA 1TWCJ 2ZMEC 5CJ9A 3DKYA 3OYMA 1ZRCA 3KYDB 2NXNB 3WE3A 2ZXJA 1YI2I 3FHNA 2RC4A 1VQOI 2AQFA 1RIOH 1YTYA 3G1OA 1NHAA 2WAQN 1P92A 3BTCA 3A1YA 3BZ6A 3S14J 3Q9SA 3HOWJ 2CW8A 2FBIA 1IDZA 4XKBA 3GX4X 1HSJA 2P5LC 1V55H 1SVLA 2DA2A 2ZSIB 2X1EA 3NQOA 3FKIJ 4A3LJ 4XLEA 1FEXA 2NS7A 1NK2P 1PYVA 5EEHA 2XDVA 4CA0A 4H0EA 1R9TJ 1MIJA 2ZNYA 2A68F 2IS2A 1KU9A 3DLLF 2P6TA 3ZMZA 1J75A 3R61A 4D5FA 5DV5A 4FX0A 3QRFF 1UFMA 4HW0A 5E3OA 2CQKA 1IRGA 3K6GA 4LITA 1U9NA 2FSWA 1BOBA 1H89C 3C1DA 1WRJA 1U5TA 3FM5A 1WQ2A 3E5UA 2ME6A 2R7OA 4IQJA 4HX4A 3CMEI 2DA4A 2WV0A 4W1UA 4HDUA 1QQIA 4XRMA 4P9UA 5EGOA 4IHSA 2HZDA 3IP4B 2FBKA 3KYCB 3AG1H 2R7FA 2ZXIA 2DOAA 4QTRA 3TO9A 1D5YA 3MCZA 2QSGX 1BJAA 4MTDA 2XF7A 2FRHA 4UXNA 1BM9A 1ETVA 4B4CA 2E1NA 5BOXA 5HNHA 2VN2A 2IGNA 2XAGA 3BG5A 4RB1A 2JJ7A 1FYMA 5DUKA 3GTJJ 3I0TA 4KN7X 2UWMA 4ZYGA 1XMKA 5DEQA 4G9YA 5FKNA 4N4OB 1BR2A 1Q1HA 2LKPA 2QQ8A 5KHDA 2CU7A 1S7EA 1LFBA 4MTEA 4RGXA 4P55A 2Q0OA 3QWLA 3CJTB 4BBSJ 3HM5A 1QBJA 1ORKA 1U8RA 4BEHB 1LFPA 3S1NJ 5FRMA 4RM2A 1XSXA 1G4DA 4BE2A 3K4KA 1DUXC 2OD5A 2JMWA 2DTZA 3NWTA 2MD5A 4C3IJ 1UHMA 3BT9A 3I9V2 4R1HA 4KT5C 3BROA 4O3MA 2MLKA 1ZG1A 3G4SI 2DFEA 1K61A 2PMZN 2Z5UA 1DP3A 2HQ5A 1E2XA 1MKMA 5TRDA 3E5XA 2NOJB 3CCYA 3LSGA 5E1ZB 2QWWA 4HSTA 1O3TA 2CW7A 2X1CA 3BPVA 4XK4A 1SD5A 4MIMA 3HBLA 3FXLA 4RLFA 1TWAJ 2Y75A 4FT8A 3ZQQA 2XAHA 2MBFA 4CSWA 3OMYA 3GTQJ 2LG4A 2QUFA 2E36A 3UKGA 2DA6A 3HOVJ 2KRHA 4CCLA 1YHQI 1JTXA 3KP3A 5DCMA 3IWZA 9ANTA 4JX6A 2QKLB 4BXFA 3D5RC 1E3HA 5E3NA 1VQ7I 3HZJA 1WVRA 1REPC 3M8FA 3CP8A 4XLHA 4KNYA 3S15J 3AG3H 4GO1A 2EWNA 3CJRB 4PJNA 3X2QH 3OYAA 2NNNA 1JT0A 2R5YB 4Y3OA 4FTHA 2ID6A 2IGMA 2BHZA 5HNFA 2PMHA 2M30A 4QPOA 2EB7A 4CCJA 5JHUA 3BG3A 4ON0A 3ZXSA 5J40A 4FETA 2FXAA 3L9FA 3REOA 1GXQA 2W00A 3SQNA 1ETXA 2R7WA 3BTJA 3WG7H 3K70C 5ICEA 2K85A 3WU2C 3BOQA 2ACJA 1BI2A 3SEQA 1WGXA 5F0FA 2PG4A 3TBIA 1SMYF 1E3OC 5D5VB 2CQ7A 2HEOA 1O7FA 1T6SA 1XD7A 2EK5A 2ICWG 2RN7A 3HIFA 4ENNA 3K2AA 3WHCA 2IGOA 3KZIC 4DYCA 2R7DA 1IRFA 1S72I 2JA2A 2KFDA 2C6YA 3MN2A 2CSOA 4HNVA 4OMYA 2B0LA 1ERDA 3G1MA 1ZTRA 3AKZA 3PSFA 2HU9A 1I27A 4RB2C 3Q5FA 1FOWA 5GAHJ 1IV8A 3IH3A 5F64A 4ZTJA 5J8CA 4RDUA 1KYWA 3HOTA 2ETHA 3TDZC 1KGSA 4IRGA 1VTNC 5DUIA 2DQRA 2M8GX 4M3BA 1X2NA 4Y33A 3G71I 3JRBA 3DLAA 1WH7A 2FA5A 3PSIA 5DCFA 1MH4A 4IHTA 1FWZA 4PFPA 3SJMA 3I59B 5GTIC 2R5YA 1A6QA 4V19K 3V7RA 3F8FA 2R4GA 4JQFA 2E2HJ 3W6KB 3S2HJ 2PX9A 3I4PA 1YJNI 3M8JA 1R4MB 5D8KB 4BHCA 2XKPA 3E3VA 4GYIA 3EDPA 4YELA 2PBIA 4A2UA 2VB6A 5LHHA 1R5GA 1S9HA 4L5IA 4D9JA 2WAEA 1JHFA 1ETWA 1P4AA 2LYCA 3I71A 4OOIA 4M6VA 4PCQA 1IXSB 1HKQA 4LK1F 2M0MA 4M9ZA 1R7JA 4LD5A 4A3EJ 4KJZA 3JSPA 2XC7A 4IRHA 4GYGA 3ZQCA 1IXRC 3BR0A 3BR5A 1HSTA 4M3DA 4C3HJ 4G6QA 4I99C 2DQLA 2QZ8A 1Z0XA 2DA3A 2DT7B 1QVUA 1WI9A 3N05A 3K4MA 4BH9A 2FQ3A 3BR3A 2K3PA 1OYWA 3BY6A 3A02A 1Z6RA 3H3ZA 4HPQA 2F4IA 3KEQA 1JGGA 2IRFG 3RKWA 4CZCA 4WX9A 4MO7A 1MMAA 3PNTA 4UNOA 3QYBA 2DODA 2CMPA 3UNGC 3CUOA 2Z33A 4KIGA 3QOEA 1Y1VJ 3M1EA 2QSFX 1STZA 2OTJI 3I5UA 2V9KA 3KYLA 3BP8A 1X19A 3KIOA 5FGMA 4S0HB 3FBNB 4RBOA 2OUMA 1NH3A 2EJRA 4FE7A 3ULQB 3I59A 2KZVA 1DU0A 1ZQ3P 2LDUA 1DQUA 1POGA 3PM1A 4A0XA 2K9LA 4BJ6C 1G2HA 2HFHA 2L2OA 4ZZLA 1OYYA 2VPLA 1LQ1A 1G3TA 3QU3A 4KA4A 4M73A 3V4GA 2O5RA 1HDPA 3L1PA 3FXOA 4IJAA 2X6WA 4LGWA 1OR7C 3A0HC 2Z3YA 2FU4A 3ABLH 2VBXA 3Q3SA 2DU9A 2IPQX 3F8NA 3E6BA 5B5EC 5LRRA 4M6XA 1BL0A 1XGMA 2KKOA 2Z9OA 3ZMTA 4RA2A 1RUNA 1BBYA 2Z1DA 4EJOA 1RUOA 2K9MA 2X9DA 4BACA 1X1DA 5TJJA 3ELKA 3V8LA 4CH7A 3CJNA 1SD7A 2KDOA 4RLQA 1P7IA 2E5NA 3TW6A 3PL8A 4IQ4A 1I6XA 1WPKA 3NWSA 3O3KA 2LMDA 1KU3A 4M3EA 2VXDA 2DDBA 2VC1A 1MBHA 4MGRA 3SXYA 2WWYA 1A35A 1N25A 1YX3A 3ZR8X 2VKHA 3P9KA 2JA7J 2K3FA 1XG1A 2VASA 1W36D 3MZYA 2A5YB 5KAIC 3FKJA 3JRIA 3EUHA 5DS9A 1YJWI 2BY1A 5IT9K 2GBYA 1PP7U 4QIWN 2M45A 3J81Z 2CRGA 1T98A 3RJPA 3GBGA 2LVSA 1YG2A 1B9NA 2H6CA 2ZMEB 4ESJA 3DFGA 1W7PB 4C9YA 5DM6F 2XSDC 4U0YA 4JX5A 1IGNA 2Y31A 3LOCA 4ANJA 2HDDA 1U6GA 3SDGA 4D7NA 2ID3A 4LLNA 2CQXA 3T1BA 2VOOA 1T33A 2P5VA 3NEUA 4I02A 2O8KA 3OYJA 3OYBA 2IA0A 1FOKA 2JVHA 5GPAA 3LA3A 1IZ1A 1OMIA 2XAQA 2HYFA 3B73A 2LREA 3FDYA 1VQ8I 1FMVA 3JR9A 5LFAA 5IP9J 2WC2A 2K4JA 3DF8A 2R7UA 3CUQA 4IHVA 2XASA 2RQPA 2IT0A 1FC3A 5J4YA 1JHHA 3MFKA 1XN7A 2VKDA 1TT0A 1QZYA 3TP0A 2M7AA 4M3FA 2FOKA 5C44J 4IHYA 5KNLA 4BY7J 3TQNA 2LP0A 2JQ7A 1LPQA 2BXZA 1RI7A 4I09A 3OYIA 2KDZA 1OISA 1R36A 2DFHA 4HF0A 3PQJA 4QWQA 3KX2A 3TO7A 4BJ5C 5GAEJ 3QPLA 4OAYA 1XB4A 3HC7A 1JXSA 5FJ8J 2K9NA 2V9VA 3HXLA 4A12A 1YIJI 2F4MB 2HYGD 3I58A 3K4JA 2IJLA 1Z67A 3HPGA 1U78A 2WBMA 3OV8A 2HPIA 3S17J 2V1XA 4HX7A 4F93B 4II2A 1W5TA 4QPQA 3FHZA 1LKXA 2XGDA 1VQNI 2NVQJ 3JAMZ 4G8XA 5C4JJ 2B9SA 3KFWX 3F6VA 4L18B 2YU9J 1T0FC 1JKOC 1SFKA 3KEYA 2L9NA 1PDNC 1JJ8C 1XGSA 3IRQA 2FNPA 2ZMEA 1HBXG 1W7PA 2H09A 4ASNA 4OIPF 3L2RA 2Y0SA 3F3XA 1NG6A 1ACIA 2W25A 1W0TA 5J47A 3FXQA 5HDNA 3U9GA 1HXDA 1F36A 3Q9VA 3LA7A 1MGTA 4FE4A 5JR3A 3TKYA 1QZZA 3RPUD 5JLWA 5E3LA 1FTTA 4YIIA 2R7VA 4LG3A 2NVXJ 2FOWA 4HAMA 2M4KA 5D5WB 3S2WA 3K1NA 4S04A 1IC8A 4Q48A 4KMFA 3HKZA 1T2KA 5H20A 3DTEA 1LE8B 1Y39A 2LKSA 4UB6C 4RB3C 5B66C 3FWEA 3S1MJ 2CFXA 4UVBA 4LG0B 4J01A 2QEXI 3EYIA 1LJ9A 3MKZA 1SANA 1ZGJA 1X4PA 4L9VA 3OYEA 2VBWA 4A3JJ 1QPIA 2ZFUA 4LMYA 1IDYA 2DMNA 3TL4X 2VJJA 3CO7C 1WFXA 5M3FJ 2A3SA 3MKYB 1RKWA 3HGYA 4HLYA 4Y52J 1B8IB 3ASNH 1PUFB 1Z1DA 3BQZA 1ZR2A 4ZC3A 1B72B 1PUEE 2Y9ZA 1QGPA 3SZGA 1FYKA 2CUJA 4A93J 1WJFA 1SD4A 4BJTA 2ZXHA 1AHDP 3SFZA 5IPAA 1J9IA 3SZTA 1D8JA 1K6YA 4I0BA 3BR6A 3PO2J 1OCCH 4G7OF 1MBEA 2COMA 3K2ZA 3WHBA 2HKOA 2R5ZB 1LDJA 2NOGA 4O6JA 4DW6A 1TW2A 5JLXA 5FKMA 1MZBA 2B7EA 2BV6A 2AXLA 2FD5A 3P9IA 2I10A 2LFBA 2HVSA 3JSOA 3G3ZA 5ICGA 2VJIA 3WGHA 1P7JA 3O6BB 4E7JA 1XGNA 2LBFB 3CCLI 2RAEA 3J80Z 1EH6A 1VQKI 3CCUI 2LSOA 1BR4A 3Q0WA 3ZP5A 4EJTA 3BG6A 3E1SA 2JSCA 1BI1A 1IV6A 3I53A 1VI0A 2IAIA 1ON1A 2HKXA 1Z7LA 3LFUA 1YW9A 3TW7A 2XAUA 3OYKA 4DOZA 2XUBA 3EETA 1H9GA 2KQRA 2L4AA 3I54A 2A6EF 2VBZA 2F5EA 1LE8A 3QODA 4N9HA 1G3WA 4XLCA 1FSEA 3MZHA 1BIBA 2BY3A 1FLIA 1YW7A 2H8WA 3CCEI 2W85A 3VOEA 3W2WA 2VE8A 2ZBKA 3FX3A 1BR1A 2MW8A 3FM3A 3L2VA 1BC7C 1MSFC 2DLLA 2STTA 2DJNA 5CVJA 1B8IA 3BCAA 1PUFA 3S2DJ 3HGGA 1R1VA 3ZQ7A 1C0WA 1UMQA 3G6EI 1B72A 2L5QA 3M4OJ 4PUSA 1X58A 4B44A 4UUSB 2XRNA 1TTYA 2ZB9A 3E97A 3ABTA 1XC5A 4MFDA 3FZVA 3F9KA 3QYEA 2V1DA 1S7OA 2Q8KA 3HUGA 2Y30A 4HV6A 2R5ZA 2EQRA 1P4WA 3B6AA 4AC0A 5F1RA 2G9WA 3R0AA 1FIAA 4UB8C 5C4XJ 2P6SA 2Z99A 2EINH 2IW5A 1B1BA 4B3AA 4EJWA 1W36C 1R71A 2LF8A 2QSHX 2WB1N 3WGGA 2KL4A 4L9TA 2LH9A 4BBRJ 5TGTA 4EQQA 1MNEA 2EZLA 3W2VA 3OYCA 5F1JA 5JVTA 2CG4A 2LC2A 2AHQA 2LBFA 2NYXA 5D6EA 5FKLA 3LWFA 4EV0A 1Y0UA 2VQLA 3F0CA 1OLTA 1LEBA 1SVOA 3L2CA 2IGKA 1RPWA 2QVOA 2X0LA 3FXRA 3L00A 4HEA2 1OFCX 4I98B 5CVVA 2HI3A 2CFOA 4HYEA 2J5OA 2E7WA 4XOPA 2PJPA 2W4SA 4RAZA 3DP7A 3C3WA 4Z2YA 2EIKH 2HOSA 1D0XA 2CQQA 4G6DA 1X2MA 2KIMA 4ETSA 1WJBA 5L3DA 1OCZH 1V5GA 4EJUA 2K7LA 4MHGA 2L0KA 3CCJI 2XPWA 4CDGA 4YFKF 2QQAA 4XNFA 4WCGA 3QP6A 1P9QC 4AD9A 2NVUB 2M0CA 2NVYJ 2V1NA 3LFKA 5B1AH 2XHKA 5AIPA 1ETOA 4HRIA 2ZFWA 4KIFA 5M5YJ 2L7KA 4Y7NJ 5TISC 1CGPA 3D5SC 3T8TA 3ZGKA 3LSHA 1USTA 2MGQA 4NNJA 4UUSA 3OY9A 4U87A 1FT9A 1XMXA 1A36A 4M71A 1DGRM 1ZH5A 3W6JB 1G8XA 2W1OA 2WTEA 4RGSA 2D45A 3MVPA 4D7MA 1FTZA 3H5AA 3LA2A 3CQZJ 2DPDA 4X0GA 2QKMB 4A0YA 2ZO4A 4HQMA 1VF9A 3LQRA 3WGIA 3NARA 2FEZA 4YFXF 3DXJF 1ENHA 4ZYDA 2HOEA 4BE1A 3VYRB 2DXIA 2HOAA 1UELB 1O7LA
chains in the Genus database with same CATH topology
2UUZA 1QHGA 2F4IA 4HPQA 4DJAA 4CZCA 3LSKA 2GOXB 3DWLE 3H0DA 1MMAA 3PNTA 4E4HA 3QYBA 2CMPA 3UNGC 3RTRA 3SEZA 3H5RA 4LIUA 3QOEA 2VLAA 1UG0A 5CQEA 2JUGA 4E7IA 2M4GA 4NQWB 4PJJA 4R79A 5HVQC 2BW3A 1X1CA 2HVRA 3HOSA 2V9KA 4Y4RA 1D1AA 3KYLA 4BDZA 1X19A 1MMDA 2WA0A 1T95A 1D0ZA 2XSJC 3FBNB 2M3AA 2BVLA 3CMMA 3OYHA 2MFZA 2OUMA 2VL8A 3RQ4A 1N78A 2XF6A 1J09A 3S3MA 2KZVA 1YE9A 2OC6A 1DQUA 2MABA 2Z16A 3OOUA 4BEHA 3U21A 2XF5A 2K9LA 4BJ6C 3OYGA 3TMOA 2JVGA 2PJRA 2L2OA 3I3LA 2VPLA 1MW7A 4BL0B 3AFHA 3PUBA 4IZZA 3DTIA 2HPMA 2O5RA 2X6WA 2IXSA 4J00A 1OR7C 4XKVA 2V6EA 3VSKA 4XR6A 1X1AA 5FROA 1U0JA 2GOMA 3A4CA 4XKCA 3VDXA 1X4OA 2L9SA 1Z21A 2WADA 2WY8Q 5HOOA 4AYBA 1D0YA 1WJEA 3IAM2 2Z1DA 4EATA 2K9MA 4BACA 1X1DA 3OYFA 3C2GA 4CH7A 4RLQA 3EUHC 2KDOA 3SYTA 2CUZA 2E5NA 4E7HA 1GLNA 2BVMA 3PL8A 4IQ4A 3S8PA 3NWSA 4PK4A 3HPHA 3H9JA 2VXDA 3ONQA 3HG9A 4RMNA 4B47A 4DBRA 2W82A 3S32A 4ITVA 3OR2C 3LMMA 1YX3A 2KHMA 2VKHA 4HG2A 4PSXA 3ZR8X 2KP6A 2HQAA 2VASA 1W36D 3IUOA 3L2WA 1MNDA 1KONA 3BC8A 4F55A 3VYSB 2X6XA 4AVZA 3FKJA 2R7XA 3BLYA 2HNHA 3CF2A 3MD2A 3CJQB 4OWRB 3MKWB 2HDWA 2LOOA 3H5NA 2ZSHB 4F52A 1DGWY 3LL7A 1Z3YA 3DU6A 3FBIB 3OYNA 3BG7A 3GBGA 4XLFA 4FASD 3OIQA 4II3A 4ZYAA 4PJMA 4C9YA 2R7SA 1TZLA 4KT6A 3OS1A 3OYLA 4E7KA 3AL0B 3HUGB 4XQFA 1Y6IA 4MLOA 4ANJA 2IS6A 3K4NA 4XONA 4C30A 5KCMA 1QU3A 3OYJA 2X51A 4ZDPA 3OYBA 2JVHA 1ZELA 1E0EA 2LREA 3FDYA 1HA8A 2OV7A 3M1CA 4BQOA 1FMVA 5LFAA 3VWBA 2DJIA 1FMWA 4C2UA 1PJRA 2VIXA 3PNVA 2KLOA 3OYDA 2R7UA 3LSMA 2E1MB 1QHHD 1V5FA 2VKDA 2UV1A 3LSIA 1TT0A 2M7AA 4N4NB 1UAAA 3S3OA 3RCOA 5KNLA 4E7SA 3S3NA 4E7ZA 3OYIA 4CUGA 3D5LA 3KX2A 4IX7A 4BJ5C 4OAYA 5CQGA 3HC7A 1LVKA 3HXLA 2A5WA 2X6YA 3K4JA 3HPGA 4ZTFA 4JOMA 2WAFA 2WBMA 1Y56A 2HPIA 4F93B 3DKYA 3OYMA 4II2A 4QPQA 4F91B 2IS4A 1LKXA 3K4BA 3AL0C 5CPRB 1WJAA 3FHNA 3OL3A 2AQFA 2VQHA 2F6CA 3K10A 3DQVC 3A1YA 4P5OA 3G2BA 1T0FC 3DKXA 1SFKA 2CW8A 2L9NA 3KEYA 4XKBA 2R7QA 2KPMA 4XORA 4DBQA 2ZSIB 4U7BA 2X1EA 3L2RA 2Y0SA 2ELJA 4XLEA 1NG6A 1N77A 1PYVA 1X1BA 2XDVA 4CA0A 4NC8A 2LY1A 2IS2A 2E1MC 1SAUA 3RPUD 2R7VA 4LG3A 2M4KA 3K6GA 4LITA 4F92B 4XOTA 2I8DA 1BOBA 2KRCA 3HKZA 1N75A 3DTEA 2HVQA 4XM3A 2R7OA 4IQJA 4PFOA 4CCKA 4J01A 3BCBA 1MMGA 4XLAA 2M7BA 3OS2A 3MKZA 3H9QA 1X4PA 3OYEA 2HZDA 3IP4B 3VYUB 2ZXIA 3K4CA 2DOAA 2VJ4A 2ZFUA 3TL4X 2VJJA 4ZDOA 1WFXA 3MKYB 2XF7A 2BW3B 2JSPA 5HNHA 2IGNA 2DT6A 3EUAA 4ZC3A 3L2UA 3SZGA 2CUJA 2V4JC 1WJFA 4BJTA 4G6TB 2ZXHA 2UWMA 2FUG2 2MYSA 1K6YA 4N4OB 1BR2A 4HSRA 2MC4A 5KHDA 1VZ0A 4XMYA 4BDYA 4B48A 3PJRA 3W2AA 4BEHB 1LFPA 5FRMA 3OWTA 4RM2A 4DIQA 2RNGA 4BE2A 3K4KA 4OAZA 3ZCOA 3NWTA 2HVSA 1MMNA 2VJIA 4XKWA 3I9V2 2CV2A 4D1QA 2MD0A 4E7JA 2LBFB 2E5ZA 3EUKL 4E7LA 1DP3A 4KISA 3E0JB 1BR4A 1EA3A 2NOJB 3LSGA 2IS1A 3BG6A 3E1SA 3J7AY 4HSTA 2CW7A 2X1CA 3QYFA 2WY7Q 1Z7LA 3LFUA 2XAUA 3IAS2 4HNTA 5HLTA 3OYKA 4DOZA 4RLFA 2CV0A 3MMYB 1V5EA 3ZQQA 2VXZA 3DU5A 1D1BA 4CSWA 2KQRA 4LIVA 3OMYA 3CESA 3OIPA 2LG4A 4AU7A 3QODA 4CCOA 4XLCA 3CZ6A 2KRHA 4CCLA 3CP2A 3W2WA 4BXFA 2QKLB 2CV1A 3D5RC 3K4LA 1BR1A 3L2VA 2W7NA 1Z3XA 3EPZA 3CP8A 4XLHA 2R7RA 2WAQA 3A2KA 2VQCA 4NC7A 3CJRB 3BCAA 4PJNA 3OYAA 4CCNA 2VQGA 4Y3OA 2IGMA 2L5QA 2R7TA 4PUSA 5HNFA 4B44A 4QPOA 4CCJA 4E6KG 2F5VA 3F9KA 3QYEA 3ZXSA 2VJ5A 4FETA 3H35A 4RM3A 2W00A 4PSWA 3VSLA 2WB1A 2R7WA 3K70C 4F3QA 4XN3A 3C2HA 4BGDA 1R6RA 1W36C 1IRXA 3SEQA 4BQQA 4GRIA 2BOLA 4C2TA 2KL4A 2LH9A 4PJLA 5TGTA 1MNEA 3W2VA 3OYCA 2LC2A 2LBFA 3TBIA 3UR3C 3H9GA 3DPUA 2KMUA 2VQLA 2CS3A 1OLTA 2V7FA 2IGOA 2E60A 3DEEA 2IGKA 4HEA2 2JA2A 4ZDLA 4CCMA 1WJ5A 5FRNA 4BE0A 2CFOA 3PFYA 1ERDA 5CKTA 4B3XA 3S93A 4H4KC 4XOPA 2RQQA 4NUBA 4XL9A 2W4SA 3AKZA 3L2QA 3PSFA 2HU9A 1D0XA 2CH0A 3DPLC 1WJBA 4B43A 1V5GA 2A6TA 4YRVA 3OR1C 4ZTJA 2Q2EB 1WJDA 3HOTA 4BQNA 2V26A 4BUPA 4HNUA 4XNFA 2AQEA 4Y33A 3DLAA 3K70D 1P9QC 3RSNA 1AA7A 2V1NA 2LY2A 3PSIA 2K5CA 3VYTB 1G59A 4HRIA 5JHFA 4PFPA 4ZJZA 2L7KA 2X85A 1WJCA 3D5SC 3ZGKA 2R4GA 3LSHA 3SDBA 4KITB 4JQFA 4NNJA 4YEJA 1NG7A 2LRDA 1LDKB 1YX5A 4U87A 3OY9A 3M8JA 2RREA 3PNYA 2PJRB 3OL4A 3W3CA 2PMZA 4IKFA 4P1WA 1DGRM 3DTKA 4YELA 1JI8A 1D1CA 1G8XA 2VB6A 3HL2A 2W1OA 1S9HA 4BU2A 4D9JA 4DGWB 2WAEA 3DPTA 2DCEA 2LYCA 3H5AA 2Q1ZB 5LD2C 4X0GA 2M0MA 2QKMB 4KJZA 2XC7A 2Z2SB 3OS0A 2X1DA 3ZRGA 2DT7B 3N05A 3V42A 3K4MA 4BS9A 4BE1A 3VYRB 2DXIA 2K3PA 2P0WA 1UELB 4XN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CUJ A;  2DCE A;  2AQF A;  2ELJ A;  2AQE A; 
#chains in the Genus database with same CATH topology
 1ETK A;  3HDD A;  2K86 A;  5K1Y A;  4XRF A;  2GOX B;  2IBD A;  2DAO A;  1S29 A;  1O3S A;  5H6Q A;  2W57 A;  4V2G A;  1HF0 A;  2W24 A;  3KP6 A;  3P5J A;  1H9T A;  3RTR A;  2L4M A;  5H2F C;  4KUM A;  1PP8 F;  3RYR A;  2QA4 I;  4UY8 I;  5F0C A;  4KDP A;  2M4G A;  4PJJ A;  4R79 A;  3BR2 A;  2H1L A;  3OSF A;  2EFP A;  4JBA A;  2AXT C;  1D8K A;  3GFI A;  4MNU A;  2P7C B;  1ZR4 A;  3BR1 A;  3V8K A;  4BDZ A;  4WWC A;  1IUY A;  2DK8 A;  3G73 A;  3GTM J;  3GLL A;  2IVM A;  2RGV A;  1P4X A;  2XSJ C;  5CVI A;  4LB6 B;  2M3A A;  3ZN0 A;  2MFZ A;  2OQG A;  4E70 A;  3Q0U A;  1N78 A;  1LFU P;  4UV8 A;  1YE9 A;  5BPD A;  2MAB A;  4BEH A;  3U21 A;  2XF5 A;  3A03 A;  5EF6 A;  2PLY A;  2GA1 A;  3TMO A;  2H8R A;  3D0S A;  4XSX F;  4OIR F;  3F22 A;  3V7S A;  4IZZ A;  5J1Y A;  4XIC A;  2LK2 A;  4J19 A;  2TCT A;  2FNA A;  3WTU C;  2EIM H;  1H8A C;  1T8I A;  3RZO J;  1GHC A;  4OIO F;  1YYV A;  2V6E A;  4GGG A;  1X1A A;  5D6F A;  5DDG A;  5LLQ A;  1I3A A;  1USS A;  4XKC A;  4NB5 A;  2BY0 A;  2BHY A;  4HA8 A;  3JRA A;  5FKK A;  4AYB A;  2KZG A;  1TWG J;  2HQR A;  2LY9 A;  5K7H A;  2PEX A;  2BE5 F;  3IAM 2;  3BJ6 A;  3GZN B;  4K2E A;  5GP9 A;  3MAJ A;  2HTJ A;  2NS8 A;  5ICC A;  1GDT A;  2R92 J;  1FSH A;  1R22 A;  2JA6 J;  4RGR A;  2CUZ A;  3EYY A;  1GLN A;  3CCS I;  1BC8 C;  1G3Y A;  3E7L A;  1NK3 P;  1U9O A;  3HPH A;  4B47 A;  3MEX A;  1HDD C;  2W82 A;  4LLL A;  3QAH A;  4HBL A;  1YW8 A;  2N8G A;  1EF4 A;  4PSX A;  3GW2 A;  2ZXW H;  3IUO A;  1GVD A;  1MND A;  1H88 C;  3BC8 A;  3VOD A;  1ZG5 A;  3VYS B;  4I01 A;  2E19 A;  1L3L A;  3VFZ A;  2H27 A;  4A3B J;  3MWM A;  1FX7 A;  2E7X A;  4XRS G;  1TP4 A;  2JA5 J;  3H5N A;  2ZSH B;  2DBB A;  4EMS A;  1M1E B;  2BXY A;  4PGH A;  5ICF A;  1ZAR A;  2QYO A;  5FLX K;  4FAS D;  2M87 A;  3R6S A;  3RKQ A;  4ZYA A;  1V54 H;  1X3W B;  3A01 B;  4PJM A;  1LVA A;  1TZL A;  4IF4 A;  3OYL A;  5IP7 J;  2E1C A;  5L3F A;  4E7K A;  3TED A;  4M6Y A;  3F21 A;  4M9X A;  2PFB A;  2F4O B;  3QPH A;  3HOY J;  4C30 A;  2BYV E;  1GXP A;  3C2B A;  1FP2 A;  4ZDP A;  2MSY A;  1FBS A;  1ODD A;  1RZ4 A;  4N0B A;  3V8J A;  1HKS A;  1X3U A;  1E0E A;  1YO5 C;  2OV7 A;  2XRL A;  4BQO A;  2MH2 A;  3VWB A;  5K7F A;  4EGY A;  5FKO A;  1JUP A;  2VIX A;  3PNV A;  1Y1W J;  2KLO A;  4ZZD A;  1B59 A;  2M8E A;  3IRR A;  1F43 A;  1V5F A;  1ETY A;  3MQ0 A;  1UAA A;  1ETQ A;  3RCO A;  5JFR A;  4E7Z A;  3DEW A;  2JTV A;  3ABU A;  2F2E A;  2LNB A;  1YS7 A;  4RS8 A;  1Z6T A;  5E17 F;  1IRZ A;  3D5L A;  5D8L B;  3RYP A;  5A2Q Z;  1AOY A;  5D5U B;  4PZJ A;  1FIP A;  1JUM A;  2RVC A;  2L9V A;  1F9N A;  2A5W A;  5JVG F;  3HOZ J;  4G94 A;  5B1B H;  4NHJ A;  1AKH B;  3BZC A;  1HQC A;  1S3J A;  1Y56 A;  5BPI A;  4KN4 X;  1VQP I;  3HHH A;  1BW5 A;  2IS4 A;  3KCC A;  1LEA A;  3K4B A;  5DD8 A;  3AL0 C;  2DMP A;  5BNG A;  1QO0 D;  1R1T A;  3OL3 A;  4UUV A;  2AS5 F;  1X1P A;  5DYM A;  3K10 A;  2KJC A;  3WTW C;  2XKO A;  3G1L A;  3CCV I;  4XLP F;  3QPT A;  1RR8 C;  4BYY A;  3WTZ A;  4D5C A;  2R7Q A;  2KPM A;  4XOR A;  4DBQ A;  3OIO A;  4EVI A;  2DDA A;  2GIZ A;  3A01 A;  3ABM H;  4F7Z A;  2ELJ A;  1N77 A;  4YG2 F;  5LEK A;  1MSE C;  2B63 J;  3J81 K;  1ZRE A;  4JP0 A;  5E18 F;  1T0F A;  2M1B A;  1OYI A;  3FK7 A;  4CXF A;  3HOX J;  3BZK A;  1YLF A;  2JPC A;  3GFM A;  3Q0V A;  5HDG A;  2JWT A;  4XOT A;  3PIP F;  3H0G J;  5LBQ A;  4CYD A;  4A3M J;  2EV0 A;  2UXX A;  2KRC A;  1I1G A;  1N75 A;  2XGX A;  4AM3 A;  2HVQ A;  3KE2 A;  1DPR A;  1T56 A;  3KLN A;  5KVR A;  4A3G J;  4PFO A;  4CCK A;  4CYC B;  1MMG A;  4G7H F;  4XLA A;  2M7B A;  3OS2 A;  3BTI A;  4EM2 A;  3H9Q A;  2STW A;  5LGN A;  3LAJ A;  3PO3 J;  4P96 A;  1IUF A;  3RKX A;  5FD5 A;  4EGZ A;  2ESN A;  2E1O A;  2O03 A;  3E6C C;  4AIJ A;  3GCM A;  5EG0 B;  2L01 A;  2BW3 B;  4Q47 A;  3GTL J;  2E71 A;  1QRY A;  3EUA A;  3KP4 A;  3L2U A;  4EM1 A;  3HRT A;  1AKH A;  2V4J C;  3DBL B;  1OCP A;  3U2R A;  1JKQ C;  2DMQ A;  3KZZ A;  1MDM B;  5J6X A;  2QBY B;  4A6E A;  2CW0 F;  3ZOB A;  4HSR A;  2MC4 A;  2VKE A;  1A5J A;  5F08 A;  3FMR A;  1VZ0 A;  3I64 A;  1Z77 A;  5EEG A;  3IHU A;  2GAU A;  5FB2 A;  1IG7 A;  1MJA A;  4BDY A;  4B48 A;  3PJR A;  4X6A J;  4L5J A;  4A5M A;  4LK0 F;  2LR8 A;  2YX4 A;  3CCR I;  5E8I A;  5E1X A;  4OAZ A;  3ZCO A;  2HXO A;  2DMU A;  4RGU A;  1MMN A;  2CV2 A;  4XRS A;  4A3D J;  4D1Q A;  3GVA A;  2E5Z A;  3IL2 A;  1KU7 A;  3JAM K;  4E7L A;  5KAF C;  4RAG A;  4M74 A;  2OZ6 A;  2L7Z A;  1ZGA A;  1H0M A;  5L3E A;  4BHP A;  3JRG A;  3J7A Y;  3JRH A;  2MG4 A;  3QYF A;  2X48 A;  3VB2 A;  2V1U A;  5D4R A;  4HNT A;  2EFN A;  1FJL A;  1ZLJ A;  1S5L C;  4LIV A;  3B6C A;  3CES A;  5F27 A;  3OIP A;  1W1W E;  5GPC A;  3CO6 C;  2FX0 A;  5IOZ A;  4CYC A;  1XDS A;  2F5C A;  1K78 B;  3CP2 A;  1WCM J;  2ZNZ A;  2CV1 A;  2DTR A;  4XBF A;  1T39 A;  5E79 C;  1MJ9 A;  2W7N A;  1GUU A;  1Z3X A;  3EPZ A;  2K9S A;  5K5R A;  1WKM A;  3P7N A;  2R7R A;  2WAQ A;  3A2K A;  5EG0 A;  3AAF A;  2DT5 A;  1CF7 B;  2F5F A;  5IT3 A;  3GYH X;  1HLV A;  2VQG A;  1IN5 A;  1X3Z B;  2HOT A;  3ABK H;  4CHU A;  1QVT A;  2HQN A;  3KEO A;  1TNS A;  5EDN A;  2DN0 A;  3FXJ A;  2QBY A;  5BMZ A;  3S16 J;  1LNW A;  2F5V A;  4XID A;  2HXI A;  1FP1 D;  1MJB A;  3COA C;  3CTA A;  2VJ5 A;  1I39 A;  4ENM A;  2KIS A;  5J4V A;  1MBG A;  4PSW A;  4OU0 A;  3VSL A;  2WB1 A;  4XN3 A;  3D1N I;  3GEZ A;  1R6R A;  2E2I J;  5M5X J;  4TV7 A;  2BOL A;  4PJL A;  5CVU A;  1FPQ A;  5ILU A;  1AWC A;  2LTP A;  2GXA A;  3UR3 C;  3H9G A;  1UJ8 A;  3I56 I;  2YSR A;  3J7Y J;  4IRI A;  2MLG A;  2KMU A;  2X4H A;  2VE9 A;  4KYW A;  3ROU A;  2HR3 A;  2LKX A;  2DOE A;  1JUS A;  4ZDL A;  4CCM A;  4A3K J;  1WJ5 A;  4BE0 A;  1LB2 A;  3BPX A;  5CKT A;  1A04 A;  4B3X A;  4H4K C;  1G6N A;  2GXB A;  3J80 K;  1Z7U A;  3L2Q A;  2DO7 A;  1VQ6 I;  4I0A A;  1FOX A;  2O6G E;  2K4B A;  2CH0 A;  3DPL C;  3U1D A;  4B43 A;  2XRO A;  3CD6 I;  1Y0N A;  3K69 A;  5M3M J;  2DYS H;  4YRV A;  2Q2E B;  1WJD A;  1K78 A;  2LF7 A;  4Y17 A;  1D3Y A;  2D2W A;  1WH5 A;  2V26 A;  2MA3 A;  4HNU A;  2E2J J;  2AQE A;  3K70 D;  1YFH A;  3IV5 A;  3AG4 H;  1KZH A;  3RSN A;  1AA7 A;  3U1K A;  2K5C A;  3VYT B;  2OTL I;  1E3P A;  1CF7 A;  2CJJ A;  5JHF A;  4ZJZ A;  3CMY A;  5AON A;  5B3S H;  2X85 A;  3J7A O;  2VOP A;  1WJC A;  4PDK A;  1YS6 A;  4I76 A;  1OPC A;  4R8H A;  1BI3 A;  1RES A;  3SDB A;  4KIT B;  2UZK A;  1K4S A;  1TWF J;  2AO9 A;  1JGS A;  1NG7 A;  1LDK B;  1YX5 A;  3PNY A;  3LNQ A;  3BG9 A;  2ISY A;  3OL4 A;  3W3C A;  2PMZ A;  2JK3 A;  4IKF A;  3ECH A;  1WZ2 A;  4P1W A;  3DTK A;  2CYY A;  4BQA A;  1FBU A;  4DGW B;  2W84 A;  4ABZ A;  1HW1 A;  1YIT I;  3DPT A;  1KYZ A;  4B09 A;  3BWG A;  2PQ8 A;  1U8B A;  1OCR H;  1VQL I;  3L7W A;  4KIC A;  4HDV A;  3CUQ C;  1F4K A;  2PN6 A;  1GT0 C;  1Q1V A;  3LSR A;  4L0Y B;  2Z2S B;  5LGU A;  1SEU A;  2JA8 J;  1EV7 A;  3O8G A;  3V42 A;  2WV1 A;  4BS9 A;  1QPM A;  2HYJ A;  3JRF A;  3HHG A;  2CUF A;  3E6D A;  2P0W A;  4XN0 A;  1OQY A;  3RZD J;  4IXA A;  1QHG A;  1DP7 P;  1UHW A;  1KU2 A;  3LSK A;  4LG0 A;  2A05 A;  3H0D A;  3GFL A;  1ITY A;  5AIQ A;  4E4H A;  1O3R A;  4FIS A;  1BW6 A;  2COB A;  1HW5 A;  3LQQ A;  4W97 A;  2O8X A;  3B02 A;  4IL6 C;  4BKX A;  3ZQH A;  2V9P A;  1IN4 A;  5CQE A;  4E7I A;  3JRC A;  5HVQ C;  4NQW B;  1R00 A;  4ZYE A;  1IAW A;  1X1C A;  2Q2E A;  4HZF A;  2QLZ A;  2GZW A;  3ZQF A;  4U0V A;  1K83 J;  4A69 C;  2HVR A;  2E35 A;  4Y4R A;  1AU7 A;  2OU2 A;  1KQ8 A;  4IOC F;  1MMD A;  2WA0 A;  2EFQ A;  1T95 A;  2QQB A;  3SZP A;  3JTH A;  1BIA A;  2BVL A;  3ZQL A;  1JKR C;  3CMM A;  5DD4 A;  2VL8 A;  5BQT A;  2JPB A;  3RQ4 A;  4WXH A;  4I2O A;  3RPU A;  2R3S A;  2EH3 A;  2Z16 A;  2YR2 A;  3OOU A;  3GXO A;  1WHU A;  3HYI A;  2HS5 A;  3OYG A;  2L54 A;  3I3L A;  4Q5S F;  2HGC A;  3W6V A;  1IO2 A;  4GXO A;  3GFJ A;  2QGU A;  1MW7 A;  2K9Q A;  4BL0 B;  4RB0 A;  3AFH A;  4U7D A;  4IHX A;  3DTI A;  3GZ5 A;  4J00 A;  2R0Q C;  2JRT A;  1EH7 A;  5F6F A;  5GAG J;  5K5Q A;  2GOM A;  2Y0S N;  2ESH A;  3WTS C;  1IXC A;  1MBJ A;  1X4O A;  2ECB A;  2TRT A;  3VDX A;  5K7Z A;  1RRJ A;  1ZLK A;  1T08 B;  3BTL A;  2M9H A;  2ZJ2 A;  2ZC2 A;  4PGG A;  2WAD A;  5CLS A;  2WY8 Q;  2XV4 S;  4D0P A;  5HOO A;  2BZT A;  1D0Y A;  3PFI A;  1ZHF A;  3ZMU A;  2A69 F;  4S05 A;  3M7G A;  3IH2 A;  3K9T A;  2PI0 A;  1J59 A;  1B6A A;  2EIJ H;  4ZYH A;  1BJZ A;  3ISP A;  1SFE A;  2BVM A;  2XGC A;  2ZCW A;  3S8P A;  2DYR H;  1XTA A;  3H9J A;  4UVA A;  3ONQ A;  1F1Z A;  4I6Z A;  2BGC A;  3HKZ N;  3S32 A;  1YQA A;  4DBR A;  4ITV A;  3PUF A;  5HLG A;  5DCM B;  3DCF A;  3MZ8 A;  4AUX A;  2KHM A;  4HG2 A;  3PIO F;  3F8M A;  2KP6 A;  4NBQ A;  2YUS A;  5E3M A;  3T8R A;  4NQW A;  3L2W A;  4L0Z B;  4F55 A;  1K79 A;  4WF2 A;  4AVZ A;  2R7X A;  4A0Z A;  5DM7 F;  3JRD A;  4A5N A;  1L0O C;  3BLY A;  1Z91 A;  2HNH A;  3CF2 A;  2QQ9 A;  2RV8 A;  1RKT A;  2VBY A;  3MD2 A;  1D5V A;  2UXN A;  3MKW B;  2HDW A;  2YX7 A;  2CQN A;  2LOO A;  4F52 A;  4C3J J;  3FBI B;  1IN7 A;  4DNC A;  4XLF A;  4II3 A;  3JCU C;  2JT1 A;  3BDD A;  5L3B A;  3I4M J;  1RC9 A;  3KET A;  3OS1 A;  4ENK A;  3CC4 I;  3AL0 B;  3WU1 B;  1FZP B;  4MLO A;  1HCR A;  2HZT A;  1SD6 A;  1XCB A;  3GO5 A;  3K4N A;  2V6C A;  4XON A;  2IS6 A;  1I50 J;  2XGE A;  1O4X A;  5KCM A;  3F23 A;  3CMA I;  1QU3 A;  1VND A;  4Q4Z F;  3CC7 I;  2KIF A;  1ZEL A;  3NRV A;  2KIQ A;  5EZH A;  2EPF A;  3L09 A;  2DJI A;  1FMW A;  5IYD J;  3TOB A;  4C2U A;  4G7Z F;  4IVN A;  3OYD A;  5IP6 A;  3T0Y A;  3LSM A;  1W0U A;  4HF2 A;  4HF1 A;  1QHH D;  2UV1 A;  2NRA C;  2XVC A;  3S3O A;  1RR7 A;  2DA5 A;  3HB9 A;  1YIO A;  4JK1 X;  5E8G A;  5EJC A;  1V3F A;  3FMQ A;  3HEF A;  3LAP A;  3R0J A;  4MQ9 F;  4CUG A;  4FX4 A;  2ECC A;  1DU6 A;  4IX7 A;  1P2F A;  1I3Q J;  2O7O A;  2ME0 A;  1ULY A;  4Y15 A;  1SMT A;  3K1M A;  5CQG A;  1LVK A;  1G3S A;  5ED4 A;  4DZP A;  1ZYR F;  1J2X A;  2X6Y A;  2CGP A;  4JOM A;  2FML A;  2WAF A;  5GAD J;  3WG9 A;  1YOV B;  1IW7 F;  4WXD A;  3F72 A;  4Y13 A;  3C7J A;  3ZQG A;  4F91 B;  3DBH B;  2Y2Z A;  5CPR B;  1SFU A;  1WJA A;  1TNT A;  3R60 A;  2VQH A;  2F6C A;  3CDI A;  2VT3 A;  3T5X A;  4XSZ F;  2OJE D;  2EZK A;  3FXM A;  4KMU X;  3ZPL A;  1MD0 A;  2OBP A;  2ZKZ A;  3DQV C;  3TDU C;  4P5O A;  3G2B A;  3DKX A;  1EKE A;  3KP2 A;  4ENJ A;  1XS9 A;  4KFC A;  2DFI A;  4U7B A;  2DW4 A;  3K7A J;  3CDL A;  3H1C A;  1HKT A;  3ESW B;  5EEA A;  5FLM J;  5F04 A;  2IP2 A;  1UCR A;  2A61 A;  2IA2 A;  1X1B A;  3O2P E;  4B1R A;  5F0H A;  3CCM I;  1U5T C;  4GFB A;  5K5O A;  4O5V A;  2NS0 A;  3IKT A;  5HLI A;  3OOP A;  4NC8 A;  2LY1 A;  2E1M C;  4IHW A;  2GQQ A;  3GTP J;  2X6O A;  1SAU A;  5FFZ A;  2TDX A;  4DZJ A;  3RPQ A;  1Y8Q B;  2VUM J;  3ASO H;  1J7K A;  4EEF G;  1IN6 A;  4PJ0 C;  4BAY A;  4Z6Y A;  3N4M A;  1XSD A;  4AID A;  5IYB J;  4F92 B;  3WTV C;  3GTG J;  1BN5 A;  1OR7 A;  1UB9 A;  2I8D A;  4MQV A;  3SHF A;  2F5D A;  2KRF A;  3QPS A;  1FBQ A;  1R5H A;  6PAX A;  4FCY A;  3H3U A;  2ZJP F;  2KT0 A;  1FOY A;  1HOM A;  4XM3 A;  1JE8 A;  1TL8 A;  5M5W J;  3BCB A;  2ISZ A;  2LD5 A;  1OJL A;  2Y48 A;  2V79 A;  4N9I A;  2EFO A;  2QCO A;  3IH4 A;  2BEO A;  3VYU B;  4M3G A;  1QA6 A;  4FHT A;  1ZRF A;  3K4C A;  3HJE A;  1GV2 A;  2NVT J;  2VJ4 A;  2Y9Y A;  2I5U A;  3IWF A;  4ZDO A;  3FIS A;  4AVP A;  2RKH A;  1ZKG A;  4XLN F;  2L7M P;  2JSP A;  2DT6 A;  1WSU A;  3SFI A;  2XAF A;  4G6T B;  2KIU A;  4BXX J;  4HLX A;  2FUG 2;  2MYS A;  2IEK A;  3IKV A;  5A2Q K;  4BHB A;  3CLO A;  4GCV A;  2ZJQ F;  2GIV A;  4FQG A;  4XMY A;  4BY1 J;  1FYL A;  1K7A A;  2ADU A;  3GWZ A;  5BS6 A;  3PQK A;  5D4S A;  4NC6 A;  3W2A A;  4AWX B;  3OWT A;  4BXU A;  4DIQ A;  2RNG A;  1I6H J;  4ESB A;  2OQR A;  4IPA A;  1S6L A;  3HRM A;  1I5Z A;  4XKW A;  2OAZ A;  2MD0 A;  1IN8 A;  3EUK L;  4MEY F;  2PMU A;  4KIS A;  1HC8 A;  3E0J B;  1EA3 A;  3S1R J;  4MEX F;  2IS1 A;  3VEP A;  3ERE D;  2JZY A;  2WY7 Q;  3ERM A;  5LRS A;  2JRM A;  2BY2 A;  1TLH B;  2H6B A;  3IAS 2;  5HLT A;  2K40 A;  3A0B C;  1Y8R B;  4I7H A;  2CV0 A;  3MMY B;  1V5E A;  5FO5 A;  1ZN2 A;  4DYQ A;  2VXZ A;  3DU5 A;  1D1B A;  2J5P A;  3H92 A;  1VQ4 I;  1YRN B;  4AU7 A;  4CCO A;  2DK5 A;  2Y69 H;  2GWR A;  2XPV A;  1TWH J;  3CZ6 A;  4CO8 A;  1I1S A;  3N97 A;  2HTS A;  2L02 A;  4RAF A;  3F8B A;  4CIC A;  1MBK A;  4OIQ F;  3K4L A;  3GZ6 A;  2LLK A;  4BNC A;  4L5E A;  3DEU A;  1TQM A;  2D1V A;  2MH9 A;  5FLX Z;  2GM4 A;  3R4K A;  1R23 A;  2EIL H;  1U3E M;  3HTU A;  5DTD A;  2JN6 A;  2VQC A;  1EH8 A;  4UV9 A;  2RNJ A;  4NC7 A;  3HRU A;  5HS9 A;  1A6I A;  2OCE A;  4HV5 A;  1NTC A;  2KJB A;  3DV8 A;  4CCN A;  4L9N A;  2R7T A;  1BOA A;  1FY7 A;  4B8X A;  5J3L A;  2G0E A;  5C3E J;  5LHI A;  4LFU A;  1KQ0 A;  1LUJ B;  3TOA A;  3ML6 A;  4E6K G;  5HLH A;  2XB5 A;  4A3C J;  4U0W A;  1XSV A;  1OCO H;  3ZMV A;  3GTK J;  4ZH4 F;  3H35 A;  4RM3 A;  2VPR A;  4UUT A;  3V7C A;  2RDP A;  1DPU A;  1O57 A;  4F3Q A;  1MBF A;  3C2H A;  4BGD A;  2FF4 A;  1KA8 A;  4AIH A;  2VI6 A;  1IRX A;  1JTY A;  4BQQ A;  2EV5 A;  4QLC U;  4GRI A;  5HDK A;  2HDC A;  4LOC A;  4C2T A;  4M9S A;  3HSR A;  5CYV A;  3RQI A;  2FMY A;  1F5T A;  1ONV A;  1MNM C;  3DPU A;  1R49 A;  1TT5 B;  2QEN A;  3EQL F;  3GTO J;  2CS3 A;  3FF5 A;  2V7F A;  3BJO A;  2A07 F;  2E60 A;  1W7P D;  3DEE A;  1TQP A;  1Z9C A;  3CUQ B;  5LHG A;  5FRN A;  1FNN A;  3LSP A;  1BA5 A;  3I55 I;  3PFY A;  3CF5 F;  1J0R A;  5IOY A;  3S93 A;  2RQQ A;  4NUB A;  1Z05 A;  4XL9 A;  1YJ9 I;  1YRN A;  5J1U A;  2EA2 A;  4AYB N;  3OSG A;  2L3D A;  2FJ1 A;  1SFX A;  4YFN F;  5HS8 A;  2A6T A;  2R93 J;  3OR1 C;  3S1Q J;  1HW2 A;  4BQN A;  3DKW A;  4AIK A;  4GDF A;  2EBI A;  4BUP A;  1XGO A;  1SAX A;  3F8C A;  2CUE A;  4MFE A;  4IEJ A;  2P4W A;  2OPT A;  4G12 A;  2EV6 A;  2LY2 A;  3E5Q A;  3FIW A;  1G59 A;  3HSE A;  1R4N B;  3GME A;  1MMS A;  3M3Y J;  3M8E A;  1DDN A;  1PVE A;  4YEJ A;  2LRD A;  4CGZ A;  2RRE A;  2A6H F;  2W48 A;  2PJR B;  1UZC A;  3QOP A;  4RAY A;  1JI8 A;  1D1C A;  1WI3 A;  2P5K A;  5IYC J;  2D1H A;  5H6R A;  3HL2 A;  2R7Z J;  3ZN1 A;  4BU2 A;  4A3I J;  3IC7 A;  3GLX A;  2DCE A;  1KQ9 A;  1XX5 A;  3WTX C;  3BJA A;  2Q1Z B;  3AG2 H;  2FE3 A;  5LD2 C;  5JI6 A;  1CQT A;  1W5C C;  2DFF A;  3FMS A;  1B9M A;  1EJ9 A;  2H1K A;  4HOB A;  3ZMD A;  1T38 A;  3OS0 A;  2X1D A;  2E34 A;  2ELH A;  3ZRG A;  3DBR B;  3VPR A;  5D5X B;  3BQY A;  3KLO A;  2BBY A;  1RNL A;  3HSF A;  4JX4 A;  2XAJ A;  3CCQ I;  3QU6 A;  3KP5 A;  3WTT C;  2UUZ A;  5HOD A;  4DJA A;  2M5W A;  2FQ4 A;  5EZG A;  3DWL E;  5IT9 Z;  2M2E A;  3K0L A;  3H3V K;  3TO6 A;  3C18 A;  1QZE A;  3RIR A;  4C2M J;  1TQI A;  1U2W A;  3HTS B;  5ILS A;  1WWX A;  3SEZ A;  1S7A A;  1ZG3 A;  3H5R A;  4LIU A;  2VLA A;  1UG0 A;  5IY5 H;  2FBH A;  3JRE A;  2JUG A;  2BW3 A;  2XB0 X;  4WXC A;  2P8T A;  2YS9 A;  1BI0 A;  4DQ2 A;  3HOS A;  3I4N J;  1D1A A;  3F6O A;  2OF7 A;  2ZJR F;  2QM3 A;  1MDM A;  1D0Z A;  5L3G A;  3JW4 A;  5HS7 A;  3OYH A;  5FFX A;  4L9J A;  2XF6 A;  1J09 A;  2OA4 A;  2H94 A;  3GUD A;  1GVJ A;  4NDL A;  3S3M A;  4CZZ A;  1B4A A;  2OC6 A;  4EM0 B;  1SC7 A;  1IJW C;  3TP3 A;  1A31 A;  3J7Z I;  3ZMS A;  4UVC A;  4IO9 F;  5LEJ A;  2G7H A;  4A3F J;  1XMA A;  2JVG A;  3O8H A;  2PJR A;  3FXK A;  2VOD A;  2YU3 A;  5J1R A;  3H36 A;  5LGT A;  4P9F A;  2EZI A;  1TC3 C;  4U88 A;  1K6O A;  3PUB A;  3RI4 A;  2HPM A;  1XPX A;  3CC2 I;  2O61 A;  2ELK A;  3MKL A;  4DYR A;  2HWV A;  4IOA F;  2IXS A;  4X1E A;  4XKV A;  3JTG A;  3VSK A;  1R1U A;  4XR6 A;  5FRO A;  3WE2 A;  1U0J A;  3A4C A;  4HQE A;  2DI3 A;  1E17 A;  2VON A;  1W4M A;  1XCV A;  2L9S A;  3KPH A;  1Z21 A;  3FK6 A;  1O3Q A;  4UHT A;  5E1W A;  1WJE A;  1VFC A;  1VQ5 I;  4M72 A;  2O0Y A;  4YIR X;  4OMZ A;  5EYR A;  4EAT A;  2CO5 A;  1VQ9 I;  1QNT A;  2XIG A;  3C2G A;  3OYF A;  3FXU A;  3EUH C;  3SYT A;  2JUC A;  4E7H A;  1RET A;  1OKR A;  3M9A A;  4PK4 A;  2YPR A;  1JKP C;  4RMN A;  3HG9 A;  3LSJ A;  2EFW A;  3HRS A;  3OR2 C;  3LMM A;  4A6D A;  1ON2 A;  1J5Y A;  1P6R A;  4QSH A;  3GF2 A;  2HQA A;  2Y0M A;  1TBX A;  4LB5 A;  1ZAO A;  2K02 A;  1KON A;  3LST A;  3TGN A;  2O3F A;  2X6X A;  2L7F P;  5E20 A;  4JYK A;  1IF1 A;  5ILV A;  1ZGW A;  4WK8 F;  3CJQ B;  4OWR B;  2NNY A;  2DA1 A;  1DGW Y;  3LL7 A;  1Z3Y A;  3DU6 A;  3CLQ A;  3OYN A;  5FD6 A;  3QP5 A;  3BG7 A;  3P9C A;  2DMT A;  3OIQ A;  2R7S A;  3QQA A;  1R58 A;  2F48 A;  4KT6 A;  1VQM I;  4EJV A;  3ZQI A;  3ECO A;  3HUG B;  1SVM A;  4XQF A;  1Y6I A;  2G7U A;  1S8N A;  3E6M A;  2QF7 A;  3CDH A;  3HOU J;  3NAU A;  2K27 A;  4ESF A;  2X51 A;  2EA4 A;  2EZH A;  3KP7 A;  2OCC H;  1XDU A;  1HA8 A;  1R5I D;  1JJ6 C;  5ERI A;  2IA1 A;  1LDD A;  4HX8 A;  2DOF A;  3M1C A;  5J8F A;  2DPU A;  1UHS A;  5L3C A;  3WOD F;  1PJR A;  1U5T B;  3RKY A;  2XPU A;  5KK1 A;  4LLG F;  3WTY C;  2E1M B;  2GA2 A;  3WU0 A;  3LSI A;  2L9R A;  4N4N B;  2MC3 A;  4LJZ F;  2O9L A;  4KIB A;  5CVR A;  2GXG A;  2CWE A;  2VT2 A;  2P81 A;  4E7S A;  5EGO B;  3S3N A;  2GLO A;  5FLV A;  1GV5 A;  3K1P A;  1ZRD A;  1TW3 A;  1APL C;  1UG2 A;  2DA7 A;  2NAZ A;  4YIF A;  5GTH C;  4V2F A;  2P7V B;  3KZY A;  1SFO J;  3RDI A;  3M07 A;  4OIN F;  1V4R A;  1K4T A;  2OZU A;  4ZTF A;  1MH3 A;  2M34 A;  1JT6 A;  2VC0 A;  1OCT C;  2D5V A;  1ZK8 A;  2VKV A;  1W5S A;  1TWC J;  2ZME C;  5CJ9 A;  3DKY A;  3OYM A;  1ZRC A;  3KYD B;  2NXN B;  3WE3 A;  2ZXJ A;  1YI2 I;  3FHN A;  2RC4 A;  1VQO I;  2AQF A;  1RIO H;  1YTY A;  3G1O A;  1NHA A;  2WAQ N;  1P92 A;  3BTC A;  3A1Y A;  3BZ6 A;  3S14 J;  3Q9S A;  3HOW J;  2CW8 A;  2FBI A;  1IDZ A;  4XKB A;  3GX4 X;  1HSJ A;  2P5L C;  1V55 H;  1SVL A;  2DA2 A;  2ZSI B;  2X1E A;  3NQO A;  3FKI J;  4A3L J;  4XLE A;  1FEX A;  2NS7 A;  1NK2 P;  1PYV A;  5EEH A;  2XDV A;  4CA0 A;  4H0E A;  1R9T J;  1MIJ A;  2ZNY A;  2A68 F;  2IS2 A;  1KU9 A;  3DLL F;  2P6T A;  3ZMZ A;  1J75 A;  3R61 A;  4D5F A;  5DV5 A;  4FX0 A;  3QRF F;  1UFM A;  4HW0 A;  5E3O A;  2CQK A;  1IRG A;  3K6G A;  4LIT A;  1U9N A;  2FSW A;  1BOB A;  1H89 C;  3C1D A;  1WRJ A;  1U5T A;  3FM5 A;  1WQ2 A;  3E5U A;  2ME6 A;  2R7O A;  4IQJ A;  4HX4 A;  3CME I;  2DA4 A;  2WV0 A;  4W1U A;  4HDU A;  1QQI A;  4XRM A;  4P9U A;  5EGO A;  4IHS A;  2HZD A;  3IP4 B;  2FBK A;  3KYC B;  3AG1 H;  2R7F A;  2ZXI A;  2DOA A;  4QTR A;  3TO9 A;  1D5Y A;  3MCZ A;  2QSG X;  1BJA A;  4MTD A;  2XF7 A;  2FRH A;  4UXN A;  1BM9 A;  1ETV A;  4B4C A;  2E1N A;  5BOX A;  5HNH A;  2VN2 A;  2IGN A;  2XAG A;  3BG5 A;  4RB1 A;  2JJ7 A;  1FYM A;  5DUK A;  3GTJ J;  3I0T A;  4KN7 X;  2UWM A;  4ZYG A;  1XMK A;  5DEQ A;  4G9Y A;  5FKN A;  4N4O B;  1BR2 A;  1Q1H A;  2LKP A;  2QQ8 A;  5KHD A;  2CU7 A;  1S7E A;  1LFB A;  4MTE A;  4RGX A;  4P55 A;  2Q0O A;  3QWL A;  3CJT B;  4BBS J;  3HM5 A;  1QBJ A;  1ORK A;  1U8R A;  4BEH B;  1LFP A;  3S1N J;  5FRM A;  4RM2 A;  1XSX A;  1G4D A;  4BE2 A;  3K4K A;  1DUX C;  2OD5 A;  2JMW A;  2DTZ A;  3NWT A;  2MD5 A;  4C3I J;  1UHM A;  3BT9 A;  3I9V 2;  4R1H A;  4KT5 C;  3BRO A;  4O3M A;  2MLK A;  1ZG1 A;  3G4S I;  2DFE A;  1K61 A;  2PMZ N;  2Z5U A;  1DP3 A;  2HQ5 A;  1E2X A;  1MKM A;  5TRD A;  3E5X A;  2NOJ B;  3CCY A;  3LSG A;  5E1Z B;  2QWW A;  4HST A;  1O3T A;  2CW7 A;  2X1C A;  3BPV A;  4XK4 A;  1SD5 A;  4MIM A;  3HBL A;  3FXL A;  4RLF A;  1TWA J;  2Y75 A;  4FT8 A;  3ZQQ A;  2XAH A;  2MBF A;  4CSW A;  3OMY A;  3GTQ J;  2LG4 A;  2QUF A;  2E36 A;  3UKG A;  2DA6 A;  3HOV J;  2KRH A;  4CCL A;  1YHQ I;  1JTX A;  3KP3 A;  5DCM A;  3IWZ A;  9ANT A;  4JX6 A;  2QKL B;  4BXF A;  3D5R C;  1E3H A;  5E3N A;  1VQ7 I;  3HZJ A;  1WVR A;  1REP C;  3M8F A;  3CP8 A;  4XLH A;  4KNY A;  3S15 J;  3AG3 H;  4GO1 A;  2EWN A;  3CJR B;  4PJN A;  3X2Q H;  3OYA A;  2NNN A;  1JT0 A;  2R5Y B;  4Y3O A;  4FTH A;  2ID6 A;  2IGM A;  2BHZ A;  5HNF A;  2PMH A;  2M30 A;  4QPO A;  2EB7 A;  4CCJ A;  5JHU A;  3BG3 A;  4ON0 A;  3ZXS A;  5J40 A;  4FET A;  2FXA A;  3L9F A;  3REO A;  1GXQ A;  2W00 A;  3SQN A;  1ETX A;  2R7W A;  3BTJ A;  3WG7 H;  3K70 C;  5ICE A;  2K85 A;  3WU2 C;  3BOQ A;  2ACJ A;  1BI2 A;  3SEQ A;  1WGX A;  5F0F A;  2PG4 A;  3TBI A;  1SMY F;  1E3O C;  5D5V B;  2CQ7 A;  2HEO A;  1O7F A;  1T6S A;  1XD7 A;  2EK5 A;  2ICW G;  2RN7 A;  3HIF A;  4ENN A;  3K2A A;  3WHC A;  2IGO A;  3KZI C;  4DYC A;  2R7D A;  1IRF A;  1S72 I;  2JA2 A;  2KFD A;  2C6Y A;  3MN2 A;  2CSO A;  4HNV A;  4OMY A;  2B0L A;  1ERD A;  3G1M A;  1ZTR A;  3AKZ A;  3PSF A;  2HU9 A;  1I27 A;  4RB2 C;  3Q5F A;  1FOW A;  5GAH J;  1IV8 A;  3IH3 A;  5F64 A;  4ZTJ A;  5J8C A;  4RDU A;  1KYW A;  3HOT A;  2ETH A;  3TDZ C;  1KGS A;  4IRG A;  1VTN C;  5DUI A;  2DQR A;  2M8G X;  4M3B A;  1X2N A;  4Y33 A;  3G71 I;  3JRB A;  3DLA A;  1WH7 A;  2FA5 A;  3PSI A;  5DCF A;  1MH4 A;  4IHT A;  1FWZ A;  4PFP A;  3SJM A;  3I59 B;  5GTI C;  2R5Y A;  1A6Q A;  4V19 K;  3V7R A;  3F8F A;  2R4G A;  4JQF A;  2E2H J;  3W6K B;  3S2H J;  2PX9 A;  3I4P A;  1YJN I;  3M8J A;  1R4M B;  5D8K B;  4BHC A;  2XKP A;  3E3V A;  4GYI A;  3EDP A;  4YEL A;  2PBI A;  4A2U A;  2VB6 A;  5LHH A;  1R5G A;  1S9H A;  4L5I A;  4D9J A;  2WAE A;  1JHF A;  1ETW A;  1P4A A;  2LYC A;  3I71 A;  4OOI A;  4M6V A;  4PCQ A;  1IXS B;  1HKQ A;  4LK1 F;  2M0M A;  4M9Z A;  1R7J A;  4LD5 A;  4A3E J;  4KJZ A;  3JSP A;  2XC7 A;  4IRH A;  4GYG A;  3ZQC A;  1IXR C;  3BR0 A;  3BR5 A;  1HST A;  4M3D A;  4C3H J;  4G6Q A;  4I99 C;  2DQL A;  2QZ8 A;  1Z0X A;  2DA3 A;  2DT7 B;  1QVU A;  1WI9 A;  3N05 A;  3K4M A;  4BH9 A;  2FQ3 A;  3BR3 A;  2K3P A;  1OYW A;  3BY6 A;  3A02 A;  1Z6R A;  3H3Z A;  4HPQ A;  2F4I A;  3KEQ A;  1JGG A;  2IRF G;  3RKW A;  4CZC A;  4WX9 A;  4MO7 A;  1MMA A;  3PNT A;  4UNO A;  3QYB A;  2DOD A;  2CMP A;  3UNG C;  3CUO A;  2Z33 A;  4KIG A;  3QOE A;  1Y1V J;  3M1E A;  2QSF X;  1STZ A;  2OTJ I;  3I5U A;  2V9K A;  3KYL A;  3BP8 A;  1X19 A;  3KIO A;  5FGM A;  4S0H B;  3FBN B;  4RBO A;  2OUM A;  1NH3 A;  2EJR A;  4FE7 A;  3ULQ B;  3I59 A;  2KZV A;  1DU0 A;  1ZQ3 P;  2LDU A;  1DQU A;  1POG A;  3PM1 A;  4A0X A;  2K9L A;  4BJ6 C;  1G2H A;  2HFH A;  2L2O A;  4ZZL A;  1OYY A;  2VPL A;  1LQ1 A;  1G3T A;  3QU3 A;  4KA4 A;  4M73 A;  3V4G A;  2O5R A;  1HDP A;  3L1P A;  3FXO A;  4IJA A;  2X6W A;  4LGW A;  1OR7 C;  3A0H C;  2Z3Y A;  2FU4 A;  3ABL H;  2VBX A;  3Q3S A;  2DU9 A;  2IPQ X;  3F8N A;  3E6B A;  5B5E C;  5LRR A;  4M6X A;  1BL0 A;  1XGM A;  2KKO A;  2Z9O A;  3ZMT A;  4RA2 A;  1RUN A;  1BBY A;  2Z1D A;  4EJO A;  1RUO A;  2K9M A;  2X9D A;  4BAC A;  1X1D A;  5TJJ A;  3ELK A;  3V8L A;  4CH7 A;  3CJN A;  1SD7 A;  2KDO A;  4RLQ A;  1P7I A;  2E5N A;  3TW6 A;  3PL8 A;  4IQ4 A;  1I6X A;  1WPK A;  3NWS A;  3O3K A;  2LMD A;  1KU3 A;  4M3E A;  2VXD A;  2DDB A;  2VC1 A;  1MBH A;  4MGR A;  3SXY A;  2WWY A;  1A35 A;  1N25 A;  1YX3 A;  3ZR8 X;  2VKH A;  3P9K A;  2JA7 J;  2K3F A;  1XG1 A;  2VAS A;  1W36 D;  3MZY A;  2A5Y B;  5KAI C;  3FKJ A;  3JRI A;  3EUH A;  5DS9 A;  1YJW I;  2BY1 A;  5IT9 K;  2GBY A;  1PP7 U;  4QIW N;  2M45 A;  3J81 Z;  2CRG A;  1T98 A;  3RJP A;  3GBG A;  2LVS A;  1YG2 A;  1B9N A;  2H6C A;  2ZME B;  4ESJ A;  3DFG A;  1W7P B;  4C9Y A;  5DM6 F;  2XSD C;  4U0Y A;  4JX5 A;  1IGN A;  2Y31 A;  3LOC A;  4ANJ A;  2HDD A;  1U6G A;  3SDG A;  4D7N A;  2ID3 A;  4LLN A;  2CQX A;  3T1B A;  2VOO A;  1T33 A;  2P5V A;  3NEU A;  4I02 A;  2O8K A;  3OYJ A;  3OYB A;  2IA0 A;  1FOK A;  2JVH A;  5GPA A;  3LA3 A;  1IZ1 A;  1OMI A;  2XAQ A;  2HYF A;  3B73 A;  2LRE A;  3FDY A;  1VQ8 I;  1FMV A;  3JR9 A;  5LFA A;  5IP9 J;  2WC2 A;  2K4J A;  3DF8 A;  2R7U A;  3CUQ A;  4IHV A;  2XAS A;  2RQP A;  2IT0 A;  1FC3 A;  5J4Y A;  1JHH A;  3MFK A;  1XN7 A;  2VKD A;  1TT0 A;  1QZY A;  3TP0 A;  2M7A A;  4M3F A;  2FOK A;  5C44 J;  4IHY A;  5KNL A;  4BY7 J;  3TQN A;  2LP0 A;  2JQ7 A;  1LPQ A;  2BXZ A;  1RI7 A;  4I09 A;  3OYI A;  2KDZ A;  1OIS A;  1R36 A;  2DFH A;  4HF0 A;  3PQJ A;  4QWQ A;  3KX2 A;  3TO7 A;  4BJ5 C;  5GAE J;  3QPL A;  4OAY A;  1XB4 A;  3HC7 A;  1JXS A;  5FJ8 J;  2K9N A;  2V9V A;  3HXL A;  4A12 A;  1YIJ I;  2F4M B;  2HYG D;  3I58 A;  3K4J A;  2IJL A;  1Z67 A;  3HPG A;  1U78 A;  2WBM A;  3OV8 A;  2HPI A;  3S17 J;  2V1X A;  4HX7 A;  4F93 B;  4II2 A;  1W5T A;  4QPQ A;  3FHZ A;  1LKX A;  2XGD A;  1VQN I;  2NVQ J;  3JAM Z;  4G8X A;  5C4J J;  2B9S A;  3KFW X;  3F6V A;  4L18 B;  2YU9 J;  1T0F C;  1JKO C;  1SFK A;  3KEY A;  2L9N A;  1PDN C;  1JJ8 C;  1XGS A;  3IRQ A;  2FNP A;  2ZME A;  1HBX G;  1W7P A;  2H09 A;  4ASN A;  4OIP F;  3L2R A;  2Y0S A;  3F3X A;  1NG6 A;  1ACI A;  2W25 A;  1W0T A;  5J47 A;  3FXQ A;  5HDN A;  3U9G A;  1HXD A;  1F36 A;  3Q9V A;  3LA7 A;  1MGT A;  4FE4 A;  5JR3 A;  3TKY A;  1QZZ A;  3RPU D;  5JLW A;  5E3L A;  1FTT A;  4YII A;  2R7V A;  4LG3 A;  2NVX J;  2FOW A;  4HAM A;  2M4K A;  5D5W B;  3S2W A;  3K1N A;  4S04 A;  1IC8 A;  4Q48 A;  4KMF A;  3HKZ A;  1T2K A;  5H20 A;  3DTE A;  1LE8 B;  1Y39 A;  2LKS A;  4UB6 C;  4RB3 C;  5B66 C;  3FWE A;  3S1M J;  2CFX A;  4UVB A;  4LG0 B;  4J01 A;  2QEX I;  3EYI A;  1LJ9 A;  3MKZ A;  1SAN A;  1ZGJ A;  1X4P A;  4L9V A;  3OYE A;  2VBW A;  4A3J J;  1QPI A;  2ZFU A;  4LMY A;  1IDY A;  2DMN A;  3TL4 X;  2VJJ A;  3CO7 C;  1WFX A;  5M3F J;  2A3S A;  3MKY B;  1RKW A;  3HGY A;  4HLY A;  4Y52 J;  1B8I B;  3ASN H;  1PUF B;  1Z1D A;  3BQZ A;  1ZR2 A;  4ZC3 A;  1B72 B;  1PUE E;  2Y9Z A;  1QGP A;  3SZG A;  1FYK A;  2CUJ A;  4A93 J;  1WJF A;  1SD4 A;  4BJT A;  2ZXH A;  1AHD P;  3SFZ A;  5IPA A;  1J9I A;  3SZT A;  1D8J A;  1K6Y A;  4I0B A;  3BR6 A;  3PO2 J;  1OCC H;  4G7O F;  1MBE A;  2COM A;  3K2Z A;  3WHB A;  2HKO A;  2R5Z B;  1LDJ A;  2NOG A;  4O6J A;  4DW6 A;  1TW2 A;  5JLX A;  5FKM A;  1MZB A;  2B7E A;  2BV6 A;  2AXL A;  2FD5 A;  3P9I A;  2I10 A;  2LFB A;  2HVS A;  3JSO A;  3G3Z A;  5ICG A;  2VJI A;  3WGH A;  1P7J A;  3O6B B;  4E7J A;  1XGN A;  2LBF B;  3CCL I;  2RAE A;  3J80 Z;  1EH6 A;  1VQK I;  3CCU I;  2LSO A;  1BR4 A;  3Q0W A;  3ZP5 A;  4EJT A;  3BG6 A;  3E1S A;  2JSC A;  1BI1 A;  1IV6 A;  3I53 A;  1VI0 A;  2IAI A;  1ON1 A;  2HKX A;  1Z7L A;  3LFU A;  1YW9 A;  3TW7 A;  2XAU A;  3OYK A;  4DOZ A;  2XUB A;  3EET A;  1H9G A;  2KQR A;  2L4A A;  3I54 A;  2A6E F;  2VBZ A;  2F5E A;  1LE8 A;  3QOD A;  4N9H A;  1G3W A;  4XLC A;  1FSE A;  3MZH A;  1BIB A;  2BY3 A;  1FLI A;  1YW7 A;  2H8W A;  3CCE I;  2W85 A;  3VOE A;  3W2W A;  2VE8 A;  2ZBK A;  3FX3 A;  1BR1 A;  2MW8 A;  3FM3 A;  3L2V A;  1BC7 C;  1MSF C;  2DLL A;  2STT A;  2DJN A;  5CVJ A;  1B8I A;  3BCA A;  1PUF A;  3S2D J;  3HGG A;  1R1V A;  3ZQ7 A;  1C0W A;  1UMQ A;  3G6E I;  1B72 A;  2L5Q A;  3M4O J;  4PUS A;  1X58 A;  4B44 A;  4UUS B;  2XRN A;  1TTY A;  2ZB9 A;  3E97 A;  3ABT A;  1XC5 A;  4MFD A;  3FZV A;  3F9K A;  3QYE A;  2V1D A;  1S7O A;  2Q8K A;  3HUG A;  2Y30 A;  4HV6 A;  2R5Z A;  2EQR A;  1P4W A;  3B6A A;  4AC0 A;  5F1R A;  2G9W A;  3R0A A;  1FIA A;  4UB8 C;  5C4X J;  2P6S A;  2Z99 A;  2EIN H;  2IW5 A;  1B1B A;  4B3A A;  4EJW A;  1W36 C;  1R71 A;  2LF8 A;  2QSH X;  2WB1 N;  3WGG A;  2KL4 A;  4L9T A;  2LH9 A;  4BBR J;  5TGT A;  4EQQ A;  1MNE A;  2EZL A;  3W2V A;  3OYC A;  5F1J A;  5JVT A;  2CG4 A;  2LC2 A;  2AHQ A;  2LBF A;  2NYX A;  5D6E A;  5FKL A;  3LWF A;  4EV0 A;  1Y0U A;  2VQL A;  3F0C A;  1OLT A;  1LEB A;  1SVO A;  3L2C A;  2IGK A;  1RPW A;  2QVO A;  2X0L A;  3FXR A;  3L00 A;  4HEA 2;  1OFC X;  4I98 B;  5CVV A;  2HI3 A;  2CFO A;  4HYE A;  2J5O A;  2E7W A;  4XOP A;  2PJP A;  2W4S A;  4RAZ A;  3DP7 A;  3C3W A;  4Z2Y A;  2EIK H;  2HOS A;  1D0X A;  2CQQ A;  4G6D A;  1X2M A;  2KIM A;  4ETS A;  1WJB A;  5L3D A;  1OCZ H;  1V5G A;  4EJU A;  2K7L A;  4MHG A;  2L0K A;  3CCJ I;  2XPW A;  4CDG A;  4YFK F;  2QQA A;  4XNF A;  4WCG A;  3QP6 A;  1P9Q C;  4AD9 A;  2NVU B;  2M0C A;  2NVY J;  2V1N A;  3LFK A;  5B1A H;  2XHK A;  5AIP A;  1ETO A;  4HRI A;  2ZFW A;  4KIF A;  5M5Y J;  2L7K A;  4Y7N J;  5TIS C;  1CGP A;  3D5S C;  3T8T A;  3ZGK A;  3LSH A;  1UST A;  2MGQ A;  4NNJ A;  4UUS A;  3OY9 A;  4U87 A;  1FT9 A;  1XMX A;  1A36 A;  4M71 A;  1DGR M;  1ZH5 A;  3W6J B;  1G8X A;  2W1O A;  2WTE A;  4RGS A;  2D45 A;  3MVP A;  4D7M A;  1FTZ A;  3H5A A;  3LA2 A;  3CQZ J;  2DPD A;  4X0G A;  2QKM B;  4A0Y A;  2ZO4 A;  4HQM A;  1VF9 A;  3LQR A;  3WGI A;  3NAR A;  2FEZ A;  4YFX F;  3DXJ F;  1ENH A;  4ZYD A;  2HOE A;  4BE1 A;  3VYR B;  2DXI A;  2HOA A;  1UEL B;  1O7L A; 
#chains in the Genus database with same CATH homology
 2UUZ A;  1QHG A;  2F4I A;  4HPQ A;  4DJA A;  4CZC A;  3LSK A;  2GOX B;  3DWL E;  3H0D A;  1MMA A;  3PNT A;  4E4H A;  3QYB A;  2CMP A;  3UNG C;  3RTR A;  3SEZ A;  3H5R A;  4LIU A;  3QOE A;  2VLA A;  1UG0 A;  5CQE A;  2JUG A;  4E7I A;  2M4G A;  4NQW B;  4PJJ A;  4R79 A;  5HVQ C;  2BW3 A;  1X1C A;  2HVR A;  3HOS A;  2V9K A;  4Y4R A;  1D1A A;  3KYL A;  4BDZ A;  1X19 A;  1MMD A;  2WA0 A;  1T95 A;  1D0Z A;  2XSJ C;  3FBN B;  2M3A A;  2BVL A;  3CMM A;  3OYH A;  2MFZ A;  2OUM A;  2VL8 A;  3RQ4 A;  1N78 A;  2XF6 A;  1J09 A;  3S3M A;  2KZV A;  1YE9 A;  2OC6 A;  1DQU A;  2MAB A;  2Z16 A;  3OOU A;  4BEH A;  3U21 A;  2XF5 A;  2K9L A;  4BJ6 C;  3OYG A;  3TMO A;  2JVG A;  2PJR A;  2L2O A;  3I3L A;  2VPL A;  1MW7 A;  4BL0 B;  3AFH A;  3PUB A;  4IZZ A;  3DTI A;  2HPM A;  2O5R A;  2X6W A;  2IXS A;  4J00 A;  1OR7 C;  4XKV A;  2V6E A;  3VSK A;  4XR6 A;  1X1A A;  5FRO A;  1U0J A;  2GOM A;  3A4C A;  4XKC A;  3VDX A;  1X4O A;  2L9S A;  1Z21 A;  2WAD A;  2WY8 Q;  5HOO A;  4AYB A;  1D0Y A;  1WJE A;  3IAM 2;  2Z1D A;  4EAT A;  2K9M A;  4BAC A;  1X1D A;  3OYF A;  3C2G A;  4CH7 A;  4RLQ A;  3EUH C;  2KDO A;  3SYT A;  2CUZ A;  2E5N A;  4E7H A;  1GLN A;  2BVM A;  3PL8 A;  4IQ4 A;  3S8P A;  3NWS A;  4PK4 A;  3HPH A;  3H9J A;  2VXD A;  3ONQ A;  3HG9 A;  4RMN A;  4B47 A;  4DBR A;  2W82 A;  3S32 A;  4ITV A;  3OR2 C;  3LMM A;  1YX3 A;  2KHM A;  2VKH A;  4HG2 A;  4PSX A;  3ZR8 X;  2KP6 A;  2HQA A;  2VAS A;  1W36 D;  3IUO A;  3L2W A;  1MND A;  1KON A;  3BC8 A;  4F55 A;  3VYS B;  2X6X A;  4AVZ A;  3FKJ A;  2R7X A;  3BLY A;  2HNH A;  3CF2 A;  3MD2 A;  3CJQ B;  4OWR B;  3MKW B;  2HDW A;  2LOO A;  3H5N A;  2ZSH B;  4F52 A;  1DGW Y;  3LL7 A;  1Z3Y A;  3DU6 A;  3FBI B;  3OYN A;  3BG7 A;  3GBG A;  4XLF A;  4FAS D;  3OIQ A;  4II3 A;  4ZYA A;  4PJM A;  4C9Y A;  2R7S A;  1TZL A;  4KT6 A;  3OS1 A;  3OYL A;  4E7K A;  3AL0 B;  3HUG B;  4XQF A;  1Y6I A;  4MLO A;  4ANJ A;  2IS6 A;  3K4N A;  4XON A;  4C30 A;  5KCM A;  1QU3 A;  3OYJ A;  2X51 A;  4ZDP A;  3OYB A;  2JVH A;  1ZEL A;  1E0E A;  2LRE A;  3FDY A;  1HA8 A;  2OV7 A;  3M1C A;  4BQO A;  1FMV A;  5LFA A;  3VWB A;  2DJI A;  1FMW A;  4C2U A;  1PJR A;  2VIX A;  3PNV A;  2KLO A;  3OYD A;  2R7U A;  3LSM A;  2E1M B;  1QHH D;  1V5F A;  2VKD A;  2UV1 A;  3LSI A;  1TT0 A;  2M7A A;  4N4N B;  1UAA A;  3S3O A;  3RCO A;  5KNL A;  4E7S A;  3S3N A;  4E7Z A;  3OYI A;  4CUG A;  3D5L A;  3KX2 A;  4IX7 A;  4BJ5 C;  4OAY A;  5CQG A;  3HC7 A;  1LVK A;  3HXL A;  2A5W A;  2X6Y A;  3K4J A;  3HPG A;  4ZTF A;  4JOM A;  2WAF A;  2WBM A;  1Y56 A;  2HPI A;  4F93 B;  3DKY A;  3OYM A;  4II2 A;  4QPQ A;  4F91 B;  2IS4 A;  1LKX A;  3K4B A;  3AL0 C;  5CPR B;  1WJA A;  3FHN A;  3OL3 A;  2AQF A;  2VQH A;  2F6C A;  3K10 A;  3DQV C;  3A1Y A;  4P5O A;  3G2B A;  1T0F C;  3DKX A;  1SFK A;  2CW8 A;  2L9N A;  3KEY A;  4XKB A;  2R7Q A;  2KPM A;  4XOR A;  4DBQ A;  2ZSI B;  4U7B A;  2X1E A;  3L2R A;  2Y0S A;  2ELJ A;  4XLE A;  1NG6 A;  1N77 A;  1PYV A;  1X1B A;  2XDV A;  4CA0 A;  4NC8 A;  2LY1 A;  2IS2 A;  2E1M C;  1SAU A;  3RPU D;  2R7V A;  4LG3 A;  2M4K A;  3K6G A;  4LIT A;  4F92 B;  4XOT A;  2I8D A;  1BOB A;  2KRC A;  3HKZ A;  1N75 A;  3DTE A;  2HVQ A;  4XM3 A;  2R7O A;  4IQJ A;  4PFO A;  4CCK A;  4J01 A;  3BCB A;  1MMG A;  4XLA A;  2M7B A;  3OS2 A;  3MKZ A;  3H9Q A;  1X4P A;  3OYE A;  2HZD A;  3IP4 B;  3VYU B;  2ZXI A;  3K4C A;  2DOA A;  2VJ4 A;  2ZFU A;  3TL4 X;  2VJJ A;  4ZDO A;  1WFX A;  3MKY B;  2XF7 A;  2BW3 B;  2JSP A;  5HNH A;  2IGN A;  2DT6 A;  3EUA A;  4ZC3 A;  3L2U A;  3SZG A;  2CUJ A;  2V4J C;  1WJF A;  4BJT A;  4G6T B;  2ZXH A;  2UWM A;  2FUG 2;  2MYS A;  1K6Y A;  4N4O B;  1BR2 A;  4HSR A;  2MC4 A;  5KHD A;  1VZ0 A;  4XMY A;  4BDY A;  4B48 A;  3PJR A;  3W2A A;  4BEH B;  1LFP A;  5FRM A;  3OWT A;  4RM2 A;  4DIQ A;  2RNG A;  4BE2 A;  3K4K A;  4OAZ A;  3ZCO A;  3NWT A;  2HVS A;  1MMN A;  2VJI A;  4XKW A;  3I9V 2;  2CV2 A;  4D1Q A;  2MD0 A;  4E7J A;  2LBF B;  2E5Z A;  3EUK L;  4E7L A;  1DP3 A;  4KIS A;  3E0J B;  1BR4 A;  1EA3 A;  2NOJ B;  3LSG A;  2IS1 A;  3BG6 A;  3E1S A;  3J7A Y;  4HST A;  2CW7 A;  2X1C A;  3QYF A;  2WY7 Q;  1Z7L A;  3LFU A;  2XAU A;  3IAS 2;  4HNT A;  5HLT A;  3OYK A;  4DOZ A;  4RLF A;  2CV0 A;  3MMY B;  1V5E A;  3ZQQ A;  2VXZ A;  3DU5 A;  1D1B A;  4CSW A;  2KQR A;  4LIV A;  3OMY A;  3CES A;  3OIP A;  2LG4 A;  4AU7 A;  3QOD A;  4CCO A;  4XLC A;  3CZ6 A;  2KRH A;  4CCL A;  3CP2 A;  3W2W A;  4BXF A;  2QKL B;  2CV1 A;  3D5R C;  3K4L A;  1BR1 A;  3L2V A;  2W7N A;  1Z3X A;  3EPZ A;  3CP8 A;  4XLH A;  2R7R A;  2WAQ A;  3A2K A;  2VQC A;  4NC7 A;  3CJR B;  3BCA A;  4PJN A;  3OYA A;  4CCN A;  2VQG A;  4Y3O A;  2IGM A;  2L5Q A;  2R7T A;  4PUS A;  5HNF A;  4B44 A;  4QPO A;  4CCJ A;  4E6K G;  2F5V A;  3F9K A;  3QYE A;  3ZXS A;  2VJ5 A;  4FET A;  3H35 A;  4RM3 A;  2W00 A;  4PSW A;  3VSL A;  2WB1 A;  2R7W A;  3K70 C;  4F3Q A;  4XN3 A;  3C2H A;  4BGD A;  1R6R A;  1W36 C;  1IRX A;  3SEQ A;  4BQQ A;  4GRI A;  2BOL A;  4C2T A;  2KL4 A;  2LH9 A;  4PJL A;  5TGT A;  1MNE A;  3W2V A;  3OYC A;  2LC2 A;  2LBF A;  3TBI A;  3UR3 C;  3H9G A;  3DPU A;  2KMU A;  2VQL A;  2CS3 A;  1OLT A;  2V7F A;  2IGO A;  2E60 A;  3DEE A;  2IGK A;  4HEA 2;  2JA2 A;  4ZDL A;  4CCM A;  1WJ5 A;  5FRN A;  4BE0 A;  2CFO A;  3PFY A;  1ERD A;  5CKT A;  4B3X A;  3S93 A;  4H4K C;  4XOP A;  2RQQ A;  4NUB A;  4XL9 A;  2W4S A;  3AKZ A;  3L2Q A;  3PSF A;  2HU9 A;  1D0X A;  2CH0 A;  3DPL C;  1WJB A;  4B43 A;  1V5G A;  2A6T A;  4YRV A;  3OR1 C;  4ZTJ A;  2Q2E B;  1WJD A;  3HOT A;  4BQN A;  2V26 A;  4BUP A;  4HNU A;  4XNF A;  2AQE A;  4Y33 A;  3DLA A;  3K70 D;  1P9Q C;  3RSN A;  1AA7 A;  2V1N A;  2LY2 A;  3PSI A;  2K5C A;  3VYT B;  1G59 A;  4HRI A;  5JHF A;  4PFP A;  4ZJZ A;  2L7K A;  2X85 A;  1WJC A;  3D5S C;  3ZGK A;  2R4G A;  3LSH A;  3SDB A;  4KIT B;  4JQF A;  4NNJ A;  4YEJ A;  1NG7 A;  2LRD A;  1LDK B;  1YX5 A;  4U87 A;  3OY9 A;  3M8J A;  2RRE A;  3PNY A;  2PJR B;  3OL4 A;  3W3C A;  2PMZ A;  4IKF A;  4P1W A;  1DGR M;  3DTK A;  4YEL A;  1JI8 A;  1D1C A;  1G8X A;  2VB6 A;  3HL2 A;  2W1O A;  1S9H A;  4BU2 A;  4D9J A;  4DGW B;  2WAE A;  3DPT A;  2DCE A;  2LYC A;  3H5A A;  2Q1Z B;  5LD2 C;  4X0G A;  2M0M A;  2QKM B;  4KJZ A;  2XC7 A;  2Z2S B;  3OS0 A;  2X1D A;  3ZRG A;  2DT7 B;  3N05 A;  3V42 A;  3K4M A;  4BS9 A;  4BE1 A;  3VYR B;  2DXI A;  2K3P A;  2P0W A;  1UEL B;  4XN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...