2ELJA

Solution structure of the swirm domain of baker's yeast transcriptional adapter 2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
b'GSSGSSGNMTISDIQHAPDYALLSNDEQQLCIQLKILPKPYLVLKEVMFRELLKTGGNLSKSACRELLNIDPIKANRIYDFFQSQNWM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional adapter 2
publication title Solution structure of the SWIRM domain of baker's yeast Transcriptional adapter 2
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 19
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.780 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2eljA01
2ELJA 2CUJA 2AQFA 2DCEA 2AQEA
chains in the Genus database with same CATH superfamily
1T56A 5HLIA 3HTSB 3HOZJ 4E7KA 2WY7Q 4G6QA 1G8XA 3O3KA 3T1BA 4PGHA 5JLXA 1TWCJ 1Z05A 5CVJA 1YS6A 2E60A 3VSKA 3GFIA 4KA4A 1MH3A 3BG6A 1UG0A 3OR1C 1REPC 3BC8A 3DTKA 4XLPF 5ED4A 4WWCA 1NK2P 2W85A 3OYCA 5E3OA 2ISZA 1PYVA 2IGNA 4HNVA 2VLAA 4IO9F 4FX4A 1EH6A 1YYVA 3K70D 1QRYA 1TW2A 3KYDB 4ESBA 4WX9A 5J4YA 4XR6A 1W5TA 4MNUA 1Q1HA 2E5ZA 2H8WA 1EV7A 3BG5A 2XROA 1ZRCA 1OQYA 2NRAC 3I3LA 3B6AA 1ZTRA 3TEDA 1SVMA 3S3MA 4IHVA 4KMFA 3KZIC 2HI3A 4NBQA 1P9QC 2NVQJ 3ERMA 4CGZA 4C9YA 3ECHA 2CFXA 3Q0VA 4FCYA 4HV6A 1ETKA 2M0MA 3TL4X 2BZTA 1Z6TA 4UVCA 5H6RA 2JA8J 5FLMJ 1T95A 3FKIJ 2K85A 1N75A 4PK4A 1BL0A 5IY5H 4PUSA 1U3EM 4JK1X 4L18B 2F4MB 4MQ9F 3ZR8X 3OOUA 2LG4A 2XKPA 5JHFA 5HOOA 4DYRA 5DM6F 5FRMA 1MBKA 4YFXF 4YFNF 3WGHA 3D5SC 3KEYA 3GTPJ 3IC7A 1USSA 3NAUA 4EV0A 5B5EC 2XC7A 1RRJA 2BW3B 5A2QK 3K70C 4MEYF 1HKSA 2LMDA 2BYVE 2I5UA 4DYQA 1YS7A 5ILSA 4OMZA 4RA2A 1MSFC 3SHFA 1KU2A 2ZMEC 4PDKA 4U88A 3V7RA 2P5LC 2DO7A 1WJ5A 3AG2H 2KIQA 3HUGB 3SZTA 2L02A 1O7FA 1VF9A 1GLNA 2HR3A 2ESNA 2FRHA 4GXOA 3RJPA 1SC7A 2MH2A 3J81K 1R71A 3LSRA 2KJCA 4IRHA 3EPZA 3G4SI 2HTJA 3CDIA 4F55A 1LE8B 5K5OA 2F48A 3LA7A 4A0YA 4XKCA 2JN6A 1XS9A 4IHSA 2LTPA 3QRFF 3CCQI 1PUFA 1DQUA 5KCMA 5M5XJ 3CC4I 1AKHB 4DW6A 2XHKA 1BW5A 4LG3A 3MKWB 1GVDA 2NS7A 4C3HJ 2LD5A 1XGSA 2STTA 3WTTC 2L2OA 1W5CC 2VOPA 2A6TA 2KRHA 3LQRA 1ZG3A 2CS3A 2Y0SN 3I59A 3GMEA 2WB1A 5LEKA 1TQIA 4WCGA 1YW9A 2QYOA 1WI9A 3TGNA 2CQXA 1BJZA 3ZXSA 3BZKA 2P7CB 3R6SA 4UUSB 4XN0A 3DLAA 1U5TA 4F52A 3K0LA 2LOOA 5HODA 3WTSC 2FNPA 3LWFA 3WU2C 1ZAOA 2KHMA 2NOJB 3W2WA 2OA4A 5EEGA 2MBFA 3HL2A 1YIJI 4L9TA 1MMSA 3CMYA 1QVUA 2VN2A 4M72A 3KP6A 1JUSA 3HKZN 5HLTA 2AQFA 3BY6A 4CICA 3OYAA 1IF1A 2O8KA 4C2UA 1R5ID 3IUOA 4PSWA 1W7PD 3CP8A 1D1CA 1FSHA 2OQRA 3BZ6A 3BR5A 3GF2A 1AU7A 2FMLA 2A07F 3HOXJ 2COBA 1FC3A 2JMWA 1JGSA 1K6YA 2D1VA 4EJVA 3KP5A 4J01A 2L4AA 3PIOF 5J3LA 4ZDPA 2KISA 4AIDA 2PMZA 1S7OA 2QEXI 3PM1A 1TWAJ 1QNTA 5L3FA 3E1SA 3NWTA 2EIKH 4DZJA 4ZYEA 2MLKA 1YRNB 3WG9A 2GQQA 2Z5UA 4RB1A 2QSFX 5FKKA 2ZFUA 2XGXA 3I0TA 4P96A 5J1UA 3HRTA 2KP6A 2MGQA 2NXNB 2Q1ZB 3HYIA 3OYMA 1O3QA 2H1KA 2Y75A 4CSWA 1VQ9I 2LC2A 3DLLF 3CUQB 4IOAF 3LFKA 5AONA 5K1YA 2IAIA 3C7JA 2DN0A 3A4CA 3HSEA 2P8TA 5C44J 2A5YB 1I27A 3P9CA 1YO5C 2R7WA 1J9IA 4KJZA 1SMYF 3OV8A 3QODA 2FJ1A 3AG1H 2HKOA 3ZQIA 4A0ZA 1X1DA 2K4BA 1A36A 3TW7A 3LOCA 1WI3A 1Z3XA 3FM5A 1Y8QB 5CVIA 2VJ4A 4AC0A 3FKJA 3W2AA 3J80K 5CJ9A 4M74A 2CH0A 4XN3A 4HBLA 3WTUC 3F8NA 1QU3A 2WTEA 1PP8F 3HEFA 1ZN2A 4KT5C 2QBYA 2VASA 2CMPA 2KPMA 4UXNA 5BPIA 4AWXB 4N0BA 3BDDA 4ANJA 5LFAA 2CV0A 1FZPB 3RZOJ 3LSTA 2BOLA 1LJ9A 3KLOA 3HTUA 3H3VK 3FK6A 3BR1A 2LLKA 3CLOA 1WJEA 2E7XA 1NHAA 1X4PA 5HS8A 2KDOA 3J7AO 2XRLA 3MKLA 1XSDA 1HC8A 3JTGA 4UUVA 3DCFA 3CC2I 1VQOI 1R7JA 2H1LA 2NVYJ 3S93A 1D5YA 2H27A 3F8MA 1BIBA 1R5HA 2GIZA 4PCQA 2K02A 3U1KA 4B44A 1FNNA 1ZGJA 2B7EA 4M73A 3R60A 1IV6A 4NC8A 3G73A 6PAXA 3ERED 1RC9A 4EEFG 3S1NJ 2JSCA 1X3ZB 4G6DA 3RIRA 1BI3A 3FMRA 3IKVA 2HNHA 3HZJA 3J7ZI 4BQAA 2X85A 2EIJH 3FK7A 4ENNA 3G1OA 3QPSA 4LGWA 4BL0B 1SANA 1XSVA 2DFHA 2Y2ZA 4HDUA 3VYRB 2OAZA 2DPUA 4LD5A 2EZHA 2JRMA 4EQQA 3A02A 3OS2A 2X0LA 4X6AJ 1I1SA 4YIFA 4ZC3A 3CCRI 1FT9A 4LLNA 5C4XJ 1KZHA 1FTTA 2RKHA 4XOTA 3ASOH 1IW7F 1B59A 1L3LA 3I56I 4XRMA 2DMUA 2VPLA 1MBJA 1W36C 1JE8A 1CGPA 3SZPA 1D8KA 2VKDA 1B9MA 4V2FA 2EV0A 4IPAA 2XF7A 3G1LA 3WTXC 2R5YA 2KDZA 4NQWB 3UR3C 1DGWY 3EQLF 1Z7LA 1U8BA 2TCTA 2VJIA 2DTZA 3K69A 1T08B 1T2KA 4W97A 4BXFA 4EM0B 2NNYA 2M45A 2XIGA 3V7SA 3A03A 2VUMJ 4ZZDA 5ICFA 2YU3A 4RGUA 3U21A 5KK1A 1UAAA 1ZELA 3W6VA 2KKOA 2OUMA 3DP7A 2QVOA 1PUFB 1WJFA 5IT9K 1OJLA 4MHGA 1F43A 4Q5SF 3WGIA 3DQVC 2OPTA 2XSJC 3DKXA 5FFZA 3HPHA 2K9QA 1WJAA 3FMQA 1K6OA 3LSKA 4DGWB 3K1MA 1YG2A 5IPAA 1ZG1A 3OY9A 1P6RA 1K78A 3CESA 1IN5A 3H1CA 3I59B 5EGOB 1KU9A 2CSOA 1YFHA 3LSMA 1XGNA 2JUGA 3PFIA 2R5ZA 1U5TB 1YI2I 2VE8A 3C18A 4EGZA 3QOPA 2G9WA 3TMOA 3DTIA 4R8HA 3TBIA 1SVLA 3ABMH 1JKQC 4W1UA 1R1TA 3HOTA 1TWGJ 3IWZA 5J8FA 2PMHA 4KFCA 3QYFA 1N77A 3QWLA 3L9FA 4IF4A 1X19A 5EJCA 5H20A 2WADA 3CCMI 1X2NA 2DTRA 2F2EA 4BACA 3F8BA 3ISPA 4DJAA 4HSRA 2VI6A 5HNFA 1EJ9A 2PN6A 3AG4H 3TKYA 4IX7A 4RM2A 1A6QA 1TNSA 3CDHA 3BOQA 3K10A 3L1PA 4XOPA 5KAIC 4A93J 2GWRA 4OIOF 1EH7A 1EF4A 1GHCA 2ELHA 2QUFA 3LAPA 3SDGA 2DJNA 4OWRB 3AFHA 4RB3C 2HYGD 4M9ZA 2XAGA 4HQEA 4IRIA 1H89C 1G6NA 4K2EA 3LA3A 3RKYA 4G12A 1XN7A 2CRGA 3W3CA 3HOSA 2EZKA 3K9TA 3MKZA 4V2GA 2ADUA 1JJ8C 3QAHA 1IN4A 2IBDA 3SQNA 1SFOJ 3QPLA 4ZYHA 4D7MA 1JI8A 2O8XA 2DU9A 4P9UA 4MO7A 2FEZA 5E17F 4E7HA 1IV8A 5GAHJ 4TV7A 3GYHX 4D5CA 3JRHA 3CMMA 3FXOA 5GP9A 3G3ZA 3GX4X 2LBFA 5J47A 1BN5A 4AYBN 1OCRH 1SD6A 3HPGA 1YQAA 3BTIA 2W4SA 3KLNA 3LQQA 1DPUA 3GFLA 4AU7A 2IEKA 2AQEA 4U7DA 3CUQC 2EZIA 2V9VA 1BI2A 2QBYB 4GYIA 4M6VA 5IP9J 2GAUA 5HLGA 4DBQA 2XPVA 2YR2A 4I98B 3RPUD 4L5EA 3G2BA 2DQLA 3EYYA 2XUBA 4HX4A 4L0ZB 2FBKA 2QKMB 1U9OA 3M7GA 2CQKA 3JCUC 2PJPA 3ZQQA 3E6MA 1P2FA 5CKTA 2ME6A 4RAYA 2HQNA 4EJOA 3ZMSA 2M4KA 2V1UA 2Z99A 1DU6A 3SXYA 3TDUC 4OOIA 5FKNA 2I10A 5E18F 3VPRA 3HHHA 5DV5A 2EFQA 4Y13A 1T98A 3BCAA 5BMZA 3CCEI 3CMAI 3HG9A 1D1BA 4XM3A 1F9NA 2GIVA 3MD2A 5DTDA 2R7ZJ 3BQYA 4BUPA 4M3EA 1FBSA 5ILUA 5FKLA 4L9VA 2ZCWA 2VOOA 1QA6A 1L0OC 2XF6A 2EILH 4LK1F 1FTZA 2VE9A 1H9GA 2PQ8A 1JUPA 3K6GA 4BAYA 2BEOA 3SYTA 2OC6A 4N4NB 4RS8A 1ZG5A 3AG3H 2WBMA 2QLZA 3CDLA 4UVBA 3ZN0A 3ZOBA 5D5VB 4HW0A 3O2PE 3O8HA 3ZPLA 3HOYJ 2PFBA 4LLLA 3LSHA 3MZYA 5KAFC 1SFKA 2W7NA 4B09A 4ZJZA 3CCJI 2R92J 3CCVI 3GTOJ 4ZZLA 5KVRA 1RI7A 2UXNA 1BR1A 1OISA 1ZLKA 2R7RA 1UJ8A 2VPRA 3DKYA 4WXDA 3DFGA 3CUOA 2ZXJA 1WKMA 2CV1A 2R7OA 3P7NA 1BR2A 4PZJA 4DBRA 1Z3YA 4L0YB 2VIXA 5LLQA 1X3WB 2V6EA 1LDJA 2K7LA 1WFXA 3HOUJ 3ASNH 5E3LA 2Y9YA 5KHDA 1LVKA 3QP6A 2B9SA 4RAFA 4ZDOA 1BIAA 2L9NA 4ASNA 1R36A 1MBGA 3ZQCA 3CO7C 1Y8RB 2DT5A 2O03A 4XSXF 3L7WA 5D5UB 2ME0A 1MJBA 3I53A 4P55A 1XGMA 1I3QJ 1XGOA 5BOXA 2FF4A 1ODDA 1VQ5I 2Y9ZA 2R5YB 1ZHFA 4M3FA 1GXQA 3E5XA 3PIPF 2XAHA 3CC7I 3Q0WA 4Y52J 2RC4A 3OSGA 1STZA 2CQ7A 4YELA 3A2KA 3HHGA 4F93B 1JKPC 5FLXZ 4BHBA 2FUG2 2BY3A 2OQGA 3OOPA 4F92B 4CXFA 4A3KJ 1DP3A 2LSOA 2FBIA 2QZ8A 2X1CA 1FIAA 3FXJA 1WCMJ 4RAGA 3JRBA 4H4KC 1O3TA 5CVUA 1K83J 4A3GJ 3ZN1A 3E0JB 1LPQA 4BJ5C 2HXIA 2XB5A 3W6KB 2XGEA 3S2HJ 1FMVA 3CLQA 2P7VB 2TDXA 5D8KB 4ZTFA 3D0SA 2HQ5A 5H6QA 3LSPA 2HKXA 2MABA 1R22A 5IYBJ 5F1RA 5K5RA 2AXLA 2V79A 1QVTA 4XBFA 2ZJ2A 1K78B 2XAFA 4GYGA 2BY2A 3LFUA 4MLOA 3K2ZA 5E8GA 2DMTA 1QZEA 3A1YA 1GV2A 2V1NA 2L01A 2XPWA 2P6SA 3F6OA 3IAM2 2DA7A 2DA1A 3GZ5A 1IRXA 2R5ZB 3K4KA 3ABLH 4HOBA 1E3OC 2LDUA 4O3MA 3ZMUA 3V8JA 3O8GA 4BXUA 2DOFA 1JKRC 3DKWA 1ULYA 1BC8C 4GFBA 3KFWX 4E4HA 3DXJF 2DDAA 1B4AA 1FOKA 4I7HA 3ESWB 4JQFA 1FOWA 4DYCA 3IV5A 1YOVB 1ZKGA 1MNDA 3JRIA 4RGSA 2ZJQF 1POGA 2VKHA 1ZARA 1NG6A 3M9AA 3PQKA 3F22A 1G3YA 3W6JB 4ESJA 2E34A 1SD7A 3HRSA 4A3LJ 2ECCA 2KT0A 4I02A 3BG7A 1S6LA 2CUFA 1U5TC 2TRTA 3I55I 2IPQX 2MH9A 2YX4A 4JYKA 2EPFA 2P0WA 4BYYA 5E8IA 2JSPA 4PJMA 1P4AA 3RCOA 1S7AA 2CUZA 3M8FA 3OIOA 3I4MJ 2FMYA 2E1MB 5HVQC 3BT9A 1A5JA 2KRCA 4BDYA 1KU3A 1QPIA 2QSHX 2JA6J 3BQZA 1SFUA 4ABZA 2PJRA 2HQAA 4IOCF 1TNTA 3ZQ7A 2HOSA 2M9HA 5DCMB 5K7FA 1FEXA 2OU2A 1LFBA 2Q8KA 3GLLA 4ESFA 1OKRA 2V9PA 2R7XA 2GOXB 2LF7A 1F1ZA 2M8GX 3WE2A 3HGYA 2W24A 3JSOA 3WHBA 2F5FA 4PGGA 3TO7A 1OLTA 3P9IA 1VNDA 2MSYA 3OIQA 4OU0A 1XSXA 4V19K 3QQAA 2L7KA 2OTJI 3Q9SA 2KZVA 2LBFB 5E3NA 2CG4A 2BBYA 2RQPA 2HU9A 3FZVA 4ZYAA 4D5FA 3G6EI 3KETA 2WB1N 3DBHB 4OAYA 2VBWA 1MKMA 2HOEA 3FIWA 5D5XB 1OCCH 2DA2A 3LA2A 3L2CA 1WPKA 4JX4A 3BTJA 3I64A 4RMNA 2QGUA 3RSNA 1Z1DA 2WAEA 5EEAA 3H5AA 1HKQA 2DXIA 2A61A 2HVRA 2QWWA 1K61A 1O57A 3KX2A 1X4OA 2HYFA 3HC7A 1TL8A 4B8XA 3CJQB 2Z3YA 2Q0OA 3IH2A 3EUAA 1R5GA 4HPQA 1UMQA 2YX7A 1QGPA 3RDIA 4I76A 4Z2YA 2E2IJ 5FLVA 4GDFA 4M71A 1XMKA 1O7LA 3SJMA 5K5QA 2B63J 2CW7A 4B3XA 3TOBA 1X1CA 3UKGA 2LREA 2KLOA 1IAWA 2L0KA 5M3MJ 1ACIA 4JX5A 2E1CA 2NS8A 2X6WA 5JR3A 2YSRA 4BJTA 1SMTA 5FFXA 4BNCA 3GTKJ 2JA7J 1IXCA 2Z9OA 1FSEA 2Y0MA 1ZRDA 3WGGA 1M1EB 1FLIA 1OYYA 2PMZN 2A6EF 3CP2A 3TO6A 3LSGA 3BPXA 5DYMA 3AKZA 3HDDA 3QPHA 1DP7P 2P81A 2JWTA 1XG1A 1B9NA 4NHJA 1LUJB 2VC0A 1P7IA 1UG2A 2LY1A 1R9TJ 1D1AA 5FROA 3OYBA 2ID6A 4XLHA 5M5YJ 2CUJA 1FMWA 4U0VA 4BJ6C 2D5VA 1ITYA 4CDGA 3BWGA 3OYEA 1I6XA 2QQ9A 4CYCB 1K79A 4A5MA 4IQJA 1TT0A 2YUSA 1Y39A 2HQRA 5HS7A 1XB4A 4KIGA 5IYCJ 1XDSA 4Y17A 1D5VA 2EV6A 1KU7A 2X9DA 1FYMA 1U8RA 1IRGA 4XKBA 1Q1VA 5LGUA 4B1RA 3PNVA 4QSHA 2JT1A 3HOWJ 3CCUI 3DWLE 3DU6A 4BXXJ 1MMGA 2A6HF 3PNYA 3KP7A 4FE7A 9ANTA 4LB5A 2JTVA 3CJRB 2V1XA 4PFPA 4A3DJ 5ERIA 4MFEA 2R0QC 4A3IJ 4HF2A 2F5VA 3PUFA 2NS0A 2VB6A 4B3AA 2VT3A 1PVEA 3JRDA 3F72A 3N97A 3S1MJ 2PBIA 3JRCA 2ELJA 1XD7A 1MMNA 1S3JA 2VKVA 2O6GE 5TRDA 4M3GA 4XSZF 4Y7NJ 4HQMA 4HSTA 2CU7A 1RNLA 4A0XA 2OJED 3WTVC 3K4BA 5ICEA 4CCMA 1LKXA 2DMPA 4WF2A 4BKXA 4BE1A 5AIQA 5D8LB 4A3CJ 3G71I 1X1AA 3C2GA 3N05A 4QPQA 5GPAA 2Z16A 2QSGX 2VKEA 3TQNA 4HF1A 3H3UA 1W0TA 1ON2A 1Y0UA 4PFOA 3EUHA 4BY1J 4E7JA 4GGGA 2STWA 4NB5A 5L3DA 4XRFA 4XLAA 1OFCX 1T6SA 1V3FA 4MGRA 1W36D 1TC3C 2IRFG 2Z33A 1J75A 4BHCA 2DOAA 5GADJ 2W25A 2FNAA 4FASD 1GDTA 3T8RA 2QM3A 4NC6A 1VQ6I 5F0CA 1IRZA 2X51A 1BR4A 1B6AA 2A69F 1E3HA 4XRSG 5E1ZB 1ON1A 4XLFA 3ULQB 2HDCA 2QQ8A 2RNJA 3KIOA 2VXDA 4LG0A 4G7OF 1VQKI 2DOEA 3RI4A 3K4LA 3GFMA 1R1VA 4LJZF 2XGDA 3MAJA 4MTEA 1KYZA 5GTHC 3FDYA 3S3OA 3CQZJ 5B3SH 1E3PA 2H6BA 3TP0A 1VI0A 1FYLA 4WK8F 1ETYA 4MQVA 3GFJA 3BJ6A 3OYGA 3S32A 2L54A 1I1GA 2DFFA 2DBBA 1BOBA 5CQEA 1FX7A 3ZP5A 3B02A 3WTWC 2DA6A 1WJBA 2LR8A 3FXKA 3JRAA 3H0GJ 2DAOA 1VTNC 2HZTA 4KICA 3QYBA 1BA5A 1WGXA 5J1RA 1MBFA 2K3FA 3KEOA 3KP3A 2CQQA 4AM3A 2F5EA 2CWEA 2YS9A 2WV1A 3I5UA 4CCNA 1KQ8A 2FXAA 2JJ7A 1PUEE 1XX5A 2XB0X 4RAZA 4XLEA 2A3SA 3LSJA 4I01A 5DD4A 2K40A 2X1DA 3QOEA 1BOAA 4LIVA 2L3DA 1YX3A 1R4NB 2HDWA 1F5TA 2W1OA 1HLVA 2PI0A 2V9KA 2UUZA 4H0EA 3GO5A 2VJJA 3KYCB 3MCZA 2PX9A 4N9IA 4XKWA 5LEJA 1W0UA 2BXZA 2HXOA 4B47A 3H3ZA 4B48A 5D6EA 3GTJJ 1FYKA 2EA2A 2PJRB 2LKXA 4RB2C 5L3GA 4A3JJ 4RLQA 1U0JA 2XVCA 3M1CA 2ELKA 1PP7U 1W7PA 2MLGA 2H09A 4F91B 3CMEI 1OCTC 5DM7F 2PLYA 5F0FA 5FD5A 1LFPA 2M7BA 3WG7H 2WAQA 3KZZA 2GOMA 3F23A 1HW2A 2R7QA 2OTLI 2RAEA 2WA0A 3VWBA 1VQLI 2E1MC 1HW1A 2ISYA 2RREA 3ABKH 2ETHA 3FBNB 1UELB 3I54A 2GA2A 3REOA 2ZKZA 4WXCA 3BLYA 1BI0A 2H94A 3CTAA 3AL0B 2UXXA 4BE2A 4IQ4A 3BJOA 3ZRGA 4ENMA 1GXPA 1W1WE 1YW7A 1W4MA 2WY8Q 3C1DA 3FMSA 3GCMA 2VONA 3MKYB 3IAS2 5E1WA 2G7UA 4NNJA 3KZYA 3A01A 1CQTA 1RIOH 1ETVA 2JK3A 3IRRA 2DYRH 3IH3A 3S2WA 2ZXWH 4IHTA 4UHTA 1UHMA 3AAFA 2GXAA 1IC8A 5DDGA 1XTAA 3K4NA 3DU5A 2RN7A 3HSRA 2H6CA 1JT6A 3FM3A 5LBQA 1I50J 4FE4A 4HRIA 1DUXC 3ABTA 3GEZA 4Y4RA 2G7HA 4M6XA 4KIBA 3DBLB 3M3YJ 4I2OA 2E2JJ 4XMYA 5F04A 1QZYA 2EZLA 2M87A 2R7SA 4BGDA 1XMXA 3JR9A 2KQRA 4HG2A 2QF7A 4E70A 4XIDA 3DV8A 2M30A 1R49A 1ZH5A 3D1NI 4KITB 2LKSA 4UVAA 3OYLA 3QU6A 2V7FA 2FD5A 1OCOH 2R7DA 3E5QA 3H9JA 4QTRA 3S1RJ 4CHUA 5K7HA 3N4MA 5F08A 4DQ2A 5J6XA 3BZCA 1YHQI 1LDKB 2IW5A 4UNOA 5IP6A 3F8CA 1HBXG 3Q3SA 1RUNA 1OYIA 3PNTA 3ELKA 1D8JA 1V5EA 3OYJA 4MEXF 3I4PA 1JTXA 2M4GA 3BJAA 4DIQA 4UB8C 4CZZA 3VB2A 2JVGA 1FOXA 4CCKA 4PJ0C 2ZSHB 2UWMA 2FA5A 2VQHA 1BJAA 2X1EA 4IXAA 2OZUA 2ZJPF 3ZMZA 3SDBA 2D1HA 1GUUA 3Q0UA 1MSEC 1U2WA 4RLFA 5FGMA 4ENKA 2BE5F 4Q4ZF 1UZCA 3ABUA 1MH4A 3ONQA 4NDLA 4XNFA 3HIFA 3OMYA 5IYDJ 3L2WA 4UUTA 1OPCA 2O0YA 1QZZA 4YEJA 4D1QA 1T39A 2DT7B 3ZQFA 2LY2A 3F9KA 4JX6A 1MMDA 2BHYA 5CVRA 1IUYA 3V8KA 1TWHJ 1IGNA 1I3AA 1HQCA 4HV5A 1OR7A 3OYDA 3E6CC 3NEUA 2JRTA 5FRNA 2IA1A 4LMYA 3C2HA 5HDNA 2OBPA 2A68F 1R23A 1KQ9A 2WV0A 5CPRB 1RZ4A 1O4XA 4BBSJ 3CJNA 3S3NA 3MN2A 3DPTA 5TGTA 4B43A 5LHHA 4Y33A 2DPDA 2P6TA 2LFBA 3FF5A 4FT8A 1DPRA 1JXSA 4G6TB 5BS6A 1LFUP 5JLWA 1QHHD 2IXSA 5B66C 2H8RA 2R3SA 5HS9A 3PO3J 2F4OB 2VQCA 3QPTA 2DW4A 5LHGA 2DDBA 4QPOA 5EDNA 1XPXA 3K4JA 1V5GA 4NUBA 4QWQA 2M3AA 5D4RA 1MBEA 5EEHA 1JHFA 2XKOA 4EJWA 4E7ZA 2M2EA 1TTYA 2C6YA 3GBGA 1I6HJ 1Z21A 1R1UA 3C2BA 3BG9A 2KMUA 2Y69H 1AOYA 3RTRA 1WJDA 3U9GA 4E7LA 4U7BA 3Q5FA 1ZGAA 1VZ0A 5EG0A 1MNMC 3TOAA 2JVHA 1IN7A 2LVSA 2EK5A 5F27A 2QCOA 2K9MA 2L5QA 1Y1WJ 4LG0B 2PG4A 1ZGWA 3V4GA 1KQ0A 1WWXA 5E20A 2DMQA 4ZYDA 2Q2EA 3KYLA 1P4XA 2J5OA 2VL8A 5EZHA 4FTHA 4OIPF 1LDDA 4R79A 1WSUA 4C2TA 5JI6A 4IEJA 3X2QH 1MJ9A 1W5SA 2W00A 3M1EA 5BPDA 4XQFA 3K4MA 1MNEA 2IA0A 4ZYGA 4HYEA 2HGCA 1J2XA 3GZNB 5FJ8J 1T8IA 3W2VA 4PJNA 1LEBA 2Z2SB 4LIUA 4BDZA 1R4MB 4NC7A 4EMSA 3S17J 2F6CA 5B1BH 2XAQA 1TLHB 4FISA 4AD9A 2DJIA 5J1YA 2IS4A 5JHUA 4HX8A 3LNQA 1WJCA 2DA5A 3CCYA 2ZXHA 1TW3A 3EETA 2KIFA 2VC1A 1IUFA 2JPCA 1J5YA 1X2MA 5IP7J 3S1QJ 1H9TA 3HBLA 4PSXA 3BTCA 1SFEA 3CUQA 3BROA 5CQGA 1TZLA 2E1OA 1W7PB 2LK2A 3NQOA 5F6FA 2EWNA 2OF7A 1VQPI 2EV5A 1G2HA 2IA2A 1V4RA 1LVAA 1FY7A 2HYJA 3H5RA 1USTA 4Q47A 2NVTJ 3KEQA 1APLC 2D2WA 5M3FJ 3ZGKA 4M9SA 1MGTA 2KFDA 3UNGC 3GZ6A 3I71A 3CF5F 1HSJA 4A69C 5AIPA 4LFUA 3DTEA 2E1NA 1NK3P 2MD5A 2R93J 1TBXA 1QQIA 4L9NA 4RBOA 2BHZA 1G59A 4IKFA 2ZB9A 3BG3A 1ZYRF 1T0FA 2M34A 1FOYA 1WH7A 1YW8A 2K9LA 2LY9A 3U1DA 3A01B 2NVUB 2ZXIA 1VQNI 5LD2C 4AIHA 4KN4X 2QQAA 3L2UA 1KGSA 4ZDLA 1NH3A 5HNHA 1ETQA 1IN8A 1WQ2A 1WH5A 5CYVA 2JUCA 4MFDA 2BY1A 2L9RA 1HOMA 2VT2A 4YIIA 1BM9A 5E1XA 1MBHA 4DNCA 1ZR4A 3AL0C 3DBRB 4I99C 2ZC2A 4ETSA 4D0PA 1FWZA 2UV1A 2M0CA 4I0AA 1J59A 4BU2A 1UFMA 1HDPA 1UB9A 2O7OA 4O5VA 4EGYA 5J4VA 2L4MA 3ROUA 2CYYA 2LP0A 1JTYA 2E19A 3RPUA 3GTGJ 4RDUA 3S15J 2R7UA 1IO2A 2KL4A 3HRMA 1SD4A 2Z1DA 2LKPA 2O9LA 1IN6A 3SFZA 1ZRFA 1EA3A 4XRSA 3H0DA 3V42A 1ZQ3P 3LAJA 2EFPA 3WU0A 2L9SA 4BEHA 5ICGA 1ETOA 1A04A 2RQQA 3NARA 1YJWI 2FX0A 2OZ6A 2KRFA 1Y1VJ 2NAZA 1X1PA 1S5LC 3K7AJ 1N78A 1BI1A 1UHSA 2ZNYA 2V4JC 2R7FA 4M3DA 1D0XA 1NTCA 4CCLA 4OIQF 1FIPA 3A0BC 4OINF 3JTHA 4BE0A 1JKOC 1QO0D 2K9SA 2HOAA 4LB6B 4L5JA 4IRGA 3ZQGA 4ITVA 1JHHA 3OL3A 3WE3A 3P5JA 5LGTA 3PSFA 1H0MA 3MWMA 4HEA2 5EF6A 3VODA 5FB2A 3B73A 4P1WA 1ENHA 1WHUA 3PUBA 4A3MJ 1OYWA 1J7KA 3H5NA 1ETXA 3JAMZ 2HS5A 1JJ6C 3FXMA 3HGGA 3M8EA 1Z7UA 2DYSH 2EINH 2PEXA 1N25A 2LYCA 2DODA 4XL9A 1AWCA 2OCEA 1RR7A 2VQLA 4NQWA 2LNBA 4OIRF 1YE9A 2FE3A 5BNGA 2CW0F 2Y30A 2RVCA 1YIOA 4OMYA 3D5LA 4XK4A 2X6OA 3PJRA 3GTLJ 1IXRC 1Z67A 2G0EA 1P7JA 4J00A 4S05A 2JZYA 2VXZA 3HB9A 3EYIA 1X1BA 4ENJA 2E71A 2DFIA 3BR6A 1A31A 1A35A 3OSFA 4A3BJ 1V5FA 5GAGJ 2QA4I 2R7VA 2HVSA 5HLHA 4F3QA 3O6BB 4XORA 3V8LA 2B0LA 5F1JA 4HDVA 4HLYA 4YFKF 3GTQJ 3ML6A 3QP5A 3COAC 3MMYB 4A3EJ 2F5DA 3KP4A 3H35A 1JGGA 3ZCOA 1IJWC 2V6CA 3LL7A 5FO5A 4BS9A 2OD5A 4FETA 2DCEA 4HNUA 1TT5B 1IXSB 2HPMA 2BGCA 1B72A 3NRVA 1GV5A 2R7TA 2Y48A 5FKMA 3E97A 1S9HA 3TW6A 5EGOA 4C30A 3OS0A 3F21A 4EJTA 5EG0B 4N9HA 2DK8A 4KUMA 2P5VA 3F0CA 3R61A 1D0ZA 2FU4A 2CFOA 1QHGA 3QU3A 4AVZA 2ECBA 5DS9A 2M1BA 3L2QA 2GXGA 3NWSA 3OL4A 1S29A 1CF7A 2MG4A 2XGCA 3EUHC 2DA4A 3RYPA 4KISA 5D5WB 2EA4A 1K4TA 2Q2EB 1Z6RA 5KNLA 2ID3A 2Y0SA 3RKXA 5K7ZA 3M8JA 2GBYA 3M07A 5BQTA 5JFRA 2JPBA 2M5WA 3H36A 4IVNA 3HSFA 2ZNZA 4UV8A 5C3EJ 3E6DA 4IL6C 2E5NA 3S8PA 3WU1B 4XLNF 1SAUA 3K4CA 3T0YA 2ZMEA 2VJ5A 3F6VA 2DT6A 5F0HA 1YLFA 2QKLB 1E2XA 3FX3A 2W48A 4RGXA 5LGNA 3E3VA 1RESA 3FXLA 3HKZA 2RDPA 1V54H 4XLCA 5JVTA 4HAMA 4PJLA 1BBYA 5TJJA 1LEAA 4E7SA 3IRQA 4DZPA 3FXUA 1TWFJ 4WXHA 2UZKA 3CCSI 3PO2J 4KMUX 1O3RA 2YU9J 2IVMA 5H2FC 4IHXA 1HCRA 2FBHA 2XAUA 1XC5A 4LOCA 2BV6A 3ZMTA 2O3FA 4GRIA 5ILVA 3S2DJ 2IS1A 2NYXA 1YJ9I 5D6FA 5DEQA 3SEZA 4CCOA 3OWTA 4RB0A 2MYSA 4P5OA 2XF5A 1P92A 3HRUA 4LLGF 4CCJA 1KYWA 4II2A 4C2MJ 2MFZA 3FXQA 4X0GA 3MVPA 3JRFA 3GTMJ 2QQBA 3HOVJ 4FHTA 1SFXA 3ECOA 2K5CA 1I5ZA 4II3A 3VYTB 2VBXA 2KZGA 1QPMA 2BVLA 3L2VA 4Q48A 1PDNC 1PJRA 2VBZA 4RGRA 5J40A 1FP1D 1F4KA 1G3SA 2E2HJ 1J0RA 1B8IA 4UV9A 3FWEA 2E36A 2W57A 1E0EA 3KE2A 1SD5A 2KIUA 1ONVA 2PMUA 3WHCA 1MIJA 2HDDA 3H92A 2JA5J 4YG2F 1HKTA 4QIWN 2ZO4A 1WVRA 3TDZC 3CZ6A 3VYUB 2P5KA 4PJJA 5A2QZ 1K7AA 4XICA 2EFNA 1IDZA 3WTZA 3VYSB 4BQQA 2LH9A 4BBRJ 4A5NA 2AHQA 4EJUA 3M4OJ 2HFHA 3OIPA 3D5RC 1B1BA 1ETWA 4KIFA 2XV4S 3OYFA 2QENA 2FQ4A 1X3UA 1A6IA 2GA1A 3GUDA 5JVGF 2GZWA 2HZDA 1FJLA 2RNGA 3LSIA 3J81Z 3ZMVA 2L9VA 3MZ8A 1Y6IA 3GW2A 1QBJA 1VQ7I 1Z0XA 4HZFA 3VEPA 2VQGA 2BXYA 4I6ZA 2K27A 1T38A 4QLCU 5E3MA 4G7ZF 4M3BA 1J09A 3DEUA 1HXDA 2MD0A 2A5WA 4HA8A 1BW6A 3CO6C 4BEHB 2AS5F 3ZQLA 3V7CA 2F5CA 2M7AA 2HOTA 5GPCA 2EH3A 3KCCA 1OMIA 4A12A 2F4IA 5D4SA 2EBIA 4N4OB 4LITA 2L7FP 1Z91A 3R0AA 2WAQN 1ERDA 4DOZA 2L7MP 3BTLA 2CO5A 2CJJA 2OCCH 1FBUA 1MMAA 1TQMA 3I58A 2CV2A 3RKWA 1UCRA 2FOWA 4E7IA 1MDMA 3PQJA 4EATA 2K3PA 4I0BA 3HXLA 3JRGA 1HSTA 3IKTA 2D45A 3RKQA 1E17A 1KA8A 2K86A 5DUIA 5CLSA 2V1DA 4P9FA 3DPLC 5F64A 5C4JJ 5DUKA 2RV8A 2K9NA 4BHPA 2GLOA 2IT0A 1VFCA 1VQ8I 2HEOA 2L7ZA 3GLXA 4ON0A 3SEQA 2EQRA 1SEUA 2AXTC 2AO9A 2Y31A 3E7LA 2JA2A 2LF8A 2XRNA 1DDNA 1G4DA 1XMAA 2DQRA 4Y3OA 2XAJA 1ORKA 3BR3A 3R4KA 1D0YA 3K2AA 4LK0F 2IJLA 2LRDA 3FISA 2MA3A 3PL8A 3QYEA 4KN7X 2P4WA 4F7ZA 1U78A 3MFKA 4J19A 3B6CA 2EFOA 3C3WA 4R1HA 1G3WA 1KONA 2W82A 3EUKL 4CA0A 2EB7A 5FD6A 1G3TA 1Z77A 1I39A 2O5RA 5B1AH 1V55H 4CH7A 1UHWA 3IP4B 4ZTJA 5IOYA 2IS6A 3A0HC 3F3XA 1OR7C 1MJAA 5CVVA 1WRJA 5LHIA 3OYHA 1H8AC 4Y15A 4A6DA 2JQ7A 1LQ1A 3CCLI 1RUOA 2CW8A 5FKOA 5ICCA 4YRVA 3OYKA 2XPUA 2I8DA 1OCZH 5IT3A 3VFZA 4E6KG 4EVIA 4GCVA 1XCVA 1B72B 3S16J 2MW8A 1EKEA 1MW7A 4BH9A 2IP2A 3OYNA 3L09A 2HWVA 2FQ3A 1WZ2A 1MZBA 2RGVA 1K4SA 1AA7A 3OYIA 2OV7A 1IZ1A 2K4JA 3BCBA 3E5UA 1CF7B 4G7HF 1D3YA 2XDVA 3PFYA 5GAEJ 5FLXK 3J80Z 3G1MA 5HDGA 3DPUA 5TISC 5J8CA 1TP4A 3HM5A 1U6GA 4U0YA 3J7AY 3RQ4A 2X6YA 1SAXA 2E35A 4KNYA 5IOZA 1RR8C 2HVQA 4FQGA 4YIRX 4D7NA 1LB2A 2BVMA 2E7WA 3FHNA 4BY7J 2ZMEB 1FPQA 1ZREA 2M8EA 5DD8A 3FXRA 3GVAA 2DI3A 2X6XA 3CF2A 3MEXA 5GTIC 4EM2A 3S14J 2CGPA 2IS2A 2ESHA 4MIMA 3KP2A 4HLXA 4XONA 1RKWA 1HA8A 3T8TA 1FBQA 1GT0C 2YPRA 1DGRM 2BW3A 2V26A 3GXOA 1F36A 3MQ0A 4RM3A 4KT6A 3CD6I 1SVOA 1GVJA 4C3IJ 4IHWA 4CUGA 5DCMA 3RPQA 4C3JJ 5L3BA 1LNWA 2MC4A 2XSDC 4IZZA 3HUGA 5HDKA 4UB6C 2X48A 4S0HB 5EZGA 4G9YA 2WWYA 2IGMA 3L00A 3R0JA 3MZHA 3BP8A 1R00A 4AUXA 3FHZA 1ZLJA 2GM4A 1ZK8A 3I4NJ 4A2UA 3RZDJ 1TQPA 1LE8A 4HF0A 4EM1A 1HF0A 4JP0A 4A6EA 3EDPA 2WC2A 1BC7C 1U9NA 3Q9VA 1IDYA 1S7EA 1S8NA 4U87A 2HTSA 3SFIA 2WAFA 1MD0A 1XCBA 3RYRA 1S72I 1AKHA 2COMA 1IRFA 4UY8I 4S04A 3E6BA 3H9GA 5EYRA 4CO8A 2A05A 4KDPA 4AIJA 2CQNA 4MTDA 2ICWG 2VBYA 3FBIB 2ZBKA 2XASA 1B8IB 1DU0A 3BPVA 4CZCA 4AYBA 1H88C 1Z9CA 1YJNI 5E79C 1ZR2A 2DK5A 4L5IA 4KYWA 4JBAA 3SZGA 5M5WJ 2ZJRF 1RKTA 4UUSA 3RQIA 2ZSIB 2KJBA 1HDDC 3T5XA 4D9JA 2VODA 1RPWA 4I09A 1YITI 3U2RA 1T0FC 2EIMH 3VOEA 1RETA 3JAMK 5LRRA 2CUEA 4M9XA 2NVXJ 5L3EA 3LMMA 3WODF 4AIKA 2DMNA 1P4WA 4Z6YA 4HNTA 3KPHA 1EH8A 2ZFWA 2FSWA 2HPIA 3JW4A 3JSPA 2ACJA 3GWZA 4B4CA 2NOGA 2DA3A 4X1EA 2DLLA 1JT0A 3HJEA 5DCFA 3VDXA 1AHDP 4IJAA 2EJRA 2R4GA 3H9QA 3PSIA 5IT9Z 3I9V2 2O61A 4L9JA 3L2RA 2N8GA 3P9KA 3DEEA 5L3CA 4IHYA 4XKVA 1NG7A 5LRSA 2FOKA 1VQ4I 3VSLA 3ZMDA 1JUMA 3WTYC 4CYCA 1YRNA 3IH4A 3JREA 1Y0NA 3DEWA 1R6RA 3IL2A 1IG7A 3F8FA 4ZH4F 3IWFA 4JOMA 3DF8A 4OAZA 1OCPA 3OR2C 3TP3A 3BR2A 1FP2A 3TO9A 1O3SA 1MDMB 2X4HA 4HX7A 1YX5A 4BQOA 1VQMI 1HW5A 2IGOA 4G94A 2DFEA 3CJTB 4G8XA 4GO1A 3OS1A 4M6YA 2EFWA 4U0WA 3BR0A 2NNNA 2GXBA 1R58A 2MC3A 1X58A 3K1NA 1T33A 4CYDA 3ZQHA 4A3FJ 1XDUA 4O6JA 2W84A 3K1PA 2BY0A 1C0WA 4FX0A 1YTYA 3J7YJ 2J5PA 4BQNA 4AVPA 3IHUA 2KIMA 1Y56A 2IGKA
chains in the Genus database with same CATH topology
4E7KA 3W3CA 2R7TA 2WY7Q 1S9HA 1WJBA 3MKZA 3HOSA 1G8XA 4C30A 3OS0A 1JI8A 3QYBA 1D0ZA 2CFOA 2E60A 1QHGA 3VSKA 4E7HA 4AVZA 4CCNA 3L2QA 4XLEA 3NWSA 3OL4A 3BG6A 3EUHC 1UG0A 3OR1C 3CMMA 2X1DA 3QOEA 3BC8A 4LIVA 3DTKA 4KISA 1YX3A 2HDWA 2LBFA 2Q2EB 2W1OA 5KNLA 2V9KA 2Y0SA 2UUZA 3OYCA 3HPGA 2VJJA 3M8JA 1PYVA 2IGNA 2W4SA 4XKWA 2VLAA 4AU7A 4B47A 3K70D 4B48A 2AQEA 2PJRB 4XR6A 2E5NA 3S8PA 4RLQA 1U0JA 3M1CA 2E5ZA 4DBQA 1SAUA 3K4CA 3RPUD 4F91B 2VJ5A 2DT6A 2QKLB 3G2BA 1LFPA 3I3LA 2M7BA 2WAQA 3S3MA 2GOMA 2QKMB 2R7QA 3HKZA 3ZQQA 2WA0A 3VWBA 4XLCA 5CKTA 2E1MC 1P9QC 2RREA 4PJLA 3FBNB 2M4KA 1UELB 4C9YA 4E7SA 2M0MA 3BLYA 3TL4X 3AL0B 4BE2A 4IQ4A 1T95A 3ZRGA 2WY8Q 1N75A 4PK4A 2XAUA 3MKYB 3BCAA 3IAS2 4PUSA 4NNJA 3HG9A 1D1BA 4GRIA 4XM3A 3MD2A 2IS1A 4BUPA 3SEZA 3ZR8X 3OOUA 4CCOA 3OWTA 2LG4A 2MYSA 4P5OA 5JHFA 2XF6A 5HOOA 2XF5A 4CCJA 4II2A 5FRMA 3D5SC 3K4NA 3DU5A 2MFZA 3K6GA 4X0GA 3SYTA 2OC6A 3KEYA 4N4NB 2WBMA 4HRIA 2XC7A 4Y4RA 2BW3B 3K70C 2K5CA 4XMYA 3LSHA 4II3A 3VYTB 1SFKA 2W7NA 2R7SA 2BVLA 4BGDA 4ZJZA 3L2VA 2KQRA 1PJRA 4HG2A 1BR1A 1WJ5A 2R7RA 3DKYA 3HUGB 1GLNA 1E0EA 2CV1A 2R7OA 4KITB 3OYLA 2V7FA 1BR2A 3H9JA 4DBRA 1Z3YA 2VIXA 3EPZA 3CZ6A 3VYUB 4F55A 2V6EA 1WFXA 4PJJA 1LDKB 4XKCA 5KHDA 1LVKA 4BQQA 3VYSB 4ZDOA 2LH9A 2L9NA 1DQUA 3PNTA 5KCMA 1V5EA 4LG3A 3OIPA 3OYJA 3MKWB 3D5RC 2M4GA 4DIQA 3OYFA 2JVGA 4CCKA 2ZSHB 2UWMA 2VQHA 2HZDA 2X1EA 2RNGA 3LSIA 1Y6IA 2L2OA 3SDBA 2A6TA 2VQGA 4YELA 2KRHA 3A2KA 4F93B 4RLFA 2CS3A 2FUG2 2WB1A 3ONQA 1J09A 4F92B 4XNFA 2MD0A 3OMYA 2A5WA 3ZXSA 3L2WA 1DP3A 4BEHB 2X1CA 4XN0A 4YEJA 3DLAA 4D1QA 2DT7B 4F52A 2LY2A 3F9KA 1MMDA 2LOOA 2M7AA 4H4KC 2KHMA 2NOJB 3E0JB 3W2WA 3HL2A 2F4IA 3OYDA 4N4OB 4BJ5C 4LITA 1FMVA 5FRNA 1ERDA 4DOZA 5HLTA 4ZTFA 2AQFA 1MMAA 2CV2A 3C2HA 2MABA 3OYAA 4E7IA 5CPRB 4C2UA 4EATA 2K3PA 3HXLA 3IUOA 3S3NA 4PSWA 3CP8A 3DPTA 5TGTA 4B43A 1D1CA 3LFUA 4MLOA 3DPLC 4Y33A 3A1YA 2V1NA 4G6TB 3IAM2 1QHHD 2IXSA 1IRXA 3SEQA 1K6YA 3K4KA 2VQCA 4J01A 4QPOA 2JA2A 4ZDPA 3K4JA 2PMZA 1V5GA 4NUBA 4E4HA 2M3AA 3E1SA 4Y3OA 3NWTA 1D0YA 4E7ZA 4JQFA 2LRDA 3GBGA 3PL8A 3QYEA 1Z21A 2ZFUA 2KMUA 1MNDA 2KP6A 2Q1ZB 3RTRA 3OYMA 2VKHA 1WJDA 1NG6A 4CSWA 2LC2A 4E7LA 4U7BA 1VZ0A 1KONA 3BG7A 2W82A 3EUKL 4CA0A 2JVHA 2O5RA 3A4CA 2K9MA 2L5QA 4CH7A 2R7WA 4KJZA 2P0WA 3IP4B 4ZTJA 2IS6A 2JSPA 3QODA 4PJMA 3RCOA 1OR7C 2CUZA 3OYHA 1X1DA 3KYLA 2E1MB 5HVQC 2VL8A 1Z3XA 2CW8A 2KRCA 4BDYA 4R79A 4C2TA 4YRVA 3OYKA 2VJ4A 3FKJA 2I8DA 3W2AA 2W00A 2CH0A 4XN3A 4E6KG 2PJRA 1QU3A 2HQAA 4XQFA 3K4MA 1MNEA 2VASA 1MW7A 2CMPA 2KPMA 3OYNA 3W2VA 4PJNA 2GOXB 2R7XA 2Z2SB 4LIUA 4BDZA 4NC7A 1AA7A 4ANJA 2F6CA 3OYIA 2OV7A 5LFAA 2CV0A 3BCBA 2BOLA 2DJIA 2IS4A 1WJCA 1OLTA 2XDVA 3PFYA 3OIQA 2ZXHA 2L7KA 1WJEA 3DPUA 2KZVA 1X4PA 2LBFB 2KDOA 2HU9A 4ZYAA 4OAYA 3J7AY 3RQ4A 2X6YA 3S93A 4PSXA 4RMNA 2HVQA 3RSNA 5CQGA 2WAEA 2BVMA 3H5AA 1TZLA 2DXIA 3FHNA 4B44A 2HVRA 4NC8A 3KX2A 1X4OA 3HC7A 3CJQB 2X6XA 3CF2A 3EUAA 3H5RA 4HPQA 3ZGKA 2IS2A 2HNHA 4XONA 3UNGC 2X85A 1HA8A 1DGRM 2BW3A 2V26A 3DTEA 2CW7A 4B3XA 4RM3A 4KT6A 4BL0B 1X1CA 2LREA 2KLOA 1G59A 4IKFA 3VYRB 2X6WA 4CUGA 4BJTA 3OS2A 2K9LA 2MC4A 4IZZA 2ZXIA 4ZC3A 5LD2C 3L2UA 2IGMA 4ZDLA 4XOTA 5HNHA 3CP2A 3LSGA 3AKZA 3AL0C 2VPLA 2LY1A 1W36C 4U87A 1D1AA 2UV1A 2WAFA 5FROA 4XLHA 3OYBA 2VKDA 4BU2A 3H9GA 2CUJA 1FMWA 2XF7A 4BJ6C 3OYEA 4IQJA 4NQWB 3FBIB 1TT0A 1DGWY 3UR3C 1Z7LA 2R7UA 2VJIA 2KL4A 2Z1DA 4CZCA 4AYBA 4BXFA 1EA3A 3SZGA 3H0DA 3V42A 4XKBA 3PNVA 2L9SA 4BEHA 2RQQA 3U21A 1UAAA 3DWLE 3DU6A 1ZELA 2ZSIB 1MMGA 2OUMA 3PNYA 4D9JA 1N78A 3CJRB 1WJFA 2V4JC 4PFPA 1T0FC 1D0XA 4CCLA 2F5VA 3DQVC 3LMMA 2XSJC 3DKXA 4BE0A 2VB6A 4HNTA 2HPIA 3HPHA 2ELJA 1MMNA 1WJAA 4ITVA 3OL3A 3LSKA 4DGWB 3PSFA 4HEA2 3VDXA 4HSTA 3OY9A 3CESA 3K4BA 4P1WA 2R4GA 3PUBA 3H9QA 4CCMA 1LKXA 3PSIA 4BE1A 3H5NA 3LSMA 3I9V2 2JUGA 1X1AA 3L2RA 3C2GA 3N05A 4QPQA 3DEEA 2Z16A 4XKVA 3TMOA 3DTIA 3TBIA 1NG7A 4PFOA 4E7JA 2LYCA 3VSLA 4XL9A 3HOTA 2VQLA 4XLAA 1R6RA 1YE9A 1W36D 3QYFA 1N77A 2DOAA 3D5LA 1X19A 4JOMA 4OAZA 4FASD 3OR2C 3PJRA 4J00A 2WADA 2VXZA 2X51A 1BR4A 1YX5A 4BQOA 4BACA 1X1BA 4DJAA 4HSRA 2IGOA 4XLFA 5HNFA 4IX7A 1V5FA 4RM2A 2R7VA 2HVSA 3OS1A 2VXDA 4F3QA 4XORA 3K4LA 3K10A 3FDYA 3S3OA 4XOPA 3MMYB 3H35A 3OYGA 3S32A 3ZCOA 3LL7A 4BS9A 4FETA 4OWRB 3AFHA 2DCEA 4HNUA 4BQNA 1BOBA 5CQEA 1Y56A 2HPMA 2IGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELJ A;  2CUJ A;  2AQF A;  2DCE A;  2AQE A; 
#chains in the Genus database with same CATH topology
 1T56 A;  5HLI A;  3HTS B;  3HOZ J;  4E7K A;  2WY7 Q;  4G6Q A;  1G8X A;  3O3K A;  3T1B A;  4PGH A;  5JLX A;  1TWC J;  1Z05 A;  5CVJ A;  1YS6 A;  2E60 A;  3VSK A;  3GFI A;  4KA4 A;  1MH3 A;  3BG6 A;  1UG0 A;  3OR1 C;  1REP C;  3BC8 A;  3DTK A;  4XLP F;  5ED4 A;  4WWC A;  1NK2 P;  2W85 A;  3OYC A;  5E3O A;  2ISZ A;  1PYV A;  2IGN A;  4HNV A;  2VLA A;  4IO9 F;  4FX4 A;  1EH6 A;  1YYV A;  3K70 D;  1QRY A;  1TW2 A;  3KYD B;  4ESB A;  4WX9 A;  5J4Y A;  4XR6 A;  1W5T A;  4MNU A;  1Q1H A;  2E5Z A;  2H8W A;  1EV7 A;  3BG5 A;  2XRO A;  1ZRC A;  1OQY A;  2NRA C;  3I3L A;  3B6A A;  1ZTR A;  3TED A;  1SVM A;  3S3M A;  4IHV A;  4KMF A;  3KZI C;  2HI3 A;  4NBQ A;  1P9Q C;  2NVQ J;  3ERM A;  4CGZ A;  4C9Y A;  3ECH A;  2CFX A;  3Q0V A;  4FCY A;  4HV6 A;  1ETK A;  2M0M A;  3TL4 X;  2BZT A;  1Z6T A;  4UVC A;  5H6R A;  2JA8 J;  5FLM J;  1T95 A;  3FKI J;  2K85 A;  1N75 A;  4PK4 A;  1BL0 A;  5IY5 H;  4PUS A;  1U3E M;  4JK1 X;  4L18 B;  2F4M B;  4MQ9 F;  3ZR8 X;  3OOU A;  2LG4 A;  2XKP A;  5JHF A;  5HOO A;  4DYR A;  5DM6 F;  5FRM A;  1MBK A;  4YFX F;  4YFN F;  3WGH A;  3D5S C;  3KEY A;  3GTP J;  3IC7 A;  1USS A;  3NAU A;  4EV0 A;  5B5E C;  2XC7 A;  1RRJ A;  2BW3 B;  5A2Q K;  3K70 C;  4MEY F;  1HKS A;  2LMD A;  2BYV E;  2I5U A;  4DYQ A;  1YS7 A;  5ILS A;  4OMZ A;  4RA2 A;  1MSF C;  3SHF A;  1KU2 A;  2ZME C;  4PDK A;  4U88 A;  3V7R A;  2P5L C;  2DO7 A;  1WJ5 A;  3AG2 H;  2KIQ A;  3HUG B;  3SZT A;  2L02 A;  1O7F A;  1VF9 A;  1GLN A;  2HR3 A;  2ESN A;  2FRH A;  4GXO A;  3RJP A;  1SC7 A;  2MH2 A;  3J81 K;  1R71 A;  3LSR A;  2KJC A;  4IRH A;  3EPZ A;  3G4S I;  2HTJ A;  3CDI A;  4F55 A;  1LE8 B;  5K5O A;  2F48 A;  3LA7 A;  4A0Y A;  4XKC A;  2JN6 A;  1XS9 A;  4IHS A;  2LTP A;  3QRF F;  3CCQ I;  1PUF A;  1DQU A;  5KCM A;  5M5X J;  3CC4 I;  1AKH B;  4DW6 A;  2XHK A;  1BW5 A;  4LG3 A;  3MKW B;  1GVD A;  2NS7 A;  4C3H J;  2LD5 A;  1XGS A;  2STT A;  3WTT C;  2L2O A;  1W5C C;  2VOP A;  2A6T A;  2KRH A;  3LQR A;  1ZG3 A;  2CS3 A;  2Y0S N;  3I59 A;  3GME A;  2WB1 A;  5LEK A;  1TQI A;  4WCG A;  1YW9 A;  2QYO A;  1WI9 A;  3TGN A;  2CQX A;  1BJZ A;  3ZXS A;  3BZK A;  2P7C B;  3R6S A;  4UUS B;  4XN0 A;  3DLA A;  1U5T A;  4F52 A;  3K0L A;  2LOO A;  5HOD A;  3WTS C;  2FNP A;  3LWF A;  3WU2 C;  1ZAO A;  2KHM A;  2NOJ B;  3W2W A;  2OA4 A;  5EEG A;  2MBF A;  3HL2 A;  1YIJ I;  4L9T A;  1MMS A;  3CMY A;  1QVU A;  2VN2 A;  4M72 A;  3KP6 A;  1JUS A;  3HKZ N;  5HLT A;  2AQF A;  3BY6 A;  4CIC A;  3OYA A;  1IF1 A;  2O8K A;  4C2U A;  1R5I D;  3IUO A;  4PSW A;  1W7P D;  3CP8 A;  1D1C A;  1FSH A;  2OQR A;  3BZ6 A;  3BR5 A;  3GF2 A;  1AU7 A;  2FML A;  2A07 F;  3HOX J;  2COB A;  1FC3 A;  2JMW A;  1JGS A;  1K6Y A;  2D1V A;  4EJV A;  3KP5 A;  4J01 A;  2L4A A;  3PIO F;  5J3L A;  4ZDP A;  2KIS A;  4AID A;  2PMZ A;  1S7O A;  2QEX I;  3PM1 A;  1TWA J;  1QNT A;  5L3F A;  3E1S A;  3NWT A;  2EIK H;  4DZJ A;  4ZYE A;  2MLK A;  1YRN B;  3WG9 A;  2GQQ A;  2Z5U A;  4RB1 A;  2QSF X;  5FKK A;  2ZFU A;  2XGX A;  3I0T A;  4P96 A;  5J1U A;  3HRT A;  2KP6 A;  2MGQ A;  2NXN B;  2Q1Z B;  3HYI A;  3OYM A;  1O3Q A;  2H1K A;  2Y75 A;  4CSW A;  1VQ9 I;  2LC2 A;  3DLL F;  3CUQ B;  4IOA F;  3LFK A;  5AON A;  5K1Y A;  2IAI A;  3C7J A;  2DN0 A;  3A4C A;  3HSE A;  2P8T A;  5C44 J;  2A5Y B;  1I27 A;  3P9C A;  1YO5 C;  2R7W A;  1J9I A;  4KJZ A;  1SMY F;  3OV8 A;  3QOD A;  2FJ1 A;  3AG1 H;  2HKO A;  3ZQI A;  4A0Z A;  1X1D A;  2K4B A;  1A36 A;  3TW7 A;  3LOC A;  1WI3 A;  1Z3X A;  3FM5 A;  1Y8Q B;  5CVI A;  2VJ4 A;  4AC0 A;  3FKJ A;  3W2A A;  3J80 K;  5CJ9 A;  4M74 A;  2CH0 A;  4XN3 A;  4HBL A;  3WTU C;  3F8N A;  1QU3 A;  2WTE A;  1PP8 F;  3HEF A;  1ZN2 A;  4KT5 C;  2QBY A;  2VAS A;  2CMP A;  2KPM A;  4UXN A;  5BPI A;  4AWX B;  4N0B A;  3BDD A;  4ANJ A;  5LFA A;  2CV0 A;  1FZP B;  3RZO J;  3LST A;  2BOL A;  1LJ9 A;  3KLO A;  3HTU A;  3H3V K;  3FK6 A;  3BR1 A;  2LLK A;  3CLO A;  1WJE A;  2E7X A;  1NHA A;  1X4P A;  5HS8 A;  2KDO A;  3J7A O;  2XRL A;  3MKL A;  1XSD A;  1HC8 A;  3JTG A;  4UUV A;  3DCF A;  3CC2 I;  1VQO I;  1R7J A;  2H1L A;  2NVY J;  3S93 A;  1D5Y A;  2H27 A;  3F8M A;  1BIB A;  1R5H A;  2GIZ A;  4PCQ A;  2K02 A;  3U1K A;  4B44 A;  1FNN A;  1ZGJ A;  2B7E A;  4M73 A;  3R60 A;  1IV6 A;  4NC8 A;  3G73 A;  6PAX A;  3ERE D;  1RC9 A;  4EEF G;  3S1N J;  2JSC A;  1X3Z B;  4G6D A;  3RIR A;  1BI3 A;  3FMR A;  3IKV A;  2HNH A;  3HZJ A;  3J7Z I;  4BQA A;  2X85 A;  2EIJ H;  3FK7 A;  4ENN A;  3G1O A;  3QPS A;  4LGW A;  4BL0 B;  1SAN A;  1XSV A;  2DFH A;  2Y2Z A;  4HDU A;  3VYR B;  2OAZ A;  2DPU A;  4LD5 A;  2EZH A;  2JRM A;  4EQQ A;  3A02 A;  3OS2 A;  2X0L A;  4X6A J;  1I1S A;  4YIF A;  4ZC3 A;  3CCR I;  1FT9 A;  4LLN A;  5C4X J;  1KZH A;  1FTT A;  2RKH A;  4XOT A;  3ASO H;  1IW7 F;  1B59 A;  1L3L A;  3I56 I;  4XRM A;  2DMU A;  2VPL A;  1MBJ A;  1W36 C;  1JE8 A;  1CGP A;  3SZP A;  1D8K A;  2VKD A;  1B9M A;  4V2F A;  2EV0 A;  4IPA A;  2XF7 A;  3G1L A;  3WTX C;  2R5Y A;  2KDZ A;  4NQW B;  3UR3 C;  1DGW Y;  3EQL F;  1Z7L A;  1U8B A;  2TCT A;  2VJI A;  2DTZ A;  3K69 A;  1T08 B;  1T2K A;  4W97 A;  4BXF A;  4EM0 B;  2NNY A;  2M45 A;  2XIG A;  3V7S A;  3A03 A;  2VUM J;  4ZZD A;  5ICF A;  2YU3 A;  4RGU A;  3U21 A;  5KK1 A;  1UAA A;  1ZEL A;  3W6V A;  2KKO A;  2OUM A;  3DP7 A;  2QVO A;  1PUF B;  1WJF A;  5IT9 K;  1OJL A;  4MHG A;  1F43 A;  4Q5S F;  3WGI A;  3DQV C;  2OPT A;  2XSJ C;  3DKX A;  5FFZ A;  3HPH A;  2K9Q A;  1WJA A;  3FMQ A;  1K6O A;  3LSK A;  4DGW B;  3K1M A;  1YG2 A;  5IPA A;  1ZG1 A;  3OY9 A;  1P6R A;  1K78 A;  3CES A;  1IN5 A;  3H1C A;  3I59 B;  5EGO B;  1KU9 A;  2CSO A;  1YFH A;  3LSM A;  1XGN A;  2JUG A;  3PFI A;  2R5Z A;  1U5T B;  1YI2 I;  2VE8 A;  3C18 A;  4EGZ A;  3QOP A;  2G9W A;  3TMO A;  3DTI A;  4R8H A;  3TBI A;  1SVL A;  3ABM H;  1JKQ C;  4W1U A;  1R1T A;  3HOT A;  1TWG J;  3IWZ A;  5J8F A;  2PMH A;  4KFC A;  3QYF A;  1N77 A;  3QWL A;  3L9F A;  4IF4 A;  1X19 A;  5EJC A;  5H20 A;  2WAD A;  3CCM I;  1X2N A;  2DTR A;  2F2E A;  4BAC A;  3F8B A;  3ISP A;  4DJA A;  4HSR A;  2VI6 A;  5HNF A;  1EJ9 A;  2PN6 A;  3AG4 H;  3TKY A;  4IX7 A;  4RM2 A;  1A6Q A;  1TNS A;  3CDH A;  3BOQ A;  3K10 A;  3L1P A;  4XOP A;  5KAI C;  4A93 J;  2GWR A;  4OIO F;  1EH7 A;  1EF4 A;  1GHC A;  2ELH A;  2QUF A;  3LAP A;  3SDG A;  2DJN A;  4OWR B;  3AFH A;  4RB3 C;  2HYG D;  4M9Z A;  2XAG A;  4HQE A;  4IRI A;  1H89 C;  1G6N A;  4K2E A;  3LA3 A;  3RKY A;  4G12 A;  1XN7 A;  2CRG A;  3W3C A;  3HOS A;  2EZK A;  3K9T A;  3MKZ A;  4V2G A;  2ADU A;  1JJ8 C;  3QAH A;  1IN4 A;  2IBD A;  3SQN A;  1SFO J;  3QPL A;  4ZYH A;  4D7M A;  1JI8 A;  2O8X A;  2DU9 A;  4P9U A;  4MO7 A;  2FEZ A;  5E17 F;  4E7H A;  1IV8 A;  5GAH J;  4TV7 A;  3GYH X;  4D5C A;  3JRH A;  3CMM A;  3FXO A;  5GP9 A;  3G3Z A;  3GX4 X;  2LBF A;  5J47 A;  1BN5 A;  4AYB N;  1OCR H;  1SD6 A;  3HPG A;  1YQA A;  3BTI A;  2W4S A;  3KLN A;  3LQQ A;  1DPU A;  3GFL A;  4AU7 A;  2IEK A;  2AQE A;  4U7D A;  3CUQ C;  2EZI A;  2V9V A;  1BI2 A;  2QBY B;  4GYI A;  4M6V A;  5IP9 J;  2GAU A;  5HLG A;  4DBQ A;  2XPV A;  2YR2 A;  4I98 B;  3RPU D;  4L5E A;  3G2B A;  2DQL A;  3EYY A;  2XUB A;  4HX4 A;  4L0Z B;  2FBK A;  2QKM B;  1U9O A;  3M7G A;  2CQK A;  3JCU C;  2PJP A;  3ZQQ A;  3E6M A;  1P2F A;  5CKT A;  2ME6 A;  4RAY A;  2HQN A;  4EJO A;  3ZMS A;  2M4K A;  2V1U A;  2Z99 A;  1DU6 A;  3SXY A;  3TDU C;  4OOI A;  5FKN A;  2I10 A;  5E18 F;  3VPR A;  3HHH A;  5DV5 A;  2EFQ A;  4Y13 A;  1T98 A;  3BCA A;  5BMZ A;  3CCE I;  3CMA I;  3HG9 A;  1D1B A;  4XM3 A;  1F9N A;  2GIV A;  3MD2 A;  5DTD A;  2R7Z J;  3BQY A;  4BUP A;  4M3E A;  1FBS A;  5ILU A;  5FKL A;  4L9V A;  2ZCW A;  2VOO A;  1QA6 A;  1L0O C;  2XF6 A;  2EIL H;  4LK1 F;  1FTZ A;  2VE9 A;  1H9G A;  2PQ8 A;  1JUP A;  3K6G A;  4BAY A;  2BEO A;  3SYT A;  2OC6 A;  4N4N B;  4RS8 A;  1ZG5 A;  3AG3 H;  2WBM A;  2QLZ A;  3CDL A;  4UVB A;  3ZN0 A;  3ZOB A;  5D5V B;  4HW0 A;  3O2P E;  3O8H A;  3ZPL A;  3HOY J;  2PFB A;  4LLL A;  3LSH A;  3MZY A;  5KAF C;  1SFK A;  2W7N A;  4B09 A;  4ZJZ A;  3CCJ I;  2R92 J;  3CCV I;  3GTO J;  4ZZL A;  5KVR A;  1RI7 A;  2UXN A;  1BR1 A;  1OIS A;  1ZLK A;  2R7R A;  1UJ8 A;  2VPR A;  3DKY A;  4WXD A;  3DFG A;  3CUO A;  2ZXJ A;  1WKM A;  2CV1 A;  2R7O A;  3P7N A;  1BR2 A;  4PZJ A;  4DBR A;  1Z3Y A;  4L0Y B;  2VIX A;  5LLQ A;  1X3W B;  2V6E A;  1LDJ A;  2K7L A;  1WFX A;  3HOU J;  3ASN H;  5E3L A;  2Y9Y A;  5KHD A;  1LVK A;  3QP6 A;  2B9S A;  4RAF A;  4ZDO A;  1BIA A;  2L9N A;  4ASN A;  1R36 A;  1MBG A;  3ZQC A;  3CO7 C;  1Y8R B;  2DT5 A;  2O03 A;  4XSX F;  3L7W A;  5D5U B;  2ME0 A;  1MJB A;  3I53 A;  4P55 A;  1XGM A;  1I3Q J;  1XGO A;  5BOX A;  2FF4 A;  1ODD A;  1VQ5 I;  2Y9Z A;  2R5Y B;  1ZHF A;  4M3F A;  1GXQ A;  3E5X A;  3PIP F;  2XAH A;  3CC7 I;  3Q0W A;  4Y52 J;  2RC4 A;  3OSG A;  1STZ A;  2CQ7 A;  4YEL A;  3A2K A;  3HHG A;  4F93 B;  1JKP C;  5FLX Z;  4BHB A;  2FUG 2;  2BY3 A;  2OQG A;  3OOP A;  4F92 B;  4CXF A;  4A3K J;  1DP3 A;  2LSO A;  2FBI A;  2QZ8 A;  2X1C A;  1FIA A;  3FXJ A;  1WCM J;  4RAG A;  3JRB A;  4H4K C;  1O3T A;  5CVU A;  1K83 J;  4A3G J;  3ZN1 A;  3E0J B;  1LPQ A;  4BJ5 C;  2HXI A;  2XB5 A;  3W6K B;  2XGE A;  3S2H J;  1FMV A;  3CLQ A;  2P7V B;  2TDX A;  5D8K B;  4ZTF A;  3D0S A;  2HQ5 A;  5H6Q A;  3LSP A;  2HKX A;  2MAB A;  1R22 A;  5IYB J;  5F1R A;  5K5R A;  2AXL A;  2V79 A;  1QVT A;  4XBF A;  2ZJ2 A;  1K78 B;  2XAF A;  4GYG A;  2BY2 A;  3LFU A;  4MLO A;  3K2Z A;  5E8G A;  2DMT A;  1QZE A;  3A1Y A;  1GV2 A;  2V1N A;  2L01 A;  2XPW A;  2P6S A;  3F6O A;  3IAM 2;  2DA7 A;  2DA1 A;  3GZ5 A;  1IRX A;  2R5Z B;  3K4K A;  3ABL H;  4HOB A;  1E3O C;  2LDU A;  4O3M A;  3ZMU A;  3V8J A;  3O8G A;  4BXU A;  2DOF A;  1JKR C;  3DKW A;  1ULY A;  1BC8 C;  4GFB A;  3KFW X;  4E4H A;  3DXJ F;  2DDA A;  1B4A A;  1FOK A;  4I7H A;  3ESW B;  4JQF A;  1FOW A;  4DYC A;  3IV5 A;  1YOV B;  1ZKG A;  1MND A;  3JRI A;  4RGS A;  2ZJQ F;  1POG A;  2VKH A;  1ZAR A;  1NG6 A;  3M9A A;  3PQK A;  3F22 A;  1G3Y A;  3W6J B;  4ESJ A;  2E34 A;  1SD7 A;  3HRS A;  4A3L J;  2ECC A;  2KT0 A;  4I02 A;  3BG7 A;  1S6L A;  2CUF A;  1U5T C;  2TRT A;  3I55 I;  2IPQ X;  2MH9 A;  2YX4 A;  4JYK A;  2EPF A;  2P0W A;  4BYY A;  5E8I A;  2JSP A;  4PJM A;  1P4A A;  3RCO A;  1S7A A;  2CUZ A;  3M8F A;  3OIO A;  3I4M J;  2FMY A;  2E1M B;  5HVQ C;  3BT9 A;  1A5J A;  2KRC A;  4BDY A;  1KU3 A;  1QPI A;  2QSH X;  2JA6 J;  3BQZ A;  1SFU A;  4ABZ A;  2PJR A;  2HQA A;  4IOC F;  1TNT A;  3ZQ7 A;  2HOS A;  2M9H A;  5DCM B;  5K7F A;  1FEX A;  2OU2 A;  1LFB A;  2Q8K A;  3GLL A;  4ESF A;  1OKR A;  2V9P A;  2R7X A;  2GOX B;  2LF7 A;  1F1Z A;  2M8G X;  3WE2 A;  3HGY A;  2W24 A;  3JSO A;  3WHB A;  2F5F A;  4PGG A;  3TO7 A;  1OLT A;  3P9I A;  1VND A;  2MSY A;  3OIQ A;  4OU0 A;  1XSX A;  4V19 K;  3QQA A;  2L7K A;  2OTJ I;  3Q9S A;  2KZV A;  2LBF B;  5E3N A;  2CG4 A;  2BBY A;  2RQP A;  2HU9 A;  3FZV A;  4ZYA A;  4D5F A;  3G6E I;  3KET A;  2WB1 N;  3DBH B;  4OAY A;  2VBW A;  1MKM A;  2HOE A;  3FIW A;  5D5X B;  1OCC H;  2DA2 A;  3LA2 A;  3L2C A;  1WPK A;  4JX4 A;  3BTJ A;  3I64 A;  4RMN A;  2QGU A;  3RSN A;  1Z1D A;  2WAE A;  5EEA A;  3H5A A;  1HKQ A;  2DXI A;  2A61 A;  2HVR A;  2QWW A;  1K61 A;  1O57 A;  3KX2 A;  1X4O A;  2HYF A;  3HC7 A;  1TL8 A;  4B8X A;  3CJQ B;  2Z3Y A;  2Q0O A;  3IH2 A;  3EUA A;  1R5G A;  4HPQ A;  1UMQ A;  2YX7 A;  1QGP A;  3RDI A;  4I76 A;  4Z2Y A;  2E2I J;  5FLV A;  4GDF A;  4M71 A;  1XMK A;  1O7L A;  3SJM A;  5K5Q A;  2B63 J;  2CW7 A;  4B3X A;  3TOB A;  1X1C A;  3UKG A;  2LRE A;  2KLO A;  1IAW A;  2L0K A;  5M3M J;  1ACI A;  4JX5 A;  2E1C A;  2NS8 A;  2X6W A;  5JR3 A;  2YSR A;  4BJT A;  1SMT A;  5FFX A;  4BNC A;  3GTK J;  2JA7 J;  1IXC A;  2Z9O A;  1FSE A;  2Y0M A;  1ZRD A;  3WGG A;  1M1E B;  1FLI A;  1OYY A;  2PMZ N;  2A6E F;  3CP2 A;  3TO6 A;  3LSG A;  3BPX A;  5DYM A;  3AKZ A;  3HDD A;  3QPH A;  1DP7 P;  2P81 A;  2JWT A;  1XG1 A;  1B9N A;  4NHJ A;  1LUJ B;  2VC0 A;  1P7I A;  1UG2 A;  2LY1 A;  1R9T J;  1D1A A;  5FRO A;  3OYB A;  2ID6 A;  4XLH A;  5M5Y J;  2CUJ A;  1FMW A;  4U0V A;  4BJ6 C;  2D5V A;  1ITY A;  4CDG A;  3BWG A;  3OYE A;  1I6X A;  2QQ9 A;  4CYC B;  1K79 A;  4A5M A;  4IQJ A;  1TT0 A;  2YUS A;  1Y39 A;  2HQR A;  5HS7 A;  1XB4 A;  4KIG A;  5IYC J;  1XDS A;  4Y17 A;  1D5V A;  2EV6 A;  1KU7 A;  2X9D A;  1FYM A;  1U8R A;  1IRG A;  4XKB A;  1Q1V A;  5LGU A;  4B1R A;  3PNV A;  4QSH A;  2JT1 A;  3HOW J;  3CCU I;  3DWL E;  3DU6 A;  4BXX J;  1MMG A;  2A6H F;  3PNY A;  3KP7 A;  4FE7 A;  9ANT A;  4LB5 A;  2JTV A;  3CJR B;  2V1X A;  4PFP A;  4A3D J;  5ERI A;  4MFE A;  2R0Q C;  4A3I J;  4HF2 A;  2F5V A;  3PUF A;  2NS0 A;  2VB6 A;  4B3A A;  2VT3 A;  1PVE A;  3JRD A;  3F72 A;  3N97 A;  3S1M J;  2PBI A;  3JRC A;  2ELJ A;  1XD7 A;  1MMN A;  1S3J A;  2VKV A;  2O6G E;  5TRD A;  4M3G A;  4XSZ F;  4Y7N J;  4HQM A;  4HST A;  2CU7 A;  1RNL A;  4A0X A;  2OJE D;  3WTV C;  3K4B A;  5ICE A;  4CCM A;  1LKX A;  2DMP A;  4WF2 A;  4BKX A;  4BE1 A;  5AIQ A;  5D8L B;  4A3C J;  3G71 I;  1X1A A;  3C2G A;  3N05 A;  4QPQ A;  5GPA A;  2Z16 A;  2QSG X;  2VKE A;  3TQN A;  4HF1 A;  3H3U A;  1W0T A;  1ON2 A;  1Y0U A;  4PFO A;  3EUH A;  4BY1 J;  4E7J A;  4GGG A;  2STW A;  4NB5 A;  5L3D A;  4XRF A;  4XLA A;  1OFC X;  1T6S A;  1V3F A;  4MGR A;  1W36 D;  1TC3 C;  2IRF G;  2Z33 A;  1J75 A;  4BHC A;  2DOA A;  5GAD J;  2W25 A;  2FNA A;  4FAS D;  1GDT A;  3T8R A;  2QM3 A;  4NC6 A;  1VQ6 I;  5F0C A;  1IRZ A;  2X51 A;  1BR4 A;  1B6A A;  2A69 F;  1E3H A;  4XRS G;  5E1Z B;  1ON1 A;  4XLF A;  3ULQ B;  2HDC A;  2QQ8 A;  2RNJ A;  3KIO A;  2VXD A;  4LG0 A;  4G7O F;  1VQK I;  2DOE A;  3RI4 A;  3K4L A;  3GFM A;  1R1V A;  4LJZ F;  2XGD A;  3MAJ A;  4MTE A;  1KYZ A;  5GTH C;  3FDY A;  3S3O A;  3CQZ J;  5B3S H;  1E3P A;  2H6B A;  3TP0 A;  1VI0 A;  1FYL A;  4WK8 F;  1ETY A;  4MQV A;  3GFJ A;  3BJ6 A;  3OYG A;  3S32 A;  2L54 A;  1I1G A;  2DFF A;  2DBB A;  1BOB A;  5CQE A;  1FX7 A;  3ZP5 A;  3B02 A;  3WTW C;  2DA6 A;  1WJB A;  2LR8 A;  3FXK A;  3JRA A;  3H0G J;  2DAO A;  1VTN C;  2HZT A;  4KIC A;  3QYB A;  1BA5 A;  1WGX A;  5J1R A;  1MBF A;  2K3F A;  3KEO A;  3KP3 A;  2CQQ A;  4AM3 A;  2F5E A;  2CWE A;  2YS9 A;  2WV1 A;  3I5U A;  4CCN A;  1KQ8 A;  2FXA A;  2JJ7 A;  1PUE E;  1XX5 A;  2XB0 X;  4RAZ A;  4XLE A;  2A3S A;  3LSJ A;  4I01 A;  5DD4 A;  2K40 A;  2X1D A;  3QOE A;  1BOA A;  4LIV A;  2L3D A;  1YX3 A;  1R4N B;  2HDW A;  1F5T A;  2W1O A;  1HLV A;  2PI0 A;  2V9K A;  2UUZ A;  4H0E A;  3GO5 A;  2VJJ A;  3KYC B;  3MCZ A;  2PX9 A;  4N9I A;  4XKW A;  5LEJ A;  1W0U A;  2BXZ A;  2HXO A;  4B47 A;  3H3Z A;  4B48 A;  5D6E A;  3GTJ J;  1FYK A;  2EA2 A;  2PJR B;  2LKX A;  4RB2 C;  5L3G A;  4A3J J;  4RLQ A;  1U0J A;  2XVC A;  3M1C A;  2ELK A;  1PP7 U;  1W7P A;  2MLG A;  2H09 A;  4F91 B;  3CME I;  1OCT C;  5DM7 F;  2PLY A;  5F0F A;  5FD5 A;  1LFP A;  2M7B A;  3WG7 H;  2WAQ A;  3KZZ A;  2GOM A;  3F23 A;  1HW2 A;  2R7Q A;  2OTL I;  2RAE A;  2WA0 A;  3VWB A;  1VQL I;  2E1M C;  1HW1 A;  2ISY A;  2RRE A;  3ABK H;  2ETH A;  3FBN B;  1UEL B;  3I54 A;  2GA2 A;  3REO A;  2ZKZ A;  4WXC A;  3BLY A;  1BI0 A;  2H94 A;  3CTA A;  3AL0 B;  2UXX A;  4BE2 A;  4IQ4 A;  3BJO A;  3ZRG A;  4ENM A;  1GXP A;  1W1W E;  1YW7 A;  1W4M A;  2WY8 Q;  3C1D A;  3FMS A;  3GCM A;  2VON A;  3MKY B;  3IAS 2;  5E1W A;  2G7U A;  4NNJ A;  3KZY A;  3A01 A;  1CQT A;  1RIO H;  1ETV A;  2JK3 A;  3IRR A;  2DYR H;  3IH3 A;  3S2W A;  2ZXW H;  4IHT A;  4UHT A;  1UHM A;  3AAF A;  2GXA A;  1IC8 A;  5DDG A;  1XTA A;  3K4N A;  3DU5 A;  2RN7 A;  3HSR A;  2H6C A;  1JT6 A;  3FM3 A;  5LBQ A;  1I50 J;  4FE4 A;  4HRI A;  1DUX C;  3ABT A;  3GEZ A;  4Y4R A;  2G7H A;  4M6X A;  4KIB A;  3DBL B;  3M3Y J;  4I2O A;  2E2J J;  4XMY A;  5F04 A;  1QZY A;  2EZL A;  2M87 A;  2R7S A;  4BGD A;  1XMX A;  3JR9 A;  2KQR A;  4HG2 A;  2QF7 A;  4E70 A;  4XID A;  3DV8 A;  2M30 A;  1R49 A;  1ZH5 A;  3D1N I;  4KIT B;  2LKS A;  4UVA A;  3OYL A;  3QU6 A;  2V7F A;  2FD5 A;  1OCO H;  2R7D A;  3E5Q A;  3H9J A;  4QTR A;  3S1R J;  4CHU A;  5K7H A;  3N4M A;  5F08 A;  4DQ2 A;  5J6X A;  3BZC A;  1YHQ I;  1LDK B;  2IW5 A;  4UNO A;  5IP6 A;  3F8C A;  1HBX G;  3Q3S A;  1RUN A;  1OYI A;  3PNT A;  3ELK A;  1D8J A;  1V5E A;  3OYJ A;  4MEX F;  3I4P A;  1JTX A;  2M4G A;  3BJA A;  4DIQ A;  4UB8 C;  4CZZ A;  3VB2 A;  2JVG A;  1FOX A;  4CCK A;  4PJ0 C;  2ZSH B;  2UWM A;  2FA5 A;  2VQH A;  1BJA A;  2X1E A;  4IXA A;  2OZU A;  2ZJP F;  3ZMZ A;  3SDB A;  2D1H A;  1GUU A;  3Q0U A;  1MSE C;  1U2W A;  4RLF A;  5FGM A;  4ENK A;  2BE5 F;  4Q4Z F;  1UZC A;  3ABU A;  1MH4 A;  3ONQ A;  4NDL A;  4XNF A;  3HIF A;  3OMY A;  5IYD J;  3L2W A;  4UUT A;  1OPC A;  2O0Y A;  1QZZ A;  4YEJ A;  4D1Q A;  1T39 A;  2DT7 B;  3ZQF A;  2LY2 A;  3F9K A;  4JX6 A;  1MMD A;  2BHY A;  5CVR A;  1IUY A;  3V8K A;  1TWH J;  1IGN A;  1I3A A;  1HQC A;  4HV5 A;  1OR7 A;  3OYD A;  3E6C C;  3NEU A;  2JRT A;  5FRN A;  2IA1 A;  4LMY A;  3C2H A;  5HDN A;  2OBP A;  2A68 F;  1R23 A;  1KQ9 A;  2WV0 A;  5CPR B;  1RZ4 A;  1O4X A;  4BBS J;  3CJN A;  3S3N A;  3MN2 A;  3DPT A;  5TGT A;  4B43 A;  5LHH A;  4Y33 A;  2DPD A;  2P6T A;  2LFB A;  3FF5 A;  4FT8 A;  1DPR A;  1JXS A;  4G6T B;  5BS6 A;  1LFU P;  5JLW A;  1QHH D;  2IXS A;  5B66 C;  2H8R A;  2R3S A;  5HS9 A;  3PO3 J;  2F4O B;  2VQC A;  3QPT A;  2DW4 A;  5LHG A;  2DDB A;  4QPO A;  5EDN A;  1XPX A;  3K4J A;  1V5G A;  4NUB A;  4QWQ A;  2M3A A;  5D4R A;  1MBE A;  5EEH A;  1JHF A;  2XKO A;  4EJW A;  4E7Z A;  2M2E A;  1TTY A;  2C6Y A;  3GBG A;  1I6H J;  1Z21 A;  1R1U A;  3C2B A;  3BG9 A;  2KMU A;  2Y69 H;  1AOY A;  3RTR A;  1WJD A;  3U9G A;  4E7L A;  4U7B A;  3Q5F A;  1ZGA A;  1VZ0 A;  5EG0 A;  1MNM C;  3TOA A;  2JVH A;  1IN7 A;  2LVS A;  2EK5 A;  5F27 A;  2QCO A;  2K9M A;  2L5Q A;  1Y1W J;  4LG0 B;  2PG4 A;  1ZGW A;  3V4G A;  1KQ0 A;  1WWX A;  5E20 A;  2DMQ A;  4ZYD A;  2Q2E A;  3KYL A;  1P4X A;  2J5O A;  2VL8 A;  5EZH A;  4FTH A;  4OIP F;  1LDD A;  4R79 A;  1WSU A;  4C2T A;  5JI6 A;  4IEJ A;  3X2Q H;  1MJ9 A;  1W5S A;  2W00 A;  3M1E A;  5BPD A;  4XQF A;  3K4M A;  1MNE A;  2IA0 A;  4ZYG A;  4HYE A;  2HGC A;  1J2X A;  3GZN B;  5FJ8 J;  1T8I A;  3W2V A;  4PJN A;  1LEB A;  2Z2S B;  4LIU A;  4BDZ A;  1R4M B;  4NC7 A;  4EMS A;  3S17 J;  2F6C A;  5B1B H;  2XAQ A;  1TLH B;  4FIS A;  4AD9 A;  2DJI A;  5J1Y A;  2IS4 A;  5JHU A;  4HX8 A;  3LNQ A;  1WJC A;  2DA5 A;  3CCY A;  2ZXH A;  1TW3 A;  3EET A;  2KIF A;  2VC1 A;  1IUF A;  2JPC A;  1J5Y A;  1X2M A;  5IP7 J;  3S1Q J;  1H9T A;  3HBL A;  4PSX A;  3BTC A;  1SFE A;  3CUQ A;  3BRO A;  5CQG A;  1TZL A;  2E1O A;  1W7P B;  2LK2 A;  3NQO A;  5F6F A;  2EWN A;  2OF7 A;  1VQP I;  2EV5 A;  1G2H A;  2IA2 A;  1V4R A;  1LVA A;  1FY7 A;  2HYJ A;  3H5R A;  1UST A;  4Q47 A;  2NVT J;  3KEQ A;  1APL C;  2D2W A;  5M3F J;  3ZGK A;  4M9S A;  1MGT A;  2KFD A;  3UNG C;  3GZ6 A;  3I71 A;  3CF5 F;  1HSJ A;  4A69 C;  5AIP A;  4LFU A;  3DTE A;  2E1N A;  1NK3 P;  2MD5 A;  2R93 J;  1TBX A;  1QQI A;  4L9N A;  4RBO A;  2BHZ A;  1G59 A;  4IKF A;  2ZB9 A;  3BG3 A;  1ZYR F;  1T0F A;  2M34 A;  1FOY A;  1WH7 A;  1YW8 A;  2K9L A;  2LY9 A;  3U1D A;  3A01 B;  2NVU B;  2ZXI A;  1VQN I;  5LD2 C;  4AIH A;  4KN4 X;  2QQA A;  3L2U A;  1KGS A;  4ZDL A;  1NH3 A;  5HNH A;  1ETQ A;  1IN8 A;  1WQ2 A;  1WH5 A;  5CYV A;  2JUC A;  4MFD A;  2BY1 A;  2L9R A;  1HOM A;  2VT2 A;  4YII A;  1BM9 A;  5E1X A;  1MBH A;  4DNC A;  1ZR4 A;  3AL0 C;  3DBR B;  4I99 C;  2ZC2 A;  4ETS A;  4D0P A;  1FWZ A;  2UV1 A;  2M0C A;  4I0A A;  1J59 A;  4BU2 A;  1UFM A;  1HDP A;  1UB9 A;  2O7O A;  4O5V A;  4EGY A;  5J4V A;  2L4M A;  3ROU A;  2CYY A;  2LP0 A;  1JTY A;  2E19 A;  3RPU A;  3GTG J;  4RDU A;  3S15 J;  2R7U A;  1IO2 A;  2KL4 A;  3HRM A;  1SD4 A;  2Z1D A;  2LKP A;  2O9L A;  1IN6 A;  3SFZ A;  1ZRF A;  1EA3 A;  4XRS A;  3H0D A;  3V42 A;  1ZQ3 P;  3LAJ A;  2EFP A;  3WU0 A;  2L9S A;  4BEH A;  5ICG A;  1ETO A;  1A04 A;  2RQQ A;  3NAR A;  1YJW I;  2FX0 A;  2OZ6 A;  2KRF A;  1Y1V J;  2NAZ A;  1X1P A;  1S5L C;  3K7A J;  1N78 A;  1BI1 A;  1UHS A;  2ZNY A;  2V4J C;  2R7F A;  4M3D A;  1D0X A;  1NTC A;  4CCL A;  4OIQ F;  1FIP A;  3A0B C;  4OIN F;  3JTH A;  4BE0 A;  1JKO C;  1QO0 D;  2K9S A;  2HOA A;  4LB6 B;  4L5J A;  4IRG A;  3ZQG A;  4ITV A;  1JHH A;  3OL3 A;  3WE3 A;  3P5J A;  5LGT A;  3PSF A;  1H0M A;  3MWM A;  4HEA 2;  5EF6 A;  3VOD A;  5FB2 A;  3B73 A;  4P1W A;  1ENH A;  1WHU A;  3PUB A;  4A3M J;  1OYW A;  1J7K A;  3H5N A;  1ETX A;  3JAM Z;  2HS5 A;  1JJ6 C;  3FXM A;  3HGG A;  3M8E A;  1Z7U A;  2DYS H;  2EIN H;  2PEX A;  1N25 A;  2LYC A;  2DOD A;  4XL9 A;  1AWC A;  2OCE A;  1RR7 A;  2VQL A;  4NQW A;  2LNB A;  4OIR F;  1YE9 A;  2FE3 A;  5BNG A;  2CW0 F;  2Y30 A;  2RVC A;  1YIO A;  4OMY A;  3D5L A;  4XK4 A;  2X6O A;  3PJR A;  3GTL J;  1IXR C;  1Z67 A;  2G0E A;  1P7J A;  4J00 A;  4S05 A;  2JZY A;  2VXZ A;  3HB9 A;  3EYI A;  1X1B A;  4ENJ A;  2E71 A;  2DFI A;  3BR6 A;  1A31 A;  1A35 A;  3OSF A;  4A3B J;  1V5F A;  5GAG J;  2QA4 I;  2R7V A;  2HVS A;  5HLH A;  4F3Q A;  3O6B B;  4XOR A;  3V8L A;  2B0L A;  5F1J A;  4HDV A;  4HLY A;  4YFK F;  3GTQ J;  3ML6 A;  3QP5 A;  3COA C;  3MMY B;  4A3E J;  2F5D A;  3KP4 A;  3H35 A;  1JGG A;  3ZCO A;  1IJW C;  2V6C A;  3LL7 A;  5FO5 A;  4BS9 A;  2OD5 A;  4FET A;  2DCE A;  4HNU A;  1TT5 B;  1IXS B;  2HPM A;  2BGC A;  1B72 A;  3NRV A;  1GV5 A;  2R7T A;  2Y48 A;  5FKM A;  3E97 A;  1S9H A;  3TW6 A;  5EGO A;  4C30 A;  3OS0 A;  3F21 A;  4EJT A;  5EG0 B;  4N9H A;  2DK8 A;  4KUM A;  2P5V A;  3F0C A;  3R61 A;  1D0Z A;  2FU4 A;  2CFO A;  1QHG A;  3QU3 A;  4AVZ A;  2ECB A;  5DS9 A;  2M1B A;  3L2Q A;  2GXG A;  3NWS A;  3OL4 A;  1S29 A;  1CF7 A;  2MG4 A;  2XGC A;  3EUH C;  2DA4 A;  3RYP A;  4KIS A;  5D5W B;  2EA4 A;  1K4T A;  2Q2E B;  1Z6R A;  5KNL A;  2ID3 A;  2Y0S A;  3RKX A;  5K7Z A;  3M8J A;  2GBY A;  3M07 A;  5BQT A;  5JFR A;  2JPB A;  2M5W A;  3H36 A;  4IVN A;  3HSF A;  2ZNZ A;  4UV8 A;  5C3E J;  3E6D A;  4IL6 C;  2E5N A;  3S8P A;  3WU1 B;  4XLN F;  1SAU A;  3K4C A;  3T0Y A;  2ZME A;  2VJ5 A;  3F6V A;  2DT6 A;  5F0H A;  1YLF A;  2QKL B;  1E2X A;  3FX3 A;  2W48 A;  4RGX A;  5LGN A;  3E3V A;  1RES A;  3FXL A;  3HKZ A;  2RDP A;  1V54 H;  4XLC A;  5JVT A;  4HAM A;  4PJL A;  1BBY A;  5TJJ A;  1LEA A;  4E7S A;  3IRQ A;  4DZP A;  3FXU A;  1TWF J;  4WXH A;  2UZK A;  3CCS I;  3PO2 J;  4KMU X;  1O3R A;  2YU9 J;  2IVM A;  5H2F C;  4IHX A;  1HCR A;  2FBH A;  2XAU A;  1XC5 A;  4LOC A;  2BV6 A;  3ZMT A;  2O3F A;  4GRI A;  5ILV A;  3S2D J;  2IS1 A;  2NYX A;  1YJ9 I;  5D6F A;  5DEQ A;  3SEZ A;  4CCO A;  3OWT A;  4RB0 A;  2MYS A;  4P5O A;  2XF5 A;  1P92 A;  3HRU A;  4LLG F;  4CCJ A;  1KYW A;  4II2 A;  4C2M J;  2MFZ A;  3FXQ A;  4X0G A;  3MVP A;  3JRF A;  3GTM J;  2QQB A;  3HOV J;  4FHT A;  1SFX A;  3ECO A;  2K5C A;  1I5Z A;  4II3 A;  3VYT B;  2VBX A;  2KZG A;  1QPM A;  2BVL A;  3L2V A;  4Q48 A;  1PDN C;  1PJR A;  2VBZ A;  4RGR A;  5J40 A;  1FP1 D;  1F4K A;  1G3S A;  2E2H J;  1J0R A;  1B8I A;  4UV9 A;  3FWE A;  2E36 A;  2W57 A;  1E0E A;  3KE2 A;  1SD5 A;  2KIU A;  1ONV A;  2PMU A;  3WHC A;  1MIJ A;  2HDD A;  3H92 A;  2JA5 J;  4YG2 F;  1HKT A;  4QIW N;  2ZO4 A;  1WVR A;  3TDZ C;  3CZ6 A;  3VYU B;  2P5K A;  4PJJ A;  5A2Q Z;  1K7A A;  4XIC A;  2EFN A;  1IDZ A;  3WTZ A;  3VYS B;  4BQQ A;  2LH9 A;  4BBR J;  4A5N A;  2AHQ A;  4EJU A;  3M4O J;  2HFH A;  3OIP A;  3D5R C;  1B1B A;  1ETW A;  4KIF A;  2XV4 S;  3OYF A;  2QEN A;  2FQ4 A;  1X3U A;  1A6I A;  2GA1 A;  3GUD A;  5JVG F;  2GZW A;  2HZD A;  1FJL A;  2RNG A;  3LSI A;  3J81 Z;  3ZMV A;  2L9V A;  3MZ8 A;  1Y6I A;  3GW2 A;  1QBJ A;  1VQ7 I;  1Z0X A;  4HZF A;  3VEP A;  2VQG A;  2BXY A;  4I6Z A;  2K27 A;  1T38 A;  4QLC U;  5E3M A;  4G7Z F;  4M3B A;  1J09 A;  3DEU A;  1HXD A;  2MD0 A;  2A5W A;  4HA8 A;  1BW6 A;  3CO6 C;  4BEH B;  2AS5 F;  3ZQL A;  3V7C A;  2F5C A;  2M7A A;  2HOT A;  5GPC A;  2EH3 A;  3KCC A;  1OMI A;  4A12 A;  2F4I A;  5D4S A;  2EBI A;  4N4O B;  4LIT A;  2L7F P;  1Z91 A;  3R0A A;  2WAQ N;  1ERD A;  4DOZ A;  2L7M P;  3BTL A;  2CO5 A;  2CJJ A;  2OCC H;  1FBU A;  1MMA A;  1TQM A;  3I58 A;  2CV2 A;  3RKW A;  1UCR A;  2FOW A;  4E7I A;  1MDM A;  3PQJ A;  4EAT A;  2K3P A;  4I0B A;  3HXL A;  3JRG A;  1HST A;  3IKT A;  2D45 A;  3RKQ A;  1E17 A;  1KA8 A;  2K86 A;  5DUI A;  5CLS A;  2V1D A;  4P9F A;  3DPL C;  5F64 A;  5C4J J;  5DUK A;  2RV8 A;  2K9N A;  4BHP A;  2GLO A;  2IT0 A;  1VFC A;  1VQ8 I;  2HEO A;  2L7Z A;  3GLX A;  4ON0 A;  3SEQ A;  2EQR A;  1SEU A;  2AXT C;  2AO9 A;  2Y31 A;  3E7L A;  2JA2 A;  2LF8 A;  2XRN A;  1DDN A;  1G4D A;  1XMA A;  2DQR A;  4Y3O A;  2XAJ A;  1ORK A;  3BR3 A;  3R4K A;  1D0Y A;  3K2A A;  4LK0 F;  2IJL A;  2LRD A;  3FIS A;  2MA3 A;  3PL8 A;  3QYE A;  4KN7 X;  2P4W A;  4F7Z A;  1U78 A;  3MFK A;  4J19 A;  3B6C A;  2EFO A;  3C3W A;  4R1H A;  1G3W A;  1KON A;  2W82 A;  3EUK L;  4CA0 A;  2EB7 A;  5FD6 A;  1G3T A;  1Z77 A;  1I39 A;  2O5R A;  5B1A H;  1V55 H;  4CH7 A;  1UHW A;  3IP4 B;  4ZTJ A;  5IOY A;  2IS6 A;  3A0H C;  3F3X A;  1OR7 C;  1MJA A;  5CVV A;  1WRJ A;  5LHI A;  3OYH A;  1H8A C;  4Y15 A;  4A6D A;  2JQ7 A;  1LQ1 A;  3CCL I;  1RUO A;  2CW8 A;  5FKO A;  5ICC A;  4YRV A;  3OYK A;  2XPU A;  2I8D A;  1OCZ H;  5IT3 A;  3VFZ A;  4E6K G;  4EVI A;  4GCV A;  1XCV A;  1B72 B;  3S16 J;  2MW8 A;  1EKE A;  1MW7 A;  4BH9 A;  2IP2 A;  3OYN A;  3L09 A;  2HWV A;  2FQ3 A;  1WZ2 A;  1MZB A;  2RGV A;  1K4S A;  1AA7 A;  3OYI A;  2OV7 A;  1IZ1 A;  2K4J A;  3BCB A;  3E5U A;  1CF7 B;  4G7H F;  1D3Y A;  2XDV A;  3PFY A;  5GAE J;  5FLX K;  3J80 Z;  3G1M A;  5HDG A;  3DPU A;  5TIS C;  5J8C A;  1TP4 A;  3HM5 A;  1U6G A;  4U0Y A;  3J7A Y;  3RQ4 A;  2X6Y A;  1SAX A;  2E35 A;  4KNY A;  5IOZ A;  1RR8 C;  2HVQ A;  4FQG A;  4YIR X;  4D7N A;  1LB2 A;  2BVM A;  2E7W A;  3FHN A;  4BY7 J;  2ZME B;  1FPQ A;  1ZRE A;  2M8E A;  5DD8 A;  3FXR A;  3GVA A;  2DI3 A;  2X6X A;  3CF2 A;  3MEX A;  5GTI C;  4EM2 A;  3S14 J;  2CGP A;  2IS2 A;  2ESH A;  4MIM A;  3KP2 A;  4HLX A;  4XON A;  1RKW A;  1HA8 A;  3T8T A;  1FBQ A;  1GT0 C;  2YPR A;  1DGR M;  2BW3 A;  2V26 A;  3GXO A;  1F36 A;  3MQ0 A;  4RM3 A;  4KT6 A;  3CD6 I;  1SVO A;  1GVJ A;  4C3I J;  4IHW A;  4CUG A;  5DCM A;  3RPQ A;  4C3J J;  5L3B A;  1LNW A;  2MC4 A;  2XSD C;  4IZZ A;  3HUG A;  5HDK A;  4UB6 C;  2X48 A;  4S0H B;  5EZG A;  4G9Y A;  2WWY A;  2IGM A;  3L00 A;  3R0J A;  3MZH A;  3BP8 A;  1R00 A;  4AUX A;  3FHZ A;  1ZLJ A;  2GM4 A;  1ZK8 A;  3I4N J;  4A2U A;  3RZD J;  1TQP A;  1LE8 A;  4HF0 A;  4EM1 A;  1HF0 A;  4JP0 A;  4A6E A;  3EDP A;  2WC2 A;  1BC7 C;  1U9N A;  3Q9V A;  1IDY A;  1S7E A;  1S8N A;  4U87 A;  2HTS A;  3SFI A;  2WAF A;  1MD0 A;  1XCB A;  3RYR A;  1S72 I;  1AKH A;  2COM A;  1IRF A;  4UY8 I;  4S04 A;  3E6B A;  3H9G A;  5EYR A;  4CO8 A;  2A05 A;  4KDP A;  4AIJ A;  2CQN A;  4MTD A;  2ICW G;  2VBY A;  3FBI B;  2ZBK A;  2XAS A;  1B8I B;  1DU0 A;  3BPV A;  4CZC A;  4AYB A;  1H88 C;  1Z9C A;  1YJN I;  5E79 C;  1ZR2 A;  2DK5 A;  4L5I A;  4KYW A;  4JBA A;  3SZG A;  5M5W J;  2ZJR F;  1RKT A;  4UUS A;  3RQI A;  2ZSI B;  2KJB A;  1HDD C;  3T5X A;  4D9J A;  2VOD A;  1RPW A;  4I09 A;  1YIT I;  3U2R A;  1T0F C;  2EIM H;  3VOE A;  1RET A;  3JAM K;  5LRR A;  2CUE A;  4M9X A;  2NVX J;  5L3E A;  3LMM A;  3WOD F;  4AIK A;  2DMN A;  1P4W A;  4Z6Y A;  4HNT A;  3KPH A;  1EH8 A;  2ZFW A;  2FSW A;  2HPI A;  3JW4 A;  3JSP A;  2ACJ A;  3GWZ A;  4B4C A;  2NOG A;  2DA3 A;  4X1E A;  2DLL A;  1JT0 A;  3HJE A;  5DCF A;  3VDX A;  1AHD P;  4IJA A;  2EJR A;  2R4G A;  3H9Q A;  3PSI A;  5IT9 Z;  3I9V 2;  2O61 A;  4L9J A;  3L2R A;  2N8G A;  3P9K A;  3DEE A;  5L3C A;  4IHY A;  4XKV A;  1NG7 A;  5LRS A;  2FOK A;  1VQ4 I;  3VSL A;  3ZMD A;  1JUM A;  3WTY C;  4CYC A;  1YRN A;  3IH4 A;  3JRE A;  1Y0N A;  3DEW A;  1R6R A;  3IL2 A;  1IG7 A;  3F8F A;  4ZH4 F;  3IWF A;  4JOM A;  3DF8 A;  4OAZ A;  1OCP A;  3OR2 C;  3TP3 A;  3BR2 A;  1FP2 A;  3TO9 A;  1O3S A;  1MDM B;  2X4H A;  4HX7 A;  1YX5 A;  4BQO A;  1VQM I;  1HW5 A;  2IGO A;  4G94 A;  2DFE A;  3CJT B;  4G8X A;  4GO1 A;  3OS1 A;  4M6Y A;  2EFW A;  4U0W A;  3BR0 A;  2NNN A;  2GXB A;  1R58 A;  2MC3 A;  1X58 A;  3K1N A;  1T33 A;  4CYD A;  3ZQH A;  4A3F J;  1XDU A;  4O6J A;  2W84 A;  3K1P A;  2BY0 A;  1C0W A;  4FX0 A;  1YTY A;  3J7Y J;  2J5P A;  4BQN A;  4AVP A;  3IHU A;  2KIM A;  1Y56 A;  2IGK A; 
#chains in the Genus database with same CATH homology
 4E7K A;  3W3C A;  2R7T A;  2WY7 Q;  1S9H A;  1WJB A;  3MKZ A;  3HOS A;  1G8X A;  4C30 A;  3OS0 A;  1JI8 A;  3QYB A;  1D0Z A;  2CFO A;  2E60 A;  1QHG A;  3VSK A;  4E7H A;  4AVZ A;  4CCN A;  3L2Q A;  4XLE A;  3NWS A;  3OL4 A;  3BG6 A;  3EUH C;  1UG0 A;  3OR1 C;  3CMM A;  2X1D A;  3QOE A;  3BC8 A;  4LIV A;  3DTK A;  4KIS A;  1YX3 A;  2HDW A;  2LBF A;  2Q2E B;  2W1O A;  5KNL A;  2V9K A;  2Y0S A;  2UUZ A;  3OYC A;  3HPG A;  2VJJ A;  3M8J A;  1PYV A;  2IGN A;  2W4S A;  4XKW A;  2VLA A;  4AU7 A;  4B47 A;  3K70 D;  4B48 A;  2AQE A;  2PJR B;  4XR6 A;  2E5N A;  3S8P A;  4RLQ A;  1U0J A;  3M1C A;  2E5Z A;  4DBQ A;  1SAU A;  3K4C A;  3RPU D;  4F91 B;  2VJ5 A;  2DT6 A;  2QKL B;  3G2B A;  1LFP A;  3I3L A;  2M7B A;  2WAQ A;  3S3M A;  2GOM A;  2QKM B;  2R7Q A;  3HKZ A;  3ZQQ A;  2WA0 A;  3VWB A;  4XLC A;  5CKT A;  2E1M C;  1P9Q C;  2RRE A;  4PJL A;  3FBN B;  2M4K A;  1UEL B;  4C9Y A;  4E7S A;  2M0M A;  3BLY A;  3TL4 X;  3AL0 B;  4BE2 A;  4IQ4 A;  1T95 A;  3ZRG A;  2WY8 Q;  1N75 A;  4PK4 A;  2XAU A;  3MKY B;  3BCA A;  3IAS 2;  4PUS A;  4NNJ A;  3HG9 A;  1D1B A;  4GRI A;  4XM3 A;  3MD2 A;  2IS1 A;  4BUP A;  3SEZ A;  3ZR8 X;  3OOU A;  4CCO A;  3OWT A;  2LG4 A;  2MYS A;  4P5O A;  5JHF A;  2XF6 A;  5HOO A;  2XF5 A;  4CCJ A;  4II2 A;  5FRM A;  3D5S C;  3K4N A;  3DU5 A;  2MFZ A;  3K6G A;  4X0G A;  3SYT A;  2OC6 A;  3KEY A;  4N4N B;  2WBM A;  4HRI A;  2XC7 A;  4Y4R A;  2BW3 B;  3K70 C;  2K5C A;  4XMY A;  3LSH A;  4II3 A;  3VYT B;  1SFK A;  2W7N A;  2R7S A;  2BVL A;  4BGD A;  4ZJZ A;  3L2V A;  2KQR A;  1PJR A;  4HG2 A;  1BR1 A;  1WJ5 A;  2R7R A;  3DKY A;  3HUG B;  1GLN A;  1E0E A;  2CV1 A;  2R7O A;  4KIT B;  3OYL A;  2V7F A;  1BR2 A;  3H9J A;  4DBR A;  1Z3Y A;  2VIX A;  3EPZ A;  3CZ6 A;  3VYU B;  4F55 A;  2V6E A;  1WFX A;  4PJJ A;  1LDK B;  4XKC A;  5KHD A;  1LVK A;  4BQQ A;  3VYS B;  4ZDO A;  2LH9 A;  2L9N A;  1DQU A;  3PNT A;  5KCM A;  1V5E A;  4LG3 A;  3OIP A;  3OYJ A;  3MKW B;  3D5R C;  2M4G A;  4DIQ A;  3OYF A;  2JVG A;  4CCK A;  2ZSH B;  2UWM A;  2VQH A;  2HZD A;  2X1E A;  2RNG A;  3LSI A;  1Y6I A;  2L2O A;  3SDB A;  2A6T A;  2VQG A;  4YEL A;  2KRH A;  3A2K A;  4F93 B;  4RLF A;  2CS3 A;  2FUG 2;  2WB1 A;  3ONQ A;  1J09 A;  4F92 B;  4XNF A;  2MD0 A;  3OMY A;  2A5W A;  3ZXS A;  3L2W A;  1DP3 A;  4BEH B;  2X1C A;  4XN0 A;  4YEJ A;  3DLA A;  4D1Q A;  2DT7 B;  4F52 A;  2LY2 A;  3F9K A;  1MMD A;  2LOO A;  2M7A A;  4H4K C;  2KHM A;  2NOJ B;  3E0J B;  3W2W A;  3HL2 A;  2F4I A;  3OYD A;  4N4O B;  4BJ5 C;  4LIT A;  1FMV A;  5FRN A;  1ERD A;  4DOZ A;  5HLT A;  4ZTF A;  2AQF A;  1MMA A;  2CV2 A;  3C2H A;  2MAB A;  3OYA A;  4E7I A;  5CPR B;  4C2U A;  4EAT A;  2K3P A;  3HXL A;  3IUO A;  3S3N A;  4PSW A;  3CP8 A;  3DPT A;  5TGT A;  4B43 A;  1D1C A;  3LFU A;  4MLO A;  3DPL C;  4Y33 A;  3A1Y A;  2V1N A;  4G6T B;  3IAM 2;  1QHH D;  2IXS A;  1IRX A;  3SEQ A;  1K6Y A;  3K4K A;  2VQC A;  4J01 A;  4QPO A;  2JA2 A;  4ZDP A;  3K4J A;  2PMZ A;  1V5G A;  4NUB A;  4E4H A;  2M3A A;  3E1S A;  4Y3O A;  3NWT A;  1D0Y A;  4E7Z A;  4JQF A;  2LRD A;  3GBG A;  3PL8 A;  3QYE A;  1Z21 A;  2ZFU A;  2KMU A;  1MND A;  2KP6 A;  2Q1Z B;  3RTR A;  3OYM A;  2VKH A;  1WJD A;  1NG6 A;  4CSW A;  2LC2 A;  4E7L A;  4U7B A;  1VZ0 A;  1KON A;  3BG7 A;  2W82 A;  3EUK L;  4CA0 A;  2JVH A;  2O5R A;  3A4C A;  2K9M A;  2L5Q A;  4CH7 A;  2R7W A;  4KJZ A;  2P0W A;  3IP4 B;  4ZTJ A;  2IS6 A;  2JSP A;  3QOD A;  4PJM A;  3RCO A;  1OR7 C;  2CUZ A;  3OYH A;  1X1D A;  3KYL A;  2E1M B;  5HVQ C;  2VL8 A;  1Z3X A;  2CW8 A;  2KRC A;  4BDY A;  4R79 A;  4C2T A;  4YRV A;  3OYK A;  2VJ4 A;  3FKJ A;  2I8D A;  3W2A A;  2W00 A;  2CH0 A;  4XN3 A;  4E6K G;  2PJR A;  1QU3 A;  2HQA A;  4XQF A;  3K4M A;  1MNE A;  2VAS A;  1MW7 A;  2CMP A;  2KPM A;  3OYN A;  3W2V A;  4PJN A;  2GOX B;  2R7X A;  2Z2S B;  4LIU A;  4BDZ A;  4NC7 A;  1AA7 A;  4ANJ A;  2F6C A;  3OYI A;  2OV7 A;  5LFA A;  2CV0 A;  3BCB A;  2BOL A;  2DJI A;  2IS4 A;  1WJC A;  1OLT A;  2XDV A;  3PFY A;  3OIQ A;  2ZXH A;  2L7K A;  1WJE A;  3DPU A;  2KZV A;  1X4P A;  2LBF B;  2KDO A;  2HU9 A;  4ZYA A;  4OAY A;  3J7A Y;  3RQ4 A;  2X6Y A;  3S93 A;  4PSX A;  4RMN A;  2HVQ A;  3RSN A;  5CQG A;  2WAE A;  2BVM A;  3H5A A;  1TZL A;  2DXI A;  3FHN A;  4B44 A;  2HVR A;  4NC8 A;  3KX2 A;  1X4O A;  3HC7 A;  3CJQ B;  2X6X A;  3CF2 A;  3EUA A;  3H5R A;  4HPQ A;  3ZGK A;  2IS2 A;  2HNH A;  4XON A;  3UNG C;  2X85 A;  1HA8 A;  1DGR M;  2BW3 A;  2V26 A;  3DTE A;  2CW7 A;  4B3X A;  4RM3 A;  4KT6 A;  4BL0 B;  1X1C A;  2LRE A;  2KLO A;  1G59 A;  4IKF A;  3VYR B;  2X6W A;  4CUG A;  4BJT A;  3OS2 A;  2K9L A;  2MC4 A;  4IZZ A;  2ZXI A;  4ZC3 A;  5LD2 C;  3L2U A;  2IGM A;  4ZDL A;  4XOT A;  5HNH A;  3CP2 A;  3LSG A;  3AKZ A;  3AL0 C;  2VPL A;  2LY1 A;  1W36 C;  4U87 A;  1D1A A;  2UV1 A;  2WAF A;  5FRO A;  4XLH A;  3OYB A;  2VKD A;  4BU2 A;  3H9G A;  2CUJ A;  1FMW A;  2XF7 A;  4BJ6 C;  3OYE A;  4IQJ A;  4NQW B;  3FBI B;  1TT0 A;  1DGW Y;  3UR3 C;  1Z7L A;  2R7U A;  2VJI A;  2KL4 A;  2Z1D A;  4CZC A;  4AYB A;  4BXF A;  1EA3 A;  3SZG A;  3H0D A;  3V42 A;  4XKB A;  3PNV A;  2L9S A;  4BEH A;  2RQQ A;  3U21 A;  1UAA A;  3DWL E;  3DU6 A;  1ZEL A;  2ZSI B;  1MMG A;  2OUM A;  3PNY A;  4D9J A;  1N78 A;  3CJR B;  1WJF A;  2V4J C;  4PFP A;  1T0F C;  1D0X A;  4CCL A;  2F5V A;  3DQV C;  3LMM A;  2XSJ C;  3DKX A;  4BE0 A;  2VB6 A;  4HNT A;  2HPI A;  3HPH A;  2ELJ A;  1MMN A;  1WJA A;  4ITV A;  3OL3 A;  3LSK A;  4DGW B;  3PSF A;  4HEA 2;  3VDX A;  4HST A;  3OY9 A;  3CES A;  3K4B A;  4P1W A;  2R4G A;  3PUB A;  3H9Q A;  4CCM A;  1LKX A;  3PSI A;  4BE1 A;  3H5N A;  3LSM A;  3I9V 2;  2JUG A;  1X1A A;  3L2R A;  3C2G A;  3N05 A;  4QPQ A;  3DEE A;  2Z16 A;  4XKV A;  3TMO A;  3DTI A;  3TBI A;  1NG7 A;  4PFO A;  4E7J A;  2LYC A;  3VSL A;  4XL9 A;  3HOT A;  2VQL A;  4XLA A;  1R6R A;  1YE9 A;  1W36 D;  3QYF A;  1N77 A;  2DOA A;  3D5L A;  1X19 A;  4JOM A;  4OAZ A;  4FAS D;  3OR2 C;  3PJR A;  4J00 A;  2WAD A;  2VXZ A;  2X51 A;  1BR4 A;  1YX5 A;  4BQO A;  4BAC A;  1X1B A;  4DJA A;  4HSR A;  2IGO A;  4XLF A;  5HNF A;  4IX7 A;  1V5F A;  4RM2 A;  2R7V A;  2HVS A;  3OS1 A;  2VXD A;  4F3Q A;  4XOR A;  3K4L A;  3K10 A;  3FDY A;  3S3O A;  4XOP A;  3MMY B;  3H35 A;  3OYG A;  3S32 A;  3ZCO A;  3LL7 A;  4BS9 A;  4FET A;  4OWR B;  3AFH A;  2DCE A;  4HNU A;  4BQN A;  1BOB A;  5CQE A;  1Y56 A;  2HPM A;  2IGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...