2ELKA

Solution structure of the sant domain of fission yeast spcc24b10.08c protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
GSSGSSGFDENWGADEELLLIDACETLGLGNWADIADYVGNARTKEECRDHYLKTYIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SANT domain of fission yeast SPCC24B10.08c protein
rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
molecule keywords SPCC24B10.08c protein
total genus 11
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2elkA00
5E3NA 3BR6A 3K7AJ 3BR0A 1SFOJ 2R0QC 3ZQHA 2DA5A 3BR2A 3K2AA 5E3LA 3PO3J 4A3MJ 2CUEA 4DZJA 1W0TA 3D1NI 2EQRA 2CUFA 4Y7NJ 1LE8A 1MBHA 4MIMA 1G2HA 2AO9A 5JLXA 3PO2J 3A01B 1MSEC 3H0GJ 2E2HJ 1HDDC 1ITYA 3S1NJ 1Y1VJ 1PUFB 1AHDP 5EZGA 1ZGWA 1XS9A 3M4OJ 3ZQLA 1HDPA 1BJZA 3CDLA 5EYRA 3M3YJ 2X6OA 5FLVA 5EGOA 5FKLA 5FKNA 3S2DJ 3MKLA 2TCTA 1ETYA 5F0FA 5J1UA 5J1YA 2TRTA 2LR8A 4DYRA 2M9HA 1POGA 2EZKA 5DTDA 4RDUA 2XSDC 3HEFA 3S17J 1ZR4A 2E19A 2HDDA 1Y1WJ 5K7ZA 2DMQA 1IDYA 3SFIA 1P7JA 2LD5A 5J1RA 1TWCJ 2P81A 5M3MJ 5HODA 4D5FA 1APLC 4GFBA 5IYDJ 3HGGA 2VI6A 1ZK8A 3FISA 3IH3A 4I6ZA 1XG1A 1GT0C 3S16J 4G12A 5F0HA 3HOWJ 1JJ8C 3GTPJ 2L7MP 3ZQGA 2XPWA 2NVYJ 3G1OA 2QF7A 1WH5A 5M5YJ 5EDNA 4BY7J 1RKWA 5EEAA 2DJNA 5E3MA 3H3VK 1I50J 4EEFG 3BT9A 1JUPA 1GV2A 2VUMJ 3A02A 2DA1A 1JT0A 3RZOJ 2N8GA 2LY9A 1AKHB 2B63J 2Y31A 2LFBA 3QPLA 2XB5A 3FIWA 1OCPA 2JMWA 5E3OA 5GPAA 3S14J 5M5XJ 2DA6A 3GTMJ 4IHXA 1NK2P 2JA5J 4JP0A 1UHSA 5IP9J 5FJ8J 4A3FJ 4S0HB 4MLOA 3Q3SA 5C3EJ 4A3GJ 3NAUA 4M3BA 1OCTC 1ETXA 1FTZA 1WCMJ 3RZDJ 4IHVA 1JKQC 4FCYA 4JX6A 1BW5A 1HLVA 1X58A 1MBJA 1T56A 3JRAA 2Y9ZA 4CYCB 1IC8A 1BL0A 1MH4A 4M3FA 4B1RA 3LSPA 5IOYA 1TWGJ 2JJ7A 1B72B 2I10A 2XRLA 2ELKA 4NDLA 3LSRA 1RKTA 1MBGA 2LKXA 3TEDA 3GTOJ 3GTJJ 2HI3A 1FIAA 2NVQJ 2FX0A 3BTCA 1RESA 2YS9A 2HOAA 1U78A 1X2NA 1VNDA 2COBA 1T33A 4W97A 4J19A 3GTQJ 1UG2A 2LVSA 1B72A 3I4NJ 1DU6A 3B6AA 2W48A 5C4XJ 4DYQA 2E1OA 2K9QA 4CYCA 3BQZA 1QVTA 1PUFA 5F08A 1IUFA 2KT0A 4DYCA 3OOUA 2FJ1A 4MFEA 2O9LA 4UUTA 2ME0A 5EG0A 3MVPA 4I76A 3HOVJ 2AHQA 5BNGA 1HOMA 2FD5A 3SJMA 1ETVA 4XIDA 3DCFA 2DA7A 4M3EA 4C3IJ 4DW6A 2VKEA 4MFDA 2LK2A 4QTRA 5IYCJ 1IG7A 1XC5A 3A03A 2Y0SN 4M6VA 4UUSB 2NS8A 2OPTA 2JA8J 1ENHA 1E3OC 3JRCA 2L9RA 4A3IJ 2ZB9A 2IEKA 4FTHA 1FEXA 1X2MA 3BR5A 5IP6A 2NOGA 5GP9A 2VKVA 3E7LA 1MH3A 1IGNA 4C2MJ 4ABZA 3MN2A 5J3LA 1ORKA 3JRGA 4L5EA 4XRMA 1RR7A 1D5YA 2E2JJ 4XICA 1LFUP 3Q0VA 3QPSA 4AYBN 3LNQA 4A93J 3Q0WA 1GDTA 2L7FP 2NS7A 3TP3A 1RPWA 2QCOA 2H8RA 1JTYA 2CU7A 5F27A 1JGGA 1QVUA 1EF4A 3FK7A 1HF0A 4IHYA 5IP7J 2R93J 4C3JJ 2DA2A 5K7HA 1WH7A 1OJLA 2HYJA 2M2EA 3WHCA 2R5ZB 3OIOA 2DMNA 3JRDA 1IV6A 4BBSJ 2ID6A 4LOCA 3BTLA 5IOZA 1JKPC 4M3DA 3OSFA 2HOTA 1W0UA 3JRHA 4B4CA 3HOXJ 1YRNA 1VF9A 9ANTA 1GVDA 2KDZA 3GTKJ 1JT6A 2DMTA 2LTPA 1ETOA 3SDGA 1Z0XA 3A01A 2GLOA 2LP0A 4JX4A 2YU9J 5IYBJ 3NARA 2X9DA 2ECCA 3RQIA 3G1LA 2DTZA 3FK6A 2L7ZA 3BQYA 3IH4A 3TW6A 4B3AA 5FLMJ 3BR3A 1K61A 2IBDA 1ETQA 2DA4A 3TW7A 3BR1A 5F1JA 4JYKA 2ECBA 2K9NA 5EF6A 2JK3A 3B6CA 4Y52J 3IV5A 2EBIA 2XGCA 3FKIJ 5FKMA 4UUSA 3S15J 1TWAJ 1AKHA 1U8BA 2Y2ZA 4D7NA 5M3FJ 5C4JJ 3HB9A 1IRZA 2RAEA 1QPIA 3I4MJ 5JLWA 1NTCA 2MG4A 3BG9A 1TC3C 4X6AJ 5M5WJ 1H89C 4FISA 2HXIA 1FIPA 3C2BA 5EG0B 3WHBA 1AU7A 2CQXA 4HNVA 1I6HJ 2GM4A 3GTLJ 1I3QJ 2D5VA 1MBKA 4AC0A 5GPCA 1CQTA 4D7MA 3L1PA 3HOUJ 3RKQA 3S1QJ 2GBYA 2JWTA 1F36A 1GV5A 2EZHA 2VPRA 1A5JA 1HCRA 4C3HJ 3JRIA 1S7EA 2MGQA 3ZQFA 4XK4A 3W6VA 2XGDA 2R92J 4V2FA 1RETA 1A6IA 1MSFC 1ETWA 2DA3A 1LFBA 1IJWC 4XRSA 3CMYA 2DMPA 2L0KA 2WV1A 3IH2A 4M3GA 1SANA 1TWHJ 3BG5A 3LSGA 2R7ZJ 1ZR2A 1P7IA 2HQ5A 2Y9YA 4W1UA 3ZOBA 3O8HA 4QSHA 1H8AC 1H88C 1MNMC 2NVXJ 3PM1A 2M8GX 2JA7J 2YUSA 4V2GA 2WAQN 2H1KA 1IDZA 1UMQA 1MBFA 3HBLA 3VPRA 5IPAA 2JN6A 4A3DJ 2EZIA 1DU0A 3F0CA 4A3EJ 2EZLA 1Z77A 1BA5A 2DN0A 2XPUA 3O8GA 1WI3A 2XPVA 1VFCA 1O4XA 1JKRC 4BBRJ 3S1RJ 1B8IA 1WGXA 3JREA 2R5YA 2CQQA 4FE7A 4BXXJ 3ZQCA 1JJ6C 2XB0X 3JRFA 2HXOA 1GUUA 2OF7A 5FKKA 3HGYA 2XGEA 3GTGJ 3GBGA 2ID3A 1VI0A 1JUSA 4BKXA 5F04A 1Q1VA 4A3CJ 3UKGA 2CJJA 3TP0A 1QRYA 3S1MJ 4XRSG 2K9SA 3S2HJ 4JX5A 2M0CA 3JRBA 1YRNB 5DS9A 1BW6A 3CQZJ 3Q0UA 2ME6A 1ZKGA 2EH3A 5K7FA 1JUMA 1U9OA 1JTXA 2MSYA 2X48A 3LOCA 5F0CA 5EGOB 5EZHA 4A3BJ 3LSJA 4QIWN 2R5ZA 3BTJA 4IEJA 2NVTJ 1MBEA 3BG3A 1R9TJ 1ZQ3P 2MW8A 1K83J 2LLKA 3QQAA 1ETKA 3HOZJ 2O8KA 4BY1J 1TWFJ 1NK3P 2DMUA 2Y30A 4A69C 1LE8B 3JR9A 1WPKA 2FQ4A 2K40A 2WB1N 3HOYJ 3OSGA 1OFCX 2M34A 4A3LJ 5FKOA 2G0EA 1U9NA 4X1EA 2HOSA 2O7OA 2IAIA 3HDDA 3HM5A 4D5CA 3DEWA 1FJLA 2CRGA 1F43A 4RBOA 3ZQIA 2R5YB 5C44J 2PMZN 4IHWA 3CCYA 4DZPA 1B8IB 1ZTRA 4FE4A 2JA6J 2E2IJ 3BTIA 4A3KJ 3HKZN 3G1MA 4MO7A 4A3JJ 1FTTA 1JKOC 4AUXA
chains in the Genus database with same CATH superfamily
1D8KA 3PFIA 3BR6A 2V6EA 1SFOJ 1HKQA 3OYBA 3BR2A 1CGPA 2GOXB 3K6GA 3PO3J 2M3AA 4F91B 4DZJA 4P96A 2EQRA 3SEZA 2KIUA 2MH2A 1B6AA 4P55A 1MBHA 4RAZA 3PO2J 5HS9A 3RI4A 3FXJA 4F3QA 4G7ZF 1K4SA 3S1NJ 5ICCA 2E7WA 3FHNA 2HWVA 1XS9A 2Z33A 2V9VA 1HDPA 3CMMA 3OS2A 5EEGA 4CXFA 3RPUA 3FM5A 1T38A 5DUKA 3MKLA 1HW5A 3RKWA 2W85A 4RM3A 4A6EA 3OYHA 1K79A 1QBJA 2DPUA 5DD4A 2DFEA 1DUXC 1OYYA 3NEUA 2QYOA 1B9NA 2TRTA 1Y39A 4DYRA 4E4HA 2NXNB 1K6YA 2E19A 5D5WB 2K85A 5L3CA 2HDDA 1Y1WJ 2DJIA 5L3BA 3G71I 1P7JA 1QU3A 4I02A 1KA8A 2WY8Q 5DV5A 5H6RA 1TWCJ 2KJBA 1KGSA 5HODA 1D1BA 3VYRB 2A6HF 4GFBA 1UHMA 4R1HA 3HGGA 2R7SA 3FXUA 2VI6A 3WTUC 4YIFA 3FISA 3IH3A 1R1TA 4BNCA 1JJ8C 1FPQA 4II3A 3ZQGA 1HW1A 4ZDOA 5J40A 4RGXA 4IPAA 1Z05A 1HBXG 2Z9OA 4LG0B 2O0YA 5EEAA 2DJNA 3ABLH 1QHHD 1KU2A 4OAZA 3RYRA 4EEFG 1P4XA 3N4MA 1JUPA 1LEAA 2KZGA 3LSIA 2DA1A 1P6RA 2N8GA 4ZC3A 1BR2A 5CQEA 2LY9A 2KLOA 3N97A 3FMRA 4I98B 3K69A 5D5VB 2B63J 1O3QA 2Y31A 2LFBA 5J6XA 1H9TA 2UZKA 1VQ4I 3VEPA 1BJAA 2VJ4A 3FIWA 1YIJI 2JPBA 5E3OA 1BC8C 3GTMJ 4IHXA 1NK2P 5IP9J 2GXGA 3D5RC 1KQ8A 1E3PA 3K70C 4M3BA 5KVRA 2QM3A 4ZZDA 3MAJA 3RZDJ 4FCYA 1IZ1A 1HLVA 4BAYA 3GLLA 2PMZA 2OU2A 5TGTA 1J5YA 3S3NA 1Z21A 3K9TA 3QYBA 3GFMA 3NQOA 4M3FA 3OYFA 1XB4A 1IN6A 4B1RA 3L09A 1W4MA 1VQMI 3CCJI 1U0JA 3SFZA 2EB7A 2E5ZA 2ELKA 3LSRA 2XAHA 1N25A 2A5YB 2IS1A 2E7XA 1FIAA 2DT6A 1RESA 3OYGA 3GZNB 1YJ9I 3IAS2 4MHGA 3GVAA 3J7AY 3MZ8A 1XGOA 2COBA 3FKJA 1T33A 5F6FA 3CCSI 1OYIA 3GTQJ 3MZHA 1B72A 3I4NJ 4U7BA 1MJAA 5CJ9A 5IT9K 2OZ6A 1IN5A 2F4OB 3QP5A 2DOFA 3LSKA 1OR7C 3W2WA 2MD5A 2K9QA 4XORA 5HS8A 3RIRA 4CYCA 3DLAA 2CQNA 2DQLA 1K78A 3OL4A 5F08A 1IUFA 4KMUX 1USSA 2W25A 1IXRC 2RNJA 2VJ5A 2V26A 1LPQA 5EG0A 1P4WA 4GYGA 1WJCA 2XDVA 1O3SA 2R7UA 4XM3A 3CDIA 2AQFA 1VQOI 4I0BA 2M5WA 2W00A 1OLTA 1XN7A 4ZZLA 5LHGA 1HOMA 5J4YA 3TO9A 4ZH4F 2W57A 3SJMA 2Z99A 4M3EA 4NB5A 4U0WA 3BWGA 3HSRA 1BR1A 1EH6A 2LREA 4H4KC 2G7HA 1XC5A 2OC6A 3KYCB 4M6VA 4AYBA 4HF1A 3TMOA 2A05A 2NS8A 2VC0A 4XNFA 3BCBA 3JRCA 1JHHA 1HKSA 1R1VA 4HW0A 2KJCA 5ICGA 3PIOF 4FTHA 2HS5A 1FEXA 3L2RA 4C2UA 1X2MA 2MC4A 2W84A 1NG6A 3P9KA 2P7VB 5GP9A 3QOPA 1MH3A 5CYVA 5LGUA 4S04A 2GXBA 2NOJB 3L2VA 1WJEA 2A61A 5K5OA 3BROA 2L9VA 2BZTA 3MEXA 4I0AA 3BOQA 1F1ZA 2M7BA 2RNGA 1OPCA 1LDJA 2XF5A 5CKTA 3W6JB 3ZXSA 2L2OA 5FLXZ 4ON0A 2KQRA 2XC7A 4GYIA 4EJVA 2LYCA 4HG2A 2QCOA 1JTYA 5F27A 1J59A 1QVUA 1EF4A 3R6SA 4XLEA 5E20A 3CO7C 4TV7A 1HF0A 4C3JJ 1PP8F 1HA8A 3CCVI 2Z3YA 1A36A 2I8DA 3V7SA 4YFNF 3GEZA 5HDKA 3WHCA 4E7ZA 3N05A 2O6GE 2PFBA 2F48A 1UHWA 2O03A 5IOZA 3SEQA 3K2ZA 1O3RA 1FYLA 3AKZA 3OSFA 3IUOA 4IQ4A 4L9JA 1R36A 2DYRH 3KIOA 1YRNA 2FMLA 4A2UA 1FBQA 2BHZA 2KRCA 4U87A 2F6CA 3ISPA 4QPOA 1U5TB 3HRSA 4UB6C 2X9DA 2CS3A 3FK6A 1IG7A 2F5CA 2K27A 3OYEA 3BR3A 4IHTA 4U0VA 1KU7A 4ANJA 2YU3A 3RQ4A 2FUG2 5D5UB 2WC2A 3FKIJ 5LEKA 4UUSA 4IHSA 3ERMA 1U8BA 3E0JB 4BHBA 1L0OC 4JBAA 3HB9A 2M8EA 3GYHX 4IRHA 1IRZA 1V4RA 5D5XB 4XRFA 4X6AJ 2VQCA 1NG7A 4RLFA 5M5WJ 2DDBA 4A5NA 2O3FA 4V19K 2K9LA 1OCZH 5ILUA 2VE9A 2M45A 5EG0B 4FQGA 1FOKA 2Q0OA 3WHBA 1FT9A 2DI3A 3KCCA 2K5CA 5AIPA 1STZA 4KNYA 5DCFA 3I55I 2OUMA 3CP2A 4HNVA 2EA4A 6PAXA 2R7TA 2GM4A 5FGMA 3KYDB 1RIOH 4BHCA 5JI6A 3KYLA 5GAHJ 5BOXA 2DFIA 4A12A 4Y3OA 3OL3A 1VTNC 2JWTA 3ZN0A 2LC2A 1SAXA 1W7PD 2ZFWA 4N9IA 1NH3A 1HCRA 1ZGJA 1YHQI 4B47A 2K4BA 4RAFA 4XK4A 1MSFC 2KKOA 3J80K 2MH9A 3TDUC 1LFBA 3CCQI 3BY6A 4B43A 5D4SA 1SANA 3IH2A 4HLXA 2MLKA 4M3GA 2BVMA 4HDVA 2OTLI 5FLXK 4BU2A 3I4PA 2R7ZJ 2HQ5A 3S93A 3E3VA 1HSJA 3HRMA 4G7HF 2HQRA 4LD5A 3O8HA 1EH7A 3PQJA 1GHCA 1H8AC 3BJOA 4L9TA 2NVXJ 3U9GA 2IW5A 2JA7J 3QOEA 4JQFA 1JXSA 3AG4H 2YUSA 1IDZA 4M73A 3E6CC 2O61A 4RAGA 3VPRA 3I3LA 3KZYA 2QQAA 3FMQA 1XSVA 3D0SA 5HLTA 2BHYA 2H94A 2VXDA 2R7RA 2EZLA 3M8FA 1Z77A 2DN0A 3S2WA 3R61A 2XPUA 2YPRA 1U8RA 1T0FC 2XPVA 1LJ9A 2VQGA 2MFZA 1O4XA 3CDHA 1MMNA 1B9MA 3S1RJ 5HNHA 1R1UA 1WGXA 3SHFA 4CICA 3JREA 3IWZA 3DBHB 4FE7A 2B7EA 2CFOA 2P5LC 2W82A 2HXOA 2JRTA 2X6XA 3WTTC 5JVTA 4UHTA 4O5VA 1SFKA 4BEHA 3TOAA 4Z2YA 4FT8A 3CCLI 3ZMVA 3DWLE 3GBGA 1VI0A 3DKXA 3C2HA 5F04A 4IVNA 2JZYA 2R7DA 3UKGA 2CJJA 3TP0A 2G9WA 3S1MJ 4XRSG 2B9SA 2P4WA 2YX4A 2M0CA 4E7IA 1XGSA 3W6KB 4S05A 2EH3A 5J8FA 5K7FA 3QU3A 3CUQB 2BV6A 5HLHA 3HSEA 4OIQF 5EZHA 4CCOA 4K2EA 4DOZA 2LKSA 3BTJA 4IEJA 2NVTJ 3HOTA 4KFCA 3MMYB 4OIRF 1BI2A 1IN4A 2MW8A 5DYMA 1I27A 1KONA 3W2VA 3H9QA 3VYTB 5LGTA 2O8KA 2ISZA 4BY1J 2IGNA 1S7AA 2DMUA 2Y30A 2W24A 4LMYA 5FB2A 3WTYC 1P9QC 1T08B 1ULYA 2K40A 3DPUA 2HGCA 3OSGA 4BHPA 5FROA 2HOSA 1ACIA 1U9NA 1FX7A 4BQNA 4HLYA 3ESWB 3HDDA 1F43A 2CRGA 2DODA 2ELJA 1WJAA 5C44J 1R23A 1I6XA 3CCYA 1W5SA 2VKDA 1B8IB 2XKOA 5K5RA 1X19A 4XKVA 1ZREA 3CZ6A 3OR1C 3V42A 5F1RA 4A6DA 4PGGA 1BI1A 4YEJA 4BJTA 2Y0MA 4XN3A 5AONA 4A3JJ 4XLCA 3HUGA 4PDKA 3K7AJ 3ZQHA 1M1EB 3K2AA 1XGMA 3ASNH 1E2XA 4G8XA 4MQ9F 3AAFA 1E17A 1G3TA 3RKXA 1IN8A 3OMYA 5DCMA 4RB1A 1TTYA 3KLOA 1E3HA 2HDCA 3MKYB 3H0GJ 3TDZC 1UJ8A 1HDDC 3OYLA 2E2HJ 4RB0A 1Y1VJ 2WTEA 1DP3A 5LD2C 1ZGWA 1SVOA 2RQQA 5B1AH 3VYSB 1D1CA 5FLVA 2VB6A 3VDXA 4PGHA 5FKLA 5FKNA 3OYJA 5F0FA 5J1UA 3K4LA 1FWZA 1S29A 2NS0A 3QODA 2X6WA 3K4CA 2LR8A 1BIAA 3SZGA 4WF2A 2OJED 1XPXA 4EJTA 4P9FA 1D3YA 5K7ZA 2RREA 2ZCWA 2Z5UA 4XN0A 2PJRA 4MEYF 4PJNA 1WHUA 3OYKA 4HPQA 2NAZA 1KQ9A 4GGGA 3CUOA 1FBUA 2QQ8A 1APLC 2E1CA 2CV1A 1TT5B 3LL7A 1YJWI 1YW7A 3QPHA 3TBIA 1ZK8A 3ECOA 2CG4A 1XG1A 1V55H 3C3WA 1GT0C 3S16J 3F6VA 3HOWJ 2MLGA 1R4NB 5HLGA 2L7MP 1KZHA 3D5SC 2QKMB 3T8RA 2DT5A 1IO2A 2NVYJ 3G1OA 4CCMA 5M5YJ 2JQ7A 2L54A 1RKWA 3H3UA 1A31A 1EJ9A 4CGZA 4UB8C 1I50J 3WE2A 4IO9F 3GWZA 3GMEA 4HZFA 4GCVA 3EUAA 3A02A 4EQQA 1JT0A 3ZMTA 5K1YA 5E79C 4ZYAA 5B1BH 1W5TA 1I5ZA 3A4CA 3QPLA 1K6OA 1OCPA 2JMWA 2V7FA 4RS8A 4LG0A 1VQ7I 1QPMA 2DA6A 4EJUA 4OOIA 3I71A 5FJ8J 4MLOA 3NAUA 3W2AA 3LSHA 4G7OF 1WCMJ 4IHVA 2GA2A 1JKQC 3PSFA 3E6DA 4P5OA 1T56A 3J7ZI 3JRAA 3KX2A 1WJBA 4WCGA 3DPLC 3QAHA 2IGMA 4KT5C 3WG9A 1ON1A 4I7HA 1TWGJ 2JJ7A 2BYVE 2XRLA 3CF2A 2KRHA 3TEDA 3GTOJ 4IJAA 3WG7H 3GTJJ 2NVQJ 1IRGA 2YS9A 4CCKA 3M8JA 2HOAA 2BVLA 2VOOA 2UV1A 1U78A 3KP5A 4KIFA 2LNBA 1MGTA 1VNDA 1PP7U 3TO6A 4RM2A 4BYYA 2BXZA 2FNAA 4XKCA 2W4SA 2CW7A 1G8XA 3LSMA 2R7OA 1YYVA 2VQHA 4L5IA 5C4XJ 3Q9SA 3CUQC 4MEXF 3BQZA 2FNPA 1QVTA 1PUFA 4XLNF 3ZPLA 3LWFA 4L5JA 2E1NA 3ZP5A 2FJ1A 5ILSA 4MFEA 2RN7A 1D5VA 2O9LA 2ME0A 3E97A 3MVPA 4E70A 1OKRA 1OISA 4OMZA 4XQFA 2JUGA 2X1EA 2AHQA 4Q5SF 5HLIA 1Z7UA 1RUNA 2FD5A 1ETVA 2ICWG 3BP8A 1MW7A 2D2WA 2WA0A 3GZ6A 2HVRA 4QTRA 3OV8A 5IYCJ 3CD6I 2QSGX 2EV5A 4UUSB 2OPTA 2JA8J 4LITA 3C18A 2PI0A 4AIHA 2V1DA 3T0YA 2QBYA 4A3IJ 4WWCA 4NQWA 3SYTA 1X1CA 4L9NA 2RDPA 3AFHA 3BJAA 2NOGA 1IN7A 3E7LA 5LHIA 3J81Z 1TBXA 3TKYA 4ZYEA 4C2MJ 3ZQQA 2A3SA 2ZNYA 2XGXA 2E5NA 2A6TA 3RYPA 3CCEI 3CC7I 1BIBA 4L5EA 4WXCA 4XRMA 3JRGA 1RR7A 3VYUB 4AIKA 3Q0VA 1GXQA 3ZGKA 1ZGAA 3LNQA 3L2QA 3IAM2 3DEEA 3R0AA 4A93J 3A2KA 4HDUA 1GDTA 2L7FP 2NS7A 1EV7A 3J81K 1ZG3A 1OCCH 3BDDA 3I53A 5IP7J 2R93J 5LRRA 1FOXA 4G6DA 2HYJA 3F21A 2VIXA 3EYIA 4BACA 2R5ZB 4ENKA 2EK5A 2A68F 3S8PA 3K70D 3BTLA 4EMSA 1JKPC 2FEZA 3J7AO 3H35A 3JTHA 2GZWA 3FXMA 3DTKA 4HF2A 5DDGA 3JRHA 5ED4A 2EWNA 5FRNA 1R6RA 4RB3C 2PEXA 2MABA 2ZFUA 1RRJA 1TW3A 2M7AA 5CVVA 3HL2A 3CO6C 9ANTA 2V1NA 2X6YA 3K4NA 2KDZA 2DMTA 1K7AA 3SDGA 2GLOA 2LP0A 1FOYA 3VODA 3ERED 2ZXWH 4BDZA 2K4JA 4C2TA 5IYBJ 2JUCA 4KIBA 2DTZA 4B3AA 4EM1A 3OY9A 2JPCA 5FO5A 3DFGA 2VASA 2IBDA 2DA4A 3TW7A 1X1AA 5ICEA 4Y52J 3IV5A 5E18F 2VC1A 1AKHA 3IRQA 4PJJA 1FSEA 1ZELA 1ZLJA 2BY3A 3PQKA 3I4MJ 1I39A 2VJIA 4CH7A 3VSKA 1H9GA 4FISA 3LQRA 2F4IA 2HXIA 4XSZF 2VT3A 4CZZA 2X0LA 3C2BA 4HV6A 1TZLA 4LK1F 4C9YA 1LVKA 4XLAA 2EPFA 1MD0A 3IKTA 3KPHA 1SD4A 2Z1DA 3FXKA 1AU7A 2CQXA 1K78B 1I6HJ 2QZ8A 4I09A 1R5HA 1TQMA 3GTLJ 4MTEA 1W36C 2D5VA 4AC0A 2Q2EA 1IUYA 4WXDA 4AM3A 1CQTA 4D7MA 2F5DA 3L1PA 4F52A 3FXQA 3RKQA 3HOUJ 3TOBA 3ZR8X 2F5FA 3JSOA 4QPQA 3FHZA 1SD7A 3RSNA 1GV5A 2EZHA 1WWXA 2VPRA 3I64A 3OWTA 4EV0A 1A5JA 4H0EA 3MFKA 2BE5F 1S7EA 2MGQA 2Z2SB 2ZSIB 4BE0A 3KP6A 2XROA 1FSHA 5EJCA 3V4GA 4V2FA 2MA3A 2P8TA 3O6BB 1XCVA 2ZMEA 2M87A 1IJWC 2P6SA 2M4KA 4Q48A 1TWHJ 1D0XA 4ZDLA 4EVIA 2FU4A 4PFPA 4IRIA 1P7IA 1MJBA 4HV5A 3R0JA 3J7YJ 3L2WA 1WZ2A 3ZOBA 2O8XA 5KHDA 1OR7A 1P2FA 3E6BA 4IKFA 2JVGA 1H88C 1MNMC 3PM1A 3OYMA 1FY7A 3KEYA 4MTDA 2FF4A 4V2GA 2WAQN 2H1KA 4Y13A 5LFAA 3FX3A 2Q8KA 2LSOA 5IPAA 3PFYA 2OA4A 4PFOA 2JVHA 4EM0B 2EZIA 4NC8A 1LDKB 3B02A 1DU0A 3F0CA 1V54H 4JK1X 1BA5A 1WI3A 2WY7Q 2DBBA 5DEQA 1MDMB 2QEXI 1CF7B 3L9FA 4EJOA 3V8KA 1VFCA 1YS6A 1Z3YA 4BBRJ 1QO0D 1DPRA 3EUKL 2R5YA 3KZIC 2CQQA 1Z1DA 3RKYA 3U2RA 4BXXJ 3Q9VA 2L5QA 4LLGF 5LEJA 2DFHA 1ZH5A 4PJ0C 2M4GA 2OF7A 3PSIA 5FKKA 3U1KA 3WTXC 5TRDA 4UUVA 2ZSHB 4YRVA 2XGEA 3RCOA 4Y15A 2EIKH 4FX0A 4BKXA 3JTGA 3JAMK 3O3KA 1U5TA 4HEA2 3KZZA 3M1EA 4PJMA 1YG2A 3BZCA 2LOOA 4F55A 3OYNA 2OBPA 2EIJH 1D1AA 3S2HJ 2EJRA 1HXDA 4BQOA 4JX5A 1YRNB 3JRBA 5DS9A 4LGWA 1ZRCA 4IL6C 2KDOA 2H27A 2IVMA 5F0CA 2XAQA 3T5XA 5EGOB 4LK0F 3LSJA 1WSUA 3WGGA 5GAEJ 5BPIA 1G59A 2G7UA 2LG4A 3G3ZA 3JAMZ 3KEQA 3QU6A 2L9SA 2H1LA 2EILH 4OIPF 5DUIA 3QQAA 1TLHB 3CCMI 3HOZJ 1QZZA 1MKMA 2ZXHA 4EM2A 1NK3P 3FXOA 3JR9A 3CTAA 5KK1A 4YIRX 2FBHA 1QQIA 2LMDA 4XSXF 3OYDA 4XMYA 3GO5A 1QGPA 1SMYF 4LB5A 1DGWY 2IAIA 2EFOA 3HM5A 4D5CA 1T2KA 3AL0C 3ZQIA 2CO5A 2W7NA 1B59A 1JHFA 1O7FA 2DU9A 2IXSA 4FE4A 1XMXA 1ZRFA 1R5ID 2HPMA 2JA6J 1SC7A 3DU5A 4IQJA 3PNYA 3G6EI 2HTSA 3G1MA 2FMYA 4MO7A 3I54A 4FETA 4AUXA 2KPMA 2KISA 5E3NA 1JE8A 1NHAA 3QWLA 2VBXA 3E5XA 2XUBA 2OCEA 5H20A 4HNUA 4ZJZA 1UELB 4IX7A 1FC3A 4NC6A 4L0ZB 4LIVA 4F7ZA 5KCMA 1T8IA 1FBSA 4Y7NJ 4MIMA 3IRRA 2WV0A 5JLXA 3A01B 4WXHA 1ONVA 3ZRGA 2KRFA 4XLHA 2YSRA 5HDGA 1YJNI 3QPTA 1PUFB 1AHDP 3ASOH 3M9AA 2L4AA 3WTZA 3ZMZA 4CYDA 1K4TA 1IAWA 3CDLA 5EYRA 4FHTA 2X6OA 2FQ3A 3M3YJ 4EGYA 5EGOA 2E1MB 1JGSA 4B8XA 3S2DJ 1XD7A 2VL8A 4BJ5C 1ETYA 3C7JA 3HOSA 4IOAF 2EV6A 3UR3C 5JVGF 3MD2A 1J09A 2VOPA 2A07F 1F4KA 3BCAA 1TNSA 3HEFA 4GO1A 3V7CA 5ERIA 5DM6F 1YE9A 1XCBA 3DTEA 5A2QK 4NBQA 2CYYA 2FA5A 3G4SI 2D1VA 2GWRA 3EUHA 2DPDA 1HC8A 1IDYA 3EPZA 4ZYGA 4OINF 2LD5A 5J1RA 3FBIB 4ITVA 4HA8A 5M3MJ 3A0BC 1KU3A 3A1YA 4UV8A 4DGWB 5IYDJ 2E1MC 1WJ5A 1W5CC 2DTRA 3OYCA 3D5LA 4I6ZA 3HKZA 3VOEA 2YR2A 2IS4A 2PBIA 2IS6A 4G12A 5F0HA 3HPHA 1F5TA 5E1WA 4DIQA 4IOCF 2XPWA 2IS2A 2ESHA 1U2WA 3MKZA 4PZJA 5EDNA 1LEBA 4XONA 4I01A 4XL9A 3CLQA 5E3MA 2AQEA 5CVIA 2L02A 3K4JA 2WAEA 1Z91A 4N4NB 2PQ8A 1BC7C 3I58A 3C2GA 2ESNA 1HSTA 2VUMJ 3K0LA 4AIJA 4DQ2A 2L7KA 1L3LA 4HNTA 1AKHB 1WVRA 3WTVC 5D8LB 2XB5A 3S14J 5GPAA 2VBYA 2JA5J 5L3GA 1UHSA 4A3FJ 4S0HB 2CUJA 5TJJA 3Q3SA 5C3EJ 5HDNA 1OCTC 1ETXA 5JHFA 1VQKI 1FTZA 2F4MB 5E1ZB 5JHUA 5A2QZ 4JX6A 1BW5A 1YTYA 4BGDA 1IXSB 4CUGA 1BL0A 3VWBA 3HHHA 1W36D 2IA0A 4LLLA 2A6EF 2J5PA 2IGOA 5IOYA 5LLQA 5HVQC 3KEOA 5BQTA 1E0EA 1ON2A 5F64A 1VQ6I 4ZTFA 1OYWA 1EA3A 2HI3A 2L9NA 2ZO4A 4ETSA 3BZKA 4UY8I 4KJZA 1YIOA 4LB6B 1FMWA 1X2NA 4YELA 2HZDA 4W97A 4J19A 2LVSA 3GUDA 2DK8A 3B6AA 4RLQA 2W48A 1YLFA 1Y0UA 4DYQA 4U0YA 1WI9A 3O2PE 4L18B 3PIPF 2L3DA 2KT0A 2CSOA 4DYCA 5CVUA 3HG9A 2XSJC 2UXNA 4FX4A 3HRTA 4UUTA 3DBRB 5GTHC 1DDNA 4G9YA 1UB9A 2QLZA 3HOVJ 4IRGA 5BNGA 3NWTA 2WBMA 3K1NA 1Z6TA 4N4OB 4E7KA 1J2XA 1MIJA 3TL4X 2QBYB 2VE8A 2CMPA 3DCFA 4P1WA 4C3IJ 4DW6A 2OV7A 2VKEA 4MFDA 2LK2A 2VT2A 3A03A 4CO8A 2ADUA 3BC8A 3K4MA 1E3OC 1EKEA 3EUHC 2ZB9A 4BQQA 3H5NA 1I1SA 2ZJRF 2AXTC 1W1WE 4KA4A 2E35A 2VKVA 2H6CA 2HU9A 3PNTA 1IGNA 2JA2A 4CZCA 3GFLA 1WJFA 1XTAA 3MN2A 5DD8A 5J3LA 4AU7A 1C0WA 1D5YA 4J01A 2FSWA 1LNWA 4XICA 2Y69H 3OOPA 2E2JJ 3LA7A 1KYZA 4D9JA 1LQ1A 4KISA 2H8WA 2UUZA 4PSWA 4LFUA 2VXZA 3H5AA 2WAQA 1P4AA 5BMZA 3F23A 3M8EA 1ZN2A 2QENA 2A5WA 2CU7A 1JGGA 4DJAA 3FK7A 2E71A 5GTIC 1R71A 2GIVA 3GZ5A 3ZMDA 2LBFA 1WH7A 1FLIA 3F8BA 4EATA 1G3WA 3AG1H 1XMKA 1BOBA 3I0TA 4O6JA 2DMNA 2GA1A 4BBSJ 4LOCA 3IL2A 1Q1HA 4M3DA 4HYEA 5HS7A 3SDBA 4ZDPA 3GFIA 1WFXA 4O3MA 2OAZA 1IW7F 4AVZA 1V5EA 2L4MA 4M72A 4B4CA 3P9IA 3ZN1A 2O5RA 4CDGA 3HHGA 5J4VA 4HRIA 1R4MB 2LTPA 4HSTA 1OCRH 5KAIC 4XR6A 2CGPA 4MQVA 1SEUA 2K3PA 1D0YA 3NARA 2ECCA 3G1LA 1IXCA 1Z3XA 2L7ZA 3IH4A 1K61A 2E34A 2XF6A 5L3FA 3DP7A 5EF6A 5IT9Z 3B6CA 1QHGA 2NYXA 2EBIA 4X0GA 5FKMA 2DW4A 3S15J 1TWAJ 1Y8QB 1ZHFA 3CJRB 2Y2ZA 4D7NA 2E60A 1EH8A 1MMDA 4ASNA 1XMAA 1W7PA 2RAEA 3CLOA 5D4RA 2STWA 3BG9A 2RKHA 4GXOA 1SVLA 5H6QA 2HFHA 1H89C 3DXJF 3G73A 2HYFA 1FIPA 2K9MA 2QVOA 2QWWA 1V5FA 2BOLA 3RTRA 2LRDA 3CF5F 1BN5A 2UWMA 2BBYA 4BDYA 1BR4A 5HOOA 2EA2A 3E5UA 1S8NA 4HBLA 4HX7A 1TL8A 2FE3A 2DCEA 1OQYA 2P0WA 2ZXIA 1HQCA 3WU2C 5H2FC 2Q1ZB 1MBKA 5GPCA 4HQEA 5L3DA 1X4PA 2K02A 4XKBA 2HKOA 3G2BA 2HDWA 1XGNA 3DBLB 1BI0A 3OYAA 2ACJA 1G3SA 4XOPA 4Q4ZF 2FRHA 2NNNA 2P6TA 4MNUA 3E6MA 5ILVA 1D0ZA 4C3HJ 2ZMEB 3GXOA 1J9IA 1RI7A 3W6VA 3CMEI 4L0YB 2XGDA 2R92J 1RETA 1A6IA 2XAJA 1ETWA 2V4JC 3P9CA 3OS1A 1YFHA 1PDNC 3NWSA 3GF2A 4NC7A 1UAAA 5CVJA 1KU9A 2ZJ2A 2KP6A 5CQGA 4J00A 3H92A 3RDIA 1GLNA 3WODF 4IF4A 3BG5A 2HTJA 2R4GA 3LSGA 1ZR2A 2FOKA 4ZTJA 5DM7F 4A0XA 2J5OA 3VSLA 4QSHA 2I5UA 4UXNA 4E7JA 4AIDA 2VBWA 1YW8A 5DCMB 2M8GX 3K1MA 2WB1A 2V1XA 4KT6A 4UNOA 3S32A 1S3JA 3HBLA 2V6CA 3R4KA 3M7GA 1Z7LA 2JN6A 2V9KA 2CW0F 4CCNA 4A3DJ 1IV8A 2QQ9A 2B0LA 5D8KB 3HUGB 1REPC 2YX7A 2DOEA 2PX9A 4HSRA 2BY1A 3HC7A 4KICA 2AXLA 1A35A 1ZG1A 1B8IA 2GQQA 3V7RA 2CQKA 2H09A 1FZPB 2KIMA 2JT1A 2HYGD 2VBZA 2VQLA 3H5RA 1ERDA 2XB0X 2NNYA 3ZMSA 4R79A 5CPRB 2IA2A 1V3FA 1GUUA 4II2A 3VFZA 2HR3A 3HZJA 4BXUA 1T98A 2JTVA 3PUBA 3WGIA 3H0DA 1DP7P 4LIUA 3GTGJ 3MZYA 1JUSA 3K10A 4YG2F 2JSPA 1R5GA 1AOYA 4A3CJ 4CCJA 2MC3A 3GW2A 3WE3A 2FOWA 2HZTA 1FMVA 2K9SA 3IP4B 4BQAA 1S72I 2BXYA 2X51A 2ME6A 1RC9A 2BGCA 4PJLA 4U7DA 3GFJA 3DKWA 2KIFA 1R00A 1U9OA 4U88A 1JTXA 2MSYA 1YQAA 2X48A 4M74A 4A3BJ 4QIWN 4D1QA 2R5ZA 5FFXA 2EFWA 3I9V2 1T6SA 2Y48A 4ZYDA 2DLLA 1MBEA 4BH9A 3BG3A 3X2QH 2QUFA 1ZQ3P 4RGSA 2F5VA 2OQRA 1PUEE 3F8CA 4NNJA 1LUJB 4A69C 2Q2EB 1WPKA 1VZ0A 1KYWA 3PNVA 3HOYJ 1OFCX 2PMUA 2P7CB 3BPVA 2QQBA 5FKOA 2XIGA 2O7OA 4CA0A 1SAUA 3J80Z 1OMIA 1FYMA 1J7KA 2HVSA 1FJLA 4FASD 3FM3A 4RBOA 4BJ6C 3L7WA 3H36A 2BEOA 1Y56A 2FBIA 4IHWA 1FOWA 2D45A 4DZPA 1ZTRA 3ZQ7A 3I56I 2E2IJ 4KIGA 3SZPA 2XRNA 3BTIA 4A3KJ 4XLPF 1W7PB 1Z6RA 2NRAC 1X3WB 3HKZN 4BS9A 4M9ZA 1FTTA 4XBFA 2DFFA 1JKOC 4IXAA 4G6QA 3BR0A 4D0PA 2R0QC 2XASA 2DA5A 3HIFA 3H9JA 5E3LA 2CUZA 4P9UA 1UFMA 4A3MJ 2CUEA 3OR2C 4QWQA 4OU0A 1W0TA 3MCZA 3OS0A 3D1NI 3H9GA 2CUFA 5IT3A 1RUOA 3HJEA 1LE8A 1VQ5I 1G2HA 5E8IA 2AO9A 3K1PA 1MSEC 1YO5C 2LY1A 1YOVB 2XKPA 1ITYA 3KP2A 1TP4A 4ENNA 2V79A 3QYFA 5EZGA 2IP2A 4E7LA 3RPUD 3M4OJ 3CMAI 3ZQLA 3KLNA 1BJZA 5CVRA 2W1OA 3NRVA 3H1CA 1PJRA 2TCTA 5JR3A 4QLCU 1XDSA 4UVBA 2DAOA 2HKXA 5J1YA 3DLLF 4HX4A 2BY2A 2M9HA 1POGA 2EZKA 5DTDA 4RDUA 2XSDC 3F22A 3S17J 2LF7A 2GIZA 2OCCH 1ZR4A 2OQGA 2RV8A 4YIIA 1Y6IA 2RVCA 1TNTA 2DMQA 2MD0A 2HQAA 3L00A 3TQNA 4PSXA 3SFIA 2GOMA 2K3FA 2CH0A 4RGRA 2P81A 5BPDA 4UVAA 4D5FA 1G6NA 2PN6A 1X1PA 1X4OA 1SFEA 1FP1D 2X4HA 4OMYA 5E8GA 2HNHA 2XHKA 4I2OA 1Z67A 3GTPJ 4EJWA 5E17F 2D1HA 1USTA 1SD6A 2DO7A 3HXLA 2EV0A 2QF7A 1WH5A 3LSTA 4CCLA 4E6KG 3LAPA 4BY7J 1O57A 2CW8A 4C30A 3ULQB 3H3VK 1D8JA 1V5GA 1TT0A 3ECHA 4Y4RA 1LFPA 1GV2A 3BT9A 3IC7A 2CQ7A 3RZOJ 2L01A 1VQPI 1G4DA 2DDAA 4ENJA 3LA2A 1WKMA 3I59A 3ZCOA 1OCOH 4BXFA 5D6FA 4ENMA 4LLNA 2CFXA 5M5XJ 2RC4A 4JP0A 1O7LA 2MBFA 2CWEA 3SXYA 1XSDA 4A3GJ 4CHUA 2X1DA 2GXAA 4I99C 2STTA 2Y75A 3L2CA 2IPQX 1X58A 1MBJA 3HYIA 3CCUI 3U21A 4CYCB 2XAGA 2Y9ZA 1IC8A 1AWCA 1MH4A 3KP7A 2LH9A 3LSPA 3S3MA 2HOEA 2FBKA 3WU1B 2PJRB 1B72B 3CC2I 2I10A 4NDLA 3WGHA 2VLAA 1RKTA 1MBGA 3EETA 2LKXA 2KL4A 5CLSA 1S9HA 4G6TB 2FX0A 3BTCA 1ODDA 2KIQA 5KAFC 4LJZF 4A5MA 2RGVA 3QRFF 3PL8A 1BOAA 1BBYA 4DBQA 2Y0SA 4ZYHA 3S3OA 1PVEA 4XOTA 2CV0A 2VPLA 1QZEA 4KN4X 4UV9A 2EFQA 1UG2A 3W3CA 1DGRM 1DU6A 3LMMA 5FD5A 1XDUA 1QZYA 4OIOF 3F8FA 2E1OA 2XVCA 3KE2A 4KN7X 3FZVA 3ML6A 3AL0B 3CJTB 2ZJPF 5K5QA 3OOUA 1N77A 2EIMH 2V9PA 3MQ0A 1YI2I 4B48A 4M9XA 3LFUA 4L9VA 2JRMA 2R7QA 3CP8A 2HPIA 2RQPA 1MMAA 1R22A 1WRJA 2XF7A 4I76A 4KDPA 1T95A 2BW3B 1VQ9I 4BE2A 1YW9A 1YX3A 3T8TA 2H6BA 4AWXB 2KMUA 1B1BA 1LKXA 4XIDA 2DA7A 2XV4S 1S5LC 2DXIA 1FYKA 1F9NA 2WADA 3WTWC 3KP3A 3FF5A 4IZZA 2Y0SN 3BZ6A 1ENHA 1YX5A 1KQ0A 4G94A 2LKPA 3EDPA 2L9RA 2VJJA 2A69F 1R58A 2IEKA 3IWFA 3OIPA 5ICFA 1XX5A 3F9KA 3FWEA 2E36A 1TQPA 3BR5A 1A6QA 5AIQA 5TISC 2KHMA 2DT7B 1FNNA 2EFNA 3ONQA 4A0YA 4BUPA 5IP6A 5IY5H 3Q5FA 3K4KA 3R60A 2CV2A 2PMHA 4ABZA 2ZKZA 2X1CA 4Q47A 1ORKA 1MZBA 1MMGA 2VODA 3I5UA 2WAFA 3CJQB 2EINH 1LFUP 3QPSA 4AYBN 2GAUA 3COAC 5LHHA 1H0MA 3Q0WA 5EEHA 1G3YA 3F8NA 3M07A 1SMTA 3TP3A 1RPWA 2H8RA 1GVJA 3IKVA 3OIQA 4IHYA 2DA2A 4PUSA 5K7HA 4M6XA 4NUBA 1OJLA 2M2EA 3VB2A 4B3XA 3B73A 4ESBA 2OZUA 3OIOA 3PUFA 3JRDA 4WK8F 5JFRA 2BY0A 2ID6A 1IV6A 1DPUA 4ESJA 2M0MA 4BE1A 2NVUB 3FXRA 2HOTA 1W0UA 1MNDA 2HVQA 4CSWA 2PG4A 3HOXJ 3ROUA 2K7LA 3MKWB 1VF9A 4AVPA 4AD9A 2UXXA 4OWRB 3BLYA 1GVDA 3GTKJ 1TW2A 1JT6A 3CESA 3FBNB 3FXLA 1ETOA 3A01A 1Z0XA 3DKYA 3KP4A 2DQRA 4JX4A 2YU9J 3GLXA 3RQIA 3BQYA 4F92B 3TW6A 4N9HA 2IGKA 5FLMJ 2IT0A 1ETQA 2QSFX 3BR1A 4NQWB 5F1JA 4JYKA 2ECBA 2K9NA 3LQQA 4XLFA 2JK3A 5D6EA 5B5EC 1A04A 4HQMA 2XGCA 4WX9A 4E7SA 2DK5A 2ETHA 3HSFA 1IRXA 2PLYA 5M3FJ 3AG2H 5C4JJ 2VONA 2PJPA 1QPIA 5JLWA 5L3EA 1NTCA 2MG4A 2ZC2A 3WU0A 3WTSC 3JSPA 1ZG5A 1TC3C 1CF7A 1MDMA 1U6GA 1Y8RB 2F2EA 2VKHA 3U1DA 2BW3A 1Z9CA 4KUMA 1R7JA 4R8HA 2LY2A 5GADJ 1X1BA 1N75A 3BG7A 3L2UA 3MWMA 4PK4A 1DQUA 1ZYRF 3H3ZA 3A0HC 1YS7A 1GXPA 2LF8A 2K86A 3ABKH 3LA3A 1I1GA 2Z16A 1SVMA 3E5QA 1I3QJ 1WJDA 3P5JA 3CJNA 2OD5A 3JW4A 3F6OA 1UCRA 2XAUA 5GAGJ 3OYIA 1ZRDA 1J0RA 2ZXJA 3S1QJ 2GBYA 3FDYA 1R49A 2P5VA 1F36A 3SZTA 2M30A 2R7FA 3V8JA 4KITB 1LVAA 3DTIA 2ZMEC 3ABTA 3JRIA 3ZQFA 3QYEA 3DU6A 3LAJA 1JI8A 3CC4I 1P92A 1SD5A 3SQNA 5LRSA 2DA3A 3F3XA 4XRSA 3CMYA 1AA7A 1RZ4A 5FFZA 4F93B 2DMPA 3K4BA 4XKWA 2L0KA 2WV1A 1RR8C 2ISYA 4HOBA 2ZNZA 2R7WA 5J8CA 1RNLA 2Y9YA 4W1UA 5B66C 3DF8A 3CCRI 2V1UA 1U3EM 1X1DA 2ELHA 2VN2A 1YITI 4B44A 4HX8A 4M9SA 3RJPA 1UMQA 4RB2C 1MBFA 3I59B 4UVCA 3T1BA 1ZARA 4PCQA 1QA6A 3HTSB 3BJ6A 2KZVA 4GRIA 4A3EJ 1IRFA 4JOMA 1BI3A 1QNTA 3F72A 2IA1A 4M6YA 3BG6A 3O8GA 5LBQA 3EQLF 3RPQA 4KMFA 4RGUA 3HRUA 3DEUA 4BL0B 3BPXA 1HKTA 4GDFA 3P7NA 3M1CA 1S7OA 3AG3H 2LDUA 3UNGC 5E1XA 1JKRC 2M1BA 2ZJQF 2HEOA 1UZCA 2F5EA 3LFKA 1S6LA 5LGNA 3ZQCA 1JJ6C 4M71A 3JRFA 4LG3A 4B09A 1U5TC 4OAYA 1BM9A 1LDDA 3EYYA 3HGYA 1SFUA 1MMSA 2ID3A 5BS6A 1T0FA 4E7HA 3HPGA 1PYVA 3QP6A 1I3AA 1J75A 2ZBKA 1Q1VA 4RMNA 1N78A 1X3ZB 1QRYA 3DV8A 3ZMUA 1Y0NA 2X85A 3TGNA 5KNLA 4DBRA 3V8LA 1BW6A 1B4AA 3CQZJ 3Q0UA 1O3TA 1ZKGA 1MNEA 1SFXA 1JUMA 3CUQA 3LOCA 3F8MA 2COMA 2P5KA 5J47A 1VQLI 2XAFA 3ABMH 4DNCA 1IF1A 2LBFB 3HTUA 4HF0A 2QA4I 1R9TJ 1FP2A 1MJ9A 5FRMA 3TO7A 2R3SA 1K83J 2LLKA 5HNFA 1ETKA 2QKLB 3E1SA 5FD6A 1TWFJ 1VQ8I 1LE8B 4YFKF 1X3UA 3GCMA 3REOA 4A0ZA 1UG0A 2FQ4A 3DPTA 2IRFG 3PJRA 2R7XA 1WQ2A 2WB1N 4BEHB 3GX4X 2IJLA 2M34A 1LB2A 2EFPA 2KFDA 4EGZA 2G0EA 4A3LJ 4X1EA 4RAYA 5B3SH 3C1DA 3KETA 4HAMA 3ELKA 3DEWA 2DOAA 4RA2A 4Y33A 2MYSA 1ZAOA 2R5YB 1HW2A 2PMZN 1ZLKA 2HQNA 2C6YA 3IHUA 1T39A 3DQVC 4ESFA 3FMSA 4Y17A 4YFXF 2TDXA 4NHJA 2R7VA 2JSCA 2QGUA 1TQIA 4Z6YA 3JCUC 2FXAA 3KFWX 2WWYA 2QSHX 1VQNI 2OTJI 3ABUA 4MGRA 2AS5F 1XSXA 4N0BA 4KYWA 2DYSH
chains in the Genus database with same CATH topology
5E3NA 3BR6A 3K7AJ 3BR0A 1SFOJ 2R0QC 3ZQHA 2DA5A 3BR2A 3K2AA 5E3LA 3PO3J 4A3MJ 2CUEA 4DZJA 1W0TA 3D1NI 2EQRA 2CUFA 4Y7NJ 1LE8A 1MBHA 4MIMA 1G2HA 2AO9A 5JLXA 3PO2J 3A01B 1MSEC 3H0GJ 2E2HJ 1HDDC 1ITYA 3S1NJ 1Y1VJ 1PUFB 1AHDP 5EZGA 1ZGWA 1XS9A 3M4OJ 3ZQLA 1HDPA 1BJZA 3CDLA 5EYRA 3M3YJ 2X6OA 5FLVA 5EGOA 5FKLA 5FKNA 3S2DJ 3MKLA 2TCTA 1ETYA 5F0FA 5J1UA 5J1YA 2TRTA 2LR8A 4DYRA 2M9HA 1POGA 2EZKA 5DTDA 4RDUA 2XSDC 3HEFA 3S17J 1ZR4A 2E19A 2HDDA 1Y1WJ 5K7ZA 2DMQA 1IDYA 3SFIA 1P7JA 2LD5A 5J1RA 1TWCJ 2P81A 5M3MJ 5HODA 4D5FA 1APLC 4GFBA 5IYDJ 3HGGA 2VI6A 1ZK8A 3FISA 3IH3A 4I6ZA 1XG1A 1GT0C 3S16J 4G12A 5F0HA 3HOWJ 1JJ8C 3GTPJ 2L7MP 3ZQGA 2XPWA 2NVYJ 3G1OA 2QF7A 1WH5A 5M5YJ 5EDNA 4BY7J 1RKWA 5EEAA 2DJNA 5E3MA 3H3VK 1I50J 4EEFG 3BT9A 1JUPA 1GV2A 2VUMJ 3A02A 2DA1A 1JT0A 3RZOJ 2N8GA 2LY9A 1AKHB 2B63J 2Y31A 2LFBA 3QPLA 2XB5A 3FIWA 1OCPA 2JMWA 5E3OA 5GPAA 3S14J 5M5XJ 2DA6A 3GTMJ 4IHXA 1NK2P 2JA5J 4JP0A 1UHSA 5IP9J 5FJ8J 4A3FJ 4S0HB 4MLOA 3Q3SA 5C3EJ 4A3GJ 3NAUA 4M3BA 1OCTC 1ETXA 1FTZA 1WCMJ 3RZDJ 4IHVA 1JKQC 4FCYA 4JX6A 1BW5A 1HLVA 1X58A 1MBJA 1T56A 3JRAA 2Y9ZA 4CYCB 1IC8A 1BL0A 1MH4A 4M3FA 4B1RA 3LSPA 5IOYA 1TWGJ 2JJ7A 1B72B 2I10A 2XRLA 2ELKA 4NDLA 3LSRA 1RKTA 1MBGA 2LKXA 3TEDA 3GTOJ 3GTJJ 2HI3A 1FIAA 2NVQJ 2FX0A 3BTCA 1RESA 2YS9A 2HOAA 1U78A 1X2NA 1VNDA 2COBA 1T33A 4W97A 4J19A 3GTQJ 1UG2A 2LVSA 1B72A 3I4NJ 1DU6A 3B6AA 2W48A 5C4XJ 4DYQA 2E1OA 2K9QA 4CYCA 3BQZA 1QVTA 1PUFA 5F08A 1IUFA 2KT0A 4DYCA 3OOUA 2FJ1A 4MFEA 2O9LA 4UUTA 2ME0A 5EG0A 3MVPA 4I76A 3HOVJ 2AHQA 5BNGA 1HOMA 2FD5A 3SJMA 1ETVA 4XIDA 3DCFA 2DA7A 4M3EA 4C3IJ 4DW6A 2VKEA 4MFDA 2LK2A 4QTRA 5IYCJ 1IG7A 1XC5A 3A03A 2Y0SN 4M6VA 4UUSB 2NS8A 2OPTA 2JA8J 1ENHA 1E3OC 3JRCA 2L9RA 4A3IJ 2ZB9A 2IEKA 4FTHA 1FEXA 1X2MA 3BR5A 5IP6A 2NOGA 5GP9A 2VKVA 3E7LA 1MH3A 1IGNA 4C2MJ 4ABZA 3MN2A 5J3LA 1ORKA 3JRGA 4L5EA 4XRMA 1RR7A 1D5YA 2E2JJ 4XICA 1LFUP 3Q0VA 3QPSA 4AYBN 3LNQA 4A93J 3Q0WA 1GDTA 2L7FP 2NS7A 3TP3A 1RPWA 2QCOA 2H8RA 1JTYA 2CU7A 5F27A 1JGGA 1QVUA 1EF4A 3FK7A 1HF0A 4IHYA 5IP7J 2R93J 4C3JJ 2DA2A 5K7HA 1WH7A 1OJLA 2HYJA 2M2EA 3WHCA 2R5ZB 3OIOA 2DMNA 3JRDA 1IV6A 4BBSJ 2ID6A 4LOCA 3BTLA 5IOZA 1JKPC 4M3DA 3OSFA 2HOTA 1W0UA 3JRHA 4B4CA 3HOXJ 1YRNA 1VF9A 9ANTA 1GVDA 2KDZA 3GTKJ 1JT6A 2DMTA 2LTPA 1ETOA 3SDGA 1Z0XA 3A01A 2GLOA 2LP0A 4JX4A 2YU9J 5IYBJ 3NARA 2X9DA 2ECCA 3RQIA 3G1LA 2DTZA 3FK6A 2L7ZA 3BQYA 3IH4A 3TW6A 4B3AA 5FLMJ 3BR3A 1K61A 2IBDA 1ETQA 2DA4A 3TW7A 3BR1A 5F1JA 4JYKA 2ECBA 2K9NA 5EF6A 2JK3A 3B6CA 4Y52J 3IV5A 2EBIA 2XGCA 3FKIJ 5FKMA 4UUSA 3S15J 1TWAJ 1AKHA 1U8BA 2Y2ZA 4D7NA 5M3FJ 5C4JJ 3HB9A 1IRZA 2RAEA 1QPIA 3I4MJ 5JLWA 1NTCA 2MG4A 3BG9A 1TC3C 4X6AJ 5M5WJ 1H89C 4FISA 2HXIA 1FIPA 3C2BA 5EG0B 3WHBA 1AU7A 2CQXA 4HNVA 1I6HJ 2GM4A 3GTLJ 1I3QJ 2D5VA 1MBKA 4AC0A 5GPCA 1CQTA 4D7MA 3L1PA 3HOUJ 3RKQA 3S1QJ 2GBYA 2JWTA 1F36A 1GV5A 2EZHA 2VPRA 1A5JA 1HCRA 4C3HJ 3JRIA 1S7EA 2MGQA 3ZQFA 4XK4A 3W6VA 2XGDA 2R92J 4V2FA 1RETA 1A6IA 1MSFC 1ETWA 2DA3A 1LFBA 1IJWC 4XRSA 3CMYA 2DMPA 2L0KA 2WV1A 3IH2A 4M3GA 1SANA 1TWHJ 3BG5A 3LSGA 2R7ZJ 1ZR2A 1P7IA 2HQ5A 2Y9YA 4W1UA 3ZOBA 3O8HA 4QSHA 1H8AC 1H88C 1MNMC 2NVXJ 3PM1A 2M8GX 2JA7J 2YUSA 4V2GA 2WAQN 2H1KA 1IDZA 1UMQA 1MBFA 3HBLA 3VPRA 5IPAA 2JN6A 4A3DJ 2EZIA 1DU0A 3F0CA 4A3EJ 2EZLA 1Z77A 1BA5A 2DN0A 2XPUA 3O8GA 1WI3A 2XPVA 1VFCA 1O4XA 1JKRC 4BBRJ 3S1RJ 1B8IA 1WGXA 3JREA 2R5YA 2CQQA 4FE7A 4BXXJ 3ZQCA 1JJ6C 2XB0X 3JRFA 2HXOA 1GUUA 2OF7A 5FKKA 3HGYA 2XGEA 3GTGJ 3GBGA 2ID3A 1VI0A 1JUSA 4BKXA 5F04A 1Q1VA 4A3CJ 3UKGA 2CJJA 3TP0A 1QRYA 3S1MJ 4XRSG 2K9SA 3S2HJ 4JX5A 2M0CA 3JRBA 1YRNB 5DS9A 1BW6A 3CQZJ 3Q0UA 2ME6A 1ZKGA 2EH3A 5K7FA 1JUMA 1U9OA 1JTXA 2MSYA 2X48A 3LOCA 5F0CA 5EGOB 5EZHA 4A3BJ 3LSJA 4QIWN 2R5ZA 3BTJA 4IEJA 2NVTJ 1MBEA 3BG3A 1R9TJ 1ZQ3P 2MW8A 1K83J 2LLKA 3QQAA 1ETKA 3HOZJ 2O8KA 4BY1J 1TWFJ 1NK3P 2DMUA 2Y30A 4A69C 1LE8B 3JR9A 1WPKA 2FQ4A 2K40A 2WB1N 3HOYJ 3OSGA 1OFCX 2M34A 4A3LJ 5FKOA 2G0EA 1U9NA 4X1EA 2HOSA 2O7OA 2IAIA 3HDDA 3HM5A 4D5CA 3DEWA 1FJLA 2CRGA 1F43A 4RBOA 3ZQIA 2R5YB 5C44J 2PMZN 4IHWA 3CCYA 4DZPA 1B8IB 1ZTRA 4FE4A 2JA6J 2E2IJ 3BTIA 4A3KJ 3HKZN 3G1MA 4MO7A 4A3JJ 1FTTA 1JKOC 4AUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3N A;  3BR6 A;  3K7A J;  3BR0 A;  1SFO J;  2R0Q C;  3ZQH A;  2DA5 A;  3BR2 A;  3K2A A;  5E3L A;  3PO3 J;  4A3M J;  2CUE A;  4DZJ A;  1W0T A;  3D1N I;  2EQR A;  2CUF A;  4Y7N J;  1LE8 A;  1MBH A;  4MIM A;  1G2H A;  2AO9 A;  5JLX A;  3PO2 J;  3A01 B;  1MSE C;  3H0G J;  2E2H J;  1HDD C;  1ITY A;  3S1N J;  1Y1V J;  1PUF B;  1AHD P;  5EZG A;  1ZGW A;  1XS9 A;  3M4O J;  3ZQL A;  1HDP A;  1BJZ A;  3CDL A;  5EYR A;  3M3Y J;  2X6O A;  5FLV A;  5EGO A;  5FKL A;  5FKN A;  3S2D J;  3MKL A;  2TCT A;  1ETY A;  5F0F A;  5J1U A;  5J1Y A;  2TRT A;  2LR8 A;  4DYR A;  2M9H A;  1POG A;  2EZK A;  5DTD A;  4RDU A;  2XSD C;  3HEF A;  3S17 J;  1ZR4 A;  2E19 A;  2HDD A;  1Y1W J;  5K7Z A;  2DMQ A;  1IDY A;  3SFI A;  1P7J A;  2LD5 A;  5J1R A;  1TWC J;  2P81 A;  5M3M J;  5HOD A;  4D5F A;  1APL C;  4GFB A;  5IYD J;  3HGG A;  2VI6 A;  1ZK8 A;  3FIS A;  3IH3 A;  4I6Z A;  1XG1 A;  1GT0 C;  3S16 J;  4G12 A;  5F0H A;  3HOW J;  1JJ8 C;  3GTP J;  2L7M P;  3ZQG A;  2XPW A;  2NVY J;  3G1O A;  2QF7 A;  1WH5 A;  5M5Y J;  5EDN A;  4BY7 J;  1RKW A;  5EEA A;  2DJN A;  5E3M A;  3H3V K;  1I50 J;  4EEF G;  3BT9 A;  1JUP A;  1GV2 A;  2VUM J;  3A02 A;  2DA1 A;  1JT0 A;  3RZO J;  2N8G A;  2LY9 A;  1AKH B;  2B63 J;  2Y31 A;  2LFB A;  3QPL A;  2XB5 A;  3FIW A;  1OCP A;  2JMW A;  5E3O A;  5GPA A;  3S14 J;  5M5X J;  2DA6 A;  3GTM J;  4IHX A;  1NK2 P;  2JA5 J;  4JP0 A;  1UHS A;  5IP9 J;  5FJ8 J;  4A3F J;  4S0H B;  4MLO A;  3Q3S A;  5C3E J;  4A3G J;  3NAU A;  4M3B A;  1OCT C;  1ETX A;  1FTZ A;  1WCM J;  3RZD J;  4IHV A;  1JKQ C;  4FCY A;  4JX6 A;  1BW5 A;  1HLV A;  1X58 A;  1MBJ A;  1T56 A;  3JRA A;  2Y9Z A;  4CYC B;  1IC8 A;  1BL0 A;  1MH4 A;  4M3F A;  4B1R A;  3LSP A;  5IOY A;  1TWG J;  2JJ7 A;  1B72 B;  2I10 A;  2XRL A;  2ELK A;  4NDL A;  3LSR A;  1RKT A;  1MBG A;  2LKX A;  3TED A;  3GTO J;  3GTJ J;  2HI3 A;  1FIA A;  2NVQ J;  2FX0 A;  3BTC A;  1RES A;  2YS9 A;  2HOA A;  1U78 A;  1X2N A;  1VND A;  2COB A;  1T33 A;  4W97 A;  4J19 A;  3GTQ J;  1UG2 A;  2LVS A;  1B72 A;  3I4N J;  1DU6 A;  3B6A A;  2W48 A;  5C4X J;  4DYQ A;  2E1O A;  2K9Q A;  4CYC A;  3BQZ A;  1QVT A;  1PUF A;  5F08 A;  1IUF A;  2KT0 A;  4DYC A;  3OOU A;  2FJ1 A;  4MFE A;  2O9L A;  4UUT A;  2ME0 A;  5EG0 A;  3MVP A;  4I76 A;  3HOV J;  2AHQ A;  5BNG A;  1HOM A;  2FD5 A;  3SJM A;  1ETV A;  4XID A;  3DCF A;  2DA7 A;  4M3E A;  4C3I J;  4DW6 A;  2VKE A;  4MFD A;  2LK2 A;  4QTR A;  5IYC J;  1IG7 A;  1XC5 A;  3A03 A;  2Y0S N;  4M6V A;  4UUS B;  2NS8 A;  2OPT A;  2JA8 J;  1ENH A;  1E3O C;  3JRC A;  2L9R A;  4A3I J;  2ZB9 A;  2IEK A;  4FTH A;  1FEX A;  1X2M A;  3BR5 A;  5IP6 A;  2NOG A;  5GP9 A;  2VKV A;  3E7L A;  1MH3 A;  1IGN A;  4C2M J;  4ABZ A;  3MN2 A;  5J3L A;  1ORK A;  3JRG A;  4L5E A;  4XRM A;  1RR7 A;  1D5Y A;  2E2J J;  4XIC A;  1LFU P;  3Q0V A;  3QPS A;  4AYB N;  3LNQ A;  4A93 J;  3Q0W A;  1GDT A;  2L7F P;  2NS7 A;  3TP3 A;  1RPW A;  2QCO A;  2H8R A;  1JTY A;  2CU7 A;  5F27 A;  1JGG A;  1QVU A;  1EF4 A;  3FK7 A;  1HF0 A;  4IHY A;  5IP7 J;  2R93 J;  4C3J J;  2DA2 A;  5K7H A;  1WH7 A;  1OJL A;  2HYJ A;  2M2E A;  3WHC A;  2R5Z B;  3OIO A;  2DMN A;  3JRD A;  1IV6 A;  4BBS J;  2ID6 A;  4LOC A;  3BTL A;  5IOZ A;  1JKP C;  4M3D A;  3OSF A;  2HOT A;  1W0U A;  3JRH A;  4B4C A;  3HOX J;  1YRN A;  1VF9 A;  9ANT A;  1GVD A;  2KDZ A;  3GTK J;  1JT6 A;  2DMT A;  2LTP A;  1ETO A;  3SDG A;  1Z0X A;  3A01 A;  2GLO A;  2LP0 A;  4JX4 A;  2YU9 J;  5IYB J;  3NAR A;  2X9D A;  2ECC A;  3RQI A;  3G1L A;  2DTZ A;  3FK6 A;  2L7Z A;  3BQY A;  3IH4 A;  3TW6 A;  4B3A A;  5FLM J;  3BR3 A;  1K61 A;  2IBD A;  1ETQ A;  2DA4 A;  3TW7 A;  3BR1 A;  5F1J A;  4JYK A;  2ECB A;  2K9N A;  5EF6 A;  2JK3 A;  3B6C A;  4Y52 J;  3IV5 A;  2EBI A;  2XGC A;  3FKI J;  5FKM A;  4UUS A;  3S15 J;  1TWA J;  1AKH A;  1U8B A;  2Y2Z A;  4D7N A;  5M3F J;  5C4J J;  3HB9 A;  1IRZ A;  2RAE A;  1QPI A;  3I4M J;  5JLW A;  1NTC A;  2MG4 A;  3BG9 A;  1TC3 C;  4X6A J;  5M5W J;  1H89 C;  4FIS A;  2HXI A;  1FIP A;  3C2B A;  5EG0 B;  3WHB A;  1AU7 A;  2CQX A;  4HNV A;  1I6H J;  2GM4 A;  3GTL J;  1I3Q J;  2D5V A;  1MBK A;  4AC0 A;  5GPC A;  1CQT A;  4D7M A;  3L1P A;  3HOU J;  3RKQ A;  3S1Q J;  2GBY A;  2JWT A;  1F36 A;  1GV5 A;  2EZH A;  2VPR A;  1A5J A;  1HCR A;  4C3H J;  3JRI A;  1S7E A;  2MGQ A;  3ZQF A;  4XK4 A;  3W6V A;  2XGD A;  2R92 J;  4V2F A;  1RET A;  1A6I A;  1MSF C;  1ETW A;  2DA3 A;  1LFB A;  1IJW C;  4XRS A;  3CMY A;  2DMP A;  2L0K A;  2WV1 A;  3IH2 A;  4M3G A;  1SAN A;  1TWH J;  3BG5 A;  3LSG A;  2R7Z J;  1ZR2 A;  1P7I A;  2HQ5 A;  2Y9Y A;  4W1U A;  3ZOB A;  3O8H A;  4QSH A;  1H8A C;  1H88 C;  1MNM C;  2NVX J;  3PM1 A;  2M8G X;  2JA7 J;  2YUS A;  4V2G A;  2WAQ N;  2H1K A;  1IDZ A;  1UMQ A;  1MBF A;  3HBL A;  3VPR A;  5IPA A;  2JN6 A;  4A3D J;  2EZI A;  1DU0 A;  3F0C A;  4A3E J;  2EZL A;  1Z77 A;  1BA5 A;  2DN0 A;  2XPU A;  3O8G A;  1WI3 A;  2XPV A;  1VFC A;  1O4X A;  1JKR C;  4BBR J;  3S1R J;  1B8I A;  1WGX A;  3JRE A;  2R5Y A;  2CQQ A;  4FE7 A;  4BXX J;  3ZQC A;  1JJ6 C;  2XB0 X;  3JRF A;  2HXO A;  1GUU A;  2OF7 A;  5FKK A;  3HGY A;  2XGE A;  3GTG J;  3GBG A;  2ID3 A;  1VI0 A;  1JUS A;  4BKX A;  5F04 A;  1Q1V A;  4A3C J;  3UKG A;  2CJJ A;  3TP0 A;  1QRY A;  3S1M J;  4XRS G;  2K9S A;  3S2H J;  4JX5 A;  2M0C A;  3JRB A;  1YRN B;  5DS9 A;  1BW6 A;  3CQZ J;  3Q0U A;  2ME6 A;  1ZKG A;  2EH3 A;  5K7F A;  1JUM A;  1U9O A;  1JTX A;  2MSY A;  2X48 A;  3LOC A;  5F0C A;  5EGO B;  5EZH A;  4A3B J;  3LSJ A;  4QIW N;  2R5Z A;  3BTJ A;  4IEJ A;  2NVT J;  1MBE A;  3BG3 A;  1R9T J;  1ZQ3 P;  2MW8 A;  1K83 J;  2LLK A;  3QQA A;  1ETK A;  3HOZ J;  2O8K A;  4BY1 J;  1TWF J;  1NK3 P;  2DMU A;  2Y30 A;  4A69 C;  1LE8 B;  3JR9 A;  1WPK A;  2FQ4 A;  2K40 A;  2WB1 N;  3HOY J;  3OSG A;  1OFC X;  2M34 A;  4A3L J;  5FKO A;  2G0E A;  1U9N A;  4X1E A;  2HOS A;  2O7O A;  2IAI A;  3HDD A;  3HM5 A;  4D5C A;  3DEW A;  1FJL A;  2CRG A;  1F43 A;  4RBO A;  3ZQI A;  2R5Y B;  5C44 J;  2PMZ N;  4IHW A;  3CCY A;  4DZP A;  1B8I B;  1ZTR A;  4FE4 A;  2JA6 J;  2E2I J;  3BTI A;  4A3K J;  3HKZ N;  3G1M A;  4MO7 A;  4A3J J;  1FTT A;  1JKO C;  4AUX A; 
#chains in the Genus database with same CATH topology
 1D8K A;  3PFI A;  3BR6 A;  2V6E A;  1SFO J;  1HKQ A;  3OYB A;  3BR2 A;  1CGP A;  2GOX B;  3K6G A;  3PO3 J;  2M3A A;  4F91 B;  4DZJ A;  4P96 A;  2EQR A;  3SEZ A;  2KIU A;  2MH2 A;  1B6A A;  4P55 A;  1MBH A;  4RAZ A;  3PO2 J;  5HS9 A;  3RI4 A;  3FXJ A;  4F3Q A;  4G7Z F;  1K4S A;  3S1N J;  5ICC A;  2E7W A;  3FHN A;  2HWV A;  1XS9 A;  2Z33 A;  2V9V A;  1HDP A;  3CMM A;  3OS2 A;  5EEG A;  4CXF A;  3RPU A;  3FM5 A;  1T38 A;  5DUK A;  3MKL A;  1HW5 A;  3RKW A;  2W85 A;  4RM3 A;  4A6E A;  3OYH A;  1K79 A;  1QBJ A;  2DPU A;  5DD4 A;  2DFE A;  1DUX C;  1OYY A;  3NEU A;  2QYO A;  1B9N A;  2TRT A;  1Y39 A;  4DYR A;  4E4H A;  2NXN B;  1K6Y A;  2E19 A;  5D5W B;  2K85 A;  5L3C A;  2HDD A;  1Y1W J;  2DJI A;  5L3B A;  3G71 I;  1P7J A;  1QU3 A;  4I02 A;  1KA8 A;  2WY8 Q;  5DV5 A;  5H6R A;  1TWC J;  2KJB A;  1KGS A;  5HOD A;  1D1B A;  3VYR B;  2A6H F;  4GFB A;  1UHM A;  4R1H A;  3HGG A;  2R7S A;  3FXU A;  2VI6 A;  3WTU C;  4YIF A;  3FIS A;  3IH3 A;  1R1T A;  4BNC A;  1JJ8 C;  1FPQ A;  4II3 A;  3ZQG A;  1HW1 A;  4ZDO A;  5J40 A;  4RGX A;  4IPA A;  1Z05 A;  1HBX G;  2Z9O A;  4LG0 B;  2O0Y A;  5EEA A;  2DJN A;  3ABL H;  1QHH D;  1KU2 A;  4OAZ A;  3RYR A;  4EEF G;  1P4X A;  3N4M A;  1JUP A;  1LEA A;  2KZG A;  3LSI A;  2DA1 A;  1P6R A;  2N8G A;  4ZC3 A;  1BR2 A;  5CQE A;  2LY9 A;  2KLO A;  3N97 A;  3FMR A;  4I98 B;  3K69 A;  5D5V B;  2B63 J;  1O3Q A;  2Y31 A;  2LFB A;  5J6X A;  1H9T A;  2UZK A;  1VQ4 I;  3VEP A;  1BJA A;  2VJ4 A;  3FIW A;  1YIJ I;  2JPB A;  5E3O A;  1BC8 C;  3GTM J;  4IHX A;  1NK2 P;  5IP9 J;  2GXG A;  3D5R C;  1KQ8 A;  1E3P A;  3K70 C;  4M3B A;  5KVR A;  2QM3 A;  4ZZD A;  3MAJ A;  3RZD J;  4FCY A;  1IZ1 A;  1HLV A;  4BAY A;  3GLL A;  2PMZ A;  2OU2 A;  5TGT A;  1J5Y A;  3S3N A;  1Z21 A;  3K9T A;  3QYB A;  3GFM A;  3NQO A;  4M3F A;  3OYF A;  1XB4 A;  1IN6 A;  4B1R A;  3L09 A;  1W4M A;  1VQM I;  3CCJ I;  1U0J A;  3SFZ A;  2EB7 A;  2E5Z A;  2ELK A;  3LSR A;  2XAH A;  1N25 A;  2A5Y B;  2IS1 A;  2E7X A;  1FIA A;  2DT6 A;  1RES A;  3OYG A;  3GZN B;  1YJ9 I;  3IAS 2;  4MHG A;  3GVA A;  3J7A Y;  3MZ8 A;  1XGO A;  2COB A;  3FKJ A;  1T33 A;  5F6F A;  3CCS I;  1OYI A;  3GTQ J;  3MZH A;  1B72 A;  3I4N J;  4U7B A;  1MJA A;  5CJ9 A;  5IT9 K;  2OZ6 A;  1IN5 A;  2F4O B;  3QP5 A;  2DOF A;  3LSK A;  1OR7 C;  3W2W A;  2MD5 A;  2K9Q A;  4XOR A;  5HS8 A;  3RIR A;  4CYC A;  3DLA A;  2CQN A;  2DQL A;  1K78 A;  3OL4 A;  5F08 A;  1IUF A;  4KMU X;  1USS A;  2W25 A;  1IXR C;  2RNJ A;  2VJ5 A;  2V26 A;  1LPQ A;  5EG0 A;  1P4W A;  4GYG A;  1WJC A;  2XDV A;  1O3S A;  2R7U A;  4XM3 A;  3CDI A;  2AQF A;  1VQO I;  4I0B A;  2M5W A;  2W00 A;  1OLT A;  1XN7 A;  4ZZL A;  5LHG A;  1HOM A;  5J4Y A;  3TO9 A;  4ZH4 F;  2W57 A;  3SJM A;  2Z99 A;  4M3E A;  4NB5 A;  4U0W A;  3BWG A;  3HSR A;  1BR1 A;  1EH6 A;  2LRE A;  4H4K C;  2G7H A;  1XC5 A;  2OC6 A;  3KYC B;  4M6V A;  4AYB A;  4HF1 A;  3TMO A;  2A05 A;  2NS8 A;  2VC0 A;  4XNF A;  3BCB A;  3JRC A;  1JHH A;  1HKS A;  1R1V A;  4HW0 A;  2KJC A;  5ICG A;  3PIO F;  4FTH A;  2HS5 A;  1FEX A;  3L2R A;  4C2U A;  1X2M A;  2MC4 A;  2W84 A;  1NG6 A;  3P9K A;  2P7V B;  5GP9 A;  3QOP A;  1MH3 A;  5CYV A;  5LGU A;  4S04 A;  2GXB A;  2NOJ B;  3L2V A;  1WJE A;  2A61 A;  5K5O A;  3BRO A;  2L9V A;  2BZT A;  3MEX A;  4I0A A;  3BOQ A;  1F1Z A;  2M7B A;  2RNG A;  1OPC A;  1LDJ A;  2XF5 A;  5CKT A;  3W6J B;  3ZXS A;  2L2O A;  5FLX Z;  4ON0 A;  2KQR A;  2XC7 A;  4GYI A;  4EJV A;  2LYC A;  4HG2 A;  2QCO A;  1JTY A;  5F27 A;  1J59 A;  1QVU A;  1EF4 A;  3R6S A;  4XLE A;  5E20 A;  3CO7 C;  4TV7 A;  1HF0 A;  4C3J J;  1PP8 F;  1HA8 A;  3CCV I;  2Z3Y A;  1A36 A;  2I8D A;  3V7S A;  4YFN F;  3GEZ A;  5HDK A;  3WHC A;  4E7Z A;  3N05 A;  2O6G E;  2PFB A;  2F48 A;  1UHW A;  2O03 A;  5IOZ A;  3SEQ A;  3K2Z A;  1O3R A;  1FYL A;  3AKZ A;  3OSF A;  3IUO A;  4IQ4 A;  4L9J A;  1R36 A;  2DYR H;  3KIO A;  1YRN A;  2FML A;  4A2U A;  1FBQ A;  2BHZ A;  2KRC A;  4U87 A;  2F6C A;  3ISP A;  4QPO A;  1U5T B;  3HRS A;  4UB6 C;  2X9D A;  2CS3 A;  3FK6 A;  1IG7 A;  2F5C A;  2K27 A;  3OYE A;  3BR3 A;  4IHT A;  4U0V A;  1KU7 A;  4ANJ A;  2YU3 A;  3RQ4 A;  2FUG 2;  5D5U B;  2WC2 A;  3FKI J;  5LEK A;  4UUS A;  4IHS A;  3ERM A;  1U8B A;  3E0J B;  4BHB A;  1L0O C;  4JBA A;  3HB9 A;  2M8E A;  3GYH X;  4IRH A;  1IRZ A;  1V4R A;  5D5X B;  4XRF A;  4X6A J;  2VQC A;  1NG7 A;  4RLF A;  5M5W J;  2DDB A;  4A5N A;  2O3F A;  4V19 K;  2K9L A;  1OCZ H;  5ILU A;  2VE9 A;  2M45 A;  5EG0 B;  4FQG A;  1FOK A;  2Q0O A;  3WHB A;  1FT9 A;  2DI3 A;  3KCC A;  2K5C A;  5AIP A;  1STZ A;  4KNY A;  5DCF A;  3I55 I;  2OUM A;  3CP2 A;  4HNV A;  2EA4 A;  6PAX A;  2R7T A;  2GM4 A;  5FGM A;  3KYD B;  1RIO H;  4BHC A;  5JI6 A;  3KYL A;  5GAH J;  5BOX A;  2DFI A;  4A12 A;  4Y3O A;  3OL3 A;  1VTN C;  2JWT A;  3ZN0 A;  2LC2 A;  1SAX A;  1W7P D;  2ZFW A;  4N9I A;  1NH3 A;  1HCR A;  1ZGJ A;  1YHQ I;  4B47 A;  2K4B A;  4RAF A;  4XK4 A;  1MSF C;  2KKO A;  3J80 K;  2MH9 A;  3TDU C;  1LFB A;  3CCQ I;  3BY6 A;  4B43 A;  5D4S A;  1SAN A;  3IH2 A;  4HLX A;  2MLK A;  4M3G A;  2BVM A;  4HDV A;  2OTL I;  5FLX K;  4BU2 A;  3I4P A;  2R7Z J;  2HQ5 A;  3S93 A;  3E3V A;  1HSJ A;  3HRM A;  4G7H F;  2HQR A;  4LD5 A;  3O8H A;  1EH7 A;  3PQJ A;  1GHC A;  1H8A C;  3BJO A;  4L9T A;  2NVX J;  3U9G A;  2IW5 A;  2JA7 J;  3QOE A;  4JQF A;  1JXS A;  3AG4 H;  2YUS A;  1IDZ A;  4M73 A;  3E6C C;  2O61 A;  4RAG A;  3VPR A;  3I3L A;  3KZY A;  2QQA A;  3FMQ A;  1XSV A;  3D0S A;  5HLT A;  2BHY A;  2H94 A;  2VXD A;  2R7R A;  2EZL A;  3M8F A;  1Z77 A;  2DN0 A;  3S2W A;  3R61 A;  2XPU A;  2YPR A;  1U8R A;  1T0F C;  2XPV A;  1LJ9 A;  2VQG A;  2MFZ A;  1O4X A;  3CDH A;  1MMN A;  1B9M A;  3S1R J;  5HNH A;  1R1U A;  1WGX A;  3SHF A;  4CIC A;  3JRE A;  3IWZ A;  3DBH B;  4FE7 A;  2B7E A;  2CFO A;  2P5L C;  2W82 A;  2HXO A;  2JRT A;  2X6X A;  3WTT C;  5JVT A;  4UHT A;  4O5V A;  1SFK A;  4BEH A;  3TOA A;  4Z2Y A;  4FT8 A;  3CCL I;  3ZMV A;  3DWL E;  3GBG A;  1VI0 A;  3DKX A;  3C2H A;  5F04 A;  4IVN A;  2JZY A;  2R7D A;  3UKG A;  2CJJ A;  3TP0 A;  2G9W A;  3S1M J;  4XRS G;  2B9S A;  2P4W A;  2YX4 A;  2M0C A;  4E7I A;  1XGS A;  3W6K B;  4S05 A;  2EH3 A;  5J8F A;  5K7F A;  3QU3 A;  3CUQ B;  2BV6 A;  5HLH A;  3HSE A;  4OIQ F;  5EZH A;  4CCO A;  4K2E A;  4DOZ A;  2LKS A;  3BTJ A;  4IEJ A;  2NVT J;  3HOT A;  4KFC A;  3MMY B;  4OIR F;  1BI2 A;  1IN4 A;  2MW8 A;  5DYM A;  1I27 A;  1KON A;  3W2V A;  3H9Q A;  3VYT B;  5LGT A;  2O8K A;  2ISZ A;  4BY1 J;  2IGN A;  1S7A A;  2DMU A;  2Y30 A;  2W24 A;  4LMY A;  5FB2 A;  3WTY C;  1P9Q C;  1T08 B;  1ULY A;  2K40 A;  3DPU A;  2HGC A;  3OSG A;  4BHP A;  5FRO A;  2HOS A;  1ACI A;  1U9N A;  1FX7 A;  4BQN A;  4HLY A;  3ESW B;  3HDD A;  1F43 A;  2CRG A;  2DOD A;  2ELJ A;  1WJA A;  5C44 J;  1R23 A;  1I6X A;  3CCY A;  1W5S A;  2VKD A;  1B8I B;  2XKO A;  5K5R A;  1X19 A;  4XKV A;  1ZRE A;  3CZ6 A;  3OR1 C;  3V42 A;  5F1R A;  4A6D A;  4PGG A;  1BI1 A;  4YEJ A;  4BJT A;  2Y0M A;  4XN3 A;  5AON A;  4A3J J;  4XLC A;  3HUG A;  4PDK A;  3K7A J;  3ZQH A;  1M1E B;  3K2A A;  1XGM A;  3ASN H;  1E2X A;  4G8X A;  4MQ9 F;  3AAF A;  1E17 A;  1G3T A;  3RKX A;  1IN8 A;  3OMY A;  5DCM A;  4RB1 A;  1TTY A;  3KLO A;  1E3H A;  2HDC A;  3MKY B;  3H0G J;  3TDZ C;  1UJ8 A;  1HDD C;  3OYL A;  2E2H J;  4RB0 A;  1Y1V J;  2WTE A;  1DP3 A;  5LD2 C;  1ZGW A;  1SVO A;  2RQQ A;  5B1A H;  3VYS B;  1D1C A;  5FLV A;  2VB6 A;  3VDX A;  4PGH A;  5FKL A;  5FKN A;  3OYJ A;  5F0F A;  5J1U A;  3K4L A;  1FWZ A;  1S29 A;  2NS0 A;  3QOD A;  2X6W A;  3K4C A;  2LR8 A;  1BIA A;  3SZG A;  4WF2 A;  2OJE D;  1XPX A;  4EJT A;  4P9F A;  1D3Y A;  5K7Z A;  2RRE A;  2ZCW A;  2Z5U A;  4XN0 A;  2PJR A;  4MEY F;  4PJN A;  1WHU A;  3OYK A;  4HPQ A;  2NAZ A;  1KQ9 A;  4GGG A;  3CUO A;  1FBU A;  2QQ8 A;  1APL C;  2E1C A;  2CV1 A;  1TT5 B;  3LL7 A;  1YJW I;  1YW7 A;  3QPH A;  3TBI A;  1ZK8 A;  3ECO A;  2CG4 A;  1XG1 A;  1V55 H;  3C3W A;  1GT0 C;  3S16 J;  3F6V A;  3HOW J;  2MLG A;  1R4N B;  5HLG A;  2L7M P;  1KZH A;  3D5S C;  2QKM B;  3T8R A;  2DT5 A;  1IO2 A;  2NVY J;  3G1O A;  4CCM A;  5M5Y J;  2JQ7 A;  2L54 A;  1RKW A;  3H3U A;  1A31 A;  1EJ9 A;  4CGZ A;  4UB8 C;  1I50 J;  3WE2 A;  4IO9 F;  3GWZ A;  3GME A;  4HZF A;  4GCV A;  3EUA A;  3A02 A;  4EQQ A;  1JT0 A;  3ZMT A;  5K1Y A;  5E79 C;  4ZYA A;  5B1B H;  1W5T A;  1I5Z A;  3A4C A;  3QPL A;  1K6O A;  1OCP A;  2JMW A;  2V7F A;  4RS8 A;  4LG0 A;  1VQ7 I;  1QPM A;  2DA6 A;  4EJU A;  4OOI A;  3I71 A;  5FJ8 J;  4MLO A;  3NAU A;  3W2A A;  3LSH A;  4G7O F;  1WCM J;  4IHV A;  2GA2 A;  1JKQ C;  3PSF A;  3E6D A;  4P5O A;  1T56 A;  3J7Z I;  3JRA A;  3KX2 A;  1WJB A;  4WCG A;  3DPL C;  3QAH A;  2IGM A;  4KT5 C;  3WG9 A;  1ON1 A;  4I7H A;  1TWG J;  2JJ7 A;  2BYV E;  2XRL A;  3CF2 A;  2KRH A;  3TED A;  3GTO J;  4IJA A;  3WG7 H;  3GTJ J;  2NVQ J;  1IRG A;  2YS9 A;  4CCK A;  3M8J A;  2HOA A;  2BVL A;  2VOO A;  2UV1 A;  1U78 A;  3KP5 A;  4KIF A;  2LNB A;  1MGT A;  1VND A;  1PP7 U;  3TO6 A;  4RM2 A;  4BYY A;  2BXZ A;  2FNA A;  4XKC A;  2W4S A;  2CW7 A;  1G8X A;  3LSM A;  2R7O A;  1YYV A;  2VQH A;  4L5I A;  5C4X J;  3Q9S A;  3CUQ C;  4MEX F;  3BQZ A;  2FNP A;  1QVT A;  1PUF A;  4XLN F;  3ZPL A;  3LWF A;  4L5J A;  2E1N A;  3ZP5 A;  2FJ1 A;  5ILS A;  4MFE A;  2RN7 A;  1D5V A;  2O9L A;  2ME0 A;  3E97 A;  3MVP A;  4E70 A;  1OKR A;  1OIS A;  4OMZ A;  4XQF A;  2JUG A;  2X1E A;  2AHQ A;  4Q5S F;  5HLI A;  1Z7U A;  1RUN A;  2FD5 A;  1ETV A;  2ICW G;  3BP8 A;  1MW7 A;  2D2W A;  2WA0 A;  3GZ6 A;  2HVR A;  4QTR A;  3OV8 A;  5IYC J;  3CD6 I;  2QSG X;  2EV5 A;  4UUS B;  2OPT A;  2JA8 J;  4LIT A;  3C18 A;  2PI0 A;  4AIH A;  2V1D A;  3T0Y A;  2QBY A;  4A3I J;  4WWC A;  4NQW A;  3SYT A;  1X1C A;  4L9N A;  2RDP A;  3AFH A;  3BJA A;  2NOG A;  1IN7 A;  3E7L A;  5LHI A;  3J81 Z;  1TBX A;  3TKY A;  4ZYE A;  4C2M J;  3ZQQ A;  2A3S A;  2ZNY A;  2XGX A;  2E5N A;  2A6T A;  3RYP A;  3CCE I;  3CC7 I;  1BIB A;  4L5E A;  4WXC A;  4XRM A;  3JRG A;  1RR7 A;  3VYU B;  4AIK A;  3Q0V A;  1GXQ A;  3ZGK A;  1ZGA A;  3LNQ A;  3L2Q A;  3IAM 2;  3DEE A;  3R0A A;  4A93 J;  3A2K A;  4HDU A;  1GDT A;  2L7F P;  2NS7 A;  1EV7 A;  3J81 K;  1ZG3 A;  1OCC H;  3BDD A;  3I53 A;  5IP7 J;  2R93 J;  5LRR A;  1FOX A;  4G6D A;  2HYJ A;  3F21 A;  2VIX A;  3EYI A;  4BAC A;  2R5Z B;  4ENK A;  2EK5 A;  2A68 F;  3S8P A;  3K70 D;  3BTL A;  4EMS A;  1JKP C;  2FEZ A;  3J7A O;  3H35 A;  3JTH A;  2GZW A;  3FXM A;  3DTK A;  4HF2 A;  5DDG A;  3JRH A;  5ED4 A;  2EWN A;  5FRN A;  1R6R A;  4RB3 C;  2PEX A;  2MAB A;  2ZFU A;  1RRJ A;  1TW3 A;  2M7A A;  5CVV A;  3HL2 A;  3CO6 C;  9ANT A;  2V1N A;  2X6Y A;  3K4N A;  2KDZ A;  2DMT A;  1K7A A;  3SDG A;  2GLO A;  2LP0 A;  1FOY A;  3VOD A;  3ERE D;  2ZXW H;  4BDZ A;  2K4J A;  4C2T A;  5IYB J;  2JUC A;  4KIB A;  2DTZ A;  4B3A A;  4EM1 A;  3OY9 A;  2JPC A;  5FO5 A;  3DFG A;  2VAS A;  2IBD A;  2DA4 A;  3TW7 A;  1X1A A;  5ICE A;  4Y52 J;  3IV5 A;  5E18 F;  2VC1 A;  1AKH A;  3IRQ A;  4PJJ A;  1FSE A;  1ZEL A;  1ZLJ A;  2BY3 A;  3PQK A;  3I4M J;  1I39 A;  2VJI A;  4CH7 A;  3VSK A;  1H9G A;  4FIS A;  3LQR A;  2F4I A;  2HXI A;  4XSZ F;  2VT3 A;  4CZZ A;  2X0L A;  3C2B A;  4HV6 A;  1TZL A;  4LK1 F;  4C9Y A;  1LVK A;  4XLA A;  2EPF A;  1MD0 A;  3IKT A;  3KPH A;  1SD4 A;  2Z1D A;  3FXK A;  1AU7 A;  2CQX A;  1K78 B;  1I6H J;  2QZ8 A;  4I09 A;  1R5H A;  1TQM A;  3GTL J;  4MTE A;  1W36 C;  2D5V A;  4AC0 A;  2Q2E A;  1IUY A;  4WXD A;  4AM3 A;  1CQT A;  4D7M A;  2F5D A;  3L1P A;  4F52 A;  3FXQ A;  3RKQ A;  3HOU J;  3TOB A;  3ZR8 X;  2F5F A;  3JSO A;  4QPQ A;  3FHZ A;  1SD7 A;  3RSN A;  1GV5 A;  2EZH A;  1WWX A;  2VPR A;  3I64 A;  3OWT A;  4EV0 A;  1A5J A;  4H0E A;  3MFK A;  2BE5 F;  1S7E A;  2MGQ A;  2Z2S B;  2ZSI B;  4BE0 A;  3KP6 A;  2XRO A;  1FSH A;  5EJC A;  3V4G A;  4V2F A;  2MA3 A;  2P8T A;  3O6B B;  1XCV A;  2ZME A;  2M87 A;  1IJW C;  2P6S A;  2M4K A;  4Q48 A;  1TWH J;  1D0X A;  4ZDL A;  4EVI A;  2FU4 A;  4PFP A;  4IRI A;  1P7I A;  1MJB A;  4HV5 A;  3R0J A;  3J7Y J;  3L2W A;  1WZ2 A;  3ZOB A;  2O8X A;  5KHD A;  1OR7 A;  1P2F A;  3E6B A;  4IKF A;  2JVG A;  1H88 C;  1MNM C;  3PM1 A;  3OYM A;  1FY7 A;  3KEY A;  4MTD A;  2FF4 A;  4V2G A;  2WAQ N;  2H1K A;  4Y13 A;  5LFA A;  3FX3 A;  2Q8K A;  2LSO A;  5IPA A;  3PFY A;  2OA4 A;  4PFO A;  2JVH A;  4EM0 B;  2EZI A;  4NC8 A;  1LDK B;  3B02 A;  1DU0 A;  3F0C A;  1V54 H;  4JK1 X;  1BA5 A;  1WI3 A;  2WY7 Q;  2DBB A;  5DEQ A;  1MDM B;  2QEX I;  1CF7 B;  3L9F A;  4EJO A;  3V8K A;  1VFC A;  1YS6 A;  1Z3Y A;  4BBR J;  1QO0 D;  1DPR A;  3EUK L;  2R5Y A;  3KZI C;  2CQQ A;  1Z1D A;  3RKY A;  3U2R A;  4BXX J;  3Q9V A;  2L5Q A;  4LLG F;  5LEJ A;  2DFH A;  1ZH5 A;  4PJ0 C;  2M4G A;  2OF7 A;  3PSI A;  5FKK A;  3U1K A;  3WTX C;  5TRD A;  4UUV A;  2ZSH B;  4YRV A;  2XGE A;  3RCO A;  4Y15 A;  2EIK H;  4FX0 A;  4BKX A;  3JTG A;  3JAM K;  3O3K A;  1U5T A;  4HEA 2;  3KZZ A;  3M1E A;  4PJM A;  1YG2 A;  3BZC A;  2LOO A;  4F55 A;  3OYN A;  2OBP A;  2EIJ H;  1D1A A;  3S2H J;  2EJR A;  1HXD A;  4BQO A;  4JX5 A;  1YRN B;  3JRB A;  5DS9 A;  4LGW A;  1ZRC A;  4IL6 C;  2KDO A;  2H27 A;  2IVM A;  5F0C A;  2XAQ A;  3T5X A;  5EGO B;  4LK0 F;  3LSJ A;  1WSU A;  3WGG A;  5GAE J;  5BPI A;  1G59 A;  2G7U A;  2LG4 A;  3G3Z A;  3JAM Z;  3KEQ A;  3QU6 A;  2L9S A;  2H1L A;  2EIL H;  4OIP F;  5DUI A;  3QQA A;  1TLH B;  3CCM I;  3HOZ J;  1QZZ A;  1MKM A;  2ZXH A;  4EM2 A;  1NK3 P;  3FXO A;  3JR9 A;  3CTA A;  5KK1 A;  4YIR X;  2FBH A;  1QQI A;  2LMD A;  4XSX F;  3OYD A;  4XMY A;  3GO5 A;  1QGP A;  1SMY F;  4LB5 A;  1DGW Y;  2IAI A;  2EFO A;  3HM5 A;  4D5C A;  1T2K A;  3AL0 C;  3ZQI A;  2CO5 A;  2W7N A;  1B59 A;  1JHF A;  1O7F A;  2DU9 A;  2IXS A;  4FE4 A;  1XMX A;  1ZRF A;  1R5I D;  2HPM A;  2JA6 J;  1SC7 A;  3DU5 A;  4IQJ A;  3PNY A;  3G6E I;  2HTS A;  3G1M A;  2FMY A;  4MO7 A;  3I54 A;  4FET A;  4AUX A;  2KPM A;  2KIS A;  5E3N A;  1JE8 A;  1NHA A;  3QWL A;  2VBX A;  3E5X A;  2XUB A;  2OCE A;  5H20 A;  4HNU A;  4ZJZ A;  1UEL B;  4IX7 A;  1FC3 A;  4NC6 A;  4L0Z B;  4LIV A;  4F7Z A;  5KCM A;  1T8I A;  1FBS A;  4Y7N J;  4MIM A;  3IRR A;  2WV0 A;  5JLX A;  3A01 B;  4WXH A;  1ONV A;  3ZRG A;  2KRF A;  4XLH A;  2YSR A;  5HDG A;  1YJN I;  3QPT A;  1PUF B;  1AHD P;  3ASO H;  3M9A A;  2L4A A;  3WTZ A;  3ZMZ A;  4CYD A;  1K4T A;  1IAW A;  3CDL A;  5EYR A;  4FHT A;  2X6O A;  2FQ3 A;  3M3Y J;  4EGY A;  5EGO A;  2E1M B;  1JGS A;  4B8X A;  3S2D J;  1XD7 A;  2VL8 A;  4BJ5 C;  1ETY A;  3C7J A;  3HOS A;  4IOA F;  2EV6 A;  3UR3 C;  5JVG F;  3MD2 A;  1J09 A;  2VOP A;  2A07 F;  1F4K A;  3BCA A;  1TNS A;  3HEF A;  4GO1 A;  3V7C A;  5ERI A;  5DM6 F;  1YE9 A;  1XCB A;  3DTE A;  5A2Q K;  4NBQ A;  2CYY A;  2FA5 A;  3G4S I;  2D1V A;  2GWR A;  3EUH A;  2DPD A;  1HC8 A;  1IDY A;  3EPZ A;  4ZYG A;  4OIN F;  2LD5 A;  5J1R A;  3FBI B;  4ITV A;  4HA8 A;  5M3M J;  3A0B C;  1KU3 A;  3A1Y A;  4UV8 A;  4DGW B;  5IYD J;  2E1M C;  1WJ5 A;  1W5C C;  2DTR A;  3OYC A;  3D5L A;  4I6Z A;  3HKZ A;  3VOE A;  2YR2 A;  2IS4 A;  2PBI A;  2IS6 A;  4G12 A;  5F0H A;  3HPH A;  1F5T A;  5E1W A;  4DIQ A;  4IOC F;  2XPW A;  2IS2 A;  2ESH A;  1U2W A;  3MKZ A;  4PZJ A;  5EDN A;  1LEB A;  4XON A;  4I01 A;  4XL9 A;  3CLQ A;  5E3M A;  2AQE A;  5CVI A;  2L02 A;  3K4J A;  2WAE A;  1Z91 A;  4N4N B;  2PQ8 A;  1BC7 C;  3I58 A;  3C2G A;  2ESN A;  1HST A;  2VUM J;  3K0L A;  4AIJ A;  4DQ2 A;  2L7K A;  1L3L A;  4HNT A;  1AKH B;  1WVR A;  3WTV C;  5D8L B;  2XB5 A;  3S14 J;  5GPA A;  2VBY A;  2JA5 J;  5L3G A;  1UHS A;  4A3F J;  4S0H B;  2CUJ A;  5TJJ A;  3Q3S A;  5C3E J;  5HDN A;  1OCT C;  1ETX A;  5JHF A;  1VQK I;  1FTZ A;  2F4M B;  5E1Z B;  5JHU A;  5A2Q Z;  4JX6 A;  1BW5 A;  1YTY A;  4BGD A;  1IXS B;  4CUG A;  1BL0 A;  3VWB A;  3HHH A;  1W36 D;  2IA0 A;  4LLL A;  2A6E F;  2J5P A;  2IGO A;  5IOY A;  5LLQ A;  5HVQ C;  3KEO A;  5BQT A;  1E0E A;  1ON2 A;  5F64 A;  1VQ6 I;  4ZTF A;  1OYW A;  1EA3 A;  2HI3 A;  2L9N A;  2ZO4 A;  4ETS A;  3BZK A;  4UY8 I;  4KJZ A;  1YIO A;  4LB6 B;  1FMW A;  1X2N A;  4YEL A;  2HZD A;  4W97 A;  4J19 A;  2LVS A;  3GUD A;  2DK8 A;  3B6A A;  4RLQ A;  2W48 A;  1YLF A;  1Y0U A;  4DYQ A;  4U0Y A;  1WI9 A;  3O2P E;  4L18 B;  3PIP F;  2L3D A;  2KT0 A;  2CSO A;  4DYC A;  5CVU A;  3HG9 A;  2XSJ C;  2UXN A;  4FX4 A;  3HRT A;  4UUT A;  3DBR B;  5GTH C;  1DDN A;  4G9Y A;  1UB9 A;  2QLZ A;  3HOV J;  4IRG A;  5BNG A;  3NWT A;  2WBM A;  3K1N A;  1Z6T A;  4N4O B;  4E7K A;  1J2X A;  1MIJ A;  3TL4 X;  2QBY B;  2VE8 A;  2CMP A;  3DCF A;  4P1W A;  4C3I J;  4DW6 A;  2OV7 A;  2VKE A;  4MFD A;  2LK2 A;  2VT2 A;  3A03 A;  4CO8 A;  2ADU A;  3BC8 A;  3K4M A;  1E3O C;  1EKE A;  3EUH C;  2ZB9 A;  4BQQ A;  3H5N A;  1I1S A;  2ZJR F;  2AXT C;  1W1W E;  4KA4 A;  2E35 A;  2VKV A;  2H6C A;  2HU9 A;  3PNT A;  1IGN A;  2JA2 A;  4CZC A;  3GFL A;  1WJF A;  1XTA A;  3MN2 A;  5DD8 A;  5J3L A;  4AU7 A;  1C0W A;  1D5Y A;  4J01 A;  2FSW A;  1LNW A;  4XIC A;  2Y69 H;  3OOP A;  2E2J J;  3LA7 A;  1KYZ A;  4D9J A;  1LQ1 A;  4KIS A;  2H8W A;  2UUZ A;  4PSW A;  4LFU A;  2VXZ A;  3H5A A;  2WAQ A;  1P4A A;  5BMZ A;  3F23 A;  3M8E A;  1ZN2 A;  2QEN A;  2A5W A;  2CU7 A;  1JGG A;  4DJA A;  3FK7 A;  2E71 A;  5GTI C;  1R71 A;  2GIV A;  3GZ5 A;  3ZMD A;  2LBF A;  1WH7 A;  1FLI A;  3F8B A;  4EAT A;  1G3W A;  3AG1 H;  1XMK A;  1BOB A;  3I0T A;  4O6J A;  2DMN A;  2GA1 A;  4BBS J;  4LOC A;  3IL2 A;  1Q1H A;  4M3D A;  4HYE A;  5HS7 A;  3SDB A;  4ZDP A;  3GFI A;  1WFX A;  4O3M A;  2OAZ A;  1IW7 F;  4AVZ A;  1V5E A;  2L4M A;  4M72 A;  4B4C A;  3P9I A;  3ZN1 A;  2O5R A;  4CDG A;  3HHG A;  5J4V A;  4HRI A;  1R4M B;  2LTP A;  4HST A;  1OCR H;  5KAI C;  4XR6 A;  2CGP A;  4MQV A;  1SEU A;  2K3P A;  1D0Y A;  3NAR A;  2ECC A;  3G1L A;  1IXC A;  1Z3X A;  2L7Z A;  3IH4 A;  1K61 A;  2E34 A;  2XF6 A;  5L3F A;  3DP7 A;  5EF6 A;  5IT9 Z;  3B6C A;  1QHG A;  2NYX A;  2EBI A;  4X0G A;  5FKM A;  2DW4 A;  3S15 J;  1TWA J;  1Y8Q B;  1ZHF A;  3CJR B;  2Y2Z A;  4D7N A;  2E60 A;  1EH8 A;  1MMD A;  4ASN A;  1XMA A;  1W7P A;  2RAE A;  3CLO A;  5D4R A;  2STW A;  3BG9 A;  2RKH A;  4GXO A;  1SVL A;  5H6Q A;  2HFH A;  1H89 C;  3DXJ F;  3G73 A;  2HYF A;  1FIP A;  2K9M A;  2QVO A;  2QWW A;  1V5F A;  2BOL A;  3RTR A;  2LRD A;  3CF5 F;  1BN5 A;  2UWM A;  2BBY A;  4BDY A;  1BR4 A;  5HOO A;  2EA2 A;  3E5U A;  1S8N A;  4HBL A;  4HX7 A;  1TL8 A;  2FE3 A;  2DCE A;  1OQY A;  2P0W A;  2ZXI A;  1HQC A;  3WU2 C;  5H2F C;  2Q1Z B;  1MBK A;  5GPC A;  4HQE A;  5L3D A;  1X4P A;  2K02 A;  4XKB A;  2HKO A;  3G2B A;  2HDW A;  1XGN A;  3DBL B;  1BI0 A;  3OYA A;  2ACJ A;  1G3S A;  4XOP A;  4Q4Z F;  2FRH A;  2NNN A;  2P6T A;  4MNU A;  3E6M A;  5ILV A;  1D0Z A;  4C3H J;  2ZME B;  3GXO A;  1J9I A;  1RI7 A;  3W6V A;  3CME I;  4L0Y B;  2XGD A;  2R92 J;  1RET A;  1A6I A;  2XAJ A;  1ETW A;  2V4J C;  3P9C A;  3OS1 A;  1YFH A;  1PDN C;  3NWS A;  3GF2 A;  4NC7 A;  1UAA A;  5CVJ A;  1KU9 A;  2ZJ2 A;  2KP6 A;  5CQG A;  4J00 A;  3H92 A;  3RDI A;  1GLN A;  3WOD F;  4IF4 A;  3BG5 A;  2HTJ A;  2R4G A;  3LSG A;  1ZR2 A;  2FOK A;  4ZTJ A;  5DM7 F;  4A0X A;  2J5O A;  3VSL A;  4QSH A;  2I5U A;  4UXN A;  4E7J A;  4AID A;  2VBW A;  1YW8 A;  5DCM B;  2M8G X;  3K1M A;  2WB1 A;  2V1X A;  4KT6 A;  4UNO A;  3S32 A;  1S3J A;  3HBL A;  2V6C A;  3R4K A;  3M7G A;  1Z7L A;  2JN6 A;  2V9K A;  2CW0 F;  4CCN A;  4A3D J;  1IV8 A;  2QQ9 A;  2B0L A;  5D8K B;  3HUG B;  1REP C;  2YX7 A;  2DOE A;  2PX9 A;  4HSR A;  2BY1 A;  3HC7 A;  4KIC A;  2AXL A;  1A35 A;  1ZG1 A;  1B8I A;  2GQQ A;  3V7R A;  2CQK A;  2H09 A;  1FZP B;  2KIM A;  2JT1 A;  2HYG D;  2VBZ A;  2VQL A;  3H5R A;  1ERD A;  2XB0 X;  2NNY A;  3ZMS A;  4R79 A;  5CPR B;  2IA2 A;  1V3F A;  1GUU A;  4II2 A;  3VFZ A;  2HR3 A;  3HZJ A;  4BXU A;  1T98 A;  2JTV A;  3PUB A;  3WGI A;  3H0D A;  1DP7 P;  4LIU A;  3GTG J;  3MZY A;  1JUS A;  3K10 A;  4YG2 F;  2JSP A;  1R5G A;  1AOY A;  4A3C J;  4CCJ A;  2MC3 A;  3GW2 A;  3WE3 A;  2FOW A;  2HZT A;  1FMV A;  2K9S A;  3IP4 B;  4BQA A;  1S72 I;  2BXY A;  2X51 A;  2ME6 A;  1RC9 A;  2BGC A;  4PJL A;  4U7D A;  3GFJ A;  3DKW A;  2KIF A;  1R00 A;  1U9O A;  4U88 A;  1JTX A;  2MSY A;  1YQA A;  2X48 A;  4M74 A;  4A3B J;  4QIW N;  4D1Q A;  2R5Z A;  5FFX A;  2EFW A;  3I9V 2;  1T6S A;  2Y48 A;  4ZYD A;  2DLL A;  1MBE A;  4BH9 A;  3BG3 A;  3X2Q H;  2QUF A;  1ZQ3 P;  4RGS A;  2F5V A;  2OQR A;  1PUE E;  3F8C A;  4NNJ A;  1LUJ B;  4A69 C;  2Q2E B;  1WPK A;  1VZ0 A;  1KYW A;  3PNV A;  3HOY J;  1OFC X;  2PMU A;  2P7C B;  3BPV A;  2QQB A;  5FKO A;  2XIG A;  2O7O A;  4CA0 A;  1SAU A;  3J80 Z;  1OMI A;  1FYM A;  1J7K A;  2HVS A;  1FJL A;  4FAS D;  3FM3 A;  4RBO A;  4BJ6 C;  3L7W A;  3H36 A;  2BEO A;  1Y56 A;  2FBI A;  4IHW A;  1FOW A;  2D45 A;  4DZP A;  1ZTR A;  3ZQ7 A;  3I56 I;  2E2I J;  4KIG A;  3SZP A;  2XRN A;  3BTI A;  4A3K J;  4XLP F;  1W7P B;  1Z6R A;  2NRA C;  1X3W B;  3HKZ N;  4BS9 A;  4M9Z A;  1FTT A;  4XBF A;  2DFF A;  1JKO C;  4IXA A;  4G6Q A;  3BR0 A;  4D0P A;  2R0Q C;  2XAS A;  2DA5 A;  3HIF A;  3H9J A;  5E3L A;  2CUZ A;  4P9U A;  1UFM A;  4A3M J;  2CUE A;  3OR2 C;  4QWQ A;  4OU0 A;  1W0T A;  3MCZ A;  3OS0 A;  3D1N I;  3H9G A;  2CUF A;  5IT3 A;  1RUO A;  3HJE A;  1LE8 A;  1VQ5 I;  1G2H A;  5E8I A;  2AO9 A;  3K1P A;  1MSE C;  1YO5 C;  2LY1 A;  1YOV B;  2XKP A;  1ITY A;  3KP2 A;  1TP4 A;  4ENN A;  2V79 A;  3QYF A;  5EZG A;  2IP2 A;  4E7L A;  3RPU D;  3M4O J;  3CMA I;  3ZQL A;  3KLN A;  1BJZ A;  5CVR A;  2W1O A;  3NRV A;  3H1C A;  1PJR A;  2TCT A;  5JR3 A;  4QLC U;  1XDS A;  4UVB A;  2DAO A;  2HKX A;  5J1Y A;  3DLL F;  4HX4 A;  2BY2 A;  2M9H A;  1POG A;  2EZK A;  5DTD A;  4RDU A;  2XSD C;  3F22 A;  3S17 J;  2LF7 A;  2GIZ A;  2OCC H;  1ZR4 A;  2OQG A;  2RV8 A;  4YII A;  1Y6I A;  2RVC A;  1TNT A;  2DMQ A;  2MD0 A;  2HQA A;  3L00 A;  3TQN A;  4PSX A;  3SFI A;  2GOM A;  2K3F A;  2CH0 A;  4RGR A;  2P81 A;  5BPD A;  4UVA A;  4D5F A;  1G6N A;  2PN6 A;  1X1P A;  1X4O A;  1SFE A;  1FP1 D;  2X4H A;  4OMY A;  5E8G A;  2HNH A;  2XHK A;  4I2O A;  1Z67 A;  3GTP J;  4EJW A;  5E17 F;  2D1H A;  1UST A;  1SD6 A;  2DO7 A;  3HXL A;  2EV0 A;  2QF7 A;  1WH5 A;  3LST A;  4CCL A;  4E6K G;  3LAP A;  4BY7 J;  1O57 A;  2CW8 A;  4C30 A;  3ULQ B;  3H3V K;  1D8J A;  1V5G A;  1TT0 A;  3ECH A;  4Y4R A;  1LFP A;  1GV2 A;  3BT9 A;  3IC7 A;  2CQ7 A;  3RZO J;  2L01 A;  1VQP I;  1G4D A;  2DDA A;  4ENJ A;  3LA2 A;  1WKM A;  3I59 A;  3ZCO A;  1OCO H;  4BXF A;  5D6F A;  4ENM A;  4LLN A;  2CFX A;  5M5X J;  2RC4 A;  4JP0 A;  1O7L A;  2MBF A;  2CWE A;  3SXY A;  1XSD A;  4A3G J;  4CHU A;  2X1D A;  2GXA A;  4I99 C;  2STT A;  2Y75 A;  3L2C A;  2IPQ X;  1X58 A;  1MBJ A;  3HYI A;  3CCU I;  3U21 A;  4CYC B;  2XAG A;  2Y9Z A;  1IC8 A;  1AWC A;  1MH4 A;  3KP7 A;  2LH9 A;  3LSP A;  3S3M A;  2HOE A;  2FBK A;  3WU1 B;  2PJR B;  1B72 B;  3CC2 I;  2I10 A;  4NDL A;  3WGH A;  2VLA A;  1RKT A;  1MBG A;  3EET A;  2LKX A;  2KL4 A;  5CLS A;  1S9H A;  4G6T B;  2FX0 A;  3BTC A;  1ODD A;  2KIQ A;  5KAF C;  4LJZ F;  4A5M A;  2RGV A;  3QRF F;  3PL8 A;  1BOA A;  1BBY A;  4DBQ A;  2Y0S A;  4ZYH A;  3S3O A;  1PVE A;  4XOT A;  2CV0 A;  2VPL A;  1QZE A;  4KN4 X;  4UV9 A;  2EFQ A;  1UG2 A;  3W3C A;  1DGR M;  1DU6 A;  3LMM A;  5FD5 A;  1XDU A;  1QZY A;  4OIO F;  3F8F A;  2E1O A;  2XVC A;  3KE2 A;  4KN7 X;  3FZV A;  3ML6 A;  3AL0 B;  3CJT B;  2ZJP F;  5K5Q A;  3OOU A;  1N77 A;  2EIM H;  2V9P A;  3MQ0 A;  1YI2 I;  4B48 A;  4M9X A;  3LFU A;  4L9V A;  2JRM A;  2R7Q A;  3CP8 A;  2HPI A;  2RQP A;  1MMA A;  1R22 A;  1WRJ A;  2XF7 A;  4I76 A;  4KDP A;  1T95 A;  2BW3 B;  1VQ9 I;  4BE2 A;  1YW9 A;  1YX3 A;  3T8T A;  2H6B A;  4AWX B;  2KMU A;  1B1B A;  1LKX A;  4XID A;  2DA7 A;  2XV4 S;  1S5L C;  2DXI A;  1FYK A;  1F9N A;  2WAD A;  3WTW C;  3KP3 A;  3FF5 A;  4IZZ A;  2Y0S N;  3BZ6 A;  1ENH A;  1YX5 A;  1KQ0 A;  4G94 A;  2LKP A;  3EDP A;  2L9R A;  2VJJ A;  2A69 F;  1R58 A;  2IEK A;  3IWF A;  3OIP A;  5ICF A;  1XX5 A;  3F9K A;  3FWE A;  2E36 A;  1TQP A;  3BR5 A;  1A6Q A;  5AIQ A;  5TIS C;  2KHM A;  2DT7 B;  1FNN A;  2EFN A;  3ONQ A;  4A0Y A;  4BUP A;  5IP6 A;  5IY5 H;  3Q5F A;  3K4K A;  3R60 A;  2CV2 A;  2PMH A;  4ABZ A;  2ZKZ A;  2X1C A;  4Q47 A;  1ORK A;  1MZB A;  1MMG A;  2VOD A;  3I5U A;  2WAF A;  3CJQ B;  2EIN H;  1LFU P;  3QPS A;  4AYB N;  2GAU A;  3COA C;  5LHH A;  1H0M A;  3Q0W A;  5EEH A;  1G3Y A;  3F8N A;  3M07 A;  1SMT A;  3TP3 A;  1RPW A;  2H8R A;  1GVJ A;  3IKV A;  3OIQ A;  4IHY A;  2DA2 A;  4PUS A;  5K7H A;  4M6X A;  4NUB A;  1OJL A;  2M2E A;  3VB2 A;  4B3X A;  3B73 A;  4ESB A;  2OZU A;  3OIO A;  3PUF A;  3JRD A;  4WK8 F;  5JFR A;  2BY0 A;  2ID6 A;  1IV6 A;  1DPU A;  4ESJ A;  2M0M A;  4BE1 A;  2NVU B;  3FXR A;  2HOT A;  1W0U A;  1MND A;  2HVQ A;  4CSW A;  2PG4 A;  3HOX J;  3ROU A;  2K7L A;  3MKW B;  1VF9 A;  4AVP A;  4AD9 A;  2UXX A;  4OWR B;  3BLY A;  1GVD A;  3GTK J;  1TW2 A;  1JT6 A;  3CES A;  3FBN B;  3FXL A;  1ETO A;  3A01 A;  1Z0X A;  3DKY A;  3KP4 A;  2DQR A;  4JX4 A;  2YU9 J;  3GLX A;  3RQI A;  3BQY A;  4F92 B;  3TW6 A;  4N9H A;  2IGK A;  5FLM J;  2IT0 A;  1ETQ A;  2QSF X;  3BR1 A;  4NQW B;  5F1J A;  4JYK A;  2ECB A;  2K9N A;  3LQQ A;  4XLF A;  2JK3 A;  5D6E A;  5B5E C;  1A04 A;  4HQM A;  2XGC A;  4WX9 A;  4E7S A;  2DK5 A;  2ETH A;  3HSF A;  1IRX A;  2PLY A;  5M3F J;  3AG2 H;  5C4J J;  2VON A;  2PJP A;  1QPI A;  5JLW A;  5L3E A;  1NTC A;  2MG4 A;  2ZC2 A;  3WU0 A;  3WTS C;  3JSP A;  1ZG5 A;  1TC3 C;  1CF7 A;  1MDM A;  1U6G A;  1Y8R B;  2F2E A;  2VKH A;  3U1D A;  2BW3 A;  1Z9C A;  4KUM A;  1R7J A;  4R8H A;  2LY2 A;  5GAD J;  1X1B A;  1N75 A;  3BG7 A;  3L2U A;  3MWM A;  4PK4 A;  1DQU A;  1ZYR F;  3H3Z A;  3A0H C;  1YS7 A;  1GXP A;  2LF8 A;  2K86 A;  3ABK H;  3LA3 A;  1I1G A;  2Z16 A;  1SVM A;  3E5Q A;  1I3Q J;  1WJD A;  3P5J A;  3CJN A;  2OD5 A;  3JW4 A;  3F6O A;  1UCR A;  2XAU A;  5GAG J;  3OYI A;  1ZRD A;  1J0R A;  2ZXJ A;  3S1Q J;  2GBY A;  3FDY A;  1R49 A;  2P5V A;  1F36 A;  3SZT A;  2M30 A;  2R7F A;  3V8J A;  4KIT B;  1LVA A;  3DTI A;  2ZME C;  3ABT A;  3JRI A;  3ZQF A;  3QYE A;  3DU6 A;  3LAJ A;  1JI8 A;  3CC4 I;  1P92 A;  1SD5 A;  3SQN A;  5LRS A;  2DA3 A;  3F3X A;  4XRS A;  3CMY A;  1AA7 A;  1RZ4 A;  5FFZ A;  4F93 B;  2DMP A;  3K4B A;  4XKW A;  2L0K A;  2WV1 A;  1RR8 C;  2ISY A;  4HOB A;  2ZNZ A;  2R7W A;  5J8C A;  1RNL A;  2Y9Y A;  4W1U A;  5B66 C;  3DF8 A;  3CCR I;  2V1U A;  1U3E M;  1X1D A;  2ELH A;  2VN2 A;  1YIT I;  4B44 A;  4HX8 A;  4M9S A;  3RJP A;  1UMQ A;  4RB2 C;  1MBF A;  3I59 B;  4UVC A;  3T1B A;  1ZAR A;  4PCQ A;  1QA6 A;  3HTS B;  3BJ6 A;  2KZV A;  4GRI A;  4A3E J;  1IRF A;  4JOM A;  1BI3 A;  1QNT A;  3F72 A;  2IA1 A;  4M6Y A;  3BG6 A;  3O8G A;  5LBQ A;  3EQL F;  3RPQ A;  4KMF A;  4RGU A;  3HRU A;  3DEU A;  4BL0 B;  3BPX A;  1HKT A;  4GDF A;  3P7N A;  3M1C A;  1S7O A;  3AG3 H;  2LDU A;  3UNG C;  5E1X A;  1JKR C;  2M1B A;  2ZJQ F;  2HEO A;  1UZC A;  2F5E A;  3LFK A;  1S6L A;  5LGN A;  3ZQC A;  1JJ6 C;  4M71 A;  3JRF A;  4LG3 A;  4B09 A;  1U5T C;  4OAY A;  1BM9 A;  1LDD A;  3EYY A;  3HGY A;  1SFU A;  1MMS A;  2ID3 A;  5BS6 A;  1T0F A;  4E7H A;  3HPG A;  1PYV A;  3QP6 A;  1I3A A;  1J75 A;  2ZBK A;  1Q1V A;  4RMN A;  1N78 A;  1X3Z B;  1QRY A;  3DV8 A;  3ZMU A;  1Y0N A;  2X85 A;  3TGN A;  5KNL A;  4DBR A;  3V8L A;  1BW6 A;  1B4A A;  3CQZ J;  3Q0U A;  1O3T A;  1ZKG A;  1MNE A;  1SFX A;  1JUM A;  3CUQ A;  3LOC A;  3F8M A;  2COM A;  2P5K A;  5J47 A;  1VQL I;  2XAF A;  3ABM H;  4DNC A;  1IF1 A;  2LBF B;  3HTU A;  4HF0 A;  2QA4 I;  1R9T J;  1FP2 A;  1MJ9 A;  5FRM A;  3TO7 A;  2R3S A;  1K83 J;  2LLK A;  5HNF A;  1ETK A;  2QKL B;  3E1S A;  5FD6 A;  1TWF J;  1VQ8 I;  1LE8 B;  4YFK F;  1X3U A;  3GCM A;  3REO A;  4A0Z A;  1UG0 A;  2FQ4 A;  3DPT A;  2IRF G;  3PJR A;  2R7X A;  1WQ2 A;  2WB1 N;  4BEH B;  3GX4 X;  2IJL A;  2M34 A;  1LB2 A;  2EFP A;  2KFD A;  4EGZ A;  2G0E A;  4A3L J;  4X1E A;  4RAY A;  5B3S H;  3C1D A;  3KET A;  4HAM A;  3ELK A;  3DEW A;  2DOA A;  4RA2 A;  4Y33 A;  2MYS A;  1ZAO A;  2R5Y B;  1HW2 A;  2PMZ N;  1ZLK A;  2HQN A;  2C6Y A;  3IHU A;  1T39 A;  3DQV C;  4ESF A;  3FMS A;  4Y17 A;  4YFX F;  2TDX A;  4NHJ A;  2R7V A;  2JSC A;  2QGU A;  1TQI A;  4Z6Y A;  3JCU C;  2FXA A;  3KFW X;  2WWY A;  2QSH X;  1VQN I;  2OTJ I;  3ABU A;  4MGR A;  2AS5 F;  1XSX A;  4N0B A;  4KYW A;  2DYS H; 
#chains in the Genus database with same CATH homology
 5E3N A;  3BR6 A;  3K7A J;  3BR0 A;  1SFO J;  2R0Q C;  3ZQH A;  2DA5 A;  3BR2 A;  3K2A A;  5E3L A;  3PO3 J;  4A3M J;  2CUE A;  4DZJ A;  1W0T A;  3D1N I;  2EQR A;  2CUF A;  4Y7N J;  1LE8 A;  1MBH A;  4MIM A;  1G2H A;  2AO9 A;  5JLX A;  3PO2 J;  3A01 B;  1MSE C;  3H0G J;  2E2H J;  1HDD C;  1ITY A;  3S1N J;  1Y1V J;  1PUF B;  1AHD P;  5EZG A;  1ZGW A;  1XS9 A;  3M4O J;  3ZQL A;  1HDP A;  1BJZ A;  3CDL A;  5EYR A;  3M3Y J;  2X6O A;  5FLV A;  5EGO A;  5FKL A;  5FKN A;  3S2D J;  3MKL A;  2TCT A;  1ETY A;  5F0F A;  5J1U A;  5J1Y A;  2TRT A;  2LR8 A;  4DYR A;  2M9H A;  1POG A;  2EZK A;  5DTD A;  4RDU A;  2XSD C;  3HEF A;  3S17 J;  1ZR4 A;  2E19 A;  2HDD A;  1Y1W J;  5K7Z A;  2DMQ A;  1IDY A;  3SFI A;  1P7J A;  2LD5 A;  5J1R A;  1TWC J;  2P81 A;  5M3M J;  5HOD A;  4D5F A;  1APL C;  4GFB A;  5IYD J;  3HGG A;  2VI6 A;  1ZK8 A;  3FIS A;  3IH3 A;  4I6Z A;  1XG1 A;  1GT0 C;  3S16 J;  4G12 A;  5F0H A;  3HOW J;  1JJ8 C;  3GTP J;  2L7M P;  3ZQG A;  2XPW A;  2NVY J;  3G1O A;  2QF7 A;  1WH5 A;  5M5Y J;  5EDN A;  4BY7 J;  1RKW A;  5EEA A;  2DJN A;  5E3M A;  3H3V K;  1I50 J;  4EEF G;  3BT9 A;  1JUP A;  1GV2 A;  2VUM J;  3A02 A;  2DA1 A;  1JT0 A;  3RZO J;  2N8G A;  2LY9 A;  1AKH B;  2B63 J;  2Y31 A;  2LFB A;  3QPL A;  2XB5 A;  3FIW A;  1OCP A;  2JMW A;  5E3O A;  5GPA A;  3S14 J;  5M5X J;  2DA6 A;  3GTM J;  4IHX A;  1NK2 P;  2JA5 J;  4JP0 A;  1UHS A;  5IP9 J;  5FJ8 J;  4A3F J;  4S0H B;  4MLO A;  3Q3S A;  5C3E J;  4A3G J;  3NAU A;  4M3B A;  1OCT C;  1ETX A;  1FTZ A;  1WCM J;  3RZD J;  4IHV A;  1JKQ C;  4FCY A;  4JX6 A;  1BW5 A;  1HLV A;  1X58 A;  1MBJ A;  1T56 A;  3JRA A;  2Y9Z A;  4CYC B;  1IC8 A;  1BL0 A;  1MH4 A;  4M3F A;  4B1R A;  3LSP A;  5IOY A;  1TWG J;  2JJ7 A;  1B72 B;  2I10 A;  2XRL A;  2ELK A;  4NDL A;  3LSR A;  1RKT A;  1MBG A;  2LKX A;  3TED A;  3GTO J;  3GTJ J;  2HI3 A;  1FIA A;  2NVQ J;  2FX0 A;  3BTC A;  1RES A;  2YS9 A;  2HOA A;  1U78 A;  1X2N A;  1VND A;  2COB A;  1T33 A;  4W97 A;  4J19 A;  3GTQ J;  1UG2 A;  2LVS A;  1B72 A;  3I4N J;  1DU6 A;  3B6A A;  2W48 A;  5C4X J;  4DYQ A;  2E1O A;  2K9Q A;  4CYC A;  3BQZ A;  1QVT A;  1PUF A;  5F08 A;  1IUF A;  2KT0 A;  4DYC A;  3OOU A;  2FJ1 A;  4MFE A;  2O9L A;  4UUT A;  2ME0 A;  5EG0 A;  3MVP A;  4I76 A;  3HOV J;  2AHQ A;  5BNG A;  1HOM A;  2FD5 A;  3SJM A;  1ETV A;  4XID A;  3DCF A;  2DA7 A;  4M3E A;  4C3I J;  4DW6 A;  2VKE A;  4MFD A;  2LK2 A;  4QTR A;  5IYC J;  1IG7 A;  1XC5 A;  3A03 A;  2Y0S N;  4M6V A;  4UUS B;  2NS8 A;  2OPT A;  2JA8 J;  1ENH A;  1E3O C;  3JRC A;  2L9R A;  4A3I J;  2ZB9 A;  2IEK A;  4FTH A;  1FEX A;  1X2M A;  3BR5 A;  5IP6 A;  2NOG A;  5GP9 A;  2VKV A;  3E7L A;  1MH3 A;  1IGN A;  4C2M J;  4ABZ A;  3MN2 A;  5J3L A;  1ORK A;  3JRG A;  4L5E A;  4XRM A;  1RR7 A;  1D5Y A;  2E2J J;  4XIC A;  1LFU P;  3Q0V A;  3QPS A;  4AYB N;  3LNQ A;  4A93 J;  3Q0W A;  1GDT A;  2L7F P;  2NS7 A;  3TP3 A;  1RPW A;  2QCO A;  2H8R A;  1JTY A;  2CU7 A;  5F27 A;  1JGG A;  1QVU A;  1EF4 A;  3FK7 A;  1HF0 A;  4IHY A;  5IP7 J;  2R93 J;  4C3J J;  2DA2 A;  5K7H A;  1WH7 A;  1OJL A;  2HYJ A;  2M2E A;  3WHC A;  2R5Z B;  3OIO A;  2DMN A;  3JRD A;  1IV6 A;  4BBS J;  2ID6 A;  4LOC A;  3BTL A;  5IOZ A;  1JKP C;  4M3D A;  3OSF A;  2HOT A;  1W0U A;  3JRH A;  4B4C A;  3HOX J;  1YRN A;  1VF9 A;  9ANT A;  1GVD A;  2KDZ A;  3GTK J;  1JT6 A;  2DMT A;  2LTP A;  1ETO A;  3SDG A;  1Z0X A;  3A01 A;  2GLO A;  2LP0 A;  4JX4 A;  2YU9 J;  5IYB J;  3NAR A;  2X9D A;  2ECC A;  3RQI A;  3G1L A;  2DTZ A;  3FK6 A;  2L7Z A;  3BQY A;  3IH4 A;  3TW6 A;  4B3A A;  5FLM J;  3BR3 A;  1K61 A;  2IBD A;  1ETQ A;  2DA4 A;  3TW7 A;  3BR1 A;  5F1J A;  4JYK A;  2ECB A;  2K9N A;  5EF6 A;  2JK3 A;  3B6C A;  4Y52 J;  3IV5 A;  2EBI A;  2XGC A;  3FKI J;  5FKM A;  4UUS A;  3S15 J;  1TWA J;  1AKH A;  1U8B A;  2Y2Z A;  4D7N A;  5M3F J;  5C4J J;  3HB9 A;  1IRZ A;  2RAE A;  1QPI A;  3I4M J;  5JLW A;  1NTC A;  2MG4 A;  3BG9 A;  1TC3 C;  4X6A J;  5M5W J;  1H89 C;  4FIS A;  2HXI A;  1FIP A;  3C2B A;  5EG0 B;  3WHB A;  1AU7 A;  2CQX A;  4HNV A;  1I6H J;  2GM4 A;  3GTL J;  1I3Q J;  2D5V A;  1MBK A;  4AC0 A;  5GPC A;  1CQT A;  4D7M A;  3L1P A;  3HOU J;  3RKQ A;  3S1Q J;  2GBY A;  2JWT A;  1F36 A;  1GV5 A;  2EZH A;  2VPR A;  1A5J A;  1HCR A;  4C3H J;  3JRI A;  1S7E A;  2MGQ A;  3ZQF A;  4XK4 A;  3W6V A;  2XGD A;  2R92 J;  4V2F A;  1RET A;  1A6I A;  1MSF C;  1ETW A;  2DA3 A;  1LFB A;  1IJW C;  4XRS A;  3CMY A;  2DMP A;  2L0K A;  2WV1 A;  3IH2 A;  4M3G A;  1SAN A;  1TWH J;  3BG5 A;  3LSG A;  2R7Z J;  1ZR2 A;  1P7I A;  2HQ5 A;  2Y9Y A;  4W1U A;  3ZOB A;  3O8H A;  4QSH A;  1H8A C;  1H88 C;  1MNM C;  2NVX J;  3PM1 A;  2M8G X;  2JA7 J;  2YUS A;  4V2G A;  2WAQ N;  2H1K A;  1IDZ A;  1UMQ A;  1MBF A;  3HBL A;  3VPR A;  5IPA A;  2JN6 A;  4A3D J;  2EZI A;  1DU0 A;  3F0C A;  4A3E J;  2EZL A;  1Z77 A;  1BA5 A;  2DN0 A;  2XPU A;  3O8G A;  1WI3 A;  2XPV A;  1VFC A;  1O4X A;  1JKR C;  4BBR J;  3S1R J;  1B8I A;  1WGX A;  3JRE A;  2R5Y A;  2CQQ A;  4FE7 A;  4BXX J;  3ZQC A;  1JJ6 C;  2XB0 X;  3JRF A;  2HXO A;  1GUU A;  2OF7 A;  5FKK A;  3HGY A;  2XGE A;  3GTG J;  3GBG A;  2ID3 A;  1VI0 A;  1JUS A;  4BKX A;  5F04 A;  1Q1V A;  4A3C J;  3UKG A;  2CJJ A;  3TP0 A;  1QRY A;  3S1M J;  4XRS G;  2K9S A;  3S2H J;  4JX5 A;  2M0C A;  3JRB A;  1YRN B;  5DS9 A;  1BW6 A;  3CQZ J;  3Q0U A;  2ME6 A;  1ZKG A;  2EH3 A;  5K7F A;  1JUM A;  1U9O A;  1JTX A;  2MSY A;  2X48 A;  3LOC A;  5F0C A;  5EGO B;  5EZH A;  4A3B J;  3LSJ A;  4QIW N;  2R5Z A;  3BTJ A;  4IEJ A;  2NVT J;  1MBE A;  3BG3 A;  1R9T J;  1ZQ3 P;  2MW8 A;  1K83 J;  2LLK A;  3QQA A;  1ETK A;  3HOZ J;  2O8K A;  4BY1 J;  1TWF J;  1NK3 P;  2DMU A;  2Y30 A;  4A69 C;  1LE8 B;  3JR9 A;  1WPK A;  2FQ4 A;  2K40 A;  2WB1 N;  3HOY J;  3OSG A;  1OFC X;  2M34 A;  4A3L J;  5FKO A;  2G0E A;  1U9N A;  4X1E A;  2HOS A;  2O7O A;  2IAI A;  3HDD A;  3HM5 A;  4D5C A;  3DEW A;  1FJL A;  2CRG A;  1F43 A;  4RBO A;  3ZQI A;  2R5Y B;  5C44 J;  2PMZ N;  4IHW A;  3CCY A;  4DZP A;  1B8I B;  1ZTR A;  4FE4 A;  2JA6 J;  2E2I J;  3BTI A;  4A3K J;  3HKZ N;  3G1M A;  4MO7 A;  4A3J J;  1FTT A;  1JKO C;  4AUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...