2ELKA

Solution structure of the sant domain of fission yeast spcc24b10.08c protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
b'GSSGSSGFDENWGADEELLLIDACETLGLGNWADIADYVGNARTKEECRDHYLKTYIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPCC24B10.08c protein
publication title Solution structure of the SANT domain of fission yeast SPCC24B10.08c protein
rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
total genus 11
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2007-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2elkA00
1QVTA 2HQ5A 3FK7A 2L9RA 3LOCA 1B8IA 4X6AJ 2LR8A 2L7ZA 3H3VK 2HOTA 1FIPA 4BBSJ 1IDYA 1RESA 2Y0SN 5F27A 1H88C 1AHDP 2XGEA 3BR1A 3S14J 1ZKGA 2FQ4A 1VF9A 3JR9A 4EEFG 5EDNA 2G0EA 3PO3J 2NOGA 2XGDA 1P7IA 3HEFA 3JRDA 2LTPA 3JRCA 1QVUA 2CU7A 1MSEC 1DU6A 4C2MJ 2EZHA 2JA5J 4Y52J 2K40A 3S15J 3I4NJ 2LD5A 3BG9A 2IEKA 2R5YB 1WI3A 1GUUA 5E3LA 1GDTA 2AHQA 4FCYA 2MW8A 3TW6A 4A3MJ 3HGGA 1ZK8A 3BR0A 1LFBA 3LNQA 2ME0A 2R5YA 4FTHA 1MH4A 2NS7A 1JUMA 3DEWA 1TWCJ 1ETOA 2HOSA 1S7EA 3LSPA 4L5EA 2XPWA 2E2IJ 1OFCX 1JUSA 4XRSA 1H8AC 4JYKA 4C3HJ 2XPVA 5IYBJ 3ZQGA 3ZQHA 1LFUP 1MNMC 3S2DJ 1IRZA 3GTMJ 1HOMA 2LK2A 2K9QA 5FKOA 2ME6A 2Y9ZA 5IP9J 5EG0A 2YS9A 1WPKA 2MGQA 4MFEA 3BTLA 5FLMJ 1X58A 3OSGA 2CUFA 1UMQA 5IOYA 3GTOJ 2XSDC 2DMTA 3HOYJ 4A3KJ 1ENHA 1APLC 2HDDA 3A02A 2R93J 2WB1N 2FD5A 3FKIJ 2E2HJ 5GP9A 1TC3C 4MIMA 3CQZJ 3Q3SA 3F0CA 5JLXA 1OCPA 3H0GJ 3Q0UA 5GPCA 2DA1A 1QRYA 2ID6A 4V2GA 4AUXA 1Q1VA 4A69C 1JT6A 1I50J 1RETA 5E3MA 2XRLA 1U9NA 2DA2A 3JRBA 4A3CJ 2L7FP 1UG2A 2MG4A 4A93J 1W0TA 2PMZN 2DA7A 2Y30A 2JK3A 4A3GJ 4A3IJ 4M3EA 2DA6A 2XGCA 1HF0A 1UHSA 1YRNA 2E1OA 2DMPA 1AKHB 3A03A 4MO7A 2OF7A 3RZDJ 3PM1A 1U8BA 2GBYA 2ZB9A 3BR6A 2E2JJ 1ZQ3P 1GV2A 2JA8J 1ZR4A 2Y31A 2O7OA 2N8GA 2H8RA 2HYJA 2I10A 1T33A 3TP0A 4JX4A 3S1QJ 1TWFJ 2EZIA 1K61A 1MBJA 3HOXJ 2L0KA 2ID3A 3ZQCA 1B72A 1ZR2A 3BQYA 2EH3A 4D7NA 4XICA 1HLVA 1NK3P 4A3BJ 4DZPA 1IC8A 4DYCA 3JRIA 2KT0A 3A01B 3O8HA 3UKGA 3TEDA 1R9TJ 3HKZN 4M3DA 3BTIA 3PO2J 1ETYA 4M3GA 2E19A 2FJ1A 4MLOA 2X6OA 5FKMA 4B3AA 4XRSG 5M5XJ 3CDLA 3HOWJ 5BNGA 1DU0A 4D7MA 2H1KA 1A6IA 1XG1A 3WHBA 5HODA 1K83J 2VPRA 4I76A 4B4CA 4JX6A 5EYRA 4M6VA 3ZQLA 2LY9A 1TWHJ 2M0CA 2HXOA 3IV5A 1JTYA 1BL0A 1ETQA 2AO9A 3SDGA 3BTCA 3HDDA 2D5VA 3DCFA 5J3LA 4XRMA 2K9NA 2QF7A 1JT0A 1Y1VJ 2QCOA 2EZKA 2DA5A 2IAIA 4D5FA 3B6AA 5M5YJ 2CRGA 1GV5A 1OJLA 5F04A 1SANA 1U78A 2Y9YA 1CQTA 2LKXA 1MBFA 1JJ6C 2OPTA 4IEJA 4MFDA 2JA6J 3Q0WA 2DTZA 1MBHA 4JX5A 2O9LA 5FKKA 4B1RA 3K2AA 3JRAA 1WH5A 1U9OA 4AYBN 3W6VA 4C3IJ 2R7ZJ 1JGGA 2CJJA 2LP0A 5EZGA 1JJ8C 3GTGJ 1WCMJ 4C3JJ 2X9DA 3HBLA 5FKLA 4I6ZA 1ZGWA 2VUMJ 5F0FA 1ZTRA 3QQAA 3BR3A 3S16J 2LVSA 1IG7A 4QSHA 2DA3A 2W48A 3BR5A 1RPWA 1MBGA 4W1UA 3B6CA 5IP6A 5EF6A 1VNDA 2EBIA 1GVDA 1VI0A 4CYCB 1F43A 2M9HA 2CQQA 2DMNA 3RQIA 2FX0A 1ETKA 2VI6A 3RKQA 5IYDJ 4DYRA 2HXIA 1BJZA 1SFOJ 2JA7J 1EF4A 1W0UA 3MKLA 3SFIA 2DN0A 1AKHA 2XB5A 4FE4A 1Z0XA 2JN6A 2GM4A 5IPAA 5EZHA 4AC0A 4RBOA 3D1NI 5K7FA 4V2FA 1MH3A 4RDUA 1Y1WJ 2M34A 1TWAJ 1E3OC 3HOZJ 4HNVA 3C2BA 4Y7NJ 1OCTC 2XPUA 4BXXJ 4DW6A 2O8KA 1ETWA 1IUFA 1VFCA 2DMQA 1MBKA 3K7AJ 5E3OA 4X1EA 3HOVJ 2WAQN 3GTJJ 1X2MA 1TWGJ 2R0QC 2B63J 4A3DJ 2IBDA 2HI3A 4M3BA 3ZQIA 5IP7J 3S17J 3A01A 2ECBA 4BY1J 2Y2ZA 1A5JA 2R5ZB 5DTDA 1I6HJ 1WH7A 1JKRC 1QPIA 5C3EJ 3O8GA 1BW5A 1IJWC 4IHXA 2DJNA 2L7MP 3GTQJ 2R5ZA 1B8IB 3QPLA 4DYQA 5J1RA 2YUSA 3OOUA 1POGA 2JWTA 4IHWA 3ZQFA 3QPSA 5C44J 4BBRJ 5F0HA 2EZLA 3G1OA 2VKVA 4NDLA 1H89C 3HB9A 3WHCA 2K9SA 3JRFA 2CQXA 1P7JA 2TRTA 3BTJA 3S1RJ 1JKOC 1JUPA 5K7HA 2JJ7A 4S0HB 1O4XA 4D5CA 5C4JJ 1PUFB 4BKXA 3IH4A 2EQRA 3LSRA 3FISA 1RR7A 1PUFA 4QTRA 4A3EJ 5DS9A 5F1JA 3CMYA 2MSYA 5F0CA 4DZJA 5M3MJ 2KDZA 3G1MA 4IHYA 4G12A 2RAEA 4J19A 3IH3A 3BT9A 3HOUJ 1FJLA 1FEXA 2P81A 5IOZA 5EGOB 1WGXA 2X48A 1ETXA 1F36A 3LSGA 1RKTA 4LOCA 1IDZA 5IYCJ 3JREA 1XC5A 1FTTA 3MVPA 5EG0B 5EGOA 1XS9A 1RKWA 1MSFC 2NVXJ 2NVYJ 3S1MJ 1G2HA 2CUEA 2NVTJ 1HCRA 3BR2A 3BQZA 4FISA 3FK6A 3HM5A 5C4XJ 2LLKA 9ANTA 2GLOA 3I4MJ 3GTLJ 1IV6A 1T56A 2JMWA 3GBGA 1JKPC 1MBEA 2ELKA 1AU7A 4ABZA 3GTKJ 3LSJA 4FE7A 5JLWA 5EEAA 1JKQC 2M2EA 3CCYA 3L1PA 2ECCA 2R92J 4CYCA 3E7LA 5J1UA 5E3NA 2NS8A 2NVQJ 4XK4A 4XIDA 1ITYA 1X2NA 1HDPA 1JTXA 3VPRA 2YU9J 1NK2P 1FIAA 4A3LJ 1NTCA 5FJ8J 3S2HJ 2HOAA 2XB0X 4UUSB 2COBA 4BY7J 2M8GX 1D5YA 1I3QJ 2LFBA 5M5WJ 1YRNB 4M3FA 1FTZA 3OSFA 4UUSA 1ORKA 2TCTA 1HDDC 1ETVA 4GFBA 5FLVA 1BA5A 1IGNA 1BW6A 3JRGA 1LE8B 3RZOJ 3M3YJ 3G1LA 3GTPJ 4A3JJ 4JP0A 3TP3A 5GPAA 4IHVA 1LE8A 3M4OJ 5M3FJ 5FKNA 3MN2A 3NAUA 1B72B 3IH2A 3FIWA 3TW7A 3S1NJ 2WV1A 1GT0C 1Z77A 2DA4A 4W97A 3OIOA 3BG3A 5F08A 2DMUA 4UUTA 2VKEA 4QIWN 3HGYA 4A3FJ 3NARA 5K7ZA 3BG5A 3JRHA 3SJMA 5J1YA 3ZOBA 3Q0VA
chains in the Genus database with same CATH superfamily
3MMYB 3MZ8A 1VQ5I 3S3MA 4P5OA 2Y75A 4E6KG 1ZREA 2L7ZA 5FB2A 3BCAA 1T2KA 3F23A 1IDYA 4YG2F 5JHFA 3A1YA 5F27A 2XGEA 2GIZA 3NWSA 1SFKA 1MIJA 1ZKGA 1VF9A 2HTJA 2E1CA 1S8NA 4IRIA 5EDNA 2G0EA 3EYIA 1P7IA 3TKYA 1YFHA 3HEFA 1QZEA 3CCSI 3JRDA 3WU1B 4CO8A 3JRCA 5J4VA 1QVUA 1TP4A 1MSEC 1PVEA 1X1CA 4IQ4A 1FLIA 2L9VA 3S15J 3BG9A 3H3UA 2IEKA 2R5YB 5AIPA 2EPFA 2MW8A 2K02A 3CUOA 3BR0A 4CH7A 1IF1A 1OLTA 1XB4A 2ME0A 3M8JA 2R5YA 4LG3A 2OTJI 1ZRDA 1R5ID 2NS7A 2BXZA 2M7BA 2CW7A 1ETOA 2HOSA 1FMWA 2WAEA 3IWZA 2HFHA 3CCJI 1CGPA 3U2RA 5L3BA 2CYYA 2PMZA 3A0BC 2KFDA 1LFUP 2Q0OA 4PJMA 2FBHA 2K9QA 4F7ZA 2KP6A 2ME6A 1R36A 3I71A 5EG0A 1YJ9I 1GLNA 5CQEA 3AL0C 1EJ9A 2LG4A 5D5VB 3DTIA 4LMYA 3WU0A 2VBWA 2CUFA 3W6KB 3GTOJ 4MQVA 2R7VA 4A3KJ 4HOBA 4B3XA 3KIOA 1HW1A 4P9FA 4XN3A 4HF0A 1MNEA 4RM3A 5JLXA 3E6BA 3H0GJ 2FSWA 3CF2A 3PUBA 3IC7A 4WXHA 4Y13A 3D5LA 3H9GA 2VXDA 5JVTA 5E3MA 2XRLA 2K4JA 4KA4A 2QM3A 3JRBA 1TNTA 4A3CJ 2L7FP 3COAC 2OQGA 1YX5A 2DW4A 2PMZN 4Y33A 2W85A 2DYSH 2X1DA 3GXOA 2QQAA 2ZMEC 3Q5FA 1ZH5A 4A12A 3I56I 1XMKA 1PP8F 3K4BA 4KMUX 2E1OA 3T1BA 2KMUA 4MO7A 4NQWB 1BN5A 2XDVA 3AKZA 3H0DA 3PNYA 4BXUA 1YHQI 4L9NA 2E2JJ 1F5TA 1EV7A 1GV2A 2Y31A 4NQWA 4XBFA 3IRRA 1LUJB 4WCGA 3B02A 4UV8A 2ZSHB 2Q8KA 3HPHA 1A36A 4E7JA 1FT9A 1K61A 3M8FA 1MBJA 3J7AY 3HOXJ 1OCZH 1XGNA 2BEOA 2L0KA 2IA2A 4E7ZA 4OAYA 3QWLA 3D5SC 1ZR2A 3BQYA 2EH3A 4U7DA 3K69A 2M3AA 1I5ZA 5KHDA 3BZKA 2L02A 4BU2A 4HLYA 1TT5B 3X2QH 3CCLI 2DOEA 4FX0A 2OD5A 1ZELA 4L9TA 2W7NA 3DBHB 4EGZA 2DOFA 3TEDA 3N97A 4XLPF 4CXFA 2BE5F 3DWLE 2JZYA 4M3DA 1WJCA 4AIDA 5F6FA 4M3GA 2E19A 2KIQA 2OTLI 4RAGA 2E1MB 1FYKA 4IOCF 4A0YA 2XAHA 3LQQA 3MQ0A 3ULQB 4IX7A 1TT0A 3V4GA 5LEJA 2DQLA 2DCEA 4D7MA 3OIPA 3CJRB 3E0JB 1XG1A 3WHBA 1C0WA 3ABLH 4MEXF 1EH6A 4JX6A 5EYRA 2QSHX 3RCOA 2LKSA 4M6VA 4N4NB 1AOYA 3G3ZA 4YIFA 5TGTA 2VC1A 4DNCA 1TWHJ 4KITB 1SFXA 4Q5SF 1TL8A 3GZ5A 4D1QA 3DPLC 1D8KA 2IJLA 3BTCA 4PDKA 2F4MB 5J3LA 1UG0A 2X4HA 3WTZA 2MFZA 2LSOA 4Y3OA 2PMHA 2RQPA 3E97A 2QCOA 1WKMA 2Z16A 3HUGB 1BJAA 2IAIA 2HVQA 1NG7A 1NHAA 4JBAA 5F04A 1SANA 2XAJA 2IGMA 1MBFA 1TQIA 4WF2A 2JA6J 3CCMI 1X3ZB 4XLCA 1HXDA 1IN5A 1MBHA 2V6EA 2XVCA 4M72A 6PAXA 3I58A 5CVVA 1PDNC 3H9JA 2VT2A 4B1RA 1KU9A 3K2AA 3RKXA 5LHIA 1U9OA 3ZRGA 4PGGA 4HX4A 4ENMA 3P5JA 3W6VA 2CV0A 4CCNA 3GTGJ 1HW2A 1OR7C 2H94A 3LL7A 2FE3A 4BE2A 5F0FA 2WY7Q 2LVSA 2RV8A 3R4KA 1IG7A 3G2BA 2W48A 3QPHA 5DCMA 1IO2A 2R7XA 1W7PD 5EF6A 5DYMA 4DBQA 4CYCB 2OC6A 2W24A 1LNWA 3M8EA 1X1BA 1W36C 3GO5A 4E7HA 2O6GE 1Z7LA 2FX0A 3ERED 2KIMA 4DYRA 2HXIA 2VBYA 1BBYA 2B0LA 3C2HA 2O3FA 3I5UA 4FX4A 2IW5A 4NBQA 3SFIA 2DOAA 3J7ZI 1AKHA 5B66C 3CJNA 5EZHA 2E7WA 3BP8A 1W1WE 2MA3A 4XLHA 3HSFA 1TWAJ 2RC4A 1Z9CA 5A2QZ 3LSKA 2RQQA 3KP7A 4Y7NJ 3I64A 4C2TA 1XDSA 1DQUA 2A6TA 2A3SA 2STTA 1ETWA 4JOMA 2H6BA 3F8BA 3GZ6A 3HOVJ 3H92A 4X1EA 3C7JA 3VSLA 1ON2A 1KONA 5DD8A 2L4AA 2DK8A 3GTJJ 1X2MA 1TWGJ 2Q2EB 4U87A 4XKWA 4EATA 2E71A 1SAUA 1VQMI 1BOBA 1T98A 4EM1A 2VASA 2JSPA 5KAIC 1O7FA 1SMTA 1MJAA 4P1WA 3BZ6A 3KX2A 1QO0D 4G6TB 5B3SH 3OYHA 1DPRA 4KNYA 1W7PB 1WVRA 3PFIA 1S5LC 2KLOA 1R1VA 3O8GA 3RYRA 5H20A 5J4YA 3F8MA 4IHXA 2DJNA 3CUQC 4BDYA 2WWYA 2VOPA 4CUGA 4IJAA 3BROA 2JVGA 3FXUA 3Q9SA 4LLNA 5HLIA 4WWCA 1D8JA 3DBLB 3ZQFA 2KQRA 3HSRA 3CCUI 4ZDOA 2M8EA 5LD2C 4BXFA 4BBRJ 1LPQA 5F0HA 4ESFA 3G1OA 1J5YA 2VN2A 2VKVA 2ZCWA 2JSCA 3HB9A 3WHCA 4YRVA 3JRFA 1QU3A 3VYUB 1P7JA 1E0EA 2V9PA 1J0RA 1JKOC 2FEZA 1GXQA 5K7HA 2JJ7A 1SD6A 4ON0A 1PUFB 1RZ4A 3IH4A 1HKTA 3V7CA 1R22A 1KU7A 1WJDA 4XLEA 1V4RA 3HOSA 1PUFA 4ENKA 3TO9A 4GCVA 1ULYA 1RR8C 2KDZA 4PFOA 4D0PA 4G12A 2RAEA 3OR1C 4QPOA 1V5GA 1FJLA 2P81A 2A07F 5IOZA 1WGXA 2X48A 1ACIA 1IXCA 5IYCJ 2M1BA 3HRUA 3JREA 3QRFF 2OA4A 1FTTA 3MVPA 1D0YA 1MSFC 4G9YA 1RKWA 1XS9A 5JFRA 4NNJA 2NVXJ 1G2HA 2CUEA 2R4GA 1HCRA 3BWGA 1I39A 1XPXA 1A31A 2GWRA 2EWNA 4FISA 4MTDA 2LF8A 2VJIA 2B7EA 1MMNA 3VB2A 9ANTA 2ZBKA 1B9NA 5AIQA 1S7OA 2VJ5A 3ELKA 1ZGAA 5ICCA 3N05A 3KCCA 4KN7X 5FRNA 4EM2A 4RAFA 3LSJA 4FE7A 2F5DA 1O3TA 2C6YA 5EEAA 1JKQC 2M2EA 3CCYA 5D6EA 3F22A 2F4IA 1TQPA 2NS8A 4ZZDA 1GHCA 2HQNA 3K1NA 2VKDA 3L2WA 3VFZA 5LGNA 4MGRA 1HDPA 2YU9J 4E70A 1NK2P 1FIAA 4IRHA 4NC6A 1WHUA 3IKVA 2HVRA 4B43A 2GAUA 2XB0X 3FXQA 4F92B 2COBA 4UUSB 4BY7J 2M8GX 1X1DA 1G8XA 1I3QJ 5FD6A 2QQBA 5DEQA 4B8XA 4M3FA 1R23A 3OSFA 2I8DA 4UUSA 2TCTA 3TOBA 3JSOA 2Y0SA 4CCMA 1A35A 4BE0A 5IT9Z 3OS2A 1UFMA 4PGHA 1SEUA 1XMAA 3GCMA 5CVUA 1U5TC 2Z1DA 5H6QA 4A3JJ 5K5RA 3TP3A 4CZCA 2IS2A 2L4MA 5LEKA 4UB6C 3M4OJ 3KZZA 1QPMA 4F91B 3S3NA 3I59B 1XCBA 1SMYF 2DPUA 1OKRA 1ZRCA 1ZG1A 1MMDA 4R79A 2RNJA 2RN7A 4IZZA 2R7FA 3OIOA 3BG3A 5F08A 1Z67A 5K7ZA 3C1DA 2A68F 3FBNB 2HOEA 4MQ9F 2OCEA 1QVTA 3FXKA 3NEUA 4HQMA 5D5WB 3BPXA 2JPCA 3LOCA 2E5NA 1B8IA 4X6AJ 2LR8A 5E8IA 4CHUA 4PK4A 2IS4A 4N4OB 3H3VK 4GGGA 3B73A 3GEZA 1FOXA 4EMSA 1RESA 2Y0SN 3OL3A 1AHDP 4JQFA 2HR3A 3H5AA 4HAMA 2FQ4A 3LFUA 2W84A 4M9XA 5HS7A 2R7OA 3S14J 3JCUC 3JR9A 2H27A 2YX4A 2NOGA 2P0WA 2VT3A 2XAFA 2XV4S 2LF7A 1NG6A 3H5RA 2QUFA 1V3FA 2BY1A 3DTEA 1USTA 2K40A 2Z3YA 3I4NJ 3KP4A 2XAQA 1P4AA 3OYJA 1GUUA 1R5GA 2AHQA 4FCYA 3F8FA 1OYIA 4HX8A 3TW6A 4WK8F 1LDJA 4HSRA 3HGGA 3FX3A 5L3FA 4FTHA 4I2OA 2KJCA 1MZBA 1O7LA 2BW3B 1MH4A 3BJ6A 4LLGF 1JUMA 3DEWA 3ONQA 2XPWA 3M07A 2E2IJ 4M9ZA 1OFCX 4XRSA 4C3HJ 4EGYA 5D6FA 2XPVA 4Q48A 1MNMC 2DT6A 2UXXA 2BHYA 3DKXA 1D0ZA 4IRGA 3SEZA 5J8CA 2PQ8A 2XGXA 3DLAA 1V5EA 2IPQX 1XTAA 2LK2A 1DGRM 5FKOA 2BHZA 1IZ1A 1WPKA 1RI7A 4BEHB 4XMYA 4MFEA 3BTLA 4PJLA 2K4BA 3TQNA 4BGDA 2XSDC 3SHFA 5DD4A 4ASNA 1ENHA 4BEHA 3GFLA 3ABMH 3HXLA 1K6OA 3FKIJ 4RB2C 3CDHA 5GP9A 5LHGA 3Q3SA 1HBXG 3OYFA 3Q0UA 2GOMA 3GFJA 4N0BA 1QRYA 4V2GA 3ZMTA 4AUXA 1Q1VA 4AWXB 1Q1HA 3CESA 4C30A 3G71I 5BPIA 3FXLA 1U9NA 3CD6I 4RB3C 3HKZA 3FWEA 2DA7A 1ZLKA 2JK3A 4ZZLA 1TTYA 1YYVA 1YITI 3HRSA 1K79A 1B4AA 1ON1A 2DA6A 1XGMA 1FP1D 2DMPA 3A03A 1G3WA 4HF1A 2OF7A 4LB5A 1BOAA 5ICEA 3DEUA 3QPTA 3O2PE 5LLQA 1RUOA 1BR1A 5LRRA 1ZQ3P 2HYJA 2L9NA 1T33A 4OIRF 2KPMA 2IP2A 2X6WA 4JX4A 1CF7B 2HQRA 1K7AA 1B59A 2QENA 3EETA 3HSEA 5A2QK 3V8KA 2O8XA 3CLOA 4M71A 2NOJB 4LITA 2D2WA 1IC8A 4DYCA 3JRIA 4EV0A 2G9WA 5ILVA 2KT0A 1H9GA 1KQ9A 3O8HA 3A0HC 4OWRB 3FM5A 5CJ9A 3EUHA 4YELA 4LGWA 3IHUA 3QP6A 2ESHA 3HKZN 2BZTA 1ZARA 3C18A 4ETSA 1FSHA 3BTIA 1S72I 4F3QA 4ZJZA 1E2XA 1UHMA 2LBFB 3RPQA 1JHFA 2ISYA 4MLOA 5F1RA 2X6OA 3SZPA 1I3AA 5FKMA 2LC2A 5M5XJ 3CZ6A 2KKOA 4Y17A 3HOWJ 4N9IA 2MBFA 3K1PA 2P7VB 5HODA 2GA1A 2RNGA 4I76A 1OMIA 4NB5A 4XN0A 2LY9A 2HXOA 2L7KA 1JTYA 2VJJA 4MNUA 2B9SA 1QA6A 3RKWA 2PJPA 3VWBA 3J7AO 3J80K 3SDGA 2FU4A 4IOAF 4XRMA 3QOEA 1AWCA 2QF7A 4O3MA 1TW2A 1KQ0A 1Y1VJ 3HRTA 2X6XA 2DA5A 2VODA 4EJWA 3B6AA 3UR3C 2H09A 2CRGA 2V79A 3E6MA 1U78A 5J47A 2OPTA 2E36A 3K4CA 1V54H 2DTZA 3OY9A 1ZLJA 4JX5A 1OCCH 3CP2A 1D1BA 4RGUA 2QQ9A 1MW7A 2F48A 2ZJRF 4NUBA 4AYBN 2OZ6A 2XUBA 4IQJA 1T6SA 1JGGA 2OCCH 3U1KA 2CJJA 2FXAA 4AVPA 2LP0A 2NNYA 1P4XA 1JJ8C 2W82A 1D1AA 2VQCA 1DUXC 1FYMA 1J7KA 4ZTJA 3AG1H 3HBLA 3MKZA 1ZGWA 3LMMA 2VUMJ 3HIFA 2COMA 1OYWA 2A61A 4QSHA 1D5VA 1BR4A 3I4PA 1R58A 4BJ5C 1RPWA 4HG2A 1MBGA 2HU9A 4QLCU 3S3OA 2KJBA 1FP2A 1VNDA 1GVDA 1VI0A 1G3SA 1F43A 2M9HA 1K4TA 1HSJA 1WJ5A 2DI3A 5TJJA 5D8KB 3RQIA 2VOOA 5IYDJ 2IXSA 2P5VA 2Y69H 3GW2A 2ZJPF 1LEAA 1FOKA 1BJZA 3MZYA 3MKLA 4XOPA 2DK5A 4NC7A 3UNGC 5JR3A 2KDOA 1J59A 2XSJC 4E4HA 4AC0A 4OIOF 3BLYA 1F1ZA 1S7AA 3D1NI 1ZG5A 3DU5A 1K6YA 2HS5A 2QZ8A 3A2KA 2L5QA 1SD5A 4JK1X 3CCRI 4HNVA 3HOZJ 3K4LA 3C2BA 1R00A 1Z3YA 3GFMA 1OCTC 2XPUA 3E5QA 3O3KA 1O3QA 2ICWG 1VFCA 4RA2A 2DDBA 3FMSA 2QEXI 2CV2A 5IT9K 2B63J 4A3DJ 1HKSA 2IBDA 4J01A 2CH0A 1RNLA 4OOIA 2Z9OA 2HI3A 3OWTA 3CMAI 2M45A 4G7ZF 1FC3A 5B1BH 3V7RA 5E79C 1YJNI 2ECBA 3CO7C 3E6DA 3L9FA 1A5JA 5DTDA 2GZWA 4E7LA 1QPIA 2LH9A 1RIOH 1BW5A 2VL8A 3TL4X 1IJWC 1W4MA 2L7MP 3GTQJ 1ZGJA 2BY2A 3F21A 2STWA 3QPLA 2PX9A 4DYQA 1FYLA 3G4SI 2NNNA 1X4OA 4E7SA 2JPBA 4BE1A 4BHCA 2JWTA 4K2EA 3P9KA 4IVNA 3SEQA 3D0SA 4HEA2 5C44J 3OYEA 1YE9A 2CUZA 4UB8C 3ZCOA 4C9YA 1Z91A 4XQFA 2K9SA 3BCBA 4LIUA 1S3JA 2CQXA 5E1ZB 5EJCA 4YEJA 2R7SA 3F8NA 2L2OA 3ABKH 3HC7A 4S0HB 5GAEJ 3PIOF 4CZZA 4ANJA 4GDFA 3PUFA 2EA2A 3HUGA 3FISA 4P9UA 4NC8A 1EKEA 3RPUD 2KL4A 2CW0F 1IXRC 4A3EJ 3CMYA 4FQGA 4DZJA 3E1SA 2X6YA 3G1MA 3SYTA 2DT7B 3WE2A 1JI8A 1FBSA 4I02A 1HC8A 2RREA 3IH3A 3BT9A 3HOUJ 2EINH 1FEXA 4CA0A 1J2XA 3HHGA 1WJBA 3L09A 4BQNA 2BGCA 1F36A 2DFHA 3M9AA 1KYWA 1OPCA 3LSGA 1EA3A 1RKTA 3JW4A 4HA8A 1X3WB 4RLFA 2P5LC 2H8WA 3AL0B 2NVYJ 4IXAA 2A5WA 3GF2A 1R1TA 4A5MA 3OYCA 2JRTA 4AD9A 4YFNF 3BQZA 1LDDA 2X51A 5FLXZ 3PNTA 4M6XA 3OL4A 2LLKA 5K5QA 2KZGA 1IRGA 2GLOA 3G6EI 3I4MJ 3GTLJ 4EVIA 2FA5A 2DO7A 3GBGA 3KEQA 2W25A 1MBEA 3VSKA 5BS6A 1IUYA 4L0ZB 4G8XA 1U0JA 1AU7A 5BQTA 4ABZA 1LKXA 3CJQB 4S04A 1SD7A 3DU6A 2V6CA 4CSWA 2R7UA 3OR2C 4CYCA 1Y0UA 5J1UA 3U1DA 3P7NA 2NVQJ 3HHHA 2BY0A 2QBYB 3IKTA 1T39A 3HZJA 1VQ4I 1LQ1A 1YTYA 3TO6A 4RMNA 1X2NA 4BL0B 2IVMA 4LJZF 3LAJA 2QBYA 2A6EF 2MLGA 4A3LJ 5FJ8J 3R0JA 2ZMEB 5FFZA 5L3CA 2HOAA 3QODA 5LFAA 2EFWA 4U0YA 5B1AH 2EJRA 1KU2A 1YRNB 1TQMA 2CO5A 4L5IA 2KRHA 3RPUA 5FLVA 4L5JA 2VBZA 1QQIA 3K10A 1LE8B 3ASNH 1W5SA 1MNDA 5J6XA 2PMUA 3M3YJ 3G1LA 3U21A 2DODA 2EILH 3GTPJ 4JP0A 1SD4A 2V26A 3OYAA 1LE8A 3WG9A 4BHPA 3P9IA 5JHUA 2Q2EA 3NAUA 1B72B 1S6LA 1MMGA 2HDWA 3ZMDA 1ODDA 1HKQA 3DQVC 3CO6C 5ILSA 1GT0C 1Z77A 5HS9A 3F9KA 3GLLA 1JHHA 1MGTA 3DXJF 3ZGKA 2HPMA 2ZSIB 2DMUA 2VKEA 4KUMA 1Z3XA 4KMFA 4V19K 3NARA 3QYFA 1Z1DA 1W7PA 1BI2A 3BG5A 3JRHA 4OINF 2LOOA 3KP6A 2Z99A 2PG4A 2HQ5A 2L9RA 5J40A 3HTSB 3BG6A 4F55A 5HNFA 3J80Z 2HOTA 2DFFA 1REPC 1FOWA 4PJNA 4UVCA 1A04A 1H88C 3RSNA 4IKFA 5GTIC 4KISA 3L00A 4R8HA 4EEFG 3PO3J 4A0XA 2XGDA 2HQAA 2DT5A 2RVCA 1B9MA 3LSHA 2EB7A 3FBIB 3JAMZ 5FFXA 2CU7A 3KYDB 1DU6A 4HLXA 4BACA 4C2MJ 2EZHA 2CW8A 1W36D 4IF4A 1VQPI 2LY1A 3RTRA 4OIQF 3HJEA 1GDTA 4ZDLA 4HSTA 2R3SA 3RDIA 4A3MJ 3KYCB 1ZK8A 2IGKA 4PZJA 1XSVA 3ECOA 2O61A 2M5WA 2XHKA 3W2WA 3WGHA 4ZH4F 4DJAA 5HS8A 3LSPA 2HDCA 5E20A 2AQEA 4A6EA 1JUSA 2XC7A 3E5XA 4P96A 5B5EC 2QKMB 1BI3A 3WTTC 3K0LA 2Z2SB 5IYBJ 3ZQGA 3ZQHA 3H9QA 4Y4RA 3MFKA 1YIJI 3KETA 1EH8A 2EFQA 2KRCA 2Y9ZA 1J9IA 2YS9A 3QYBA 3EDPA 3EUAA 4ZYEA 4RLQA 2MGQA 4NHJA 1J09A 2HKOA 5FLMJ 1X58A 3OSGA 2GA2A 2V1NA 3EPZA 5IOYA 3EUKL 4KICA 2DMTA 2HDDA 2JA2A 3A02A 3HRMA 3LQRA 2R93J 3PQJA 1FOYA 2XF7A 3L2UA 3HL2A 1WFXA 1YW8A 2ESNA 3S2WA 4XORA 4ZYAA 4Q4ZF 4MIMA 3VEPA 2VE9A 4HDUA 1TBXA 1OR7A 3KP3A 4A6DA 4CYDA 5GPCA 3HPGA 3I55I 2K3FA 4XLAA 2IA0A 3A4CA 3PSFA 1B6AA 2ID6A 5AONA 4A69C 1JT6A 3WTUC 1P92A 4RB1A 1D0XA 2LDUA 4I0AA 3W2AA 1DDNA 3GVAA 4HV5A 4PSWA 4AIJA 1UCRA 4KIBA 5EEHA 1RRJA 2MG4A 5LHHA 4KDPA 4A93J 4HRIA 1WJAA 1I1GA 4A3GJ 1P4WA 4M3EA 4CCKA 2XGCA 2LREA 3OYIA 4B44A 3J7YJ 2DXIA 1HF0A 1UHSA 1G4DA 2O5RA 1SVLA 5KAFC 1U8BA 3PM1A 2GBYA 2ZB9A 3ZMSA 1LB2A 2P7CB 3BR6A 3J81Z 3MCZA 2JA8J 3HG9A 1ZR4A 1N77A 2N8GA 3BOQA 2QSGX 3KP5A 3GUDA 3TP0A 3RI4A 4BJTA 4LFUA 2EZIA 3K4KA 1O3RA 3WTVC 5E17F 3GX4X 1AA7A 2ID3A 3ZQCA 3PIPF 4D7NA 4UXNA 3I59A 1NK3P 4ESBA 4A3BJ 2OAZA 2BY3A 2LRDA 4XKBA 2QGUA 3A01B 2JUCA 3FM3A 1I6XA 3EUHC 2K9MA 2E34A 2CSOA 3MKYB 3I9V2 1R9TJ 2EFPA 3AG2H 4B09A 5HOOA 2VQHA 3KEOA 2JTVA 2PJRB 1UJ8A 3CUQB 3TBIA 3FXOA 3F72A 3K4MA 3WE3A 4XRSG 3CDLA 1DU0A 2PJRA 1ERDA 3ML6A 2FBKA 2H1KA 3CUQA 1IN6A 2AXTC 1A6IA 2UXNA 1K83J 3VYTB 1U2WA 4B4CA 2MH9A 2FUG2 2G7HA 4N9HA 2K7LA 3JSPA 4I0BA 2HPIA 3ZQLA 3BG7A 4BUPA 3IV5A 3C3WA 3T0YA 2MABA 4XSZF 1Y8RB 2F5FA 1BL0A 2DPDA 4ZYHA 4ESJA 2V9VA 3HDDA 1KU3A 3DCFA 3KZIC 3K70C 2K9NA 4TV7A 2E1NA 2UUZA 1JT0A 4XKCA 1IV8A 2VLAA 2D45A 2A05A 3W2VA 1I1SA 3IL2A 1FPQA 2CUJA 4D5FA 2VXZA 4KT6A 1B1BA 1OJLA 2QVOA 1HW5A 2BW3A 3KZYA 2Y9YA 3DFGA 2LKXA 3MD2A 4MFDA 4UY8I 4BJ6C 5KVRA 5HVQC 1O57A 2YPRA 1T38A 4BHBA 5D5UB 2O9LA 5FKKA 2ZJ2A 3CLQA 2F5EA 5FD5A 5ILUA 3T8RA 3G73A 3JRAA 1WH5A 3OS0A 2CQKA 3IP4B 4UHTA 3QYEA 3OYBA 3OYDA 3FXMA 4LK1F 2W4SA 3MEXA 5EZGA 1OQYA 5GAGJ 3KYLA 2XKPA 1X19A 3HYIA 4C3JJ 2GIVA 2D1HA 3OMYA 2DBBA 3FXJA 2IS1A 2HNHA 2X9DA 4ITVA 1WSUA 1VTNC 2L3DA 1UELB 4I6ZA 1ZTRA 5BPDA 3S16J 3NWTA 5IT3A 1WZ2A 2DA3A 5TISC 1IN8A 1MJBA 5FLXK 3BY6A 4KN4X 3B6CA 2XF5A 2EBIA 4RGRA 3SDBA 5L3EA 4M6YA 2CGPA 1T95A 2CQQA 3E3VA 1HSTA 2OU2A 2DMNA 4LD5A 3IAS2 2DU9A 1X1PA 1YW9A 2VI6A 2V1UA 2W57A 3RKQA 1PYVA 1EF4A 2VE8A 4ZDPA 3JTGA 1Z7UA 2K5CA 5D5XB 1W0UA 1V5FA 3ZP5A 1SC7A 2XB5A 3LAPA 4FE4A 1Z0XA 5FROA 2HKXA 1Y8QB 5IPAA 3PJRA 3QOPA 2E5ZA 1Y1WJ 4V2FA 2WBMA 2ZXJA 2M34A 1E3OC 1X4PA 4U7BA 3EQLF 3SXYA 4BXXJ 2V4JC 4DBRA 4DW6A 5LGUA 1CF7A 2VQGA 4EJOA 1U5TB 2DMQA 1MBKA 2WY8Q 2CFXA 3K7AJ 5E3OA 1YS6A 3MKWB 2DFIA 3M7GA 3PNVA 2R0QC 4OAZA 1YLFA 1SFUA 4C2UA 1U5TA 2WAFA 1GVJA 5HLTA 2FQ3A 4IO9F 1TNSA 1QNTA 2O0YA 4M3BA 3ZQIA 2NRAC 3S17J 2K3PA 2ZNZA 2RDPA 2R5ZB 2VBXA 2RKHA 3H3ZA 1WH7A 1SFEA 1BR2A 5C3EJ 1XSDA 1FWZA 2LBFA 4IHTA 2E1MC 2LMDA 2P4WA 3ABTA 2R5ZA 2R7DA 1H0MA 1J75A 5KCMA 4AYBA 1SVOA 5J1RA 2Y48A 3GZNB 2YUSA 3SQNA 3VYRB 3OOUA 1POGA 3CC7I 2ZFWA 4HNUA 1VQNI 4GYGA 4BH9A 4B47A 1SAXA 4PCQA 1STZA 2Q1ZB 4IPAA 1G3TA 4KJZA 3KE2A 2D1VA 4WXDA 2EZLA 4NDLA 3QU3A 1H89C 4LB6B 5CKTA 1YX3A 1JXSA 2TRTA 3DLLF 1JUPA 4Q47A 1ZHFA 1O4XA 4D5CA 4BKXA 2EQRA 5LRSA 3JAMK 3LSRA 2LKPA 1P9QC 3E6CC 4L18B 1RR7A 5KK1A 1X3UA 2JRMA 4HV6A 5DS9A 5F1JA 2MSYA 5LGTA 2LNBA 3PL8A 4BYYA 2EFNA 5EEGA 4F93B 4XRFA 1FBUA 2QLZA 3GYHX 2P6SA 2WADA 4MEYF 3ESWB 3O6BB 1ETXA 1UB9A 2HTSA 2CV1A 1IDZA 4I99C 3FMQA 5EG0B 5CVIA 5D4RA 5J8FA 3S1MJ 2P5KA 3L2QA 1DPUA 5CVJA 4UVBA 3BR2A 2ELHA 3LSIA 2W1OA 5TRDA 1NH3A 2G7UA 3HM5A 4CICA 3ZQQA 1XGSA 2CFOA 1IV6A 2JMWA 1LVAA 4RGSA 5D4SA 3DKYA 2CWEA 1JKPC 2ADUA 2K86A 4XLFA 3M1CA 4OMZA 3GTKJ 4M9SA 4G94A 5BMZA 5JLWA 3BJOA 1M1EB 2Y0MA 1QHGA 4YFKF 4IHSA 2R92J 1WI9A 5E3NA 4XSXF 2EFOA 4HW0A 1Y6IA 4XK4A 4XIDA 3CCQI 2CQ7A 1G59A 5H6RA 3VPRA 1JTXA 1T0FA 4EQQA 4GYIA 4RAZA 5FRMA 1NTCA 4LK0F 1R5HA 5E1WA 1WQ2A 5F64A 3TDUC 3WODF 2KZVA 2LFBA 4EJVA 2X0LA 4GFBA 1ORKA 1HDDC 1BA5A 2KHMA 3CDIA 2FBIA 1BW6A 4RM2A 5LBQA 4XL9A 3KLOA 3JRGA 4AIKA 3CMEI 5DUIA 2DFEA 2YU3A 1IXSB 4XR6A 3FXRA 5GPAA 2FMYA 3VYSB 3J81K 3BZCA 5M3FJ 5GTHC 5FKNA 4BQAA 1YOVB 4FETA 3FIWA 3JTHA 3SFZA 1O3SA 4ENNA 3T5XA 4W97A 1ZG3A 2IGOA 1KQ8A 1FZPB 3HGYA 3ZR8X 1QHHD 3FMRA 2PN6A 3SJMA 5J1YA 3LSTA 2NS0A 3DV8A 4L0YB 3Q0VA 1P2FA 3FK7A 1K78B 3CMMA 3RYPA 2MD0A 3DEEA 3NRVA 1KZHA 3D5RC 2GXAA 1X1AA 4HZFA 1Y0NA 2HWVA 3QP5A 1VQLI 4UUVA 2VJ4A 3SZTA 1FIPA 1W5CC 4BBSJ 3V42A 1K78A 3BR1A 1L3LA 1VZ0A 3H5NA 2XASA 2L01A 1F4KA 3RKYA 1YQAA 1TZLA 5DUKA 4QPQA 2EA4A 2LTPA 5DCFA 1R49A 3ZMUA 2JA5J 4Y52J 2WB1A 1VQOI 2PLYA 4A5NA 2HGCA 2LD5A 2DJIA 5ERIA 1BIAA 1OCRH 1WI3A 5E3LA 3LA7A 2JVHA 5ICFA 4S05A 5DM7F 4ZC3A 1S29A 1LFBA 2I5UA 3W3CA 3LNQA 4PSXA 3WTYC 4XM3A 4BQOA 3V7SA 4CCJA 4BDZA 2MLKA 2UV1A 3DF8A 3TDZC 4XKVA 2IGNA 1N78A 3OIQA 3T8TA 4AVZA 1TWCJ 2ZXWH 1IN7A 1VQ7I 1S7EA 1R1UA 3C2GA 3OS1A 4L5EA 4Z6YA 3WG7H 1N25A 2L9SA 5CQGA 1H8AC 4JYKA 2J5PA 4M73A 2AQFA 1HQCA 3FKJA 3S2DJ 1IRZA 3TMOA 5CVRA 3GTMJ 1HOMA 5FGMA 1KGSA 3CTAA 3KP2A 2EIKH 2K9LA 2NYXA 5IP9J 2A5YB 1VQ9I 4EJTA 2F2EA 2H1LA 2LYCA 1MD0A 2X1EA 2EIMH 4DOZA 3I54A 4BNCA 4Y15A 3H1CA 1UMQA 5IY5H 3HOYJ 3OYMA 1APLC 2XROA 1FBQA 4KIGA 5HDKA 1BC7C 3BJAA 2WB1N 2FD5A 2X1CA 3CF5F 4AIHA 2QA4I 2E2HJ 1TC3C 3CQZJ 5E1XA 2KIFA 2KRFA 2ZFUA 5DCMB 3F0CA 2V1XA 1OCPA 4BAYA 2F4OB 1E3PA 3ZQ7A 1HA8A 2IT0A 2DA1A 3I53A 3ZMVA 2DDAA 1YJWI 2IS6A 1I50J 1RETA 1PUEE 3DKWA 2DA2A 2ACJA 1R6RA 1ZN2A 1UG2A 3KPHA 3OYKA 1W0TA 3TO7A 1R4NB 4KYWA 2Y30A 2VC0A 3R6SA 2BXYA 2HYFA 2ZMEA 4BS9A 1FX7A 1Y39A 4U88A 3WTXC 4A3IJ 3OV8A 3VOEA 1UAAA 3L7WA 2P6TA 1YRNA 1AKHB 3CC2I 2GXGA 1EH7A 5K5OA 3RZDJ 3IUOA 3S32A 4J00A 4CCLA 1IRFA 4G7HF 3AFHA 4XOTA 1OCOH 2O7OA 3NQOA 4I09A 1WJFA 4QWQA 2OZUA 5L3DA 2H8RA 2I10A 5JI6A 1BIBA 3S1QJ 1N75A 1TWFJ 3I0TA 2IRFG 3DP7A 4RS8A 2MC4A 1DP3A 1WJEA 1VQ6I 1PJRA 2A69F 2XIGA 1B72A 2XRNA 3M1EA 4B48A 4XICA 2OV7A 1HLVA 4FT8A 4E7KA 4DZPA 1RUNA 4EM0B 2HZDA 2PBIA 1PP7U 3KFWX 1IW7F 5GADJ 1IAWA 2MYSA 3UKGA 4M74A 1YG2A 2CQNA 4PJJA 1MDMB 3PO2J 1BC8C 1Z6TA 1ETYA 1LVKA 2FJ1A 3K4NA 1YW7A 4U0WA 1MDMA 3HTUA 1FMVA 3ECHA 1VQKI 5HLGA 1T8IA 4B3AA 3V8LA 1JE8A 5HDNA 1DP7P 5BNGA 2BYVE 1MKMA 3KEYA 2QSFX 1R4MB 2BVLA 4O6JA 5CLSA 3OYGA 1R71A 1IRXA 2VPRA 3F6OA 3P9CA 3AG4H 2FOWA 2VQLA 4H4KC 1YI2I 2M0CA 3CC4I 3CCEI 1E3HA 1RC9A 2EIJH 1U8RA 1ETQA 2AO9A 2D5VA 1P6RA 1XN7A 4HDVA 1UZCA 1ZAOA 3AAFA 1E17A 1G6NA 2PFBA 3IWFA 2EZKA 1LFPA 4I7HA 4CGZA 4OIPF 5E8GA 3R0AA 1WWXA 5M5YJ 1GV5A 3L2CA 1ZRFA 1CQTA 3L2VA 1JJ6C 4IEJA 3VODA 2V9KA 3PSIA 3Q0WA 2JUGA 2FOKA 4ZTFA 4GXOA 5HDGA 2PI0A 1Z05A 5H2FC 2CS3A 2M87A 2YR2A 2V7FA 2P8TA 5KNLA 2GQQA 4X0GA 1XSXA 3BPVA 2M4GA 3LFKA 1XMXA 1FNNA 4C3IJ 2R7ZJ 2GOXB 3K9TA 4F52A 1OISA 3R61A 3WU2C 1VQ8I 1W5TA 4KT5C 2DQRA 2YX7A 4LLLA 4EJUA 3KLNA 3ERMA 1WCMJ 4XONA 4DQ2A 3F6VA 3MWMA 3TOAA 3H35A 2XAUA 3CJTB 3Q9VA 4L9JA 5FKLA 1Z6RA 2E7XA 3QQAA 3BR3A 3DPUA 3V8JA 2HEOA 4H0EA 2WAQA 3ABUA 2DTRA 1YIOA 3BR5A 4ZYGA 3ZN0A 2IA1A 4W1UA 5IP6A 2MH2A 2OQRA 5E18F 3OYNA 2FNAA 2WA0A 2L54A 4OMYA 5JVGF 2QQ8A 4CCOA 1OYYA 2FNPA 1ETKA 2QYOA 3RQ4A 5DDGA 2JQ7A 3W6JB 3ROUA 4MHGA 3H36A 5ICGA 1IN4A 3F8CA 1SFOJ 2GXBA 2JA7J 2MC3A 4PUSA 2Z5UA 1QGPA 5CPRB 3N4MA 2DN0A 3FHZA 2JT1A 4L9VA 2M30A 3FZVA 2JN6A 2VPLA 2GM4A 3CCVI 3PFYA 4RBOA 5K7FA 2WV0A 1MH3A 4HYEA 4RDUA 2ZJQF 2DYRH 4GRIA 5BOXA 1XGOA 2EV0A 4WXCA 2M0MA 5ED4A 2VB6A 2O8KA 1IUFA 3MZHA 3DBRB 1TW3A 1XD7A 3TGNA 2E35A 2WAQN 2ZXHA 2WC2A 1K4SA 1ZYRF 3MAJA 3GLXA 3ASOH 5IP7J 3CP8A 1QZZA 4MTEA 3A01A 4BY1J 2Y2ZA 1I6HJ 2DLLA 2ISZA 5FO5A 4II3A 1JKRC 3S8PA 1U3EM 3K4JA 4O5VA 1YS7A 2NXNB 2PEXA 4ZYDA 2E60A 4RB0A 3ZN1A 1B8IB 2J5OA 2XKOA 2CMPA 1YO5C 3REOA 4YFXF 1I27A 2ETHA 2FRHA 3WTSC 4HNTA 2CG4A 1V55H 3K1MA 2LY2A 4I01A 1KYZA 3FDYA 4IL6C 4CDGA 1SVMA 3LSMA 3QPSA 3WTWC 4IHWA 3WGGA 2A6HF 4UV9A 4Z2YA 1GXPA 4DGWB 4DIQA 2VONA 3ISPA 2M7AA 3BDDA 4I98B 2F5CA 3BTJA 3S1RJ 1UHWA 3I3LA 4G6DA 4YIRX 3K2ZA 3IRQA 1T08B 4RGXA 2BV6A 5GAHJ 5C4JJ 4RAYA 3RIRA 4U0VA 3U9GA 2BOLA 2UZKA 3K6GA 3RJPA 2Z33A 5HLHA 2ZNYA 4UVAA 2BBYA 1S9HA 5CYVA 2ZKZA 4QTRA 1L0OC 2F6CA 4HBLA 3SZGA 1DGWY 4PJ0C 4G6QA 5F0CA 5M3MJ 3DTKA 4WX9A 4HF2A 2HZTA 3AG3H 4IHYA 4YIIA 4J19A 5L3GA 3EYYA 2EK5A 1TLHB 2X85A 4II2A 5EGOB 1KA8A 2AXLA 1H9TA 3ZMZA 3S93A 4LOCA 4R1HA 2NVUB 2MD5A 4AU7A 2BVMA 1XC5A 2K27A 4GO1A 4ENJA 1BI1A 2OBPA 5EGOA 3HOTA 2R7RA 1MMSA 1A6QA 2NVTJ 2R7TA 2FMLA 1D1CA 2VIXA 2K85A 4D9JA 1BI0A 1XDUA 3FK6A 1Z21A 5C4XJ 2W00A 1FSEA 5DV5A 3GWZA 1T56A 2WTEA 5D8LB 1Y56A 3PQKA 3ZPLA 2ELKA 3ZXSA 2UWMA 3LA2A 4E7IA 4LIVA 3BC8A 3QU6A 2XF6A 1D3YA 1R7JA 2ZO4A 3L1PA 3LWFA 3OOPA 2ELJA 2ECCA 1LJ9A 3DPTA 3E5UA 4XLNF 3E7LA 4HPQA 4FASD 4A0ZA 4FHTA 4UNOA 1F9NA 2HYGD 2EV6A 2QWWA 1ITYA 1USSA 3GMEA 1QZYA 1U6GA 2FF4A 1T0FC 2M4KA 2RGVA 3FF5A 2VKHA 3FHNA 4PFPA 3S2HJ 2KISA 2H6CA 3IAM2 1MJ9A 2R7QA 3VDXA 1D5YA 4G7OF 2V1DA 3GFIA 1LDKB 2EV5A 5M5WJ 1XCVA 1FTZA 1MMAA 4OU0A 5HNHA 3F3XA 4AM3A 1ETVA 2O03A 2NAZA 4BQQA 1IGNA 1BM9A 3QAHA 3K70D 1XX5A 3LA3A 2QKLB 1G3YA 1QBJA 3RZOJ 2YSRA 2HVSA 3R60A 2KIUA 4P55A 4XNFA 4IHVA 4LG0B 4KIFA 1LEBA 2R7WA 3MN2A 5DM6F 3IH2A 2ZC2A 3TW7A 3S1NJ 4HX7A 3OYLA 1ONVA 1WRJA 2WV1A 4LG0A 4A2UA 2DAOA 1JGSA 2TDXA 1FY7A 2F5VA 2DA4A 2OJED 3WGIA 5K1YA 3L2RA 4UUTA 4QIWN 2OUMA 4A3FJ 4HQEA 2AS5F 2XAGA 2ZXIA 4KFCA 3ZOBA
chains in the Genus database with same CATH topology
1QVTA 2HQ5A 3FK7A 2L9RA 3LOCA 1B8IA 4X6AJ 2LR8A 2L7ZA 3H3VK 2HOTA 1FIPA 4BBSJ 1IDYA 1RESA 2Y0SN 5F27A 1H88C 1AHDP 2XGEA 3BR1A 3S14J 1ZKGA 2FQ4A 1VF9A 3JR9A 4EEFG 5EDNA 2G0EA 3PO3J 2NOGA 2XGDA 1P7IA 3HEFA 3JRDA 2LTPA 3JRCA 1QVUA 2CU7A 1MSEC 1DU6A 4C2MJ 2EZHA 2JA5J 4Y52J 2K40A 3S15J 3I4NJ 2LD5A 3BG9A 2IEKA 2R5YB 1WI3A 1GUUA 5E3LA 1GDTA 2AHQA 4FCYA 2MW8A 3TW6A 4A3MJ 3HGGA 1ZK8A 3BR0A 1LFBA 3LNQA 2ME0A 2R5YA 4FTHA 1MH4A 2NS7A 1JUMA 3DEWA 1TWCJ 1ETOA 2HOSA 1S7EA 3LSPA 4L5EA 2XPWA 2E2IJ 1OFCX 1JUSA 4XRSA 1H8AC 4JYKA 4C3HJ 2XPVA 5IYBJ 3ZQGA 3ZQHA 1LFUP 1MNMC 3S2DJ 1IRZA 3GTMJ 1HOMA 2LK2A 2K9QA 5FKOA 2ME6A 2Y9ZA 5IP9J 5EG0A 2YS9A 1WPKA 2MGQA 4MFEA 3BTLA 5FLMJ 1X58A 3OSGA 2CUFA 1UMQA 5IOYA 3GTOJ 2XSDC 2DMTA 3HOYJ 4A3KJ 1ENHA 1APLC 2HDDA 3A02A 2R93J 2WB1N 2FD5A 3FKIJ 2E2HJ 5GP9A 1TC3C 4MIMA 3CQZJ 3Q3SA 3F0CA 5JLXA 1OCPA 3H0GJ 3Q0UA 5GPCA 2DA1A 1QRYA 2ID6A 4V2GA 4AUXA 1Q1VA 4A69C 1JT6A 1I50J 1RETA 5E3MA 2XRLA 1U9NA 2DA2A 3JRBA 4A3CJ 2L7FP 1UG2A 2MG4A 4A93J 1W0TA 2PMZN 2DA7A 2Y30A 2JK3A 4A3GJ 4A3IJ 4M3EA 2DA6A 2XGCA 1HF0A 1UHSA 1YRNA 2E1OA 2DMPA 1AKHB 3A03A 4MO7A 2OF7A 3RZDJ 3PM1A 1U8BA 2GBYA 2ZB9A 3BR6A 2E2JJ 1ZQ3P 1GV2A 2JA8J 1ZR4A 2Y31A 2O7OA 2N8GA 2H8RA 2HYJA 2I10A 1T33A 3TP0A 4JX4A 3S1QJ 1TWFJ 2EZIA 1K61A 1MBJA 3HOXJ 2L0KA 2ID3A 3ZQCA 1B72A 1ZR2A 3BQYA 2EH3A 4D7NA 4XICA 1HLVA 1NK3P 4A3BJ 4DZPA 1IC8A 4DYCA 3JRIA 2KT0A 3A01B 3O8HA 3UKGA 3TEDA 1R9TJ 3HKZN 4M3DA 3BTIA 3PO2J 1ETYA 4M3GA 2E19A 2FJ1A 4MLOA 2X6OA 5FKMA 4B3AA 4XRSG 5M5XJ 3CDLA 3HOWJ 5BNGA 1DU0A 4D7MA 2H1KA 1A6IA 1XG1A 3WHBA 5HODA 1K83J 2VPRA 4I76A 4B4CA 4JX6A 5EYRA 4M6VA 3ZQLA 2LY9A 1TWHJ 2M0CA 2HXOA 3IV5A 1JTYA 1BL0A 1ETQA 2AO9A 3SDGA 3BTCA 3HDDA 2D5VA 3DCFA 5J3LA 4XRMA 2K9NA 2QF7A 1JT0A 1Y1VJ 2QCOA 2EZKA 2DA5A 2IAIA 4D5FA 3B6AA 5M5YJ 2CRGA 1GV5A 1OJLA 5F04A 1SANA 1U78A 2Y9YA 1CQTA 2LKXA 1MBFA 1JJ6C 2OPTA 4IEJA 4MFDA 2JA6J 3Q0WA 2DTZA 1MBHA 4JX5A 2O9LA 5FKKA 4B1RA 3K2AA 3JRAA 1WH5A 1U9OA 4AYBN 3W6VA 4C3IJ 2R7ZJ 1JGGA 2CJJA 2LP0A 5EZGA 1JJ8C 3GTGJ 1WCMJ 4C3JJ 2X9DA 3HBLA 5FKLA 4I6ZA 1ZGWA 2VUMJ 5F0FA 1ZTRA 3QQAA 3BR3A 3S16J 2LVSA 1IG7A 4QSHA 2DA3A 2W48A 3BR5A 1RPWA 1MBGA 4W1UA 3B6CA 5IP6A 5EF6A 1VNDA 2EBIA 1GVDA 1VI0A 4CYCB 1F43A 2M9HA 2CQQA 2DMNA 3RQIA 2FX0A 1ETKA 2VI6A 3RKQA 5IYDJ 4DYRA 2HXIA 1BJZA 1SFOJ 2JA7J 1EF4A 1W0UA 3MKLA 3SFIA 2DN0A 1AKHA 2XB5A 4FE4A 1Z0XA 2JN6A 2GM4A 5IPAA 5EZHA 4AC0A 4RBOA 3D1NI 5K7FA 4V2FA 1MH3A 4RDUA 1Y1WJ 2M34A 1TWAJ 1E3OC 3HOZJ 4HNVA 3C2BA 4Y7NJ 1OCTC 2XPUA 4BXXJ 4DW6A 2O8KA 1ETWA 1IUFA 1VFCA 2DMQA 1MBKA 3K7AJ 5E3OA 4X1EA 3HOVJ 2WAQN 3GTJJ 1X2MA 1TWGJ 2R0QC 2B63J 4A3DJ 2IBDA 2HI3A 4M3BA 3ZQIA 5IP7J 3S17J 3A01A 2ECBA 4BY1J 2Y2ZA 1A5JA 2R5ZB 5DTDA 1I6HJ 1WH7A 1JKRC 1QPIA 5C3EJ 3O8GA 1BW5A 1IJWC 4IHXA 2DJNA 2L7MP 3GTQJ 2R5ZA 1B8IB 3QPLA 4DYQA 5J1RA 2YUSA 3OOUA 1POGA 2JWTA 4IHWA 3ZQFA 3QPSA 5C44J 4BBRJ 5F0HA 2EZLA 3G1OA 2VKVA 4NDLA 1H89C 3HB9A 3WHCA 2K9SA 3JRFA 2CQXA 1P7JA 2TRTA 3BTJA 3S1RJ 1JKOC 1JUPA 5K7HA 2JJ7A 4S0HB 1O4XA 4D5CA 5C4JJ 1PUFB 4BKXA 3IH4A 2EQRA 3LSRA 3FISA 1RR7A 1PUFA 4QTRA 4A3EJ 5DS9A 5F1JA 3CMYA 2MSYA 5F0CA 4DZJA 5M3MJ 2KDZA 3G1MA 4IHYA 4G12A 2RAEA 4J19A 3IH3A 3BT9A 3HOUJ 1FJLA 1FEXA 2P81A 5IOZA 5EGOB 1WGXA 2X48A 1ETXA 1F36A 3LSGA 1RKTA 4LOCA 1IDZA 5IYCJ 3JREA 1XC5A 1FTTA 3MVPA 5EG0B 5EGOA 1XS9A 1RKWA 1MSFC 2NVXJ 2NVYJ 3S1MJ 1G2HA 2CUEA 2NVTJ 1HCRA 3BR2A 3BQZA 4FISA 3FK6A 3HM5A 5C4XJ 2LLKA 9ANTA 2GLOA 3I4MJ 3GTLJ 1IV6A 1T56A 2JMWA 3GBGA 1JKPC 1MBEA 2ELKA 1AU7A 4ABZA 3GTKJ 3LSJA 4FE7A 5JLWA 5EEAA 1JKQC 2M2EA 3CCYA 3L1PA 2ECCA 2R92J 4CYCA 3E7LA 5J1UA 5E3NA 2NS8A 2NVQJ 4XK4A 4XIDA 1ITYA 1X2NA 1HDPA 1JTXA 3VPRA 2YU9J 1NK2P 1FIAA 4A3LJ 1NTCA 5FJ8J 3S2HJ 2HOAA 2XB0X 4UUSB 2COBA 4BY7J 2M8GX 1D5YA 1I3QJ 2LFBA 5M5WJ 1YRNB 4M3FA 1FTZA 3OSFA 4UUSA 1ORKA 2TCTA 1HDDC 1ETVA 4GFBA 5FLVA 1BA5A 1IGNA 1BW6A 3JRGA 1LE8B 3RZOJ 3M3YJ 3G1LA 3GTPJ 4A3JJ 4JP0A 3TP3A 5GPAA 4IHVA 1LE8A 3M4OJ 5M3FJ 5FKNA 3MN2A 3NAUA 1B72B 3IH2A 3FIWA 3TW7A 3S1NJ 2WV1A 1GT0C 1Z77A 2DA4A 4W97A 3OIOA 3BG3A 5F08A 2DMUA 4UUTA 2VKEA 4QIWN 3HGYA 4A3FJ 3NARA 5K7ZA 3BG5A 3JRHA 3SJMA 5J1YA 3ZOBA 3Q0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVT A;  2HQ5 A;  3FK7 A;  2L9R A;  3LOC A;  1B8I A;  4X6A J;  2LR8 A;  2L7Z A;  3H3V K;  2HOT A;  1FIP A;  4BBS J;  1IDY A;  1RES A;  2Y0S N;  5F27 A;  1H88 C;  1AHD P;  2XGE A;  3BR1 A;  3S14 J;  1ZKG A;  2FQ4 A;  1VF9 A;  3JR9 A;  4EEF G;  5EDN A;  2G0E A;  3PO3 J;  2NOG A;  2XGD A;  1P7I A;  3HEF A;  3JRD A;  2LTP A;  3JRC A;  1QVU A;  2CU7 A;  1MSE C;  1DU6 A;  4C2M J;  2EZH A;  2JA5 J;  4Y52 J;  2K40 A;  3S15 J;  3I4N J;  2LD5 A;  3BG9 A;  2IEK A;  2R5Y B;  1WI3 A;  1GUU A;  5E3L A;  1GDT A;  2AHQ A;  4FCY A;  2MW8 A;  3TW6 A;  4A3M J;  3HGG A;  1ZK8 A;  3BR0 A;  1LFB A;  3LNQ A;  2ME0 A;  2R5Y A;  4FTH A;  1MH4 A;  2NS7 A;  1JUM A;  3DEW A;  1TWC J;  1ETO A;  2HOS A;  1S7E A;  3LSP A;  4L5E A;  2XPW A;  2E2I J;  1OFC X;  1JUS A;  4XRS A;  1H8A C;  4JYK A;  4C3H J;  2XPV A;  5IYB J;  3ZQG A;  3ZQH A;  1LFU P;  1MNM C;  3S2D J;  1IRZ A;  3GTM J;  1HOM A;  2LK2 A;  2K9Q A;  5FKO A;  2ME6 A;  2Y9Z A;  5IP9 J;  5EG0 A;  2YS9 A;  1WPK A;  2MGQ A;  4MFE A;  3BTL A;  5FLM J;  1X58 A;  3OSG A;  2CUF A;  1UMQ A;  5IOY A;  3GTO J;  2XSD C;  2DMT A;  3HOY J;  4A3K J;  1ENH A;  1APL C;  2HDD A;  3A02 A;  2R93 J;  2WB1 N;  2FD5 A;  3FKI J;  2E2H J;  5GP9 A;  1TC3 C;  4MIM A;  3CQZ J;  3Q3S A;  3F0C A;  5JLX A;  1OCP A;  3H0G J;  3Q0U A;  5GPC A;  2DA1 A;  1QRY A;  2ID6 A;  4V2G A;  4AUX A;  1Q1V A;  4A69 C;  1JT6 A;  1I50 J;  1RET A;  5E3M A;  2XRL A;  1U9N A;  2DA2 A;  3JRB A;  4A3C J;  2L7F P;  1UG2 A;  2MG4 A;  4A93 J;  1W0T A;  2PMZ N;  2DA7 A;  2Y30 A;  2JK3 A;  4A3G J;  4A3I J;  4M3E A;  2DA6 A;  2XGC A;  1HF0 A;  1UHS A;  1YRN A;  2E1O A;  2DMP A;  1AKH B;  3A03 A;  4MO7 A;  2OF7 A;  3RZD J;  3PM1 A;  1U8B A;  2GBY A;  2ZB9 A;  3BR6 A;  2E2J J;  1ZQ3 P;  1GV2 A;  2JA8 J;  1ZR4 A;  2Y31 A;  2O7O A;  2N8G A;  2H8R A;  2HYJ A;  2I10 A;  1T33 A;  3TP0 A;  4JX4 A;  3S1Q J;  1TWF J;  2EZI A;  1K61 A;  1MBJ A;  3HOX J;  2L0K A;  2ID3 A;  3ZQC A;  1B72 A;  1ZR2 A;  3BQY A;  2EH3 A;  4D7N A;  4XIC A;  1HLV A;  1NK3 P;  4A3B J;  4DZP A;  1IC8 A;  4DYC A;  3JRI A;  2KT0 A;  3A01 B;  3O8H A;  3UKG A;  3TED A;  1R9T J;  3HKZ N;  4M3D A;  3BTI A;  3PO2 J;  1ETY A;  4M3G A;  2E19 A;  2FJ1 A;  4MLO A;  2X6O A;  5FKM A;  4B3A A;  4XRS G;  5M5X J;  3CDL A;  3HOW J;  5BNG A;  1DU0 A;  4D7M A;  2H1K A;  1A6I A;  1XG1 A;  3WHB A;  5HOD A;  1K83 J;  2VPR A;  4I76 A;  4B4C A;  4JX6 A;  5EYR A;  4M6V A;  3ZQL A;  2LY9 A;  1TWH J;  2M0C A;  2HXO A;  3IV5 A;  1JTY A;  1BL0 A;  1ETQ A;  2AO9 A;  3SDG A;  3BTC A;  3HDD A;  2D5V A;  3DCF A;  5J3L A;  4XRM A;  2K9N A;  2QF7 A;  1JT0 A;  1Y1V J;  2QCO A;  2EZK A;  2DA5 A;  2IAI A;  4D5F A;  3B6A A;  5M5Y J;  2CRG A;  1GV5 A;  1OJL A;  5F04 A;  1SAN A;  1U78 A;  2Y9Y A;  1CQT A;  2LKX A;  1MBF A;  1JJ6 C;  2OPT A;  4IEJ A;  4MFD A;  2JA6 J;  3Q0W A;  2DTZ A;  1MBH A;  4JX5 A;  2O9L A;  5FKK A;  4B1R A;  3K2A A;  3JRA A;  1WH5 A;  1U9O A;  4AYB N;  3W6V A;  4C3I J;  2R7Z J;  1JGG A;  2CJJ A;  2LP0 A;  5EZG A;  1JJ8 C;  3GTG J;  1WCM J;  4C3J J;  2X9D A;  3HBL A;  5FKL A;  4I6Z A;  1ZGW A;  2VUM J;  5F0F A;  1ZTR A;  3QQA A;  3BR3 A;  3S16 J;  2LVS A;  1IG7 A;  4QSH A;  2DA3 A;  2W48 A;  3BR5 A;  1RPW A;  1MBG A;  4W1U A;  3B6C A;  5IP6 A;  5EF6 A;  1VND A;  2EBI A;  1GVD A;  1VI0 A;  4CYC B;  1F43 A;  2M9H A;  2CQQ A;  2DMN A;  3RQI A;  2FX0 A;  1ETK A;  2VI6 A;  3RKQ A;  5IYD J;  4DYR A;  2HXI A;  1BJZ A;  1SFO J;  2JA7 J;  1EF4 A;  1W0U A;  3MKL A;  3SFI A;  2DN0 A;  1AKH A;  2XB5 A;  4FE4 A;  1Z0X A;  2JN6 A;  2GM4 A;  5IPA A;  5EZH A;  4AC0 A;  4RBO A;  3D1N I;  5K7F A;  4V2F A;  1MH3 A;  4RDU A;  1Y1W J;  2M34 A;  1TWA J;  1E3O C;  3HOZ J;  4HNV A;  3C2B A;  4Y7N J;  1OCT C;  2XPU A;  4BXX J;  4DW6 A;  2O8K A;  1ETW A;  1IUF A;  1VFC A;  2DMQ A;  1MBK A;  3K7A J;  5E3O A;  4X1E A;  3HOV J;  2WAQ N;  3GTJ J;  1X2M A;  1TWG J;  2R0Q C;  2B63 J;  4A3D J;  2IBD A;  2HI3 A;  4M3B A;  3ZQI A;  5IP7 J;  3S17 J;  3A01 A;  2ECB A;  4BY1 J;  2Y2Z A;  1A5J A;  2R5Z B;  5DTD A;  1I6H J;  1WH7 A;  1JKR C;  1QPI A;  5C3E J;  3O8G A;  1BW5 A;  1IJW C;  4IHX A;  2DJN A;  2L7M P;  3GTQ J;  2R5Z A;  1B8I B;  3QPL A;  4DYQ A;  5J1R A;  2YUS A;  3OOU A;  1POG A;  2JWT A;  4IHW A;  3ZQF A;  3QPS A;  5C44 J;  4BBR J;  5F0H A;  2EZL A;  3G1O A;  2VKV A;  4NDL A;  1H89 C;  3HB9 A;  3WHC A;  2K9S A;  3JRF A;  2CQX A;  1P7J A;  2TRT A;  3BTJ A;  3S1R J;  1JKO C;  1JUP A;  5K7H A;  2JJ7 A;  4S0H B;  1O4X A;  4D5C A;  5C4J J;  1PUF B;  4BKX A;  3IH4 A;  2EQR A;  3LSR A;  3FIS A;  1RR7 A;  1PUF A;  4QTR A;  4A3E J;  5DS9 A;  5F1J A;  3CMY A;  2MSY A;  5F0C A;  4DZJ A;  5M3M J;  2KDZ A;  3G1M A;  4IHY A;  4G12 A;  2RAE A;  4J19 A;  3IH3 A;  3BT9 A;  3HOU J;  1FJL A;  1FEX A;  2P81 A;  5IOZ A;  5EGO B;  1WGX A;  2X48 A;  1ETX A;  1F36 A;  3LSG A;  1RKT A;  4LOC A;  1IDZ A;  5IYC J;  3JRE A;  1XC5 A;  1FTT A;  3MVP A;  5EG0 B;  5EGO A;  1XS9 A;  1RKW A;  1MSF C;  2NVX J;  2NVY J;  3S1M J;  1G2H A;  2CUE A;  2NVT J;  1HCR A;  3BR2 A;  3BQZ A;  4FIS A;  3FK6 A;  3HM5 A;  5C4X J;  2LLK A;  9ANT A;  2GLO A;  3I4M J;  3GTL J;  1IV6 A;  1T56 A;  2JMW A;  3GBG A;  1JKP C;  1MBE A;  2ELK A;  1AU7 A;  4ABZ A;  3GTK J;  3LSJ A;  4FE7 A;  5JLW A;  5EEA A;  1JKQ C;  2M2E A;  3CCY A;  3L1P A;  2ECC A;  2R92 J;  4CYC A;  3E7L A;  5J1U A;  5E3N A;  2NS8 A;  2NVQ J;  4XK4 A;  4XID A;  1ITY A;  1X2N A;  1HDP A;  1JTX A;  3VPR A;  2YU9 J;  1NK2 P;  1FIA A;  4A3L J;  1NTC A;  5FJ8 J;  3S2H J;  2HOA A;  2XB0 X;  4UUS B;  2COB A;  4BY7 J;  2M8G X;  1D5Y A;  1I3Q J;  2LFB A;  5M5W J;  1YRN B;  4M3F A;  1FTZ A;  3OSF A;  4UUS A;  1ORK A;  2TCT A;  1HDD C;  1ETV A;  4GFB A;  5FLV A;  1BA5 A;  1IGN A;  1BW6 A;  3JRG A;  1LE8 B;  3RZO J;  3M3Y J;  3G1L A;  3GTP J;  4A3J J;  4JP0 A;  3TP3 A;  5GPA A;  4IHV A;  1LE8 A;  3M4O J;  5M3F J;  5FKN A;  3MN2 A;  3NAU A;  1B72 B;  3IH2 A;  3FIW A;  3TW7 A;  3S1N J;  2WV1 A;  1GT0 C;  1Z77 A;  2DA4 A;  4W97 A;  3OIO A;  3BG3 A;  5F08 A;  2DMU A;  4UUT A;  2VKE A;  4QIW N;  3HGY A;  4A3F J;  3NAR A;  5K7Z A;  3BG5 A;  3JRH A;  3SJM A;  5J1Y A;  3ZOB A;  3Q0V A; 
#chains in the Genus database with same CATH topology
 3MMY B;  3MZ8 A;  1VQ5 I;  3S3M A;  4P5O A;  2Y75 A;  4E6K G;  1ZRE A;  2L7Z A;  5FB2 A;  3BCA A;  1T2K A;  3F23 A;  1IDY A;  4YG2 F;  5JHF A;  3A1Y A;  5F27 A;  2XGE A;  2GIZ A;  3NWS A;  1SFK A;  1MIJ A;  1ZKG A;  1VF9 A;  2HTJ A;  2E1C A;  1S8N A;  4IRI A;  5EDN A;  2G0E A;  3EYI A;  1P7I A;  3TKY A;  1YFH A;  3HEF A;  1QZE A;  3CCS I;  3JRD A;  3WU1 B;  4CO8 A;  3JRC A;  5J4V A;  1QVU A;  1TP4 A;  1MSE C;  1PVE A;  1X1C A;  4IQ4 A;  1FLI A;  2L9V A;  3S15 J;  3BG9 A;  3H3U A;  2IEK A;  2R5Y B;  5AIP A;  2EPF A;  2MW8 A;  2K02 A;  3CUO A;  3BR0 A;  4CH7 A;  1IF1 A;  1OLT A;  1XB4 A;  2ME0 A;  3M8J A;  2R5Y A;  4LG3 A;  2OTJ I;  1ZRD A;  1R5I D;  2NS7 A;  2BXZ A;  2M7B A;  2CW7 A;  1ETO A;  2HOS A;  1FMW A;  2WAE A;  3IWZ A;  2HFH A;  3CCJ I;  1CGP A;  3U2R A;  5L3B A;  2CYY A;  2PMZ A;  3A0B C;  2KFD A;  1LFU P;  2Q0O A;  4PJM A;  2FBH A;  2K9Q A;  4F7Z A;  2KP6 A;  2ME6 A;  1R36 A;  3I71 A;  5EG0 A;  1YJ9 I;  1GLN A;  5CQE A;  3AL0 C;  1EJ9 A;  2LG4 A;  5D5V B;  3DTI A;  4LMY A;  3WU0 A;  2VBW A;  2CUF A;  3W6K B;  3GTO J;  4MQV A;  2R7V A;  4A3K J;  4HOB A;  4B3X A;  3KIO A;  1HW1 A;  4P9F A;  4XN3 A;  4HF0 A;  1MNE A;  4RM3 A;  5JLX A;  3E6B A;  3H0G J;  2FSW A;  3CF2 A;  3PUB A;  3IC7 A;  4WXH A;  4Y13 A;  3D5L A;  3H9G A;  2VXD A;  5JVT A;  5E3M A;  2XRL A;  2K4J A;  4KA4 A;  2QM3 A;  3JRB A;  1TNT A;  4A3C J;  2L7F P;  3COA C;  2OQG A;  1YX5 A;  2DW4 A;  2PMZ N;  4Y33 A;  2W85 A;  2DYS H;  2X1D A;  3GXO A;  2QQA A;  2ZME C;  3Q5F A;  1ZH5 A;  4A12 A;  3I56 I;  1XMK A;  1PP8 F;  3K4B A;  4KMU X;  2E1O A;  3T1B A;  2KMU A;  4MO7 A;  4NQW B;  1BN5 A;  2XDV A;  3AKZ A;  3H0D A;  3PNY A;  4BXU A;  1YHQ I;  4L9N A;  2E2J J;  1F5T A;  1EV7 A;  1GV2 A;  2Y31 A;  4NQW A;  4XBF A;  3IRR A;  1LUJ B;  4WCG A;  3B02 A;  4UV8 A;  2ZSH B;  2Q8K A;  3HPH A;  1A36 A;  4E7J A;  1FT9 A;  1K61 A;  3M8F A;  1MBJ A;  3J7A Y;  3HOX J;  1OCZ H;  1XGN A;  2BEO A;  2L0K A;  2IA2 A;  4E7Z A;  4OAY A;  3QWL A;  3D5S C;  1ZR2 A;  3BQY A;  2EH3 A;  4U7D A;  3K69 A;  2M3A A;  1I5Z A;  5KHD A;  3BZK A;  2L02 A;  4BU2 A;  4HLY A;  1TT5 B;  3X2Q H;  3CCL I;  2DOE A;  4FX0 A;  2OD5 A;  1ZEL A;  4L9T A;  2W7N A;  3DBH B;  4EGZ A;  2DOF A;  3TED A;  3N97 A;  4XLP F;  4CXF A;  2BE5 F;  3DWL E;  2JZY A;  4M3D A;  1WJC A;  4AID A;  5F6F A;  4M3G A;  2E19 A;  2KIQ A;  2OTL I;  4RAG A;  2E1M B;  1FYK A;  4IOC F;  4A0Y A;  2XAH A;  3LQQ A;  3MQ0 A;  3ULQ B;  4IX7 A;  1TT0 A;  3V4G A;  5LEJ A;  2DQL A;  2DCE A;  4D7M A;  3OIP A;  3CJR B;  3E0J B;  1XG1 A;  3WHB A;  1C0W A;  3ABL H;  4MEX F;  1EH6 A;  4JX6 A;  5EYR A;  2QSH X;  3RCO A;  2LKS A;  4M6V A;  4N4N B;  1AOY A;  3G3Z A;  4YIF A;  5TGT A;  2VC1 A;  4DNC A;  1TWH J;  4KIT B;  1SFX A;  4Q5S F;  1TL8 A;  3GZ5 A;  4D1Q A;  3DPL C;  1D8K A;  2IJL A;  3BTC A;  4PDK A;  2F4M B;  5J3L A;  1UG0 A;  2X4H A;  3WTZ A;  2MFZ A;  2LSO A;  4Y3O A;  2PMH A;  2RQP A;  3E97 A;  2QCO A;  1WKM A;  2Z16 A;  3HUG B;  1BJA A;  2IAI A;  2HVQ A;  1NG7 A;  1NHA A;  4JBA A;  5F04 A;  1SAN A;  2XAJ A;  2IGM A;  1MBF A;  1TQI A;  4WF2 A;  2JA6 J;  3CCM I;  1X3Z B;  4XLC A;  1HXD A;  1IN5 A;  1MBH A;  2V6E A;  2XVC A;  4M72 A;  6PAX A;  3I58 A;  5CVV A;  1PDN C;  3H9J A;  2VT2 A;  4B1R A;  1KU9 A;  3K2A A;  3RKX A;  5LHI A;  1U9O A;  3ZRG A;  4PGG A;  4HX4 A;  4ENM A;  3P5J A;  3W6V A;  2CV0 A;  4CCN A;  3GTG J;  1HW2 A;  1OR7 C;  2H94 A;  3LL7 A;  2FE3 A;  4BE2 A;  5F0F A;  2WY7 Q;  2LVS A;  2RV8 A;  3R4K A;  1IG7 A;  3G2B A;  2W48 A;  3QPH A;  5DCM A;  1IO2 A;  2R7X A;  1W7P D;  5EF6 A;  5DYM A;  4DBQ A;  4CYC B;  2OC6 A;  2W24 A;  1LNW A;  3M8E A;  1X1B A;  1W36 C;  3GO5 A;  4E7H A;  2O6G E;  1Z7L A;  2FX0 A;  3ERE D;  2KIM A;  4DYR A;  2HXI A;  2VBY A;  1BBY A;  2B0L A;  3C2H A;  2O3F A;  3I5U A;  4FX4 A;  2IW5 A;  4NBQ A;  3SFI A;  2DOA A;  3J7Z I;  1AKH A;  5B66 C;  3CJN A;  5EZH A;  2E7W A;  3BP8 A;  1W1W E;  2MA3 A;  4XLH A;  3HSF A;  1TWA J;  2RC4 A;  1Z9C A;  5A2Q Z;  3LSK A;  2RQQ A;  3KP7 A;  4Y7N J;  3I64 A;  4C2T A;  1XDS A;  1DQU A;  2A6T A;  2A3S A;  2STT A;  1ETW A;  4JOM A;  2H6B A;  3F8B A;  3GZ6 A;  3HOV J;  3H92 A;  4X1E A;  3C7J A;  3VSL A;  1ON2 A;  1KON A;  5DD8 A;  2L4A A;  2DK8 A;  3GTJ J;  1X2M A;  1TWG J;  2Q2E B;  4U87 A;  4XKW A;  4EAT A;  2E71 A;  1SAU A;  1VQM I;  1BOB A;  1T98 A;  4EM1 A;  2VAS A;  2JSP A;  5KAI C;  1O7F A;  1SMT A;  1MJA A;  4P1W A;  3BZ6 A;  3KX2 A;  1QO0 D;  4G6T B;  5B3S H;  3OYH A;  1DPR A;  4KNY A;  1W7P B;  1WVR A;  3PFI A;  1S5L C;  2KLO A;  1R1V A;  3O8G A;  3RYR A;  5H20 A;  5J4Y A;  3F8M A;  4IHX A;  2DJN A;  3CUQ C;  4BDY A;  2WWY A;  2VOP A;  4CUG A;  4IJA A;  3BRO A;  2JVG A;  3FXU A;  3Q9S A;  4LLN A;  5HLI A;  4WWC A;  1D8J A;  3DBL B;  3ZQF A;  2KQR A;  3HSR A;  3CCU I;  4ZDO A;  2M8E A;  5LD2 C;  4BXF A;  4BBR J;  1LPQ A;  5F0H A;  4ESF A;  3G1O A;  1J5Y A;  2VN2 A;  2VKV A;  2ZCW A;  2JSC A;  3HB9 A;  3WHC A;  4YRV A;  3JRF A;  1QU3 A;  3VYU B;  1P7J A;  1E0E A;  2V9P A;  1J0R A;  1JKO C;  2FEZ A;  1GXQ A;  5K7H A;  2JJ7 A;  1SD6 A;  4ON0 A;  1PUF B;  1RZ4 A;  3IH4 A;  1HKT A;  3V7C A;  1R22 A;  1KU7 A;  1WJD A;  4XLE A;  1V4R A;  3HOS A;  1PUF A;  4ENK A;  3TO9 A;  4GCV A;  1ULY A;  1RR8 C;  2KDZ A;  4PFO A;  4D0P A;  4G12 A;  2RAE A;  3OR1 C;  4QPO A;  1V5G A;  1FJL A;  2P81 A;  2A07 F;  5IOZ A;  1WGX A;  2X48 A;  1ACI A;  1IXC A;  5IYC J;  2M1B A;  3HRU A;  3JRE A;  3QRF F;  2OA4 A;  1FTT A;  3MVP A;  1D0Y A;  1MSF C;  4G9Y A;  1RKW A;  1XS9 A;  5JFR A;  4NNJ A;  2NVX J;  1G2H A;  2CUE A;  2R4G A;  1HCR A;  3BWG A;  1I39 A;  1XPX A;  1A31 A;  2GWR A;  2EWN A;  4FIS A;  4MTD A;  2LF8 A;  2VJI A;  2B7E A;  1MMN A;  3VB2 A;  9ANT A;  2ZBK A;  1B9N A;  5AIQ A;  1S7O A;  2VJ5 A;  3ELK A;  1ZGA A;  5ICC A;  3N05 A;  3KCC A;  4KN7 X;  5FRN A;  4EM2 A;  4RAF A;  3LSJ A;  4FE7 A;  2F5D A;  1O3T A;  2C6Y A;  5EEA A;  1JKQ C;  2M2E A;  3CCY A;  5D6E A;  3F22 A;  2F4I A;  1TQP A;  2NS8 A;  4ZZD A;  1GHC A;  2HQN A;  3K1N A;  2VKD A;  3L2W A;  3VFZ A;  5LGN A;  4MGR A;  1HDP A;  2YU9 J;  4E70 A;  1NK2 P;  1FIA A;  4IRH A;  4NC6 A;  1WHU A;  3IKV A;  2HVR A;  4B43 A;  2GAU A;  2XB0 X;  3FXQ A;  4F92 B;  2COB A;  4UUS B;  4BY7 J;  2M8G X;  1X1D A;  1G8X A;  1I3Q J;  5FD6 A;  2QQB A;  5DEQ A;  4B8X A;  4M3F A;  1R23 A;  3OSF A;  2I8D A;  4UUS A;  2TCT A;  3TOB A;  3JSO A;  2Y0S A;  4CCM A;  1A35 A;  4BE0 A;  5IT9 Z;  3OS2 A;  1UFM A;  4PGH A;  1SEU A;  1XMA A;  3GCM A;  5CVU A;  1U5T C;  2Z1D A;  5H6Q A;  4A3J J;  5K5R A;  3TP3 A;  4CZC A;  2IS2 A;  2L4M A;  5LEK A;  4UB6 C;  3M4O J;  3KZZ A;  1QPM A;  4F91 B;  3S3N A;  3I59 B;  1XCB A;  1SMY F;  2DPU A;  1OKR A;  1ZRC A;  1ZG1 A;  1MMD A;  4R79 A;  2RNJ A;  2RN7 A;  4IZZ A;  2R7F A;  3OIO A;  3BG3 A;  5F08 A;  1Z67 A;  5K7Z A;  3C1D A;  2A68 F;  3FBN B;  2HOE A;  4MQ9 F;  2OCE A;  1QVT A;  3FXK A;  3NEU A;  4HQM A;  5D5W B;  3BPX A;  2JPC A;  3LOC A;  2E5N A;  1B8I A;  4X6A J;  2LR8 A;  5E8I A;  4CHU A;  4PK4 A;  2IS4 A;  4N4O B;  3H3V K;  4GGG A;  3B73 A;  3GEZ A;  1FOX A;  4EMS A;  1RES A;  2Y0S N;  3OL3 A;  1AHD P;  4JQF A;  2HR3 A;  3H5A A;  4HAM A;  2FQ4 A;  3LFU A;  2W84 A;  4M9X A;  5HS7 A;  2R7O A;  3S14 J;  3JCU C;  3JR9 A;  2H27 A;  2YX4 A;  2NOG A;  2P0W A;  2VT3 A;  2XAF A;  2XV4 S;  2LF7 A;  1NG6 A;  3H5R A;  2QUF A;  1V3F A;  2BY1 A;  3DTE A;  1UST A;  2K40 A;  2Z3Y A;  3I4N J;  3KP4 A;  2XAQ A;  1P4A A;  3OYJ A;  1GUU A;  1R5G A;  2AHQ A;  4FCY A;  3F8F A;  1OYI A;  4HX8 A;  3TW6 A;  4WK8 F;  1LDJ A;  4HSR A;  3HGG A;  3FX3 A;  5L3F A;  4FTH A;  4I2O A;  2KJC A;  1MZB A;  1O7L A;  2BW3 B;  1MH4 A;  3BJ6 A;  4LLG F;  1JUM A;  3DEW A;  3ONQ A;  2XPW A;  3M07 A;  2E2I J;  4M9Z A;  1OFC X;  4XRS A;  4C3H J;  4EGY A;  5D6F A;  2XPV A;  4Q48 A;  1MNM C;  2DT6 A;  2UXX A;  2BHY A;  3DKX A;  1D0Z A;  4IRG A;  3SEZ A;  5J8C A;  2PQ8 A;  2XGX A;  3DLA A;  1V5E A;  2IPQ X;  1XTA A;  2LK2 A;  1DGR M;  5FKO A;  2BHZ A;  1IZ1 A;  1WPK A;  1RI7 A;  4BEH B;  4XMY A;  4MFE A;  3BTL A;  4PJL A;  2K4B A;  3TQN A;  4BGD A;  2XSD C;  3SHF A;  5DD4 A;  4ASN A;  1ENH A;  4BEH A;  3GFL A;  3ABM H;  3HXL A;  1K6O A;  3FKI J;  4RB2 C;  3CDH A;  5GP9 A;  5LHG A;  3Q3S A;  1HBX G;  3OYF A;  3Q0U A;  2GOM A;  3GFJ A;  4N0B A;  1QRY A;  4V2G A;  3ZMT A;  4AUX A;  1Q1V A;  4AWX B;  1Q1H A;  3CES A;  4C30 A;  3G71 I;  5BPI A;  3FXL A;  1U9N A;  3CD6 I;  4RB3 C;  3HKZ A;  3FWE A;  2DA7 A;  1ZLK A;  2JK3 A;  4ZZL A;  1TTY A;  1YYV A;  1YIT I;  3HRS A;  1K79 A;  1B4A A;  1ON1 A;  2DA6 A;  1XGM A;  1FP1 D;  2DMP A;  3A03 A;  1G3W A;  4HF1 A;  2OF7 A;  4LB5 A;  1BOA A;  5ICE A;  3DEU A;  3QPT A;  3O2P E;  5LLQ A;  1RUO A;  1BR1 A;  5LRR A;  1ZQ3 P;  2HYJ A;  2L9N A;  1T33 A;  4OIR F;  2KPM A;  2IP2 A;  2X6W A;  4JX4 A;  1CF7 B;  2HQR A;  1K7A A;  1B59 A;  2QEN A;  3EET A;  3HSE A;  5A2Q K;  3V8K A;  2O8X A;  3CLO A;  4M71 A;  2NOJ B;  4LIT A;  2D2W A;  1IC8 A;  4DYC A;  3JRI A;  4EV0 A;  2G9W A;  5ILV A;  2KT0 A;  1H9G A;  1KQ9 A;  3O8H A;  3A0H C;  4OWR B;  3FM5 A;  5CJ9 A;  3EUH A;  4YEL A;  4LGW A;  3IHU A;  3QP6 A;  2ESH A;  3HKZ N;  2BZT A;  1ZAR A;  3C18 A;  4ETS A;  1FSH A;  3BTI A;  1S72 I;  4F3Q A;  4ZJZ A;  1E2X A;  1UHM A;  2LBF B;  3RPQ A;  1JHF A;  2ISY A;  4MLO A;  5F1R A;  2X6O A;  3SZP A;  1I3A A;  5FKM A;  2LC2 A;  5M5X J;  3CZ6 A;  2KKO A;  4Y17 A;  3HOW J;  4N9I A;  2MBF A;  3K1P A;  2P7V B;  5HOD A;  2GA1 A;  2RNG A;  4I76 A;  1OMI A;  4NB5 A;  4XN0 A;  2LY9 A;  2HXO A;  2L7K A;  1JTY A;  2VJJ A;  4MNU A;  2B9S A;  1QA6 A;  3RKW A;  2PJP A;  3VWB A;  3J7A O;  3J80 K;  3SDG A;  2FU4 A;  4IOA F;  4XRM A;  3QOE A;  1AWC A;  2QF7 A;  4O3M A;  1TW2 A;  1KQ0 A;  1Y1V J;  3HRT A;  2X6X A;  2DA5 A;  2VOD A;  4EJW A;  3B6A A;  3UR3 C;  2H09 A;  2CRG A;  2V79 A;  3E6M A;  1U78 A;  5J47 A;  2OPT A;  2E36 A;  3K4C A;  1V54 H;  2DTZ A;  3OY9 A;  1ZLJ A;  4JX5 A;  1OCC H;  3CP2 A;  1D1B A;  4RGU A;  2QQ9 A;  1MW7 A;  2F48 A;  2ZJR F;  4NUB A;  4AYB N;  2OZ6 A;  2XUB A;  4IQJ A;  1T6S A;  1JGG A;  2OCC H;  3U1K A;  2CJJ A;  2FXA A;  4AVP A;  2LP0 A;  2NNY A;  1P4X A;  1JJ8 C;  2W82 A;  1D1A A;  2VQC A;  1DUX C;  1FYM A;  1J7K A;  4ZTJ A;  3AG1 H;  3HBL A;  3MKZ A;  1ZGW A;  3LMM A;  2VUM J;  3HIF A;  2COM A;  1OYW A;  2A61 A;  4QSH A;  1D5V A;  1BR4 A;  3I4P A;  1R58 A;  4BJ5 C;  1RPW A;  4HG2 A;  1MBG A;  2HU9 A;  4QLC U;  3S3O A;  2KJB A;  1FP2 A;  1VND A;  1GVD A;  1VI0 A;  1G3S A;  1F43 A;  2M9H A;  1K4T A;  1HSJ A;  1WJ5 A;  2DI3 A;  5TJJ A;  5D8K B;  3RQI A;  2VOO A;  5IYD J;  2IXS A;  2P5V A;  2Y69 H;  3GW2 A;  2ZJP F;  1LEA A;  1FOK A;  1BJZ A;  3MZY A;  3MKL A;  4XOP A;  2DK5 A;  4NC7 A;  3UNG C;  5JR3 A;  2KDO A;  1J59 A;  2XSJ C;  4E4H A;  4AC0 A;  4OIO F;  3BLY A;  1F1Z A;  1S7A A;  3D1N I;  1ZG5 A;  3DU5 A;  1K6Y A;  2HS5 A;  2QZ8 A;  3A2K A;  2L5Q A;  1SD5 A;  4JK1 X;  3CCR I;  4HNV A;  3HOZ J;  3K4L A;  3C2B A;  1R00 A;  1Z3Y A;  3GFM A;  1OCT C;  2XPU A;  3E5Q A;  3O3K A;  1O3Q A;  2ICW G;  1VFC A;  4RA2 A;  2DDB A;  3FMS A;  2QEX I;  2CV2 A;  5IT9 K;  2B63 J;  4A3D J;  1HKS A;  2IBD A;  4J01 A;  2CH0 A;  1RNL A;  4OOI A;  2Z9O A;  2HI3 A;  3OWT A;  3CMA I;  2M45 A;  4G7Z F;  1FC3 A;  5B1B H;  3V7R A;  5E79 C;  1YJN I;  2ECB A;  3CO7 C;  3E6D A;  3L9F A;  1A5J A;  5DTD A;  2GZW A;  4E7L A;  1QPI A;  2LH9 A;  1RIO H;  1BW5 A;  2VL8 A;  3TL4 X;  1IJW C;  1W4M A;  2L7M P;  3GTQ J;  1ZGJ A;  2BY2 A;  3F21 A;  2STW A;  3QPL A;  2PX9 A;  4DYQ A;  1FYL A;  3G4S I;  2NNN A;  1X4O A;  4E7S A;  2JPB A;  4BE1 A;  4BHC A;  2JWT A;  4K2E A;  3P9K A;  4IVN A;  3SEQ A;  3D0S A;  4HEA 2;  5C44 J;  3OYE A;  1YE9 A;  2CUZ A;  4UB8 C;  3ZCO A;  4C9Y A;  1Z91 A;  4XQF A;  2K9S A;  3BCB A;  4LIU A;  1S3J A;  2CQX A;  5E1Z B;  5EJC A;  4YEJ A;  2R7S A;  3F8N A;  2L2O A;  3ABK H;  3HC7 A;  4S0H B;  5GAE J;  3PIO F;  4CZZ A;  4ANJ A;  4GDF A;  3PUF A;  2EA2 A;  3HUG A;  3FIS A;  4P9U A;  4NC8 A;  1EKE A;  3RPU D;  2KL4 A;  2CW0 F;  1IXR C;  4A3E J;  3CMY A;  4FQG A;  4DZJ A;  3E1S A;  2X6Y A;  3G1M A;  3SYT A;  2DT7 B;  3WE2 A;  1JI8 A;  1FBS A;  4I02 A;  1HC8 A;  2RRE A;  3IH3 A;  3BT9 A;  3HOU J;  2EIN H;  1FEX A;  4CA0 A;  1J2X A;  3HHG A;  1WJB A;  3L09 A;  4BQN A;  2BGC A;  1F36 A;  2DFH A;  3M9A A;  1KYW A;  1OPC A;  3LSG A;  1EA3 A;  1RKT A;  3JW4 A;  4HA8 A;  1X3W B;  4RLF A;  2P5L C;  2H8W A;  3AL0 B;  2NVY J;  4IXA A;  2A5W A;  3GF2 A;  1R1T A;  4A5M A;  3OYC A;  2JRT A;  4AD9 A;  4YFN F;  3BQZ A;  1LDD A;  2X51 A;  5FLX Z;  3PNT A;  4M6X A;  3OL4 A;  2LLK A;  5K5Q A;  2KZG A;  1IRG A;  2GLO A;  3G6E I;  3I4M J;  3GTL J;  4EVI A;  2FA5 A;  2DO7 A;  3GBG A;  3KEQ A;  2W25 A;  1MBE A;  3VSK A;  5BS6 A;  1IUY A;  4L0Z B;  4G8X A;  1U0J A;  1AU7 A;  5BQT A;  4ABZ A;  1LKX A;  3CJQ B;  4S04 A;  1SD7 A;  3DU6 A;  2V6C A;  4CSW A;  2R7U A;  3OR2 C;  4CYC A;  1Y0U A;  5J1U A;  3U1D A;  3P7N A;  2NVQ J;  3HHH A;  2BY0 A;  2QBY B;  3IKT A;  1T39 A;  3HZJ A;  1VQ4 I;  1LQ1 A;  1YTY A;  3TO6 A;  4RMN A;  1X2N A;  4BL0 B;  2IVM A;  4LJZ F;  3LAJ A;  2QBY A;  2A6E F;  2MLG A;  4A3L J;  5FJ8 J;  3R0J A;  2ZME B;  5FFZ A;  5L3C A;  2HOA A;  3QOD A;  5LFA A;  2EFW A;  4U0Y A;  5B1A H;  2EJR A;  1KU2 A;  1YRN B;  1TQM A;  2CO5 A;  4L5I A;  2KRH A;  3RPU A;  5FLV A;  4L5J A;  2VBZ A;  1QQI A;  3K10 A;  1LE8 B;  3ASN H;  1W5S A;  1MND A;  5J6X A;  2PMU A;  3M3Y J;  3G1L A;  3U21 A;  2DOD A;  2EIL H;  3GTP J;  4JP0 A;  1SD4 A;  2V26 A;  3OYA A;  1LE8 A;  3WG9 A;  4BHP A;  3P9I A;  5JHU A;  2Q2E A;  3NAU A;  1B72 B;  1S6L A;  1MMG A;  2HDW A;  3ZMD A;  1ODD A;  1HKQ A;  3DQV C;  3CO6 C;  5ILS A;  1GT0 C;  1Z77 A;  5HS9 A;  3F9K A;  3GLL A;  1JHH A;  1MGT A;  3DXJ F;  3ZGK A;  2HPM A;  2ZSI B;  2DMU A;  2VKE A;  4KUM A;  1Z3X A;  4KMF A;  4V19 K;  3NAR A;  3QYF A;  1Z1D A;  1W7P A;  1BI2 A;  3BG5 A;  3JRH A;  4OIN F;  2LOO A;  3KP6 A;  2Z99 A;  2PG4 A;  2HQ5 A;  2L9R A;  5J40 A;  3HTS B;  3BG6 A;  4F55 A;  5HNF A;  3J80 Z;  2HOT A;  2DFF A;  1REP C;  1FOW A;  4PJN A;  4UVC A;  1A04 A;  1H88 C;  3RSN A;  4IKF A;  5GTI C;  4KIS A;  3L00 A;  4R8H A;  4EEF G;  3PO3 J;  4A0X A;  2XGD A;  2HQA A;  2DT5 A;  2RVC A;  1B9M A;  3LSH A;  2EB7 A;  3FBI B;  3JAM Z;  5FFX A;  2CU7 A;  3KYD B;  1DU6 A;  4HLX A;  4BAC A;  4C2M J;  2EZH A;  2CW8 A;  1W36 D;  4IF4 A;  1VQP I;  2LY1 A;  3RTR A;  4OIQ F;  3HJE A;  1GDT A;  4ZDL A;  4HST A;  2R3S A;  3RDI A;  4A3M J;  3KYC B;  1ZK8 A;  2IGK A;  4PZJ A;  1XSV A;  3ECO A;  2O61 A;  2M5W A;  2XHK A;  3W2W A;  3WGH A;  4ZH4 F;  4DJA A;  5HS8 A;  3LSP A;  2HDC A;  5E20 A;  2AQE A;  4A6E A;  1JUS A;  2XC7 A;  3E5X A;  4P96 A;  5B5E C;  2QKM B;  1BI3 A;  3WTT C;  3K0L A;  2Z2S B;  5IYB J;  3ZQG A;  3ZQH A;  3H9Q A;  4Y4R A;  3MFK A;  1YIJ I;  3KET A;  1EH8 A;  2EFQ A;  2KRC A;  2Y9Z A;  1J9I A;  2YS9 A;  3QYB A;  3EDP A;  3EUA A;  4ZYE A;  4RLQ A;  2MGQ A;  4NHJ A;  1J09 A;  2HKO A;  5FLM J;  1X58 A;  3OSG A;  2GA2 A;  2V1N A;  3EPZ A;  5IOY A;  3EUK L;  4KIC A;  2DMT A;  2HDD A;  2JA2 A;  3A02 A;  3HRM A;  3LQR A;  2R93 J;  3PQJ A;  1FOY A;  2XF7 A;  3L2U A;  3HL2 A;  1WFX A;  1YW8 A;  2ESN A;  3S2W A;  4XOR A;  4ZYA A;  4Q4Z F;  4MIM A;  3VEP A;  2VE9 A;  4HDU A;  1TBX A;  1OR7 A;  3KP3 A;  4A6D A;  4CYD A;  5GPC A;  3HPG A;  3I55 I;  2K3F A;  4XLA A;  2IA0 A;  3A4C A;  3PSF A;  1B6A A;  2ID6 A;  5AON A;  4A69 C;  1JT6 A;  3WTU C;  1P92 A;  4RB1 A;  1D0X A;  2LDU A;  4I0A A;  3W2A A;  1DDN A;  3GVA A;  4HV5 A;  4PSW A;  4AIJ A;  1UCR A;  4KIB A;  5EEH A;  1RRJ A;  2MG4 A;  5LHH A;  4KDP A;  4A93 J;  4HRI A;  1WJA A;  1I1G A;  4A3G J;  1P4W A;  4M3E A;  4CCK A;  2XGC A;  2LRE A;  3OYI A;  4B44 A;  3J7Y J;  2DXI A;  1HF0 A;  1UHS A;  1G4D A;  2O5R A;  1SVL A;  5KAF C;  1U8B A;  3PM1 A;  2GBY A;  2ZB9 A;  3ZMS A;  1LB2 A;  2P7C B;  3BR6 A;  3J81 Z;  3MCZ A;  2JA8 J;  3HG9 A;  1ZR4 A;  1N77 A;  2N8G A;  3BOQ A;  2QSG X;  3KP5 A;  3GUD A;  3TP0 A;  3RI4 A;  4BJT A;  4LFU A;  2EZI A;  3K4K A;  1O3R A;  3WTV C;  5E17 F;  3GX4 X;  1AA7 A;  2ID3 A;  3ZQC A;  3PIP F;  4D7N A;  4UXN A;  3I59 A;  1NK3 P;  4ESB A;  4A3B J;  2OAZ A;  2BY3 A;  2LRD A;  4XKB A;  2QGU A;  3A01 B;  2JUC A;  3FM3 A;  1I6X A;  3EUH C;  2K9M A;  2E34 A;  2CSO A;  3MKY B;  3I9V 2;  1R9T J;  2EFP A;  3AG2 H;  4B09 A;  5HOO A;  2VQH A;  3KEO A;  2JTV A;  2PJR B;  1UJ8 A;  3CUQ B;  3TBI A;  3FXO A;  3F72 A;  3K4M A;  3WE3 A;  4XRS G;  3CDL A;  1DU0 A;  2PJR A;  1ERD A;  3ML6 A;  2FBK A;  2H1K A;  3CUQ A;  1IN6 A;  2AXT C;  1A6I A;  2UXN A;  1K83 J;  3VYT B;  1U2W A;  4B4C A;  2MH9 A;  2FUG 2;  2G7H A;  4N9H A;  2K7L A;  3JSP A;  4I0B A;  2HPI A;  3ZQL A;  3BG7 A;  4BUP A;  3IV5 A;  3C3W A;  3T0Y A;  2MAB A;  4XSZ F;  1Y8R B;  2F5F A;  1BL0 A;  2DPD A;  4ZYH A;  4ESJ A;  2V9V A;  3HDD A;  1KU3 A;  3DCF A;  3KZI C;  3K70 C;  2K9N A;  4TV7 A;  2E1N A;  2UUZ A;  1JT0 A;  4XKC A;  1IV8 A;  2VLA A;  2D45 A;  2A05 A;  3W2V A;  1I1S A;  3IL2 A;  1FPQ A;  2CUJ A;  4D5F A;  2VXZ A;  4KT6 A;  1B1B A;  1OJL A;  2QVO A;  1HW5 A;  2BW3 A;  3KZY A;  2Y9Y A;  3DFG A;  2LKX A;  3MD2 A;  4MFD A;  4UY8 I;  4BJ6 C;  5KVR A;  5HVQ C;  1O57 A;  2YPR A;  1T38 A;  4BHB A;  5D5U B;  2O9L A;  5FKK A;  2ZJ2 A;  3CLQ A;  2F5E A;  5FD5 A;  5ILU A;  3T8R A;  3G73 A;  3JRA A;  1WH5 A;  3OS0 A;  2CQK A;  3IP4 B;  4UHT A;  3QYE A;  3OYB A;  3OYD A;  3FXM A;  4LK1 F;  2W4S A;  3MEX A;  5EZG A;  1OQY A;  5GAG J;  3KYL A;  2XKP A;  1X19 A;  3HYI A;  4C3J J;  2GIV A;  2D1H A;  3OMY A;  2DBB A;  3FXJ A;  2IS1 A;  2HNH A;  2X9D A;  4ITV A;  1WSU A;  1VTN C;  2L3D A;  1UEL B;  4I6Z A;  1ZTR A;  5BPD A;  3S16 J;  3NWT A;  5IT3 A;  1WZ2 A;  2DA3 A;  5TIS C;  1IN8 A;  1MJB A;  5FLX K;  3BY6 A;  4KN4 X;  3B6C A;  2XF5 A;  2EBI A;  4RGR A;  3SDB A;  5L3E A;  4M6Y A;  2CGP A;  1T95 A;  2CQQ A;  3E3V A;  1HST A;  2OU2 A;  2DMN A;  4LD5 A;  3IAS 2;  2DU9 A;  1X1P A;  1YW9 A;  2VI6 A;  2V1U A;  2W57 A;  3RKQ A;  1PYV A;  1EF4 A;  2VE8 A;  4ZDP A;  3JTG A;  1Z7U A;  2K5C A;  5D5X B;  1W0U A;  1V5F A;  3ZP5 A;  1SC7 A;  2XB5 A;  3LAP A;  4FE4 A;  1Z0X A;  5FRO A;  2HKX A;  1Y8Q B;  5IPA A;  3PJR A;  3QOP A;  2E5Z A;  1Y1W J;  4V2F A;  2WBM A;  2ZXJ A;  2M34 A;  1E3O C;  1X4P A;  4U7B A;  3EQL F;  3SXY A;  4BXX J;  2V4J C;  4DBR A;  4DW6 A;  5LGU A;  1CF7 A;  2VQG A;  4EJO A;  1U5T B;  2DMQ A;  1MBK A;  2WY8 Q;  2CFX A;  3K7A J;  5E3O A;  1YS6 A;  3MKW B;  2DFI A;  3M7G A;  3PNV A;  2R0Q C;  4OAZ A;  1YLF A;  1SFU A;  4C2U A;  1U5T A;  2WAF A;  1GVJ A;  5HLT A;  2FQ3 A;  4IO9 F;  1TNS A;  1QNT A;  2O0Y A;  4M3B A;  3ZQI A;  2NRA C;  3S17 J;  2K3P A;  2ZNZ A;  2RDP A;  2R5Z B;  2VBX A;  2RKH A;  3H3Z A;  1WH7 A;  1SFE A;  1BR2 A;  5C3E J;  1XSD A;  1FWZ A;  2LBF A;  4IHT A;  2E1M C;  2LMD A;  2P4W A;  3ABT A;  2R5Z A;  2R7D A;  1H0M A;  1J75 A;  5KCM A;  4AYB A;  1SVO A;  5J1R A;  2Y48 A;  3GZN B;  2YUS A;  3SQN A;  3VYR B;  3OOU A;  1POG A;  3CC7 I;  2ZFW A;  4HNU A;  1VQN I;  4GYG A;  4BH9 A;  4B47 A;  1SAX A;  4PCQ A;  1STZ A;  2Q1Z B;  4IPA A;  1G3T A;  4KJZ A;  3KE2 A;  2D1V A;  4WXD A;  2EZL A;  4NDL A;  3QU3 A;  1H89 C;  4LB6 B;  5CKT A;  1YX3 A;  1JXS A;  2TRT A;  3DLL F;  1JUP A;  4Q47 A;  1ZHF A;  1O4X A;  4D5C A;  4BKX A;  2EQR A;  5LRS A;  3JAM K;  3LSR A;  2LKP A;  1P9Q C;  3E6C C;  4L18 B;  1RR7 A;  5KK1 A;  1X3U A;  2JRM A;  4HV6 A;  5DS9 A;  5F1J A;  2MSY A;  5LGT A;  2LNB A;  3PL8 A;  4BYY A;  2EFN A;  5EEG A;  4F93 B;  4XRF A;  1FBU A;  2QLZ A;  3GYH X;  2P6S A;  2WAD A;  4MEY F;  3ESW B;  3O6B B;  1ETX A;  1UB9 A;  2HTS A;  2CV1 A;  1IDZ A;  4I99 C;  3FMQ A;  5EG0 B;  5CVI A;  5D4R A;  5J8F A;  3S1M J;  2P5K A;  3L2Q A;  1DPU A;  5CVJ A;  4UVB A;  3BR2 A;  2ELH A;  3LSI A;  2W1O A;  5TRD A;  1NH3 A;  2G7U A;  3HM5 A;  4CIC A;  3ZQQ A;  1XGS A;  2CFO A;  1IV6 A;  2JMW A;  1LVA A;  4RGS A;  5D4S A;  3DKY A;  2CWE A;  1JKP C;  2ADU A;  2K86 A;  4XLF A;  3M1C A;  4OMZ A;  3GTK J;  4M9S A;  4G94 A;  5BMZ A;  5JLW A;  3BJO A;  1M1E B;  2Y0M A;  1QHG A;  4YFK F;  4IHS A;  2R92 J;  1WI9 A;  5E3N A;  4XSX F;  2EFO A;  4HW0 A;  1Y6I A;  4XK4 A;  4XID A;  3CCQ I;  2CQ7 A;  1G59 A;  5H6R A;  3VPR A;  1JTX A;  1T0F A;  4EQQ A;  4GYI A;  4RAZ A;  5FRM A;  1NTC A;  4LK0 F;  1R5H A;  5E1W A;  1WQ2 A;  5F64 A;  3TDU C;  3WOD F;  2KZV A;  2LFB A;  4EJV A;  2X0L A;  4GFB A;  1ORK A;  1HDD C;  1BA5 A;  2KHM A;  3CDI A;  2FBI A;  1BW6 A;  4RM2 A;  5LBQ A;  4XL9 A;  3KLO A;  3JRG A;  4AIK A;  3CME I;  5DUI A;  2DFE A;  2YU3 A;  1IXS B;  4XR6 A;  3FXR A;  5GPA A;  2FMY A;  3VYS B;  3J81 K;  3BZC A;  5M3F J;  5GTH C;  5FKN A;  4BQA A;  1YOV B;  4FET A;  3FIW A;  3JTH A;  3SFZ A;  1O3S A;  4ENN A;  3T5X A;  4W97 A;  1ZG3 A;  2IGO A;  1KQ8 A;  1FZP B;  3HGY A;  3ZR8 X;  1QHH D;  3FMR A;  2PN6 A;  3SJM A;  5J1Y A;  3LST A;  2NS0 A;  3DV8 A;  4L0Y B;  3Q0V A;  1P2F A;  3FK7 A;  1K78 B;  3CMM A;  3RYP A;  2MD0 A;  3DEE A;  3NRV A;  1KZH A;  3D5R C;  2GXA A;  1X1A A;  4HZF A;  1Y0N A;  2HWV A;  3QP5 A;  1VQL I;  4UUV A;  2VJ4 A;  3SZT A;  1FIP A;  1W5C C;  4BBS J;  3V42 A;  1K78 A;  3BR1 A;  1L3L A;  1VZ0 A;  3H5N A;  2XAS A;  2L01 A;  1F4K A;  3RKY A;  1YQA A;  1TZL A;  5DUK A;  4QPQ A;  2EA4 A;  2LTP A;  5DCF A;  1R49 A;  3ZMU A;  2JA5 J;  4Y52 J;  2WB1 A;  1VQO I;  2PLY A;  4A5N A;  2HGC A;  2LD5 A;  2DJI A;  5ERI A;  1BIA A;  1OCR H;  1WI3 A;  5E3L A;  3LA7 A;  2JVH A;  5ICF A;  4S05 A;  5DM7 F;  4ZC3 A;  1S29 A;  1LFB A;  2I5U A;  3W3C A;  3LNQ A;  4PSX A;  3WTY C;  4XM3 A;  4BQO A;  3V7S A;  4CCJ A;  4BDZ A;  2MLK A;  2UV1 A;  3DF8 A;  3TDZ C;  4XKV A;  2IGN A;  1N78 A;  3OIQ A;  3T8T A;  4AVZ A;  1TWC J;  2ZXW H;  1IN7 A;  1VQ7 I;  1S7E A;  1R1U A;  3C2G A;  3OS1 A;  4L5E A;  4Z6Y A;  3WG7 H;  1N25 A;  2L9S A;  5CQG A;  1H8A C;  4JYK A;  2J5P A;  4M73 A;  2AQF A;  1HQC A;  3FKJ A;  3S2D J;  1IRZ A;  3TMO A;  5CVR A;  3GTM J;  1HOM A;  5FGM A;  1KGS A;  3CTA A;  3KP2 A;  2EIK H;  2K9L A;  2NYX A;  5IP9 J;  2A5Y B;  1VQ9 I;  4EJT A;  2F2E A;  2H1L A;  2LYC A;  1MD0 A;  2X1E A;  2EIM H;  4DOZ A;  3I54 A;  4BNC A;  4Y15 A;  3H1C A;  1UMQ A;  5IY5 H;  3HOY J;  3OYM A;  1APL C;  2XRO A;  1FBQ A;  4KIG A;  5HDK A;  1BC7 C;  3BJA A;  2WB1 N;  2FD5 A;  2X1C A;  3CF5 F;  4AIH A;  2QA4 I;  2E2H J;  1TC3 C;  3CQZ J;  5E1X A;  2KIF A;  2KRF A;  2ZFU A;  5DCM B;  3F0C A;  2V1X A;  1OCP A;  4BAY A;  2F4O B;  1E3P A;  3ZQ7 A;  1HA8 A;  2IT0 A;  2DA1 A;  3I53 A;  3ZMV A;  2DDA A;  1YJW I;  2IS6 A;  1I50 J;  1RET A;  1PUE E;  3DKW A;  2DA2 A;  2ACJ A;  1R6R A;  1ZN2 A;  1UG2 A;  3KPH A;  3OYK A;  1W0T A;  3TO7 A;  1R4N B;  4KYW A;  2Y30 A;  2VC0 A;  3R6S A;  2BXY A;  2HYF A;  2ZME A;  4BS9 A;  1FX7 A;  1Y39 A;  4U88 A;  3WTX C;  4A3I J;  3OV8 A;  3VOE A;  1UAA A;  3L7W A;  2P6T A;  1YRN A;  1AKH B;  3CC2 I;  2GXG A;  1EH7 A;  5K5O A;  3RZD J;  3IUO A;  3S32 A;  4J00 A;  4CCL A;  1IRF A;  4G7H F;  3AFH A;  4XOT A;  1OCO H;  2O7O A;  3NQO A;  4I09 A;  1WJF A;  4QWQ A;  2OZU A;  5L3D A;  2H8R A;  2I10 A;  5JI6 A;  1BIB A;  3S1Q J;  1N75 A;  1TWF J;  3I0T A;  2IRF G;  3DP7 A;  4RS8 A;  2MC4 A;  1DP3 A;  1WJE A;  1VQ6 I;  1PJR A;  2A69 F;  2XIG A;  1B72 A;  2XRN A;  3M1E A;  4B48 A;  4XIC A;  2OV7 A;  1HLV A;  4FT8 A;  4E7K A;  4DZP A;  1RUN A;  4EM0 B;  2HZD A;  2PBI A;  1PP7 U;  3KFW X;  1IW7 F;  5GAD J;  1IAW A;  2MYS A;  3UKG A;  4M74 A;  1YG2 A;  2CQN A;  4PJJ A;  1MDM B;  3PO2 J;  1BC8 C;  1Z6T A;  1ETY A;  1LVK A;  2FJ1 A;  3K4N A;  1YW7 A;  4U0W A;  1MDM A;  3HTU A;  1FMV A;  3ECH A;  1VQK I;  5HLG A;  1T8I A;  4B3A A;  3V8L A;  1JE8 A;  5HDN A;  1DP7 P;  5BNG A;  2BYV E;  1MKM A;  3KEY A;  2QSF X;  1R4M B;  2BVL A;  4O6J A;  5CLS A;  3OYG A;  1R71 A;  1IRX A;  2VPR A;  3F6O A;  3P9C A;  3AG4 H;  2FOW A;  2VQL A;  4H4K C;  1YI2 I;  2M0C A;  3CC4 I;  3CCE I;  1E3H A;  1RC9 A;  2EIJ H;  1U8R A;  1ETQ A;  2AO9 A;  2D5V A;  1P6R A;  1XN7 A;  4HDV A;  1UZC A;  1ZAO A;  3AAF A;  1E17 A;  1G6N A;  2PFB A;  3IWF A;  2EZK A;  1LFP A;  4I7H A;  4CGZ A;  4OIP F;  5E8G A;  3R0A A;  1WWX A;  5M5Y J;  1GV5 A;  3L2C A;  1ZRF A;  1CQT A;  3L2V A;  1JJ6 C;  4IEJ A;  3VOD A;  2V9K A;  3PSI A;  3Q0W A;  2JUG A;  2FOK A;  4ZTF A;  4GXO A;  5HDG A;  2PI0 A;  1Z05 A;  5H2F C;  2CS3 A;  2M87 A;  2YR2 A;  2V7F A;  2P8T A;  5KNL A;  2GQQ A;  4X0G A;  1XSX A;  3BPV A;  2M4G A;  3LFK A;  1XMX A;  1FNN A;  4C3I J;  2R7Z J;  2GOX B;  3K9T A;  4F52 A;  1OIS A;  3R61 A;  3WU2 C;  1VQ8 I;  1W5T A;  4KT5 C;  2DQR A;  2YX7 A;  4LLL A;  4EJU A;  3KLN A;  3ERM A;  1WCM J;  4XON A;  4DQ2 A;  3F6V A;  3MWM A;  3TOA A;  3H35 A;  2XAU A;  3CJT B;  3Q9V A;  4L9J A;  5FKL A;  1Z6R A;  2E7X A;  3QQA A;  3BR3 A;  3DPU A;  3V8J A;  2HEO A;  4H0E A;  2WAQ A;  3ABU A;  2DTR A;  1YIO A;  3BR5 A;  4ZYG A;  3ZN0 A;  2IA1 A;  4W1U A;  5IP6 A;  2MH2 A;  2OQR A;  5E18 F;  3OYN A;  2FNA A;  2WA0 A;  2L54 A;  4OMY A;  5JVG F;  2QQ8 A;  4CCO A;  1OYY A;  2FNP A;  1ETK A;  2QYO A;  3RQ4 A;  5DDG A;  2JQ7 A;  3W6J B;  3ROU A;  4MHG A;  3H36 A;  5ICG A;  1IN4 A;  3F8C A;  1SFO J;  2GXB A;  2JA7 J;  2MC3 A;  4PUS A;  2Z5U A;  1QGP A;  5CPR B;  3N4M A;  2DN0 A;  3FHZ A;  2JT1 A;  4L9V A;  2M30 A;  3FZV A;  2JN6 A;  2VPL A;  2GM4 A;  3CCV I;  3PFY A;  4RBO A;  5K7F A;  2WV0 A;  1MH3 A;  4HYE A;  4RDU A;  2ZJQ F;  2DYR H;  4GRI A;  5BOX A;  1XGO A;  2EV0 A;  4WXC A;  2M0M A;  5ED4 A;  2VB6 A;  2O8K A;  1IUF A;  3MZH A;  3DBR B;  1TW3 A;  1XD7 A;  3TGN A;  2E35 A;  2WAQ N;  2ZXH A;  2WC2 A;  1K4S A;  1ZYR F;  3MAJ A;  3GLX A;  3ASO H;  5IP7 J;  3CP8 A;  1QZZ A;  4MTE A;  3A01 A;  4BY1 J;  2Y2Z A;  1I6H J;  2DLL A;  2ISZ A;  5FO5 A;  4II3 A;  1JKR C;  3S8P A;  1U3E M;  3K4J A;  4O5V A;  1YS7 A;  2NXN B;  2PEX A;  4ZYD A;  2E60 A;  4RB0 A;  3ZN1 A;  1B8I B;  2J5O A;  2XKO A;  2CMP A;  1YO5 C;  3REO A;  4YFX F;  1I27 A;  2ETH A;  2FRH A;  3WTS C;  4HNT A;  2CG4 A;  1V55 H;  3K1M A;  2LY2 A;  4I01 A;  1KYZ A;  3FDY A;  4IL6 C;  4CDG A;  1SVM A;  3LSM A;  3QPS A;  3WTW C;  4IHW A;  3WGG A;  2A6H F;  4UV9 A;  4Z2Y A;  1GXP A;  4DGW B;  4DIQ A;  2VON A;  3ISP A;  2M7A A;  3BDD A;  4I98 B;  2F5C A;  3BTJ A;  3S1R J;  1UHW A;  3I3L A;  4G6D A;  4YIR X;  3K2Z A;  3IRQ A;  1T08 B;  4RGX A;  2BV6 A;  5GAH J;  5C4J J;  4RAY A;  3RIR A;  4U0V A;  3U9G A;  2BOL A;  2UZK A;  3K6G A;  3RJP A;  2Z33 A;  5HLH A;  2ZNY A;  4UVA A;  2BBY A;  1S9H A;  5CYV A;  2ZKZ A;  4QTR A;  1L0O C;  2F6C A;  4HBL A;  3SZG A;  1DGW Y;  4PJ0 C;  4G6Q A;  5F0C A;  5M3M J;  3DTK A;  4WX9 A;  4HF2 A;  2HZT A;  3AG3 H;  4IHY A;  4YII A;  4J19 A;  5L3G A;  3EYY A;  2EK5 A;  1TLH B;  2X85 A;  4II2 A;  5EGO B;  1KA8 A;  2AXL A;  1H9T A;  3ZMZ A;  3S93 A;  4LOC A;  4R1H A;  2NVU B;  2MD5 A;  4AU7 A;  2BVM A;  1XC5 A;  2K27 A;  4GO1 A;  4ENJ A;  1BI1 A;  2OBP A;  5EGO A;  3HOT A;  2R7R A;  1MMS A;  1A6Q A;  2NVT J;  2R7T A;  2FML A;  1D1C A;  2VIX A;  2K85 A;  4D9J A;  1BI0 A;  1XDU A;  3FK6 A;  1Z21 A;  5C4X J;  2W00 A;  1FSE A;  5DV5 A;  3GWZ A;  1T56 A;  2WTE A;  5D8L B;  1Y56 A;  3PQK A;  3ZPL A;  2ELK A;  3ZXS A;  2UWM A;  3LA2 A;  4E7I A;  4LIV A;  3BC8 A;  3QU6 A;  2XF6 A;  1D3Y A;  1R7J A;  2ZO4 A;  3L1P A;  3LWF A;  3OOP A;  2ELJ A;  2ECC A;  1LJ9 A;  3DPT A;  3E5U A;  4XLN F;  3E7L A;  4HPQ A;  4FAS D;  4A0Z A;  4FHT A;  4UNO A;  1F9N A;  2HYG D;  2EV6 A;  2QWW A;  1ITY A;  1USS A;  3GME A;  1QZY A;  1U6G A;  2FF4 A;  1T0F C;  2M4K A;  2RGV A;  3FF5 A;  2VKH A;  3FHN A;  4PFP A;  3S2H J;  2KIS A;  2H6C A;  3IAM 2;  1MJ9 A;  2R7Q A;  3VDX A;  1D5Y A;  4G7O F;  2V1D A;  3GFI A;  1LDK B;  2EV5 A;  5M5W J;  1XCV A;  1FTZ A;  1MMA A;  4OU0 A;  5HNH A;  3F3X A;  4AM3 A;  1ETV A;  2O03 A;  2NAZ A;  4BQQ A;  1IGN A;  1BM9 A;  3QAH A;  3K70 D;  1XX5 A;  3LA3 A;  2QKL B;  1G3Y A;  1QBJ A;  3RZO J;  2YSR A;  2HVS A;  3R60 A;  2KIU A;  4P55 A;  4XNF A;  4IHV A;  4LG0 B;  4KIF A;  1LEB A;  2R7W A;  3MN2 A;  5DM6 F;  3IH2 A;  2ZC2 A;  3TW7 A;  3S1N J;  4HX7 A;  3OYL A;  1ONV A;  1WRJ A;  2WV1 A;  4LG0 A;  4A2U A;  2DAO A;  1JGS A;  2TDX A;  1FY7 A;  2F5V A;  2DA4 A;  2OJE D;  3WGI A;  5K1Y A;  3L2R A;  4UUT A;  4QIW N;  2OUM A;  4A3F J;  4HQE A;  2AS5 F;  2XAG A;  2ZXI A;  4KFC A;  3ZOB A; 
#chains in the Genus database with same CATH homology
 1QVT A;  2HQ5 A;  3FK7 A;  2L9R A;  3LOC A;  1B8I A;  4X6A J;  2LR8 A;  2L7Z A;  3H3V K;  2HOT A;  1FIP A;  4BBS J;  1IDY A;  1RES A;  2Y0S N;  5F27 A;  1H88 C;  1AHD P;  2XGE A;  3BR1 A;  3S14 J;  1ZKG A;  2FQ4 A;  1VF9 A;  3JR9 A;  4EEF G;  5EDN A;  2G0E A;  3PO3 J;  2NOG A;  2XGD A;  1P7I A;  3HEF A;  3JRD A;  2LTP A;  3JRC A;  1QVU A;  2CU7 A;  1MSE C;  1DU6 A;  4C2M J;  2EZH A;  2JA5 J;  4Y52 J;  2K40 A;  3S15 J;  3I4N J;  2LD5 A;  3BG9 A;  2IEK A;  2R5Y B;  1WI3 A;  1GUU A;  5E3L A;  1GDT A;  2AHQ A;  4FCY A;  2MW8 A;  3TW6 A;  4A3M J;  3HGG A;  1ZK8 A;  3BR0 A;  1LFB A;  3LNQ A;  2ME0 A;  2R5Y A;  4FTH A;  1MH4 A;  2NS7 A;  1JUM A;  3DEW A;  1TWC J;  1ETO A;  2HOS A;  1S7E A;  3LSP A;  4L5E A;  2XPW A;  2E2I J;  1OFC X;  1JUS A;  4XRS A;  1H8A C;  4JYK A;  4C3H J;  2XPV A;  5IYB J;  3ZQG A;  3ZQH A;  1LFU P;  1MNM C;  3S2D J;  1IRZ A;  3GTM J;  1HOM A;  2LK2 A;  2K9Q A;  5FKO A;  2ME6 A;  2Y9Z A;  5IP9 J;  5EG0 A;  2YS9 A;  1WPK A;  2MGQ A;  4MFE A;  3BTL A;  5FLM J;  1X58 A;  3OSG A;  2CUF A;  1UMQ A;  5IOY A;  3GTO J;  2XSD C;  2DMT A;  3HOY J;  4A3K J;  1ENH A;  1APL C;  2HDD A;  3A02 A;  2R93 J;  2WB1 N;  2FD5 A;  3FKI J;  2E2H J;  5GP9 A;  1TC3 C;  4MIM A;  3CQZ J;  3Q3S A;  3F0C A;  5JLX A;  1OCP A;  3H0G J;  3Q0U A;  5GPC A;  2DA1 A;  1QRY A;  2ID6 A;  4V2G A;  4AUX A;  1Q1V A;  4A69 C;  1JT6 A;  1I50 J;  1RET A;  5E3M A;  2XRL A;  1U9N A;  2DA2 A;  3JRB A;  4A3C J;  2L7F P;  1UG2 A;  2MG4 A;  4A93 J;  1W0T A;  2PMZ N;  2DA7 A;  2Y30 A;  2JK3 A;  4A3G J;  4A3I J;  4M3E A;  2DA6 A;  2XGC A;  1HF0 A;  1UHS A;  1YRN A;  2E1O A;  2DMP A;  1AKH B;  3A03 A;  4MO7 A;  2OF7 A;  3RZD J;  3PM1 A;  1U8B A;  2GBY A;  2ZB9 A;  3BR6 A;  2E2J J;  1ZQ3 P;  1GV2 A;  2JA8 J;  1ZR4 A;  2Y31 A;  2O7O A;  2N8G A;  2H8R A;  2HYJ A;  2I10 A;  1T33 A;  3TP0 A;  4JX4 A;  3S1Q J;  1TWF J;  2EZI A;  1K61 A;  1MBJ A;  3HOX J;  2L0K A;  2ID3 A;  3ZQC A;  1B72 A;  1ZR2 A;  3BQY A;  2EH3 A;  4D7N A;  4XIC A;  1HLV A;  1NK3 P;  4A3B J;  4DZP A;  1IC8 A;  4DYC A;  3JRI A;  2KT0 A;  3A01 B;  3O8H A;  3UKG A;  3TED A;  1R9T J;  3HKZ N;  4M3D A;  3BTI A;  3PO2 J;  1ETY A;  4M3G A;  2E19 A;  2FJ1 A;  4MLO A;  2X6O A;  5FKM A;  4B3A A;  4XRS G;  5M5X J;  3CDL A;  3HOW J;  5BNG A;  1DU0 A;  4D7M A;  2H1K A;  1A6I A;  1XG1 A;  3WHB A;  5HOD A;  1K83 J;  2VPR A;  4I76 A;  4B4C A;  4JX6 A;  5EYR A;  4M6V A;  3ZQL A;  2LY9 A;  1TWH J;  2M0C A;  2HXO A;  3IV5 A;  1JTY A;  1BL0 A;  1ETQ A;  2AO9 A;  3SDG A;  3BTC A;  3HDD A;  2D5V A;  3DCF A;  5J3L A;  4XRM A;  2K9N A;  2QF7 A;  1JT0 A;  1Y1V J;  2QCO A;  2EZK A;  2DA5 A;  2IAI A;  4D5F A;  3B6A A;  5M5Y J;  2CRG A;  1GV5 A;  1OJL A;  5F04 A;  1SAN A;  1U78 A;  2Y9Y A;  1CQT A;  2LKX A;  1MBF A;  1JJ6 C;  2OPT A;  4IEJ A;  4MFD A;  2JA6 J;  3Q0W A;  2DTZ A;  1MBH A;  4JX5 A;  2O9L A;  5FKK A;  4B1R A;  3K2A A;  3JRA A;  1WH5 A;  1U9O A;  4AYB N;  3W6V A;  4C3I J;  2R7Z J;  1JGG A;  2CJJ A;  2LP0 A;  5EZG A;  1JJ8 C;  3GTG J;  1WCM J;  4C3J J;  2X9D A;  3HBL A;  5FKL A;  4I6Z A;  1ZGW A;  2VUM J;  5F0F A;  1ZTR A;  3QQA A;  3BR3 A;  3S16 J;  2LVS A;  1IG7 A;  4QSH A;  2DA3 A;  2W48 A;  3BR5 A;  1RPW A;  1MBG A;  4W1U A;  3B6C A;  5IP6 A;  5EF6 A;  1VND A;  2EBI A;  1GVD A;  1VI0 A;  4CYC B;  1F43 A;  2M9H A;  2CQQ A;  2DMN A;  3RQI A;  2FX0 A;  1ETK A;  2VI6 A;  3RKQ A;  5IYD J;  4DYR A;  2HXI A;  1BJZ A;  1SFO J;  2JA7 J;  1EF4 A;  1W0U A;  3MKL A;  3SFI A;  2DN0 A;  1AKH A;  2XB5 A;  4FE4 A;  1Z0X A;  2JN6 A;  2GM4 A;  5IPA A;  5EZH A;  4AC0 A;  4RBO A;  3D1N I;  5K7F A;  4V2F A;  1MH3 A;  4RDU A;  1Y1W J;  2M34 A;  1TWA J;  1E3O C;  3HOZ J;  4HNV A;  3C2B A;  4Y7N J;  1OCT C;  2XPU A;  4BXX J;  4DW6 A;  2O8K A;  1ETW A;  1IUF A;  1VFC A;  2DMQ A;  1MBK A;  3K7A J;  5E3O A;  4X1E A;  3HOV J;  2WAQ N;  3GTJ J;  1X2M A;  1TWG J;  2R0Q C;  2B63 J;  4A3D J;  2IBD A;  2HI3 A;  4M3B A;  3ZQI A;  5IP7 J;  3S17 J;  3A01 A;  2ECB A;  4BY1 J;  2Y2Z A;  1A5J A;  2R5Z B;  5DTD A;  1I6H J;  1WH7 A;  1JKR C;  1QPI A;  5C3E J;  3O8G A;  1BW5 A;  1IJW C;  4IHX A;  2DJN A;  2L7M P;  3GTQ J;  2R5Z A;  1B8I B;  3QPL A;  4DYQ A;  5J1R A;  2YUS A;  3OOU A;  1POG A;  2JWT A;  4IHW A;  3ZQF A;  3QPS A;  5C44 J;  4BBR J;  5F0H A;  2EZL A;  3G1O A;  2VKV A;  4NDL A;  1H89 C;  3HB9 A;  3WHC A;  2K9S A;  3JRF A;  2CQX A;  1P7J A;  2TRT A;  3BTJ A;  3S1R J;  1JKO C;  1JUP A;  5K7H A;  2JJ7 A;  4S0H B;  1O4X A;  4D5C A;  5C4J J;  1PUF B;  4BKX A;  3IH4 A;  2EQR A;  3LSR A;  3FIS A;  1RR7 A;  1PUF A;  4QTR A;  4A3E J;  5DS9 A;  5F1J A;  3CMY A;  2MSY A;  5F0C A;  4DZJ A;  5M3M J;  2KDZ A;  3G1M A;  4IHY A;  4G12 A;  2RAE A;  4J19 A;  3IH3 A;  3BT9 A;  3HOU J;  1FJL A;  1FEX A;  2P81 A;  5IOZ A;  5EGO B;  1WGX A;  2X48 A;  1ETX A;  1F36 A;  3LSG A;  1RKT A;  4LOC A;  1IDZ A;  5IYC J;  3JRE A;  1XC5 A;  1FTT A;  3MVP A;  5EG0 B;  5EGO A;  1XS9 A;  1RKW A;  1MSF C;  2NVX J;  2NVY J;  3S1M J;  1G2H A;  2CUE A;  2NVT J;  1HCR A;  3BR2 A;  3BQZ A;  4FIS A;  3FK6 A;  3HM5 A;  5C4X J;  2LLK A;  9ANT A;  2GLO A;  3I4M J;  3GTL J;  1IV6 A;  1T56 A;  2JMW A;  3GBG A;  1JKP C;  1MBE A;  2ELK A;  1AU7 A;  4ABZ A;  3GTK J;  3LSJ A;  4FE7 A;  5JLW A;  5EEA A;  1JKQ C;  2M2E A;  3CCY A;  3L1P A;  2ECC A;  2R92 J;  4CYC A;  3E7L A;  5J1U A;  5E3N A;  2NS8 A;  2NVQ J;  4XK4 A;  4XID A;  1ITY A;  1X2N A;  1HDP A;  1JTX A;  3VPR A;  2YU9 J;  1NK2 P;  1FIA A;  4A3L J;  1NTC A;  5FJ8 J;  3S2H J;  2HOA A;  2XB0 X;  4UUS B;  2COB A;  4BY7 J;  2M8G X;  1D5Y A;  1I3Q J;  2LFB A;  5M5W J;  1YRN B;  4M3F A;  1FTZ A;  3OSF A;  4UUS A;  1ORK A;  2TCT A;  1HDD C;  1ETV A;  4GFB A;  5FLV A;  1BA5 A;  1IGN A;  1BW6 A;  3JRG A;  1LE8 B;  3RZO J;  3M3Y J;  3G1L A;  3GTP J;  4A3J J;  4JP0 A;  3TP3 A;  5GPA A;  4IHV A;  1LE8 A;  3M4O J;  5M3F J;  5FKN A;  3MN2 A;  3NAU A;  1B72 B;  3IH2 A;  3FIW A;  3TW7 A;  3S1N J;  2WV1 A;  1GT0 C;  1Z77 A;  2DA4 A;  4W97 A;  3OIO A;  3BG3 A;  5F08 A;  2DMU A;  4UUT A;  2VKE A;  4QIW N;  3HGY A;  4A3F J;  3NAR A;  5K7Z A;  3BG5 A;  3JRH A;  3SJM A;  5J1Y A;  3ZOB A;  3Q0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...