2EM4A

Solution structure of the c2h2 type zinc finger (region 724-756) of human zinc finger protein 28 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGQRPYECIECGKAFKTKSSLICHRRSHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 724-756) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 28 homolog
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13912 zf-C2H2_6 C2H2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em4A01
2EM2A 3EPKA 2A25A 2ADRA 2EOEA 2EMYA 4IS1C 2EOIA 2EQ3A 2EN7A 2EPZA 1X6HA 2EMHA 1TN9A 2I13A 2EL4A 2YTQA 1BBOA 2EL5A 3M99B 2EOXA 2LO3A 1A1FA 1DGCA 2EM9A 3EPJA 2YTPA 2EM3A 2E72A 2EN8A 2WBTA 2YSPA 2YU8A 2M9AA 1UN6B 2ENHA 2EN4A 3MHSC 1MEYC 2EOYA 2ENAA 2EPRA 2CSHA 4GZNC 2EPAA 2YRHA 2EPPA 1WJPA 4IJDA 2LCEA 1TF6A 2EOJA 2EMLA 2EOMA 2EMKA 1ZU1A 2J7JA 2YTEA 4M9VC 2DGCA 1A1LA 5KL6A 4FK5C 2YTFA 2WCC3 2EM0A 2YRKA 2WBUA 5KL4A 1X6FA 1G2DC 5KL7A 1YUJA 1LLMC 1X6EA 3MHHC 2DRPA 2LVHA 2EM4A 2YTJA 2EM5A 4R2QA 1NCSA 3EPLA 2CT1A 2EM6A 2LV2A 2EN6A 2EPCA 2R1FA 2YTNA 2EOHA 2GLIA 2MKNA 1YSAC 1UBDC 2YTGA 2EN3A 2EM8A 2BB8A 1YUIA 2EOQA 2EOOA 2YU5A 4R2CA 4WSGA 3UK3C 2NABA 4R2DA 2EN2A 2EQ0A 1X5WA 2WBSA 2VRDA 2EMCA 1A1IA 1F2IG 5KL3A 2YTDA 2LT7A 1A1JA 1RMDA 2DLQA 3VHTB 2EMWA 2EMGA 1ZAAC 1TF3A 1P47A 2MKDA 2EJ4A 1AAYA 2DLKA 5KL5A 2EMIA 2JPAA 2EN1A 1B69A 1A1KA 2RSIA 2EOFA 2YRMA 2ENCA 5KL2A 2EMFA 1A1GA 2ELYA 2YSOA 2EORA 2EPXA 1G2FC 2EOSA 2EPUA 2EL6A 2EMAA 4R2EA 2EQ1A 1Z1BA 1KJKA 2EP3A 2ELZA 2YTOA 2RPCA 2PRTA 2D9HA 2GHFA 4F2JC 3EPHA 2EMZA 2MDGA 2EE8A 4R2AA 1X3CA 2JP9A 4R2SA 2EMXA 4F6MA 4F6NA 2YTIA 2CTDA 2EOZA 1BB8A 2DMIA 2EMBA 1JK2A 1ZR9A 2HGHA 2EM7A 4R2RA 4X9JA 1A1HA 4R2PA 1JK1A
chains in the Genus database with same CATH superfamily
2UXBE 1ZBQA 4TUGA 3C6MA 1WRJA 5A2QC 2UU9E 2EN7A 2EMHA 2I13A 1N33E 1WXRA 2YTQA 3M99B 5A6BD 2LO3A 5AC5A 4JI3E 3EPJA 1X49A 2YTPA 1EH7A 2WBTA 4DUZE 2YSPA 2ENHA 1DI2A 3HXLA 1TF6A 2E5LE 4DV0E 5BR8E 2YTEA 4M9VC 5LL6R 2KOUA 4O5GA 2B9DA 2YTFA 4WX9A 3OTOE 5KL4A 1STUA 2DIXA 2V8QB 4N4RB 1G2DC 5KL7A 4DR4E 5A6AA 1LLMC 1X6EA 3MHHC 2EM4A 3AUZA 2EM5A 3JAMC 5AE2A 2HJJA 1DQ3A 2LV2A 1YPNA 3ADGA 2EN6A 2R1FA 3HPSA 2GLIA 1ZBTA 2YTGA 2YU5A 5T6JA 4R2CA 2NABA 2YT4A 2EN2A 4LF7E 2LUQA 4O24A 1GTKA 2EMCA 4DV1E 1F2IG 3FIGA 1AH5A 2V87A 2VQFE 2LT7A 1A1JA 4NZVA 4DR3E 4M30A 4YHHE 2FTXB 1TF3A 1P47A 4LF6E 4P7DA 4BBYA 2DLKA 4RHBB 5IV8B 1T38A 1B69A 2YWQA 2EPNA 4TUIA 2ODRC 2RSIA 2LJHA 4JI4E 1A1GA 4O4KA 2YSOA 1N34E 1BBGA 3THNA 2V83A 2MC5A 2EMAA 2EQ1A 1T39A 1O0WA 2L92A 2ELZA 2YTOA 2RPCA 4MLQA 2M1SA 4F2JC 2NUGA 4R2AA 2JP9A 2LTSA 2N8XA 4F6MA 2EPKX 4I8OA 2YTIA 2MC6A 2CTDA 4DV7E 4B3TE 2RS6A 1JK2A 1N32E 2HGHA 2UUCE 3VYXA 5IWAE 3HPZA 5AASA 2EOIA 2EPZA 2EQ3A 4BC7A 1TN9A 2M4IA 2EL4A 4JI8E 4X64E 2B3TB 4JI1E 2EM9A 2LE2A 1XMQE 2RS7A 2JOBA 4L8NA 1UN6B 4F9BB 1KYQA 3BIDA 2EOYA 2EPRA 2B7VA 4DV6E 2EMKA 1ZU1A 2EPOA 5F3WA 1YFHA 2M7QA 4R03A 1A1LA 4WPYA 4FK5C 2WBUA 2JYAA 2LVHA 4X65E 3MSWA 1NCSA 2LMZA 3EPLA 4HEIA 2F4VE 2YTNA 1NEIA 2EOHA 5TSEA 2YPNA 2JY9A 2EOQA 2UUAE 5DNYA 2EOOA 4LF9E 1RC7A 3ECRA 4LTYA 4DUYE 3ADJA 4JI6E 1X5WA 4NXNE 2LJUA 2VRDA 2L8TA 4LFAE 2YTDA 1RMDA 2RSMA 1SR9A 2EMGA 2YZTA 2JXPA 5A6JA 2WZOA 2MKDA 1T4NA 2EJ4A 5A6BA 1AAYA 3L00A 2EPLX 5CFFE 2RQLA 2NUFA 1QNTA 2EOFA 1T4OA 4HTGA 4GKJE 1T4LB 2EPXA 4RH8A 2I9IA 1HNZE 2EPUA 4J8ZA 4F9CB 2EL6A 2UXCE 3K6QA 3THOB 3J80C 4R2EA 2G7HA 4KHPE 4DV3E 4R8OA 3IWBA 1HR0E 1J5EE 2D9HA 3HQ1A 3KZYA 5LLQA 2IHR1 1SFEA 2EOZA 4NHRA 2H36X 2DMIA 2UXDE 2HHHE 4R2RA 1QU6A 3EPKA 2A25A 2L2KB 2EOEA 2EMYA 1PDAA 3C4BA 4IS1C 4LF5E 1X6HA 1BBOA 2EOXA 1FKAE 2DB2A 1A1FA 2LTRA 3JTZA 2LRSA 3C4TA 2EN8A 2YU8A 1PJTA 2M9AA 3T1HE 3BF2A 2EN4A 3EQ1A 3DJWA 5IXMB 2CSHA 4GZNC 2EPAA 2EPPA 4IJDA 2N3GA 4WXDA 2EOJA 2EMLA 4ZYHA 4DKKA 2DGCA 1IQOA 2WCC3 2EM0A 2YRKA 4B3SE 1X6FA 4ZYDA 4BHBA 4R2QA 1IQSA 4JI5E 3IWDA 4DV2E 4Q28A 3J81C 1YSAC 2MKNA 1UBDC 2L3JA 2EN3A 2BB8A 4K0KE 2Q8UA 3UK3C 4R2DA 2L2NA 2L6MA 2EQ0A 2WBSA 1EH6A 2KHXA 4ZYGA 2VF1A 3J7Yp 3VHTB 2EMWA 2E1MA 1ZAAC 2EMIA 3LMLA 3QG5C 3ADIA 4DR5E 2EN1A 1A1KA 5A6KA 4LF8E 4X62E 3C6KA 4NXME 4JI0E 2YRMA 4DR7E 2CPNA 1YYOA 2JWOA 3ZOQB 1G2FC 2EOSA 1I94E 1L4SA 4MLVA 4JI7E 2KONA 4OOGC 3BBGA 3F6GA 1IBLE 5AC4A 5FLXC 1KJKA 2DMYA 2EP3A 2GHFA 2RTXA 2ODRD 3EPHA 1PKPA 1X48A 3DF6A 4R2SA 1XNRE 2EMXA 1FJGE 2GPIA 2V89A 4WYQB 1EKZA 4F6NA 1HNXE 1YZ9A 2F8BA 2N3HA 2EMBA 4M2ZA 4X9JA 4F54A 2V85A 1A1HA 4R2PA 1JK1A 1YYKA 2NA2A 5AE1A 2EM2A 4OX9E 4AQYE 3F6HA 3AV0A 4DV4E 2ADRA 2UUBE 2EL5A 4BCAA 3KZZA 3ADLA 1DGCA 3KWRA 1X47A 4L5NC 4F9AB 1IBME 2EM3A 2E72A 1UILA 4BMJA 1N36E 4DV5E 3MHSC 2LUPB 1MEYC 2ENAA 2YRHA 4LU9A 1WJPA 4WSPA 2LCEA 2FV4B 2L33A 2EOMA 2J7JA 4BHCA 1PJSA 4GKKE 5KL6A 1GQEA 4KWYA 2ZM6E 3JU0A 5ADZA 1YUJA 1EH8A 3H09A 2DRPA 3IWCA 2BBGA 4KZSA 4WXCA 2YTJA 4YY3E 3P1XA 2JR1A 4JV5E 2CT1A 1PJQA 2EM6A 5A69A 1J26A 2EPCA 4B3RE 1HNWE 2L2MA 2EPMX 4WFTA 4GEQB 1RQ0A 3LLHA 4M0VA 2EM8A 1YUIA 1WHNA 1IBKE 4WSGA 4X8WA 2VQEE 1YYWA 2LBSB 2MDRA 4O43A 4X66E 3T1YE 4BC9A 1GZ6A 3OMLA 3RMPA 5KL3A 1A1IA 4JYAE 2DSYA 2DLQA 4Q35B 4ZYEA 1MGTA 1XNQE 3J7AG 2K7IA 3TQMA 5KL5A 4DR6E 2JPAA 4LF4E 2JOXA 2EZ6A 1IMUA 4JI2E 1XMOE 2ENCA 5KL2A 2EMFA 3VYYA 2ELYA 4LFCE 2EORA 2VE7C 1UHZA 5LMUE 2K4VA 2JVAA 5IT9C 5LMNE 1Z1BA 2R76A 4P78A 2PRTA 2HC5A 2EMZA 3BGHA 3VK6A 2MDGA 2EWLA 2EE8A 4B3ME 3HTXA 1X3CA 2L3CA 4DR1E 2NUEA 2V86A 1N3GA 4DR2E 5AE3A 4BS9A 1BB8A 1ZR9A 2EM7A 2FGGA 2V88A 1WHQA 4DMIA 2B7TA 4LFBE
chains in the Genus database with same CATH topology
2EM2A 3EPKA 2A25A 2ADRA 2EOEA 2EMYA 4IS1C 2EOIA 2EQ3A 2EN7A 2EPZA 1X6HA 2EMHA 1TN9A 2I13A 2EL4A 2YTQA 1BBOA 2EL5A 3M99B 2EOXA 2LO3A 1A1FA 1DGCA 2EM9A 3EPJA 2YTPA 2EM3A 2E72A 2EN8A 2WBTA 2YSPA 2YU8A 2M9AA 1UN6B 2ENHA 2EN4A 3MHSC 1MEYC 2EOYA 2ENAA 2EPRA 2CSHA 4GZNC 2EPAA 2YRHA 2EPPA 1WJPA 4IJDA 2LCEA 1TF6A 2EOJA 2EMLA 2EOMA 2EMKA 1ZU1A 2J7JA 2YTEA 4M9VC 2DGCA 1A1LA 5KL6A 4FK5C 2YTFA 2WCC3 2EM0A 2YRKA 2WBUA 5KL4A 1X6FA 1G2DC 5KL7A 1YUJA 1LLMC 1X6EA 3MHHC 2DRPA 2LVHA 2EM4A 2YTJA 2EM5A 4R2QA 1NCSA 3EPLA 2CT1A 2EM6A 2LV2A 2EN6A 2EPCA 2R1FA 2YTNA 2EOHA 2GLIA 2MKNA 1YSAC 1UBDC 2YTGA 2EN3A 2EM8A 2BB8A 1YUIA 2EOQA 2EOOA 2YU5A 4R2CA 4WSGA 3UK3C 2NABA 4R2DA 2EN2A 2EQ0A 1X5WA 2WBSA 2VRDA 2EMCA 1A1IA 1F2IG 5KL3A 2YTDA 2LT7A 1A1JA 1RMDA 2DLQA 3VHTB 2EMWA 2EMGA 1ZAAC 1TF3A 1P47A 2MKDA 2EJ4A 1AAYA 2DLKA 5KL5A 2EMIA 2JPAA 2EN1A 1B69A 1A1KA 2RSIA 2EOFA 2YRMA 2ENCA 5KL2A 2EMFA 1A1GA 2ELYA 2YSOA 2EORA 2EPXA 1G2FC 2EOSA 2EPUA 2EL6A 2EMAA 4R2EA 2EQ1A 1Z1BA 1KJKA 2EP3A 2ELZA 2YTOA 2RPCA 2PRTA 2D9HA 2GHFA 4F2JC 3EPHA 2EMZA 2MDGA 2EE8A 4R2AA 1X3CA 2JP9A 4R2SA 2EMXA 4F6MA 4F6NA 2YTIA 2CTDA 2EOZA 1BB8A 2DMIA 2EMBA 1JK2A 1ZR9A 2HGHA 2EM7A 4R2RA 4X9JA 1A1HA 4R2PA 1JK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM2 A;  3EPK A;  2A25 A;  2ADR A;  2EOE A;  2EMY A;  4IS1 C;  2EOI A;  2EQ3 A;  2EN7 A;  2EPZ A;  1X6H A;  2EMH A;  1TN9 A;  2I13 A;  2EL4 A;  2YTQ A;  1BBO A;  2EL5 A;  3M99 B;  2EOX A;  2LO3 A;  1A1F A;  1DGC A;  2EM9 A;  3EPJ A;  2YTP A;  2EM3 A;  2E72 A;  2EN8 A;  2WBT A;  2YSP A;  2YU8 A;  2M9A A;  1UN6 B;  2ENH A;  2EN4 A;  3MHS C;  1MEY C;  2EOY A;  2ENA A;  2EPR A;  2CSH A;  4GZN C;  2EPA A;  2YRH A;  2EPP A;  1WJP A;  4IJD A;  2LCE A;  1TF6 A;  2EOJ A;  2EML A;  2EOM A;  2EMK A;  1ZU1 A;  2J7J A;  2YTE A;  4M9V C;  2DGC A;  1A1L A;  5KL6 A;  4FK5 C;  2YTF A;  2WCC 3;  2EM0 A;  2YRK A;  2WBU A;  5KL4 A;  1X6F A;  1G2D C;  5KL7 A;  1YUJ A;  1LLM C;  1X6E A;  3MHH C;  2DRP A;  2LVH A;  2EM4 A;  2YTJ A;  2EM5 A;  4R2Q A;  1NCS A;  3EPL A;  2CT1 A;  2EM6 A;  2LV2 A;  2EN6 A;  2EPC A;  2R1F A;  2YTN A;  2EOH A;  2GLI A;  2MKN A;  1YSA C;  1UBD C;  2YTG A;  2EN3 A;  2EM8 A;  2BB8 A;  1YUI A;  2EOQ A;  2EOO A;  2YU5 A;  4R2C A;  4WSG A;  3UK3 C;  2NAB A;  4R2D A;  2EN2 A;  2EQ0 A;  1X5W A;  2WBS A;  2VRD A;  2EMC A;  1A1I A;  1F2I G;  5KL3 A;  2YTD A;  2LT7 A;  1A1J A;  1RMD A;  2DLQ A;  3VHT B;  2EMW A;  2EMG A;  1ZAA C;  1TF3 A;  1P47 A;  2MKD A;  2EJ4 A;  1AAY A;  2DLK A;  5KL5 A;  2EMI A;  2JPA A;  2EN1 A;  1B69 A;  1A1K A;  2RSI A;  2EOF A;  2YRM A;  2ENC A;  5KL2 A;  2EMF A;  1A1G A;  2ELY A;  2YSO A;  2EOR A;  2EPX A;  1G2F C;  2EOS A;  2EPU A;  2EL6 A;  2EMA A;  4R2E A;  2EQ1 A;  1Z1B A;  1KJK A;  2EP3 A;  2ELZ A;  2YTO A;  2RPC A;  2PRT A;  2D9H A;  2GHF A;  4F2J C;  3EPH A;  2EMZ A;  2MDG A;  2EE8 A;  4R2A A;  1X3C A;  2JP9 A;  4R2S A;  2EMX A;  4F6M A;  4F6N A;  2YTI A;  2CTD A;  2EOZ A;  1BB8 A;  2DMI A;  2EMB A;  1JK2 A;  1ZR9 A;  2HGH A;  2EM7 A;  4R2R A;  4X9J A;  1A1H A;  4R2P A;  1JK1 A; 
#chains in the Genus database with same CATH topology
 2UXB E;  1ZBQ A;  4TUG A;  3C6M A;  1WRJ A;  5A2Q C;  2UU9 E;  2EN7 A;  2EMH A;  2I13 A;  1N33 E;  1WXR A;  2YTQ A;  3M99 B;  5A6B D;  2LO3 A;  5AC5 A;  4JI3 E;  3EPJ A;  1X49 A;  2YTP A;  1EH7 A;  2WBT A;  4DUZ E;  2YSP A;  2ENH A;  1DI2 A;  3HXL A;  1TF6 A;  2E5L E;  4DV0 E;  5BR8 E;  2YTE A;  4M9V C;  5LL6 R;  2KOU A;  4O5G A;  2B9D A;  2YTF A;  4WX9 A;  3OTO E;  5KL4 A;  1STU A;  2DIX A;  2V8Q B;  4N4R B;  1G2D C;  5KL7 A;  4DR4 E;  5A6A A;  1LLM C;  1X6E A;  3MHH C;  2EM4 A;  3AUZ A;  2EM5 A;  3JAM C;  5AE2 A;  2HJJ A;  1DQ3 A;  2LV2 A;  1YPN A;  3ADG A;  2EN6 A;  2R1F A;  3HPS A;  2GLI A;  1ZBT A;  2YTG A;  2YU5 A;  5T6J A;  4R2C A;  2NAB A;  2YT4 A;  2EN2 A;  4LF7 E;  2LUQ A;  4O24 A;  1GTK A;  2EMC A;  4DV1 E;  1F2I G;  3FIG A;  1AH5 A;  2V87 A;  2VQF E;  2LT7 A;  1A1J A;  4NZV A;  4DR3 E;  4M30 A;  4YHH E;  2FTX B;  1TF3 A;  1P47 A;  4LF6 E;  4P7D A;  4BBY A;  2DLK A;  4RHB B;  5IV8 B;  1T38 A;  1B69 A;  2YWQ A;  2EPN A;  4TUI A;  2ODR C;  2RSI A;  2LJH A;  4JI4 E;  1A1G A;  4O4K A;  2YSO A;  1N34 E;  1BBG A;  3THN A;  2V83 A;  2MC5 A;  2EMA A;  2EQ1 A;  1T39 A;  1O0W A;  2L92 A;  2ELZ A;  2YTO A;  2RPC A;  4MLQ A;  2M1S A;  4F2J C;  2NUG A;  4R2A A;  2JP9 A;  2LTS A;  2N8X A;  4F6M A;  2EPK X;  4I8O A;  2YTI A;  2MC6 A;  2CTD A;  4DV7 E;  4B3T E;  2RS6 A;  1JK2 A;  1N32 E;  2HGH A;  2UUC E;  3VYX A;  5IWA E;  3HPZ A;  5AAS A;  2EOI A;  2EPZ A;  2EQ3 A;  4BC7 A;  1TN9 A;  2M4I A;  2EL4 A;  4JI8 E;  4X64 E;  2B3T B;  4JI1 E;  2EM9 A;  2LE2 A;  1XMQ E;  2RS7 A;  2JOB A;  4L8N A;  1UN6 B;  4F9B B;  1KYQ A;  3BID A;  2EOY A;  2EPR A;  2B7V A;  4DV6 E;  2EMK A;  1ZU1 A;  2EPO A;  5F3W A;  1YFH A;  2M7Q A;  4R03 A;  1A1L A;  4WPY A;  4FK5 C;  2WBU A;  2JYA A;  2LVH A;  4X65 E;  3MSW A;  1NCS A;  2LMZ A;  3EPL A;  4HEI A;  2F4V E;  2YTN A;  1NEI A;  2EOH A;  5TSE A;  2YPN A;  2JY9 A;  2EOQ A;  2UUA E;  5DNY A;  2EOO A;  4LF9 E;  1RC7 A;  3ECR A;  4LTY A;  4DUY E;  3ADJ A;  4JI6 E;  1X5W A;  4NXN E;  2LJU A;  2VRD A;  2L8T A;  4LFA E;  2YTD A;  1RMD A;  2RSM A;  1SR9 A;  2EMG A;  2YZT A;  2JXP A;  5A6J A;  2WZO A;  2MKD A;  1T4N A;  2EJ4 A;  5A6B A;  1AAY A;  3L00 A;  2EPL X;  5CFF E;  2RQL A;  2NUF A;  1QNT A;  2EOF A;  1T4O A;  4HTG A;  4GKJ E;  1T4L B;  2EPX A;  4RH8 A;  2I9I A;  1HNZ E;  2EPU A;  4J8Z A;  4F9C B;  2EL6 A;  2UXC E;  3K6Q A;  3THO B;  3J80 C;  4R2E A;  2G7H A;  4KHP E;  4DV3 E;  4R8O A;  3IWB A;  1HR0 E;  1J5E E;  2D9H A;  3HQ1 A;  3KZY A;  5LLQ A;  2IHR 1;  1SFE A;  2EOZ A;  4NHR A;  2H36 X;  2DMI A;  2UXD E;  2HHH E;  4R2R A;  1QU6 A;  3EPK A;  2A25 A;  2L2K B;  2EOE A;  2EMY A;  1PDA A;  3C4B A;  4IS1 C;  4LF5 E;  1X6H A;  1BBO A;  2EOX A;  1FKA E;  2DB2 A;  1A1F A;  2LTR A;  3JTZ A;  2LRS A;  3C4T A;  2EN8 A;  2YU8 A;  1PJT A;  2M9A A;  3T1H E;  3BF2 A;  2EN4 A;  3EQ1 A;  3DJW A;  5IXM B;  2CSH A;  4GZN C;  2EPA A;  2EPP A;  4IJD A;  2N3G A;  4WXD A;  2EOJ A;  2EML A;  4ZYH A;  4DKK A;  2DGC A;  1IQO A;  2WCC 3;  2EM0 A;  2YRK A;  4B3S E;  1X6F A;  4ZYD A;  4BHB A;  4R2Q A;  1IQS A;  4JI5 E;  3IWD A;  4DV2 E;  4Q28 A;  3J81 C;  1YSA C;  2MKN A;  1UBD C;  2L3J A;  2EN3 A;  2BB8 A;  4K0K E;  2Q8U A;  3UK3 C;  4R2D A;  2L2N A;  2L6M A;  2EQ0 A;  2WBS A;  1EH6 A;  2KHX A;  4ZYG A;  2VF1 A;  3J7Y p;  3VHT B;  2EMW A;  2E1M A;  1ZAA C;  2EMI A;  3LML A;  3QG5 C;  3ADI A;  4DR5 E;  2EN1 A;  1A1K A;  5A6K A;  4LF8 E;  4X62 E;  3C6K A;  4NXM E;  4JI0 E;  2YRM A;  4DR7 E;  2CPN A;  1YYO A;  2JWO A;  3ZOQ B;  1G2F C;  2EOS A;  1I94 E;  1L4S A;  4MLV A;  4JI7 E;  2KON A;  4OOG C;  3BBG A;  3F6G A;  1IBL E;  5AC4 A;  5FLX C;  1KJK A;  2DMY A;  2EP3 A;  2GHF A;  2RTX A;  2ODR D;  3EPH A;  1PKP A;  1X48 A;  3DF6 A;  4R2S A;  1XNR E;  2EMX A;  1FJG E;  2GPI A;  2V89 A;  4WYQ B;  1EKZ A;  4F6N A;  1HNX E;  1YZ9 A;  2F8B A;  2N3H A;  2EMB A;  4M2Z A;  4X9J A;  4F54 A;  2V85 A;  1A1H A;  4R2P A;  1JK1 A;  1YYK A;  2NA2 A;  5AE1 A;  2EM2 A;  4OX9 E;  4AQY E;  3F6H A;  3AV0 A;  4DV4 E;  2ADR A;  2UUB E;  2EL5 A;  4BCA A;  3KZZ A;  3ADL A;  1DGC A;  3KWR A;  1X47 A;  4L5N C;  4F9A B;  1IBM E;  2EM3 A;  2E72 A;  1UIL A;  4BMJ A;  1N36 E;  4DV5 E;  3MHS C;  2LUP B;  1MEY C;  2ENA A;  2YRH A;  4LU9 A;  1WJP A;  4WSP A;  2LCE A;  2FV4 B;  2L33 A;  2EOM A;  2J7J A;  4BHC A;  1PJS A;  4GKK E;  5KL6 A;  1GQE A;  4KWY A;  2ZM6 E;  3JU0 A;  5ADZ A;  1YUJ A;  1EH8 A;  3H09 A;  2DRP A;  3IWC A;  2BBG A;  4KZS A;  4WXC A;  2YTJ A;  4YY3 E;  3P1X A;  2JR1 A;  4JV5 E;  2CT1 A;  1PJQ A;  2EM6 A;  5A69 A;  1J26 A;  2EPC A;  4B3R E;  1HNW E;  2L2M A;  2EPM X;  4WFT A;  4GEQ B;  1RQ0 A;  3LLH A;  4M0V A;  2EM8 A;  1YUI A;  1WHN A;  1IBK E;  4WSG A;  4X8W A;  2VQE E;  1YYW A;  2LBS B;  2MDR A;  4O43 A;  4X66 E;  3T1Y E;  4BC9 A;  1GZ6 A;  3OML A;  3RMP A;  5KL3 A;  1A1I A;  4JYA E;  2DSY A;  2DLQ A;  4Q35 B;  4ZYE A;  1MGT A;  1XNQ E;  3J7A G;  2K7I A;  3TQM A;  5KL5 A;  4DR6 E;  2JPA A;  4LF4 E;  2JOX A;  2EZ6 A;  1IMU A;  4JI2 E;  1XMO E;  2ENC A;  5KL2 A;  2EMF A;  3VYY A;  2ELY A;  4LFC E;  2EOR A;  2VE7 C;  1UHZ A;  5LMU E;  2K4V A;  2JVA A;  5IT9 C;  5LMN E;  1Z1B A;  2R76 A;  4P78 A;  2PRT A;  2HC5 A;  2EMZ A;  3BGH A;  3VK6 A;  2MDG A;  2EWL A;  2EE8 A;  4B3M E;  3HTX A;  1X3C A;  2L3C A;  4DR1 E;  2NUE A;  2V86 A;  1N3G A;  4DR2 E;  5AE3 A;  4BS9 A;  1BB8 A;  1ZR9 A;  2EM7 A;  2FGG A;  2V88 A;  1WHQ A;  4DMI A;  2B7T A;  4LFB E; 
#chains in the Genus database with same CATH homology
 2EM2 A;  3EPK A;  2A25 A;  2ADR A;  2EOE A;  2EMY A;  4IS1 C;  2EOI A;  2EQ3 A;  2EN7 A;  2EPZ A;  1X6H A;  2EMH A;  1TN9 A;  2I13 A;  2EL4 A;  2YTQ A;  1BBO A;  2EL5 A;  3M99 B;  2EOX A;  2LO3 A;  1A1F A;  1DGC A;  2EM9 A;  3EPJ A;  2YTP A;  2EM3 A;  2E72 A;  2EN8 A;  2WBT A;  2YSP A;  2YU8 A;  2M9A A;  1UN6 B;  2ENH A;  2EN4 A;  3MHS C;  1MEY C;  2EOY A;  2ENA A;  2EPR A;  2CSH A;  4GZN C;  2EPA A;  2YRH A;  2EPP A;  1WJP A;  4IJD A;  2LCE A;  1TF6 A;  2EOJ A;  2EML A;  2EOM A;  2EMK A;  1ZU1 A;  2J7J A;  2YTE A;  4M9V C;  2DGC A;  1A1L A;  5KL6 A;  4FK5 C;  2YTF A;  2WCC 3;  2EM0 A;  2YRK A;  2WBU A;  5KL4 A;  1X6F A;  1G2D C;  5KL7 A;  1YUJ A;  1LLM C;  1X6E A;  3MHH C;  2DRP A;  2LVH A;  2EM4 A;  2YTJ A;  2EM5 A;  4R2Q A;  1NCS A;  3EPL A;  2CT1 A;  2EM6 A;  2LV2 A;  2EN6 A;  2EPC A;  2R1F A;  2YTN A;  2EOH A;  2GLI A;  2MKN A;  1YSA C;  1UBD C;  2YTG A;  2EN3 A;  2EM8 A;  2BB8 A;  1YUI A;  2EOQ A;  2EOO A;  2YU5 A;  4R2C A;  4WSG A;  3UK3 C;  2NAB A;  4R2D A;  2EN2 A;  2EQ0 A;  1X5W A;  2WBS A;  2VRD A;  2EMC A;  1A1I A;  1F2I G;  5KL3 A;  2YTD A;  2LT7 A;  1A1J A;  1RMD A;  2DLQ A;  3VHT B;  2EMW A;  2EMG A;  1ZAA C;  1TF3 A;  1P47 A;  2MKD A;  2EJ4 A;  1AAY A;  2DLK A;  5KL5 A;  2EMI A;  2JPA A;  2EN1 A;  1B69 A;  1A1K A;  2RSI A;  2EOF A;  2YRM A;  2ENC A;  5KL2 A;  2EMF A;  1A1G A;  2ELY A;  2YSO A;  2EOR A;  2EPX A;  1G2F C;  2EOS A;  2EPU A;  2EL6 A;  2EMA A;  4R2E A;  2EQ1 A;  1Z1B A;  1KJK A;  2EP3 A;  2ELZ A;  2YTO A;  2RPC A;  2PRT A;  2D9H A;  2GHF A;  4F2J C;  3EPH A;  2EMZ A;  2MDG A;  2EE8 A;  4R2A A;  1X3C A;  2JP9 A;  4R2S A;  2EMX A;  4F6M A;  4F6N A;  2YTI A;  2CTD A;  2EOZ A;  1BB8 A;  2DMI A;  2EMB A;  1JK2 A;  1ZR9 A;  2HGH A;  2EM7 A;  4R2R A;  4X9J A;  1A1H A;  4R2P A;  1JK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...