2EM4A

Solution structure of the c2h2 type zinc finger (region 724-756) of human zinc finger protein 28 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGQRPYECIECGKAFKTKSSLICHRRSHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 724-756) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 28 homolog
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13912 zf-C2H2_6 C2H2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em4A01
1UBDC 2YSOA 2EPXA 2NABA 2YU8A 2EMZA 2EQ1A 2EPPA 2M9AA 1LLMC 1JK2A 2EMAA 2EJ4A 4GZNC 2I13A 2YTJA 1ZAAC 1TN9A 2YRMA 2EM9A 2EMCA 2EM6A 1P47A 2EMFA 2ENCA 2EOFA 3EPLA 2RSIA 2YTNA 2R1FA 2YRHA 2EMGA 4IJDA 4WSGA 2EL6A 1MEYC 1A1HA 4X9JA 1AAYA 3M99B 1X6FA 2ENAA 2DGCA 2JP9A 2YTPA 2PRTA 2EL5A 2EMWA 2EMKA 2EOHA 2EOEA 2EPAA 1A1LA 4F6NA 2GHFA 2YTDA 4R2SA 2EM3A 2EOJA 2YRKA 3UK3C 2EM7A 2EMXA 5KL7A 2EL4A 1B69A 2EPRA 2LO3A 2LT7A 2EM8A 4F6MA 2WCC3 2EN4A 1BB8A 2EORA 1X6HA 1NCSA 2MKDA 1TF3A 3MHSC 2EPZA 3EPJA 1YUJA 1ZR9A 4M9VC 4R2EA 2EOQA 1X5WA 4IS1C 2ENHA 1TF6A 2BB8A 2EMLA 2EMHA 2LCEA 2DLQA 3VHTB 4R2DA 2J7JA 2YU5A 2EN1A 1G2DC 1A1KA 2YTIA 4R2PA 3MHHC 1DGCA 2EQ0A 2YSPA 1A1FA 2EM4A 2ADRA 1JK1A 2YTEA 2DLKA 2ELYA 2EOOA 1RMDA 2DMIA 2MDGA 1A1JA 2EMIA 1WJPA 2EM0A 2EOMA 2WBSA 2RPCA 1KJKA 5KL6A 2EP3A 4R2CA 1Z1BA 5KL2A 2CT1A 2EOZA 4F2JC 2WBUA 2EOXA 2LV2A 5KL4A 4FK5C 2E72A 2YTQA 2CSHA 2CTDA 2EOSA 2EN7A 5KL5A 2GLIA 2EE8A 2EQ3A 2YTFA 4R2QA 3EPKA 2EOIA 2EN8A 2DRPA 2EM5A 2EN3A 2EMYA 1X6EA 2EMBA 1YSAC 2EN6A 2EM2A 2WBTA 2A25A 4R2RA 1A1GA 1A1IA 2EN2A 2EPUA 2HGHA 2EPCA 1YUIA 1F2IG 2EOYA 2LVHA 2YTGA 2ELZA 1G2FC 1BBOA 1UN6B 2D9HA 2YTOA 1ZU1A 2MKNA 2VRDA 2JPAA 3EPHA 1X3CA 5KL3A 4R2AA
chains in the Genus database with same CATH superfamily
2B7VA 2EPXA 2YU8A 4BHCA 2EMZA 4L8NA 2LJHA 2EWLA 1YPNA 3J7Yp 5BR8E 3DJWA 1JK2A 1EKZA 5IWAE 4YY3E 5AE1A 2YTJA 5A6JA 2L8TA 2YRMA 2EMCA 4F9BB 4ZYGA 4WSGA 1BBGA 1UILA 2EMGA 4IJDA 4X65E 1A1HA 1L4SA 2ENAA 1SR9A 3VYXA 4DV0E 4MLQA 1A1LA 5A6BD 4F6NA 4JI5E 4R2SA 2DIXA 2L2NA 4I8OA 1B69A 1WHNA 2EN4A 1BB8A 1HNXE 2MKDA 1TF3A 2R76A 1YUJA 5CFFE 4M9VC 2F8BA 3C4BA 4JI3E 3JU0A 2EOQA 2YT4A 1T39A 2LUPB 5F3WA 1A1KA 2YTIA 4R2PA 2EQ0A 2YSPA 1N34E 4MLVA 4LF5E 3C6KA 1N3GA 2LTRA 3K6QA 2H36X 2DMIA 5AE2A 2EMIA 2JR1A 4LFAE 4P7DA 1KJKA 2V88A 2EP3A 5AC4A 4LF9E 3HXLA 4OX9E 3T1YE 2CT1A 5A6AA 4F2JC 1IBLE 2IHR1 2E5LE 4J8ZA 2E72A 2JOBA 5DNYA 2YTQA 4JI7E 5T6JA 4DR5E 3L00A 2CTDA 2EN7A 4O43A 2E1MA 2YTFA 1YYWA 2JYAA 1YYKA 4M0VA 2DRPA 4DV6E 4JI8E 1J5EE 2EM5A 4DV5E 2NUEA 2WBTA 1RQ0A 2EPCA 2L6MA 2LVHA 2ELZA 2D9HA 2YTOA 5AC5A 2EPNA 2JPAA 3EPHA 2B3TB 1X3CA 4WXCA 2L92A 2LE2A 5IT9C 1XNRE 2EQ1A 1N33E 1GQEA 2FGGA 2MC5A 4GZNC 1MGTA 2I13A 3ECRA 3LLHA 2EMFA 1EH8A 2ODRC 2EOFA 2RSIA 2YTNA 2R1FA 2HC5A 1NEIA 4P78A 4DV4E 4JV5E 2EOEA 2FTXB 5A2QC 2UUBE 2RS6A 2EM3A 2M4IA 2NA2A 3UK3C 2UUAE 4JI2E 5KL7A 4DUYE 1GZ6A 2EL4A 2KONA 4BC9A 1T4LB 2WCC3 2VQEE 4Q28A 1NCSA 3MHSC 2LUQA 3ADGA 1ZR9A 4Q35B 1WHQA 1STUA 2V85A 2VE7C 3H09A 2EPKX 1X5WA 2JXPA 4JI6E 2EZ6A 5TSEA 2UU9E 2EMLA 2GPIA 2EMHA 2Q8UA 4AQYE 4B3SE 1QU6A 2LRSA 2YZTA 4DMIA 4X66E 2DMYA 1O0WA 4B3RE 2EN1A 3VYYA 2DB2A 1IQSA 1A1FA 2ADRA 4YHHE 2YTEA 4KWYA 2ELYA 2EOOA 1RMDA 2MDGA 2L3JA 3IWCA 2CPNA 2EM0A 2JWOA 2WBSA 3ADJA 4LU9A 5AE3A 2L2KB 4M30A 3BIDA 3AUZA 4DV7E 2WBUA 4O5GA 4FK5C 4BS9A 2CSHA 2N8XA 4GEQB 4R2QA 1DI2A 3EPKA 3OTOE 3BGHA 3ADLA 3ZOQB 1N36E 1YSAC 2K7IA 1EH7A 2EM2A 2A25A 2G7HA 4R2RA 2EPUA 4R8OA 4O24A 1FKAE 1DQ3A 1BBOA 1QNTA 1UN6B 3T1HE 5LLQA 3P1XA 2MKNA 2V87A 4L5NC 3KZZA 1UBDC 1PDAA 2RSMA 2M7QA 2NABA 2HHHE 3THNA 1LLMC 2EMAA 1ZAAC 1TN9A 3OMLA 1P47A 4LTYA 5IXMB 1XMQE 1MEYC 2B7TA 2YRHA 2JY9A 2UXDE 4OOGC 4LF8E 2DGCA 2YTPA 1WRJA 2EL5A 2EMWA 2LTSA 3AV0A 1UHZA 2EMKA 2EOHA 2EPMX 4KHPE 3FIGA 2GHFA 2KHXA 2YTDA 3JAMC 2EOJA 2YRKA 2EM7A 1X47A 4NXNE 1GTKA 5ADZA 3RMPA 5A6KA 1HNZE 2EM8A 4F6MA 4BMJA 4NZVA 3EQ1A 2KOUA 4RHBB 1T4NA 2RTXA 3BBGA 3J7AG 2B9DA 5A6BA 4B3TE 2RS7A 5FLXC 4LF4E 1TF6A 2EPOA 2LCEA 2VF1A 2DLQA 3VHTB 4JYAE 4F9AB 1PKPA 2J7JA 2YU5A 1G2DC 4X62E 1DGCA 4DR2E 3VK6A 1HR0E 2NUFA 3ADIA 3C4TA 1PJTA 4F9CB 3MSWA 1A1JA 4F54A 1WJPA 2MC6A 4LF6E 2EOMA 3F6GA 2RPCA 4WPYA 4DKKA 5LMUE 5KL6A 4LFCE 4DR1E 1AH5A 1Z1BA 1YFHA 2L33A 5AASA 3C6MA 4BHBA 1X49A 2RQLA 2EOXA 1IQOA 3BF2A 2ODRD 2NUGA 2V8QB 2GLIA 2UXBE 4NXME 1ZBTA 2JOXA 4DV1E 2JVAA 1PJQA 2WZOA 2UUCE 1A1IA 2V86A 2YWQA 1X48A 2YTGA 4WSPA 4ZYEA 2DSYA 2L3CA 4DR7E 2VRDA 4GKJE 1PJSA 1WXRA 5KL3A 1F2IG 2YSOA 4X8WA 1FJGE 2EPPA 4LFBE 2M9AA 4WX9A 4KZSA 4BBYA 2EJ4A 4WYQB 2BBGA 2EM9A 2EM6A 2ENCA 2K4VA 3EPLA 2EL6A 2YPNA 3DF6A 4X9JA 1AAYA 3M99B 1X6FA 3KZYA 4BCAA 3J81C 2JP9A 2LMZA 2PRTA 1EH6A 4DR4E 4X64E 4TUIA 1HNWE 3IWBA 2EPAA 1IBME 2F4VE 4LF7E 4K0KE 1IMUA 1N32E 3HQ1A 4DV3E 2EMXA 1SFEA 1KYQA 1YZ9A 2EPRA 2LO3A 4BC7A 2LT7A 2EORA 1X6HA 1RC7A 1J26A 2EPZA 3EPJA 4RH8A 3QG5C 4R2EA 4O4KA 2VQFE 1I94E 4IS1C 2ENHA 2M1SA 2FV4B 2BB8A 1YYOA 3IWDA 4WXDA 4DR6E 4M2ZA 2L2MA 4R2DA 2ZM6E 4JI1E 4N4RB 3MHHC 5A69A 2EM4A 2HJJA 4HTGA 1JK1A 2DLKA 4GKKE 4ZYDA 5LL6R 4ZYHA 2LBSB 2V89A 3HPZA 2V83A 2LJUA 4R2CA 5KL2A 1ZBQA 2EOZA 4JI4E 4B3ME 2LV2A 4DV2E 5KL4A 4WFTA 3KWRA 5KL5A 2EOSA 4TUGA 1XMOE 4JI0E 1T38A 2UXCE 2EE8A 2EQ3A 2EOIA 3JTZA 2EN8A 3THOB 4DR3E 3TQMA 3LMLA 4DUZE 2N3GA 2EMYA 1X6EA 2EN3A 2EMBA 3HPSA 3J80C 2EN6A 4HEIA 1T4OA 1IBKE 4R03A 1A1GA 2EN2A 2HGHA 3HTXA 1YUIA 2EOYA 3F6HA 2N3HA 1G2FC 2MDRA 5LMNE 1ZU1A 2EPLX 1XNQE 2I9IA 4NHRA 5IV8B 4R2AA
chains in the Genus database with same CATH topology
1UBDC 2YSOA 2EPXA 2NABA 2YU8A 2EMZA 2EQ1A 2EPPA 2M9AA 1LLMC 1JK2A 2EMAA 2EJ4A 4GZNC 2I13A 2YTJA 1ZAAC 1TN9A 2YRMA 2EM9A 2EMCA 2EM6A 1P47A 2EMFA 2ENCA 2EOFA 3EPLA 2RSIA 2YTNA 2R1FA 2YRHA 2EMGA 4IJDA 4WSGA 2EL6A 1MEYC 1A1HA 4X9JA 1AAYA 3M99B 1X6FA 2ENAA 2DGCA 2JP9A 2YTPA 2PRTA 2EL5A 2EMWA 2EMKA 2EOHA 2EOEA 2EPAA 1A1LA 4F6NA 2GHFA 2YTDA 4R2SA 2EM3A 2EOJA 2YRKA 3UK3C 2EM7A 2EMXA 5KL7A 2EL4A 1B69A 2EPRA 2LO3A 2LT7A 2EM8A 4F6MA 2WCC3 2EN4A 1BB8A 2EORA 1X6HA 1NCSA 2MKDA 1TF3A 3MHSC 2EPZA 3EPJA 1YUJA 1ZR9A 4M9VC 4R2EA 2EOQA 1X5WA 4IS1C 2ENHA 1TF6A 2BB8A 2EMLA 2EMHA 2LCEA 2DLQA 3VHTB 4R2DA 2J7JA 2YU5A 2EN1A 1G2DC 1A1KA 2YTIA 4R2PA 3MHHC 1DGCA 2EQ0A 2YSPA 1A1FA 2EM4A 2ADRA 1JK1A 2YTEA 2DLKA 2ELYA 2EOOA 1RMDA 2DMIA 2MDGA 1A1JA 2EMIA 1WJPA 2EM0A 2EOMA 2WBSA 2RPCA 1KJKA 5KL6A 2EP3A 4R2CA 1Z1BA 5KL2A 2CT1A 2EOZA 4F2JC 2WBUA 2EOXA 2LV2A 5KL4A 4FK5C 2E72A 2YTQA 2CSHA 2CTDA 2EOSA 2EN7A 5KL5A 2GLIA 2EE8A 2EQ3A 2YTFA 4R2QA 3EPKA 2EOIA 2EN8A 2DRPA 2EM5A 2EN3A 2EMYA 1X6EA 2EMBA 1YSAC 2EN6A 2EM2A 2WBTA 2A25A 4R2RA 1A1GA 1A1IA 2EN2A 2EPUA 2HGHA 2EPCA 1YUIA 1F2IG 2EOYA 2LVHA 2YTGA 2ELZA 1G2FC 1BBOA 1UN6B 2D9HA 2YTOA 1ZU1A 2MKNA 2VRDA 2JPAA 3EPHA 1X3CA 5KL3A 4R2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UBD C;  2YSO A;  2EPX A;  2NAB A;  2YU8 A;  2EMZ A;  2EQ1 A;  2EPP A;  2M9A A;  1LLM C;  1JK2 A;  2EMA A;  2EJ4 A;  4GZN C;  2I13 A;  2YTJ A;  1ZAA C;  1TN9 A;  2YRM A;  2EM9 A;  2EMC A;  2EM6 A;  1P47 A;  2EMF A;  2ENC A;  2EOF A;  3EPL A;  2RSI A;  2YTN A;  2R1F A;  2YRH A;  2EMG A;  4IJD A;  4WSG A;  2EL6 A;  1MEY C;  1A1H A;  4X9J A;  1AAY A;  3M99 B;  1X6F A;  2ENA A;  2DGC A;  2JP9 A;  2YTP A;  2PRT A;  2EL5 A;  2EMW A;  2EMK A;  2EOH A;  2EOE A;  2EPA A;  1A1L A;  4F6N A;  2GHF A;  2YTD A;  4R2S A;  2EM3 A;  2EOJ A;  2YRK A;  3UK3 C;  2EM7 A;  2EMX A;  5KL7 A;  2EL4 A;  1B69 A;  2EPR A;  2LO3 A;  2LT7 A;  2EM8 A;  4F6M A;  2WCC 3;  2EN4 A;  1BB8 A;  2EOR A;  1X6H A;  1NCS A;  2MKD A;  1TF3 A;  3MHS C;  2EPZ A;  3EPJ A;  1YUJ A;  1ZR9 A;  4M9V C;  4R2E A;  2EOQ A;  1X5W A;  4IS1 C;  2ENH A;  1TF6 A;  2BB8 A;  2EML A;  2EMH A;  2LCE A;  2DLQ A;  3VHT B;  4R2D A;  2J7J A;  2YU5 A;  2EN1 A;  1G2D C;  1A1K A;  2YTI A;  4R2P A;  3MHH C;  1DGC A;  2EQ0 A;  2YSP A;  1A1F A;  2EM4 A;  2ADR A;  1JK1 A;  2YTE A;  2DLK A;  2ELY A;  2EOO A;  1RMD A;  2DMI A;  2MDG A;  1A1J A;  2EMI A;  1WJP A;  2EM0 A;  2EOM A;  2WBS A;  2RPC A;  1KJK A;  5KL6 A;  2EP3 A;  4R2C A;  1Z1B A;  5KL2 A;  2CT1 A;  2EOZ A;  4F2J C;  2WBU A;  2EOX A;  2LV2 A;  5KL4 A;  4FK5 C;  2E72 A;  2YTQ A;  2CSH A;  2CTD A;  2EOS A;  2EN7 A;  5KL5 A;  2GLI A;  2EE8 A;  2EQ3 A;  2YTF A;  4R2Q A;  3EPK A;  2EOI A;  2EN8 A;  2DRP A;  2EM5 A;  2EN3 A;  2EMY A;  1X6E A;  2EMB A;  1YSA C;  2EN6 A;  2EM2 A;  2WBT A;  2A25 A;  4R2R A;  1A1G A;  1A1I A;  2EN2 A;  2EPU A;  2HGH A;  2EPC A;  1YUI A;  1F2I G;  2EOY A;  2LVH A;  2YTG A;  2ELZ A;  1G2F C;  1BBO A;  1UN6 B;  2D9H A;  2YTO A;  1ZU1 A;  2MKN A;  2VRD A;  2JPA A;  3EPH A;  1X3C A;  5KL3 A;  4R2A A; 
#chains in the Genus database with same CATH topology
 2B7V A;  2EPX A;  2YU8 A;  4BHC A;  2EMZ A;  4L8N A;  2LJH A;  2EWL A;  1YPN A;  3J7Y p;  5BR8 E;  3DJW A;  1JK2 A;  1EKZ A;  5IWA E;  4YY3 E;  5AE1 A;  2YTJ A;  5A6J A;  2L8T A;  2YRM A;  2EMC A;  4F9B B;  4ZYG A;  4WSG A;  1BBG A;  1UIL A;  2EMG A;  4IJD A;  4X65 E;  1A1H A;  1L4S A;  2ENA A;  1SR9 A;  3VYX A;  4DV0 E;  4MLQ A;  1A1L A;  5A6B D;  4F6N A;  4JI5 E;  4R2S A;  2DIX A;  2L2N A;  4I8O A;  1B69 A;  1WHN A;  2EN4 A;  1BB8 A;  1HNX E;  2MKD A;  1TF3 A;  2R76 A;  1YUJ A;  5CFF E;  4M9V C;  2F8B A;  3C4B A;  4JI3 E;  3JU0 A;  2EOQ A;  2YT4 A;  1T39 A;  2LUP B;  5F3W A;  1A1K A;  2YTI A;  4R2P A;  2EQ0 A;  2YSP A;  1N34 E;  4MLV A;  4LF5 E;  3C6K A;  1N3G A;  2LTR A;  3K6Q A;  2H36 X;  2DMI A;  5AE2 A;  2EMI A;  2JR1 A;  4LFA E;  4P7D A;  1KJK A;  2V88 A;  2EP3 A;  5AC4 A;  4LF9 E;  3HXL A;  4OX9 E;  3T1Y E;  2CT1 A;  5A6A A;  4F2J C;  1IBL E;  2IHR 1;  2E5L E;  4J8Z A;  2E72 A;  2JOB A;  5DNY A;  2YTQ A;  4JI7 E;  5T6J A;  4DR5 E;  3L00 A;  2CTD A;  2EN7 A;  4O43 A;  2E1M A;  2YTF A;  1YYW A;  2JYA A;  1YYK A;  4M0V A;  2DRP A;  4DV6 E;  4JI8 E;  1J5E E;  2EM5 A;  4DV5 E;  2NUE A;  2WBT A;  1RQ0 A;  2EPC A;  2L6M A;  2LVH A;  2ELZ A;  2D9H A;  2YTO A;  5AC5 A;  2EPN A;  2JPA A;  3EPH A;  2B3T B;  1X3C A;  4WXC A;  2L92 A;  2LE2 A;  5IT9 C;  1XNR E;  2EQ1 A;  1N33 E;  1GQE A;  2FGG A;  2MC5 A;  4GZN C;  1MGT A;  2I13 A;  3ECR A;  3LLH A;  2EMF A;  1EH8 A;  2ODR C;  2EOF A;  2RSI A;  2YTN A;  2R1F A;  2HC5 A;  1NEI A;  4P78 A;  4DV4 E;  4JV5 E;  2EOE A;  2FTX B;  5A2Q C;  2UUB E;  2RS6 A;  2EM3 A;  2M4I A;  2NA2 A;  3UK3 C;  2UUA E;  4JI2 E;  5KL7 A;  4DUY E;  1GZ6 A;  2EL4 A;  2KON A;  4BC9 A;  1T4L B;  2WCC 3;  2VQE E;  4Q28 A;  1NCS A;  3MHS C;  2LUQ A;  3ADG A;  1ZR9 A;  4Q35 B;  1WHQ A;  1STU A;  2V85 A;  2VE7 C;  3H09 A;  2EPK X;  1X5W A;  2JXP A;  4JI6 E;  2EZ6 A;  5TSE A;  2UU9 E;  2EML A;  2GPI A;  2EMH A;  2Q8U A;  4AQY E;  4B3S E;  1QU6 A;  2LRS A;  2YZT A;  4DMI A;  4X66 E;  2DMY A;  1O0W A;  4B3R E;  2EN1 A;  3VYY A;  2DB2 A;  1IQS A;  1A1F A;  2ADR A;  4YHH E;  2YTE A;  4KWY A;  2ELY A;  2EOO A;  1RMD A;  2MDG A;  2L3J A;  3IWC A;  2CPN A;  2EM0 A;  2JWO A;  2WBS A;  3ADJ A;  4LU9 A;  5AE3 A;  2L2K B;  4M30 A;  3BID A;  3AUZ A;  4DV7 E;  2WBU A;  4O5G A;  4FK5 C;  4BS9 A;  2CSH A;  2N8X A;  4GEQ B;  4R2Q A;  1DI2 A;  3EPK A;  3OTO E;  3BGH A;  3ADL A;  3ZOQ B;  1N36 E;  1YSA C;  2K7I A;  1EH7 A;  2EM2 A;  2A25 A;  2G7H A;  4R2R A;  2EPU A;  4R8O A;  4O24 A;  1FKA E;  1DQ3 A;  1BBO A;  1QNT A;  1UN6 B;  3T1H E;  5LLQ A;  3P1X A;  2MKN A;  2V87 A;  4L5N C;  3KZZ A;  1UBD C;  1PDA A;  2RSM A;  2M7Q A;  2NAB A;  2HHH E;  3THN A;  1LLM C;  2EMA A;  1ZAA C;  1TN9 A;  3OML A;  1P47 A;  4LTY A;  5IXM B;  1XMQ E;  1MEY C;  2B7T A;  2YRH A;  2JY9 A;  2UXD E;  4OOG C;  4LF8 E;  2DGC A;  2YTP A;  1WRJ A;  2EL5 A;  2EMW A;  2LTS A;  3AV0 A;  1UHZ A;  2EMK A;  2EOH A;  2EPM X;  4KHP E;  3FIG A;  2GHF A;  2KHX A;  2YTD A;  3JAM C;  2EOJ A;  2YRK A;  2EM7 A;  1X47 A;  4NXN E;  1GTK A;  5ADZ A;  3RMP A;  5A6K A;  1HNZ E;  2EM8 A;  4F6M A;  4BMJ A;  4NZV A;  3EQ1 A;  2KOU A;  4RHB B;  1T4N A;  2RTX A;  3BBG A;  3J7A G;  2B9D A;  5A6B A;  4B3T E;  2RS7 A;  5FLX C;  4LF4 E;  1TF6 A;  2EPO A;  2LCE A;  2VF1 A;  2DLQ A;  3VHT B;  4JYA E;  4F9A B;  1PKP A;  2J7J A;  2YU5 A;  1G2D C;  4X62 E;  1DGC A;  4DR2 E;  3VK6 A;  1HR0 E;  2NUF A;  3ADI A;  3C4T A;  1PJT A;  4F9C B;  3MSW A;  1A1J A;  4F54 A;  1WJP A;  2MC6 A;  4LF6 E;  2EOM A;  3F6G A;  2RPC A;  4WPY A;  4DKK A;  5LMU E;  5KL6 A;  4LFC E;  4DR1 E;  1AH5 A;  1Z1B A;  1YFH A;  2L33 A;  5AAS A;  3C6M A;  4BHB A;  1X49 A;  2RQL A;  2EOX A;  1IQO A;  3BF2 A;  2ODR D;  2NUG A;  2V8Q B;  2GLI A;  2UXB E;  4NXM E;  1ZBT A;  2JOX A;  4DV1 E;  2JVA A;  1PJQ A;  2WZO A;  2UUC E;  1A1I A;  2V86 A;  2YWQ A;  1X48 A;  2YTG A;  4WSP A;  4ZYE A;  2DSY A;  2L3C A;  4DR7 E;  2VRD A;  4GKJ E;  1PJS A;  1WXR A;  5KL3 A;  1F2I G;  2YSO A;  4X8W A;  1FJG E;  2EPP A;  4LFB E;  2M9A A;  4WX9 A;  4KZS A;  4BBY A;  2EJ4 A;  4WYQ B;  2BBG A;  2EM9 A;  2EM6 A;  2ENC A;  2K4V A;  3EPL A;  2EL6 A;  2YPN A;  3DF6 A;  4X9J A;  1AAY A;  3M99 B;  1X6F A;  3KZY A;  4BCA A;  3J81 C;  2JP9 A;  2LMZ A;  2PRT A;  1EH6 A;  4DR4 E;  4X64 E;  4TUI A;  1HNW E;  3IWB A;  2EPA A;  1IBM E;  2F4V E;  4LF7 E;  4K0K E;  1IMU A;  1N32 E;  3HQ1 A;  4DV3 E;  2EMX A;  1SFE A;  1KYQ A;  1YZ9 A;  2EPR A;  2LO3 A;  4BC7 A;  2LT7 A;  2EOR A;  1X6H A;  1RC7 A;  1J26 A;  2EPZ A;  3EPJ A;  4RH8 A;  3QG5 C;  4R2E A;  4O4K A;  2VQF E;  1I94 E;  4IS1 C;  2ENH A;  2M1S A;  2FV4 B;  2BB8 A;  1YYO A;  3IWD A;  4WXD A;  4DR6 E;  4M2Z A;  2L2M A;  4R2D A;  2ZM6 E;  4JI1 E;  4N4R B;  3MHH C;  5A69 A;  2EM4 A;  2HJJ A;  4HTG A;  1JK1 A;  2DLK A;  4GKK E;  4ZYD A;  5LL6 R;  4ZYH A;  2LBS B;  2V89 A;  3HPZ A;  2V83 A;  2LJU A;  4R2C A;  5KL2 A;  1ZBQ A;  2EOZ A;  4JI4 E;  4B3M E;  2LV2 A;  4DV2 E;  5KL4 A;  4WFT A;  3KWR A;  5KL5 A;  2EOS A;  4TUG A;  1XMO E;  4JI0 E;  1T38 A;  2UXC E;  2EE8 A;  2EQ3 A;  2EOI A;  3JTZ A;  2EN8 A;  3THO B;  4DR3 E;  3TQM A;  3LML A;  4DUZ E;  2N3G A;  2EMY A;  1X6E A;  2EN3 A;  2EMB A;  3HPS A;  3J80 C;  2EN6 A;  4HEI A;  1T4O A;  1IBK E;  4R03 A;  1A1G A;  2EN2 A;  2HGH A;  3HTX A;  1YUI A;  2EOY A;  3F6H A;  2N3H A;  1G2F C;  2MDR A;  5LMN E;  1ZU1 A;  2EPL X;  1XNQ E;  2I9I A;  4NHR A;  5IV8 B;  4R2A A; 
#chains in the Genus database with same CATH homology
 1UBD C;  2YSO A;  2EPX A;  2NAB A;  2YU8 A;  2EMZ A;  2EQ1 A;  2EPP A;  2M9A A;  1LLM C;  1JK2 A;  2EMA A;  2EJ4 A;  4GZN C;  2I13 A;  2YTJ A;  1ZAA C;  1TN9 A;  2YRM A;  2EM9 A;  2EMC A;  2EM6 A;  1P47 A;  2EMF A;  2ENC A;  2EOF A;  3EPL A;  2RSI A;  2YTN A;  2R1F A;  2YRH A;  2EMG A;  4IJD A;  4WSG A;  2EL6 A;  1MEY C;  1A1H A;  4X9J A;  1AAY A;  3M99 B;  1X6F A;  2ENA A;  2DGC A;  2JP9 A;  2YTP A;  2PRT A;  2EL5 A;  2EMW A;  2EMK A;  2EOH A;  2EOE A;  2EPA A;  1A1L A;  4F6N A;  2GHF A;  2YTD A;  4R2S A;  2EM3 A;  2EOJ A;  2YRK A;  3UK3 C;  2EM7 A;  2EMX A;  5KL7 A;  2EL4 A;  1B69 A;  2EPR A;  2LO3 A;  2LT7 A;  2EM8 A;  4F6M A;  2WCC 3;  2EN4 A;  1BB8 A;  2EOR A;  1X6H A;  1NCS A;  2MKD A;  1TF3 A;  3MHS C;  2EPZ A;  3EPJ A;  1YUJ A;  1ZR9 A;  4M9V C;  4R2E A;  2EOQ A;  1X5W A;  4IS1 C;  2ENH A;  1TF6 A;  2BB8 A;  2EML A;  2EMH A;  2LCE A;  2DLQ A;  3VHT B;  4R2D A;  2J7J A;  2YU5 A;  2EN1 A;  1G2D C;  1A1K A;  2YTI A;  4R2P A;  3MHH C;  1DGC A;  2EQ0 A;  2YSP A;  1A1F A;  2EM4 A;  2ADR A;  1JK1 A;  2YTE A;  2DLK A;  2ELY A;  2EOO A;  1RMD A;  2DMI A;  2MDG A;  1A1J A;  2EMI A;  1WJP A;  2EM0 A;  2EOM A;  2WBS A;  2RPC A;  1KJK A;  5KL6 A;  2EP3 A;  4R2C A;  1Z1B A;  5KL2 A;  2CT1 A;  2EOZ A;  4F2J C;  2WBU A;  2EOX A;  2LV2 A;  5KL4 A;  4FK5 C;  2E72 A;  2YTQ A;  2CSH A;  2CTD A;  2EOS A;  2EN7 A;  5KL5 A;  2GLI A;  2EE8 A;  2EQ3 A;  2YTF A;  4R2Q A;  3EPK A;  2EOI A;  2EN8 A;  2DRP A;  2EM5 A;  2EN3 A;  2EMY A;  1X6E A;  2EMB A;  1YSA C;  2EN6 A;  2EM2 A;  2WBT A;  2A25 A;  4R2R A;  1A1G A;  1A1I A;  2EN2 A;  2EPU A;  2HGH A;  2EPC A;  1YUI A;  1F2I G;  2EOY A;  2LVH A;  2YTG A;  2ELZ A;  1G2F C;  1BBO A;  1UN6 B;  2D9H A;  2YTO A;  1ZU1 A;  2MKN A;  2VRD A;  2JPA A;  3EPH A;  1X3C A;  5KL3 A;  4R2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...