2EM4A

Solution structure of the c2h2 type zinc finger (region 724-756) of human zinc finger protein 28 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGQRPYECIECGKAFKTKSSLICHRRSHTGEKPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 28 homolog
publication title Solution structure of the C2H2 type zinc finger (region 724-756) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13912 zf-C2H2_6 C2H2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em4A01
2EMIA 4WSGA 3EPKA 2DLQA 2EOIA 2EMYA 3EPJA 1G2DC 2EPRA 2EL5A 2EMWA 1X3CA 1A1FA 2EMAA 2EMGA 3M99B 4M9VC 2CTDA 4R2RA 4R2QA 2EOMA 1DGCA 1KJKA 2EP3A 2DLKA 3EPHA 1X6FA 1NCSA 2RPCA 4R2SA 2YU8A 2NABA 2M9AA 2WCC3 1A1GA 4R2PA 2EM3A 2EOYA 2EM4A 5KL5A 2ELZA 3UK3C 1G2FC 2WBSA 1A1IA 2EPUA 1Z1BA 2EMKA 2EPCA 2RSIA 2YTJA 2EMZA 2EPXA 2YTFA 4X9JA 1YUIA 2EQ1A 4F6NA 2EQ0A 2DMIA 4F6MA 5KL4A 4GZNC 1UN6B 1AAYA 2EOSA 1YSAC 2YSPA 2VRDA 2EN3A 3MHSC 1BB8A 2EM9A 2J7JA 2MDGA 2EM5A 1YUJA 2EM6A 2EOXA 2MKDA 2EOOA 2ENAA 1ZR9A 2E72A 2LVHA 2EMFA 1B69A 2EM8A 2HGHA 5KL6A 2YTNA 2EN8A 5KL3A 2YRMA 4R2CA 2CT1A 2LCEA 2MKNA 1TF3A 2YTPA 4IJDA 2R1FA 1ZU1A 2EMBA 2EQ3A 4R2DA 2LT7A 4F2JC 2ENHA 2DGCA 1X5WA 2YRKA 2A25A 2EMHA 2EOFA 1A1HA 2YTGA 1A1KA 2YTIA 1MEYC 3MHHC 1P47A 2EM0A 2YSOA 1LLMC 2JP9A 2D9HA 2WBTA 4R2EA 4IS1C 2LO3A 2EOJA 2EE8A 2EOHA 2EN4A 2YTOA 2EOEA 3EPLA 1JK2A 2EL6A 2EMXA 2YRHA 5KL7A 2EJ4A 2DRPA 2YTDA 1UBDC 2GHFA 2ENCA 1RMDA 2JPAA 2BB8A 2CSHA 2EPZA 2ELYA 3VHTB 1BBOA 1X6EA 1JK1A 2YTEA 2EOQA 2YTQA 2ADRA 2YU5A 1A1JA 1ZAAC 2I13A 2EMCA 2GLIA 2LV2A 2EM2A 2EOZA 2EL4A 2WBUA 1WJPA 2EN1A 2EN7A 4FK5C 2EORA 2PRTA 1TF6A 2EMLA 1TN9A 5KL2A 1A1LA 1X6HA 2EPAA 4R2AA 2EPPA 2EN2A 1F2IG 2EN6A 2EM7A
chains in the Genus database with same CATH superfamily
2N3GA 1GTKA 2DLQA 2N3HA 1X47A 1G2DC 2EMWA 1X3CA 3H09A 4B3TE 2EMAA 4N4RB 2VE7C 2L2KB 2M1SA 2EPNA 4DR1E 4NXNE 4J8ZA 4DMIA 2WCC3 2EOYA 1QU6A 2LJHA 3UK3C 4BS9A 2NUFA 4WPYA 5AE3A 2YTJA 3C4BA 2EPXA 2RQLA 3JAMC 4X9JA 4DR3E 4F6NA 2VQFE 2F4VE 1N32E 4JV5E 2VRDA 4DV6E 1BB8A 4LFCE 4JI6E 2M4IA 2DSYA 2EOXA 5AC5A 2ENAA 4MLQA 2EPMX 4JI1E 2DB2A 2LVHA 5A69A 2L33A 1WHNA 1B69A 4LF7E 2HGHA 2UUAE 2FV4B 4DR6E 4LTYA 2JVAA 2YTPA 2R1FA 3C6KA 2ENHA 2LTRA 4ZYGA 2G7HA 1HR0E 4DR4E 2YTIA 1MEYC 2YSOA 4DR7E 2KONA 2WBTA 3BIDA 4B3SE 4JI8E 2YTOA 1BBGA 4F9BB 1HNZE 2LUPB 4GKKE 3OMLA 4LF4E 4LF8E 2EL6A 3HQ1A 4OOGC 1N34E 2DRPA 2YTDA 4JI4E 2V88A 1ZBTA 4O5GA 4M30A 3VHTB 5FLXC 5LMUE 3EQ1A 3KWRA 2UXBE 5DNYA 3ADLA 2WBUA 2EN1A 1SR9A 4YY3E 2EPOA 2PRTA 3C4TA 3HXLA 4DKKA 4WSPA 3ECRA 5KL2A 1MGTA 2B7VA 2UUCE 4R8OA 1XNQE 2JOXA 4YHHE 3EPKA 5A6BA 1L4SA 2EL5A 2V86A 3ADGA 3M99B 2EMGA 2CTDA 4R2RA 1XNRE 1DGCA 2EP3A 3P1XA 1YZ9A 2I9IA 1X6FA 1NCSA 2RPCA 4R2SA 2KHXA 5AC4A 2M9AA 4R2PA 2EM3A 2EM4A 4P78A 2WBSA 1A1IA 1Z1BA 2B3TB 2EMKA 2EPCA 1QNTA 2EMZA 3AUZA 2YT4A 3THNA 2YTFA 4BHBA 2JY9A 3FIGA 3L00A 2DMIA 3LMLA 5KL4A 1AAYA 2EOSA 1YSAC 2BBGA 2YSPA 3MSWA 2UU9E 4HEIA 2EM5A 2EPKX 2LRSA 2E1MA 3C6MA 3K6QA 2MKDA 4DV0E 2LBSB 1WHQA 3T1YE 4X65E 1HNWE 2KOUA 4B3ME 4F9AB 3ZOQB 5KL3A 2YRMA 4R2CA 2EPLX 4OX9E 2CT1A 4WXCA 5LMNE 1AH5A 1O0WA 2F8BA 2WZOA 1ZU1A 2EMBA 2EQ3A 1X5WA 2YRKA 2L3CA 2A25A 4BHCA 2EOFA 2UXDE 1A1HA 2YTGA 1A1KA 2DIXA 4K0KE 4DV1E 3THOB 1P47A 4WX9A 1LLMC 5F3WA 4R2EA 4IS1C 4DV4E 2N8XA 3LLHA 2LO3A 5ADZA 2EOJA 1PDAA 2EE8A 2EOHA 1UHZA 3QG5C 1T4LB 2LTSA 1YPNA 2M7QA 1XMOE 2YRHA 1YYKA 2YZTA 5AASA 2GHFA 1N3GA 4LFAE 3BGHA 2B7TA 2L6MA 1PJQA 3J7Yp 1NEIA 1X6EA 2EWLA 2YTEA 4P7DA 1A1JA 5LL6R 1ZAAC 2I13A 2EMCA 1PJSA 1X48A 2EM2A 2EOZA 1WJPA 2EZ6A 2Q8UA 4FK5C 4L5NC 3KZYA 4KZSA 2ODRC 4WXDA 2IHR1 1A1LA 1FJGE 2EPPA 2L8TA 2ODRD 3VK6A 5A6KA 2VQEE 4I8OA 4M0VA 2EOIA 2K7IA 2EPRA 3BF2A 4O43A 2V85A 4GEQB 2ZM6E 1IQOA 1A1FA 4M9VC 4R2QA 2EOMA 2L92A 2B9DA 1KJKA 3VYYA 2L2MA 4X8WA 3EPHA 5A6AA 1IBKE 2JR1A 4ZYHA 4NHRA 1RQ0A 2NABA 1A1GA 1PJTA 3DJWA 1WXRA 4NZVA 4DV7E 4BMJA 4DUYE 1G2FC 1EH7A 2RSIA 4DUZE 4LFBE 1J26A 4R03A 3RMPA 1YFHA 1YUIA 2EQ1A 4F6MA 1UN6B 5IT9C 2YWQA 2YPNA 1RC7A 4JI0E 1YYWA 3MHSC 4WFTA 2EM9A 2MDGA 2EM6A 1EH8A 3KZZA 2EOOA 1ZR9A 1I94E 2E72A 4O4KA 2EMFA 1ZBQA 2YTNA 2EN8A 1TF3A 1T4OA 4B3RE 4R2DA 3IWDA 4BCAA 4F2JC 2LT7A 1IMUA 2EMHA 3HTXA 2RS6A 5IXMB 4TUGA 3J7AG 2D9HA 4MLVA 1N33E 2GPIA 4JI5E 4X64E 3VYXA 4LU9A 4KHPE 4BBYA 1GZ6A 3EPLA 2HHHE 2RSMA 2LJUA 1KYQA 4DV2E 2L3JA 3JTZA 1UBDC 2ENCA 4WYQB 1RMDA 2JPAA 2BB8A 3IWCA 2ELYA 1BBOA 2CPNA 1STUA 2EOQA 5LLQA 3J81C 2EL4A 4Q28A 4DV3E 2EORA 1FKAE 1UILA 2V83A 4ZYEA 1IQSA 2LE2A 5A2QC 4R2AA 4LF5E 5TSEA 1F2IG 2EN2A 2JYAA 2MC6A 2EN6A 2EM7A 3EPJA 2EMIA 4WSGA 2EMYA 2NUGA 4F9CB 2JOBA 4AQYE 2UXCE 2RS7A 1EKZA 2DLKA 1IBLE 5CFFE 4X62E 1IBME 2MC5A 4JI3E 2YU8A 2R76A 2LMZA 3HPZA 5KL5A 2ELZA 2EPUA 4HTGA 5BR8E 4JYAE 1PKPA 2DMYA 2EQ0A 1DQ3A 4GZNC 1N36E 2E5LE 4LF9E 3JU0A 4DR2E 2EN3A 2J7JA 4Q35B 4LF6E 4KWYA 1YUJA 2V87A 2VF1A 4BC9A 4F54A 4JI2E 2JXPA 2EM8A 3AV0A 5KL6A 4TUIA 4O24A 2LCEA 2MKNA 4IJDA 3F6HA 1XMQE 2DGCA 2K4VA 2V89A 4NXME 1T38A 1HNXE 3J80C 1J5EE 2L2NA 2LUQA 3MHHC 2NUEA 5A6BD 3TQMA 2EM0A 1YYOA 3DF6A 4L8NA 2JP9A 4BC7A 1GQEA 5IV8B 2FTXB 2HC5A 2EN4A 5T6JA 2EOEA 2NA2A 4JI7E 5AE1A 1JK2A 1T4NA 2EMXA 2RTXA 5KL7A 2EJ4A 4RHBB 3BBGA 4ZYDA 4DV5E 4X66E 1WRJA 1EH6A 2CSHA 2EPZA 3F6GA 5AE2A 4DR5E 5A6JA 2FGGA 2HJJA 3ADIA 1JK1A 2YTQA 2ADRA 4M2ZA 1X49A 2YU5A 2UUBE 2JWOA 2GLIA 3HPSA 1T39A 2LV2A 1SFEA 2H36X 2EN7A 3OTOE 2MDRA 3T1HE 1TF6A 2EMLA 4RH8A 1TN9A 1X6HA 2EPAA 3ADJA 4GKJE 5IWAE 3IWBA 1DI2A 2V8QB
chains in the Genus database with same CATH topology
2EMIA 4WSGA 3EPKA 2DLQA 2EOIA 2EMYA 3EPJA 1G2DC 2EPRA 2EL5A 2EMWA 1X3CA 1A1FA 2EMAA 2EMGA 3M99B 4M9VC 2CTDA 4R2RA 4R2QA 2EOMA 1DGCA 1KJKA 2EP3A 2DLKA 3EPHA 1X6FA 1NCSA 2RPCA 4R2SA 2YU8A 2NABA 2M9AA 2WCC3 1A1GA 4R2PA 2EM3A 2EOYA 2EM4A 5KL5A 2ELZA 3UK3C 1G2FC 2WBSA 1A1IA 2EPUA 1Z1BA 2EMKA 2EPCA 2RSIA 2YTJA 2EMZA 2EPXA 2YTFA 4X9JA 1YUIA 2EQ1A 4F6NA 2EQ0A 2DMIA 4F6MA 5KL4A 4GZNC 1UN6B 1AAYA 2EOSA 1YSAC 2YSPA 2VRDA 2EN3A 3MHSC 1BB8A 2EM9A 2J7JA 2MDGA 2EM5A 1YUJA 2EM6A 2EOXA 2MKDA 2EOOA 2ENAA 1ZR9A 2E72A 2LVHA 2EMFA 1B69A 2EM8A 2HGHA 5KL6A 2YTNA 2EN8A 5KL3A 2YRMA 4R2CA 2CT1A 2LCEA 2MKNA 1TF3A 2YTPA 4IJDA 2R1FA 1ZU1A 2EMBA 2EQ3A 4R2DA 2LT7A 4F2JC 2ENHA 2DGCA 1X5WA 2YRKA 2A25A 2EMHA 2EOFA 1A1HA 2YTGA 1A1KA 2YTIA 1MEYC 3MHHC 1P47A 2EM0A 2YSOA 1LLMC 2JP9A 2D9HA 2WBTA 4R2EA 4IS1C 2LO3A 2EOJA 2EE8A 2EOHA 2EN4A 2YTOA 2EOEA 3EPLA 1JK2A 2EL6A 2EMXA 2YRHA 5KL7A 2EJ4A 2DRPA 2YTDA 1UBDC 2GHFA 2ENCA 1RMDA 2JPAA 2BB8A 2CSHA 2EPZA 2ELYA 3VHTB 1BBOA 1X6EA 1JK1A 2YTEA 2EOQA 2YTQA 2ADRA 2YU5A 1A1JA 1ZAAC 2I13A 2EMCA 2GLIA 2LV2A 2EM2A 2EOZA 2EL4A 2WBUA 1WJPA 2EN1A 2EN7A 4FK5C 2EORA 2PRTA 1TF6A 2EMLA 1TN9A 5KL2A 1A1LA 1X6HA 2EPAA 4R2AA 2EPPA 2EN2A 1F2IG 2EN6A 2EM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMI A;  4WSG A;  3EPK A;  2DLQ A;  2EOI A;  2EMY A;  3EPJ A;  1G2D C;  2EPR A;  2EL5 A;  2EMW A;  1X3C A;  1A1F A;  2EMA A;  2EMG A;  3M99 B;  4M9V C;  2CTD A;  4R2R A;  4R2Q A;  2EOM A;  1DGC A;  1KJK A;  2EP3 A;  2DLK A;  3EPH A;  1X6F A;  1NCS A;  2RPC A;  4R2S A;  2YU8 A;  2NAB A;  2M9A A;  2WCC 3;  1A1G A;  4R2P A;  2EM3 A;  2EOY A;  2EM4 A;  5KL5 A;  2ELZ A;  3UK3 C;  1G2F C;  2WBS A;  1A1I A;  2EPU A;  1Z1B A;  2EMK A;  2EPC A;  2RSI A;  2YTJ A;  2EMZ A;  2EPX A;  2YTF A;  4X9J A;  1YUI A;  2EQ1 A;  4F6N A;  2EQ0 A;  2DMI A;  4F6M A;  5KL4 A;  4GZN C;  1UN6 B;  1AAY A;  2EOS A;  1YSA C;  2YSP A;  2VRD A;  2EN3 A;  3MHS C;  1BB8 A;  2EM9 A;  2J7J A;  2MDG A;  2EM5 A;  1YUJ A;  2EM6 A;  2EOX A;  2MKD A;  2EOO A;  2ENA A;  1ZR9 A;  2E72 A;  2LVH A;  2EMF A;  1B69 A;  2EM8 A;  2HGH A;  5KL6 A;  2YTN A;  2EN8 A;  5KL3 A;  2YRM A;  4R2C A;  2CT1 A;  2LCE A;  2MKN A;  1TF3 A;  2YTP A;  4IJD A;  2R1F A;  1ZU1 A;  2EMB A;  2EQ3 A;  4R2D A;  2LT7 A;  4F2J C;  2ENH A;  2DGC A;  1X5W A;  2YRK A;  2A25 A;  2EMH A;  2EOF A;  1A1H A;  2YTG A;  1A1K A;  2YTI A;  1MEY C;  3MHH C;  1P47 A;  2EM0 A;  2YSO A;  1LLM C;  2JP9 A;  2D9H A;  2WBT A;  4R2E A;  4IS1 C;  2LO3 A;  2EOJ A;  2EE8 A;  2EOH A;  2EN4 A;  2YTO A;  2EOE A;  3EPL A;  1JK2 A;  2EL6 A;  2EMX A;  2YRH A;  5KL7 A;  2EJ4 A;  2DRP A;  2YTD A;  1UBD C;  2GHF A;  2ENC A;  1RMD A;  2JPA A;  2BB8 A;  2CSH A;  2EPZ A;  2ELY A;  3VHT B;  1BBO A;  1X6E A;  1JK1 A;  2YTE A;  2EOQ A;  2YTQ A;  2ADR A;  2YU5 A;  1A1J A;  1ZAA C;  2I13 A;  2EMC A;  2GLI A;  2LV2 A;  2EM2 A;  2EOZ A;  2EL4 A;  2WBU A;  1WJP A;  2EN1 A;  2EN7 A;  4FK5 C;  2EOR A;  2PRT A;  1TF6 A;  2EML A;  1TN9 A;  5KL2 A;  1A1L A;  1X6H A;  2EPA A;  4R2A A;  2EPP A;  2EN2 A;  1F2I G;  2EN6 A;  2EM7 A; 
#chains in the Genus database with same CATH topology
 2N3G A;  1GTK A;  2DLQ A;  2N3H A;  1X47 A;  1G2D C;  2EMW A;  1X3C A;  3H09 A;  4B3T E;  2EMA A;  4N4R B;  2VE7 C;  2L2K B;  2M1S A;  2EPN A;  4DR1 E;  4NXN E;  4J8Z A;  4DMI A;  2WCC 3;  2EOY A;  1QU6 A;  2LJH A;  3UK3 C;  4BS9 A;  2NUF A;  4WPY A;  5AE3 A;  2YTJ A;  3C4B A;  2EPX A;  2RQL A;  3JAM C;  4X9J A;  4DR3 E;  4F6N A;  2VQF E;  2F4V E;  1N32 E;  4JV5 E;  2VRD A;  4DV6 E;  1BB8 A;  4LFC E;  4JI6 E;  2M4I A;  2DSY A;  2EOX A;  5AC5 A;  2ENA A;  4MLQ A;  2EPM X;  4JI1 E;  2DB2 A;  2LVH A;  5A69 A;  2L33 A;  1WHN A;  1B69 A;  4LF7 E;  2HGH A;  2UUA E;  2FV4 B;  4DR6 E;  4LTY A;  2JVA A;  2YTP A;  2R1F A;  3C6K A;  2ENH A;  2LTR A;  4ZYG A;  2G7H A;  1HR0 E;  4DR4 E;  2YTI A;  1MEY C;  2YSO A;  4DR7 E;  2KON A;  2WBT A;  3BID A;  4B3S E;  4JI8 E;  2YTO A;  1BBG A;  4F9B B;  1HNZ E;  2LUP B;  4GKK E;  3OML A;  4LF4 E;  4LF8 E;  2EL6 A;  3HQ1 A;  4OOG C;  1N34 E;  2DRP A;  2YTD A;  4JI4 E;  2V88 A;  1ZBT A;  4O5G A;  4M30 A;  3VHT B;  5FLX C;  5LMU E;  3EQ1 A;  3KWR A;  2UXB E;  5DNY A;  3ADL A;  2WBU A;  2EN1 A;  1SR9 A;  4YY3 E;  2EPO A;  2PRT A;  3C4T A;  3HXL A;  4DKK A;  4WSP A;  3ECR A;  5KL2 A;  1MGT A;  2B7V A;  2UUC E;  4R8O A;  1XNQ E;  2JOX A;  4YHH E;  3EPK A;  5A6B A;  1L4S A;  2EL5 A;  2V86 A;  3ADG A;  3M99 B;  2EMG A;  2CTD A;  4R2R A;  1XNR E;  1DGC A;  2EP3 A;  3P1X A;  1YZ9 A;  2I9I A;  1X6F A;  1NCS A;  2RPC A;  4R2S A;  2KHX A;  5AC4 A;  2M9A A;  4R2P A;  2EM3 A;  2EM4 A;  4P78 A;  2WBS A;  1A1I A;  1Z1B A;  2B3T B;  2EMK A;  2EPC A;  1QNT A;  2EMZ A;  3AUZ A;  2YT4 A;  3THN A;  2YTF A;  4BHB A;  2JY9 A;  3FIG A;  3L00 A;  2DMI A;  3LML A;  5KL4 A;  1AAY A;  2EOS A;  1YSA C;  2BBG A;  2YSP A;  3MSW A;  2UU9 E;  4HEI A;  2EM5 A;  2EPK X;  2LRS A;  2E1M A;  3C6M A;  3K6Q A;  2MKD A;  4DV0 E;  2LBS B;  1WHQ A;  3T1Y E;  4X65 E;  1HNW E;  2KOU A;  4B3M E;  4F9A B;  3ZOQ B;  5KL3 A;  2YRM A;  4R2C A;  2EPL X;  4OX9 E;  2CT1 A;  4WXC A;  5LMN E;  1AH5 A;  1O0W A;  2F8B A;  2WZO A;  1ZU1 A;  2EMB A;  2EQ3 A;  1X5W A;  2YRK A;  2L3C A;  2A25 A;  4BHC A;  2EOF A;  2UXD E;  1A1H A;  2YTG A;  1A1K A;  2DIX A;  4K0K E;  4DV1 E;  3THO B;  1P47 A;  4WX9 A;  1LLM C;  5F3W A;  4R2E A;  4IS1 C;  4DV4 E;  2N8X A;  3LLH A;  2LO3 A;  5ADZ A;  2EOJ A;  1PDA A;  2EE8 A;  2EOH A;  1UHZ A;  3QG5 C;  1T4L B;  2LTS A;  1YPN A;  2M7Q A;  1XMO E;  2YRH A;  1YYK A;  2YZT A;  5AAS A;  2GHF A;  1N3G A;  4LFA E;  3BGH A;  2B7T A;  2L6M A;  1PJQ A;  3J7Y p;  1NEI A;  1X6E A;  2EWL A;  2YTE A;  4P7D A;  1A1J A;  5LL6 R;  1ZAA C;  2I13 A;  2EMC A;  1PJS A;  1X48 A;  2EM2 A;  2EOZ A;  1WJP A;  2EZ6 A;  2Q8U A;  4FK5 C;  4L5N C;  3KZY A;  4KZS A;  2ODR C;  4WXD A;  2IHR 1;  1A1L A;  1FJG E;  2EPP A;  2L8T A;  2ODR D;  3VK6 A;  5A6K A;  2VQE E;  4I8O A;  4M0V A;  2EOI A;  2K7I A;  2EPR A;  3BF2 A;  4O43 A;  2V85 A;  4GEQ B;  2ZM6 E;  1IQO A;  1A1F A;  4M9V C;  4R2Q A;  2EOM A;  2L92 A;  2B9D A;  1KJK A;  3VYY A;  2L2M A;  4X8W A;  3EPH A;  5A6A A;  1IBK E;  2JR1 A;  4ZYH A;  4NHR A;  1RQ0 A;  2NAB A;  1A1G A;  1PJT A;  3DJW A;  1WXR A;  4NZV A;  4DV7 E;  4BMJ A;  4DUY E;  1G2F C;  1EH7 A;  2RSI A;  4DUZ E;  4LFB E;  1J26 A;  4R03 A;  3RMP A;  1YFH A;  1YUI A;  2EQ1 A;  4F6M A;  1UN6 B;  5IT9 C;  2YWQ A;  2YPN A;  1RC7 A;  4JI0 E;  1YYW A;  3MHS C;  4WFT A;  2EM9 A;  2MDG A;  2EM6 A;  1EH8 A;  3KZZ A;  2EOO A;  1ZR9 A;  1I94 E;  2E72 A;  4O4K A;  2EMF A;  1ZBQ A;  2YTN A;  2EN8 A;  1TF3 A;  1T4O A;  4B3R E;  4R2D A;  3IWD A;  4BCA A;  4F2J C;  2LT7 A;  1IMU A;  2EMH A;  3HTX A;  2RS6 A;  5IXM B;  4TUG A;  3J7A G;  2D9H A;  4MLV A;  1N33 E;  2GPI A;  4JI5 E;  4X64 E;  3VYX A;  4LU9 A;  4KHP E;  4BBY A;  1GZ6 A;  3EPL A;  2HHH E;  2RSM A;  2LJU A;  1KYQ A;  4DV2 E;  2L3J A;  3JTZ A;  1UBD C;  2ENC A;  4WYQ B;  1RMD A;  2JPA A;  2BB8 A;  3IWC A;  2ELY A;  1BBO A;  2CPN A;  1STU A;  2EOQ A;  5LLQ A;  3J81 C;  2EL4 A;  4Q28 A;  4DV3 E;  2EOR A;  1FKA E;  1UIL A;  2V83 A;  4ZYE A;  1IQS A;  2LE2 A;  5A2Q C;  4R2A A;  4LF5 E;  5TSE A;  1F2I G;  2EN2 A;  2JYA A;  2MC6 A;  2EN6 A;  2EM7 A;  3EPJ A;  2EMI A;  4WSG A;  2EMY A;  2NUG A;  4F9C B;  2JOB A;  4AQY E;  2UXC E;  2RS7 A;  1EKZ A;  2DLK A;  1IBL E;  5CFF E;  4X62 E;  1IBM E;  2MC5 A;  4JI3 E;  2YU8 A;  2R76 A;  2LMZ A;  3HPZ A;  5KL5 A;  2ELZ A;  2EPU A;  4HTG A;  5BR8 E;  4JYA E;  1PKP A;  2DMY A;  2EQ0 A;  1DQ3 A;  4GZN C;  1N36 E;  2E5L E;  4LF9 E;  3JU0 A;  4DR2 E;  2EN3 A;  2J7J A;  4Q35 B;  4LF6 E;  4KWY A;  1YUJ A;  2V87 A;  2VF1 A;  4BC9 A;  4F54 A;  4JI2 E;  2JXP A;  2EM8 A;  3AV0 A;  5KL6 A;  4TUI A;  4O24 A;  2LCE A;  2MKN A;  4IJD A;  3F6H A;  1XMQ E;  2DGC A;  2K4V A;  2V89 A;  4NXM E;  1T38 A;  1HNX E;  3J80 C;  1J5E E;  2L2N A;  2LUQ A;  3MHH C;  2NUE A;  5A6B D;  3TQM A;  2EM0 A;  1YYO A;  3DF6 A;  4L8N A;  2JP9 A;  4BC7 A;  1GQE A;  5IV8 B;  2FTX B;  2HC5 A;  2EN4 A;  5T6J A;  2EOE A;  2NA2 A;  4JI7 E;  5AE1 A;  1JK2 A;  1T4N A;  2EMX A;  2RTX A;  5KL7 A;  2EJ4 A;  4RHB B;  3BBG A;  4ZYD A;  4DV5 E;  4X66 E;  1WRJ A;  1EH6 A;  2CSH A;  2EPZ A;  3F6G A;  5AE2 A;  4DR5 E;  5A6J A;  2FGG A;  2HJJ A;  3ADI A;  1JK1 A;  2YTQ A;  2ADR A;  4M2Z A;  1X49 A;  2YU5 A;  2UUB E;  2JWO A;  2GLI A;  3HPS A;  1T39 A;  2LV2 A;  1SFE A;  2H36 X;  2EN7 A;  3OTO E;  2MDR A;  3T1H E;  1TF6 A;  2EML A;  4RH8 A;  1TN9 A;  1X6H A;  2EPA A;  3ADJ A;  4GKJ E;  5IWA E;  3IWB A;  1DI2 A;  2V8Q B; 
#chains in the Genus database with same CATH homology
 2EMI A;  4WSG A;  3EPK A;  2DLQ A;  2EOI A;  2EMY A;  3EPJ A;  1G2D C;  2EPR A;  2EL5 A;  2EMW A;  1X3C A;  1A1F A;  2EMA A;  2EMG A;  3M99 B;  4M9V C;  2CTD A;  4R2R A;  4R2Q A;  2EOM A;  1DGC A;  1KJK A;  2EP3 A;  2DLK A;  3EPH A;  1X6F A;  1NCS A;  2RPC A;  4R2S A;  2YU8 A;  2NAB A;  2M9A A;  2WCC 3;  1A1G A;  4R2P A;  2EM3 A;  2EOY A;  2EM4 A;  5KL5 A;  2ELZ A;  3UK3 C;  1G2F C;  2WBS A;  1A1I A;  2EPU A;  1Z1B A;  2EMK A;  2EPC A;  2RSI A;  2YTJ A;  2EMZ A;  2EPX A;  2YTF A;  4X9J A;  1YUI A;  2EQ1 A;  4F6N A;  2EQ0 A;  2DMI A;  4F6M A;  5KL4 A;  4GZN C;  1UN6 B;  1AAY A;  2EOS A;  1YSA C;  2YSP A;  2VRD A;  2EN3 A;  3MHS C;  1BB8 A;  2EM9 A;  2J7J A;  2MDG A;  2EM5 A;  1YUJ A;  2EM6 A;  2EOX A;  2MKD A;  2EOO A;  2ENA A;  1ZR9 A;  2E72 A;  2LVH A;  2EMF A;  1B69 A;  2EM8 A;  2HGH A;  5KL6 A;  2YTN A;  2EN8 A;  5KL3 A;  2YRM A;  4R2C A;  2CT1 A;  2LCE A;  2MKN A;  1TF3 A;  2YTP A;  4IJD A;  2R1F A;  1ZU1 A;  2EMB A;  2EQ3 A;  4R2D A;  2LT7 A;  4F2J C;  2ENH A;  2DGC A;  1X5W A;  2YRK A;  2A25 A;  2EMH A;  2EOF A;  1A1H A;  2YTG A;  1A1K A;  2YTI A;  1MEY C;  3MHH C;  1P47 A;  2EM0 A;  2YSO A;  1LLM C;  2JP9 A;  2D9H A;  2WBT A;  4R2E A;  4IS1 C;  2LO3 A;  2EOJ A;  2EE8 A;  2EOH A;  2EN4 A;  2YTO A;  2EOE A;  3EPL A;  1JK2 A;  2EL6 A;  2EMX A;  2YRH A;  5KL7 A;  2EJ4 A;  2DRP A;  2YTD A;  1UBD C;  2GHF A;  2ENC A;  1RMD A;  2JPA A;  2BB8 A;  2CSH A;  2EPZ A;  2ELY A;  3VHT B;  1BBO A;  1X6E A;  1JK1 A;  2YTE A;  2EOQ A;  2YTQ A;  2ADR A;  2YU5 A;  1A1J A;  1ZAA C;  2I13 A;  2EMC A;  2GLI A;  2LV2 A;  2EM2 A;  2EOZ A;  2EL4 A;  2WBU A;  1WJP A;  2EN1 A;  2EN7 A;  4FK5 C;  2EOR A;  2PRT A;  1TF6 A;  2EML A;  1TN9 A;  5KL2 A;  1A1L A;  1X6H A;  2EPA A;  4R2A A;  2EPP A;  2EN2 A;  1F2I G;  2EN6 A;  2EM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...