2EM4A

Solution structure of the c2h2 type zinc finger (region 724-756) of human zinc finger protein 28 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGQRPYECIECGKAFKTKSSLICHRRSHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 28 homolog
publication title Solution structure of the C2H2 type zinc finger (region 724-756) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13912 zf-C2H2_6 C2H2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em4A01
4WSGA 2EMKA 2LCEA 2JP9A 1AAYA 1F2IG 2WBUA 2LVHA 4GZNC 2EMFA 2E72A 2WCC3 2EMWA 4X9JA 2EOIA 2EN4A 2ENAA 3VHTB 2EMLA 3MHSC 2YTQA 2EMHA 2ELYA 1A1GA 4R2CA 2EOOA 2WBSA 1YUJA 2EM3A 2EMYA 2EM5A 2EOMA 2YTJA 2EPAA 2JPAA 2EMCA 2EP3A 2YRHA 1LLMC 2DMIA 2CTDA 1X6FA 4R2RA 2EN8A 2MKDA 1BBOA 3EPJA 3UK3C 2CSHA 2EPUA 5KL2A 1MEYC 4R2PA 1YUIA 2BB8A 2YTDA 5KL4A 1WJPA 2EMZA 2EJ4A 2YTFA 1A1IA 1X6HA 4IS1C 2D9HA 2GHFA 1DGCA 2EM8A 2EPRA 2EPXA 3EPHA 1BB8A 1A1HA 1A1KA 2R1FA 2EQ0A 2LV2A 1KJKA 2EOZA 2EM2A 2ADRA 2LT7A 2YTPA 2RSIA 2EMXA 2YSOA 2EE8A 2YTGA 4FK5C 2ENHA 1B69A 2EN2A 2MKNA 5KL3A 2LO3A 2YSPA 4R2SA 2YU5A 2PRTA 1UBDC 4R2QA 2HGHA 2CT1A 2EM4A 2EN6A 2EN7A 2EOYA 2YTOA 1A1FA 2EOEA 2ENCA 1G2DC 2EL5A 4F2JC 3EPKA 2EL6A 2EOXA 4F6MA 2RPCA 2EM7A 1JK2A 3MHHC 2EMBA 2EORA 2EMGA 2GLIA 2EN3A 2EOQA 1JK1A 2DLKA 4R2AA 1A1LA 2EM0A 2EOSA 5KL7A 1TN9A 2YRKA 1ZR9A 2DLQA 2YTIA 1A1JA 1TF3A 3EPLA 2EPZA 2EQ1A 5KL5A 2EL4A 2I13A 2YTNA 1RMDA 5KL6A 2EN1A 4R2DA 2YU8A 1Z1BA 2WBTA 2EMAA 2EPCA 1P47A 1YSAC 1X6EA 4M9VC 1NCSA 1X3CA 2EM9A 1ZAAC 2DRPA 2EOJA 2ELZA 1X5WA 1G2FC 2EM6A 1ZU1A 4IJDA 2M9AA 2DGCA 2YTEA 2EOFA 2J7JA 4F6NA 2MDGA 2VRDA 2YRMA 2EQ3A 2EMIA 2EOHA 2EPPA 3M99B 1UN6B 2NABA 4R2EA 2A25A 1TF6A
chains in the Genus database with same CATH superfamily
1GTKA 1EH7A 2LCEA 4DV1E 2E5LE 2E72A 2EMWA 3BGHA 2EN4A 2LMZA 2RSMA 4DR5E 4AQYE 4N4RB 1PJQA 2EM5A 4LF4E 1X47A 2EMCA 2EP3A 4LTYA 1T4LB 1QNTA 2CTDA 5IV8B 1BBOA 1XMQE 4O24A 3VK6A 2EPNA 1MEYC 4BCAA 2YTDA 5IT9C 5KL4A 1FJGE 4L5NC 4BC9A 5A6JA 1PJSA 4JI0E 2WZOA 4JYAE 1HNWE 4M0VA 4O43A 4O5GA 1GZ6A 1UILA 1A1HA 1UHZA 4B3ME 4JI5E 3JU0A 2R1FA 4NXNE 2ADRA 1XNQE 1WRJA 2EPOA 4HEIA 3KWRA 4GKKE 2B3TB 3HTXA 5AE3A 2YU5A 2ODRD 2VQEE 3VYYA 1KYQA 2EM4A 1YPNA 2EN7A 2K4VA 2YTOA 3OMLA 2RTXA 4DR4E 1NEIA 2JXPA 4ZYEA 4M2ZA 2EL6A 2EM7A 2V89A 1T39A 4X66E 3LLHA 2EMGA 2HHHE 2EN3A 2ODRC 2EOQA 2IHR1 2JYAA 2EM0A 2EOSA 4R03A 2FGGA 4Q28A 5AE2A 1ZR9A 4BBYA 4DR2E 2YTIA 1TF3A 5FLXC 2EPLX 5KL5A 2EL4A 2YTNA 2EN1A 2LJHA 4NZVA 2WBTA 1STUA 4NHRA 2EMAA 2EPCA 4KWYA 1Z1BA 4LFAE 2DSYA 3AUZA 2F4VE 1X5WA 1G2FC 4IJDA 2B7VA 2UU9E 3JAMC 3BIDA 2EOFA 2J7JA 3AV0A 4P78A 2YRMA 4WYQB 4OOGC 2A25A 3T1YE 1N32E 1XMOE 5A6AA 5LMUE 2JP9A 2EMKA 5AASA 1AAYA 4M30A 4Q35B 2WBUA 2ZM6E 4GZNC 2ENAA 4O4KA 1IBME 2YWQA 4R2CA 1ZBQA 1SFEA 1LLMC 2EZ6A 3ADIA 1X6FA 2EN8A 2MKDA 5T6JA 3EPJA 1XNRE 2EPUA 1HNXE 2L2KB 2BB8A 4ZYHA 4YY3E 2UUAE 1A1IA 1X6HA 4IS1C 4F54A 2D9HA 2GHFA 1IBKE 3EPHA 4LF5E 1BB8A 4LF8E 2JWOA 3DF6A 2EPKX 2EM2A 3HPZA 3HXLA 2V83A 4WSPA 2RSIA 2RQLA 2CPNA 2YSOA 2FTXB 1O0WA 2KHXA 3HPSA 2ENHA 1B69A 2LE2A 5TSEA 2EN2A 2LO3A 2K7IA 2I9IA 4R2QA 2EN6A 1HNZE 3ADJA 3F6HA 3VYXA 2ENCA 5AC5A 4F9AB 2EL5A 3EPKA 3C4TA 4HTGA 4LF6E 4KZSA 1IBLE 4LF9E 2RPCA 2EMBA 2EORA 4DV2E 4NXME 4OX9E 1JK1A 4R2AA 2B9DA 4K0KE 1TN9A 2LJUA 4LFBE 2V88A 2L2NA 1A1JA 4JI4E 2L3CA 4LF7E 3T1HE 3JTZA 5KL6A 1RMDA 4R2DA 2YU8A 2MC6A 2V87A 3EQ1A 4P7DA 1X6EA 5A2QC 2LRSA 5A6KA 4F9CB 3IWDA 5ADZA 2DGCA 1YYOA 1BBGA 4F9BB 2UUCE 2KOUA 1DI2A 2EOHA 3C4BA 4DR7E 2JVAA 3M99B 5LLQA 1N33E 2NABA 1WHQA 2MC5A 4DV3E 4WSGA 1F2IG 1IMUA 2LVHA 4YHHE 3BF2A 2WCC3 4JI2E 4BS9A 3VHTB 1I94E 2EMLA 1SR9A 3ADLA 2V85A 3MHSC 1PJTA 2YTQA 2EMHA 2ELYA 5BR8E 2VF1A 1A1GA 2EM3A 2EMYA 1MGTA 2GPIA 1QU6A 4DKKA 1YYKA 2YTJA 2JPAA 2NA2A 1J26A 2E1MA 2LUQA 1T4OA 3UK3C 3ADGA 1EH6A 5KL2A 4ZYDA 2G7HA 4JI6E 4GKJE 2M4IA 2EJ4A 4JV5E 4B3SE 2BBGA 2L6MA 4J8ZA 2EPXA 2HJJA 3FIGA 1RC7A 4WXCA 1X48A 2LV2A 1KJKA 2LT7A 3H09A 2YTPA 4DR6E 3MSWA 2EMXA 2EE8A 4FK5C 2MKNA 2YSPA 2M1SA 2N3HA 2JOXA 2YT4A 2H36X 1L4SA 3KZYA 4WPYA 1A1FA 2EOEA 3TQMA 2YZTA 4F6MA 3MHHC 5IWAE 2L33A 5DNYA 2LTRA 3C6KA 1HR0E 2GLIA 4DV0E 4MLQA 1A1LA 2MDRA 2FV4B 1EH8A 2L3JA 4X8WA 5A69A 2YPNA 1N34E 5AC4A 1YSAC 2DB2A 1T4NA 3ECRA 1X3CA 1X49A 2EM9A 1ZAAC 2DRPA 2EOJA 4BHBA 1ZU1A 4RH8A 2LTSA 2YTEA 4DMIA 2UUBE 3OTOE 4L8NA 2VRDA 4MLVA 2L8TA 2EPPA 5A6BA 4R2EA 1TF6A 4BC7A 1T38A 4BHCA 2EMFA 1N36E 4X9JA 4DUYE 2EOIA 3DJWA 2Q8UA 1N3GA 2B7TA 2WBSA 2EOOA 4JI8E 1YUJA 4DR1E 5F3WA 1YZ9A 4KHPE 2EOMA 2EPAA 3J81C 4TUGA 2YRHA 4WX9A 2DMIA 2M7QA 4R2RA 1IQSA 2VE7C 2CSHA 1DQ3A 4LU9A 1YYWA 2JR1A 4DR3E 1YUIA 4R2PA 2UXBE 4GEQB 3J7AG 1WJPA 2EMZA 2YTFA 2L92A 2NUEA 2DMYA 4B3TE 1DGCA 4WXDA 3THOB 2EM8A 2EPRA 3ZOQB 2UXDE 3HQ1A 3C6MA 5LMNE 2EWLA 1GQEA 1IQOA 2V8QB 1A1KA 2EQ0A 2EPMX 2EOZA 4B3RE 4JI1E 3P1XA 2YTGA 3THNA 4LFCE 2V86A 4JI3E 2R76A 5KL3A 4DV7E 5LL6R 3KZZA 3RMPA 4R2SA 2PRTA 4JI7E 1UBDC 2HC5A 3LMLA 1AH5A 5AE1A 2HGHA 2CT1A 2RS7A 2EOYA 5IXMB 3J7Yp 1YFHA 1WXRA 1PKPA 2L2MA 4X65E 5CFFE 1EKZA 3BBGA 1G2DC 2N8XA 1PDAA 4F2JC 2EOXA 4R8OA 4DV5E 1JK2A 4DV6E 2JY9A 4X64E 4WFTA 3K6QA 4BMJA 2LUPB 4TUIA 2NUFA 5A6BD 2DLKA 4DUZE 5KL7A 3J80C 1RQ0A 2YRKA 4ZYGA 2UXCE 2NUGA 2DLQA 4RHBB 1ZBTA 3F6GA 3EPLA 3QG5C 2EPZA 2EQ1A 3IWCA 2JOBA 2N3GA 2KONA 2I13A 2DIXA 2VQFE 1P47A 4M9VC 1NCSA 3IWBA 1WHNA 4DV4E 1J5EE 2ELZA 2LBSB 1FKAE 2EM6A 2M9AA 2RS6A 4F6NA 2MDGA 2F8BA 2EQ3A 2EMIA 3L00A 4I8OA 4X62E 1UN6B
chains in the Genus database with same CATH topology
4WSGA 2EMKA 2LCEA 2JP9A 1AAYA 1F2IG 2WBUA 2LVHA 4GZNC 2EMFA 2E72A 2WCC3 2EMWA 4X9JA 2EOIA 2EN4A 2ENAA 3VHTB 2EMLA 3MHSC 2YTQA 2EMHA 2ELYA 1A1GA 4R2CA 2EOOA 2WBSA 1YUJA 2EM3A 2EMYA 2EM5A 2EOMA 2YTJA 2EPAA 2JPAA 2EMCA 2EP3A 2YRHA 1LLMC 2DMIA 2CTDA 1X6FA 4R2RA 2EN8A 2MKDA 1BBOA 3EPJA 3UK3C 2CSHA 2EPUA 5KL2A 1MEYC 4R2PA 1YUIA 2BB8A 2YTDA 5KL4A 1WJPA 2EMZA 2EJ4A 2YTFA 1A1IA 1X6HA 4IS1C 2D9HA 2GHFA 1DGCA 2EM8A 2EPRA 2EPXA 3EPHA 1BB8A 1A1HA 1A1KA 2R1FA 2EQ0A 2LV2A 1KJKA 2EOZA 2EM2A 2ADRA 2LT7A 2YTPA 2RSIA 2EMXA 2YSOA 2EE8A 2YTGA 4FK5C 2ENHA 1B69A 2EN2A 2MKNA 5KL3A 2LO3A 2YSPA 4R2SA 2YU5A 2PRTA 1UBDC 4R2QA 2HGHA 2CT1A 2EM4A 2EN6A 2EN7A 2EOYA 2YTOA 1A1FA 2EOEA 2ENCA 1G2DC 2EL5A 4F2JC 3EPKA 2EL6A 2EOXA 4F6MA 2RPCA 2EM7A 1JK2A 3MHHC 2EMBA 2EORA 2EMGA 2GLIA 2EN3A 2EOQA 1JK1A 2DLKA 4R2AA 1A1LA 2EM0A 2EOSA 5KL7A 1TN9A 2YRKA 1ZR9A 2DLQA 2YTIA 1A1JA 1TF3A 3EPLA 2EPZA 2EQ1A 5KL5A 2EL4A 2I13A 2YTNA 1RMDA 5KL6A 2EN1A 4R2DA 2YU8A 1Z1BA 2WBTA 2EMAA 2EPCA 1P47A 1YSAC 1X6EA 4M9VC 1NCSA 1X3CA 2EM9A 1ZAAC 2DRPA 2EOJA 2ELZA 1X5WA 1G2FC 2EM6A 1ZU1A 4IJDA 2M9AA 2DGCA 2YTEA 2EOFA 2J7JA 4F6NA 2MDGA 2VRDA 2YRMA 2EQ3A 2EMIA 2EOHA 2EPPA 3M99B 1UN6B 2NABA 4R2EA 2A25A 1TF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WSG A;  2EMK A;  2LCE A;  2JP9 A;  1AAY A;  1F2I G;  2WBU A;  2LVH A;  4GZN C;  2EMF A;  2E72 A;  2WCC 3;  2EMW A;  4X9J A;  2EOI A;  2EN4 A;  2ENA A;  3VHT B;  2EML A;  3MHS C;  2YTQ A;  2EMH A;  2ELY A;  1A1G A;  4R2C A;  2EOO A;  2WBS A;  1YUJ A;  2EM3 A;  2EMY A;  2EM5 A;  2EOM A;  2YTJ A;  2EPA A;  2JPA A;  2EMC A;  2EP3 A;  2YRH A;  1LLM C;  2DMI A;  2CTD A;  1X6F A;  4R2R A;  2EN8 A;  2MKD A;  1BBO A;  3EPJ A;  3UK3 C;  2CSH A;  2EPU A;  5KL2 A;  1MEY C;  4R2P A;  1YUI A;  2BB8 A;  2YTD A;  5KL4 A;  1WJP A;  2EMZ A;  2EJ4 A;  2YTF A;  1A1I A;  1X6H A;  4IS1 C;  2D9H A;  2GHF A;  1DGC A;  2EM8 A;  2EPR A;  2EPX A;  3EPH A;  1BB8 A;  1A1H A;  1A1K A;  2R1F A;  2EQ0 A;  2LV2 A;  1KJK A;  2EOZ A;  2EM2 A;  2ADR A;  2LT7 A;  2YTP A;  2RSI A;  2EMX A;  2YSO A;  2EE8 A;  2YTG A;  4FK5 C;  2ENH A;  1B69 A;  2EN2 A;  2MKN A;  5KL3 A;  2LO3 A;  2YSP A;  4R2S A;  2YU5 A;  2PRT A;  1UBD C;  4R2Q A;  2HGH A;  2CT1 A;  2EM4 A;  2EN6 A;  2EN7 A;  2EOY A;  2YTO A;  1A1F A;  2EOE A;  2ENC A;  1G2D C;  2EL5 A;  4F2J C;  3EPK A;  2EL6 A;  2EOX A;  4F6M A;  2RPC A;  2EM7 A;  1JK2 A;  3MHH C;  2EMB A;  2EOR A;  2EMG A;  2GLI A;  2EN3 A;  2EOQ A;  1JK1 A;  2DLK A;  4R2A A;  1A1L A;  2EM0 A;  2EOS A;  5KL7 A;  1TN9 A;  2YRK A;  1ZR9 A;  2DLQ A;  2YTI A;  1A1J A;  1TF3 A;  3EPL A;  2EPZ A;  2EQ1 A;  5KL5 A;  2EL4 A;  2I13 A;  2YTN A;  1RMD A;  5KL6 A;  2EN1 A;  4R2D A;  2YU8 A;  1Z1B A;  2WBT A;  2EMA A;  2EPC A;  1P47 A;  1YSA C;  1X6E A;  4M9V C;  1NCS A;  1X3C A;  2EM9 A;  1ZAA C;  2DRP A;  2EOJ A;  2ELZ A;  1X5W A;  1G2F C;  2EM6 A;  1ZU1 A;  4IJD A;  2M9A A;  2DGC A;  2YTE A;  2EOF A;  2J7J A;  4F6N A;  2MDG A;  2VRD A;  2YRM A;  2EQ3 A;  2EMI A;  2EOH A;  2EPP A;  3M99 B;  1UN6 B;  2NAB A;  4R2E A;  2A25 A;  1TF6 A; 
#chains in the Genus database with same CATH topology
 1GTK A;  1EH7 A;  2LCE A;  4DV1 E;  2E5L E;  2E72 A;  2EMW A;  3BGH A;  2EN4 A;  2LMZ A;  2RSM A;  4DR5 E;  4AQY E;  4N4R B;  1PJQ A;  2EM5 A;  4LF4 E;  1X47 A;  2EMC A;  2EP3 A;  4LTY A;  1T4L B;  1QNT A;  2CTD A;  5IV8 B;  1BBO A;  1XMQ E;  4O24 A;  3VK6 A;  2EPN A;  1MEY C;  4BCA A;  2YTD A;  5IT9 C;  5KL4 A;  1FJG E;  4L5N C;  4BC9 A;  5A6J A;  1PJS A;  4JI0 E;  2WZO A;  4JYA E;  1HNW E;  4M0V A;  4O43 A;  4O5G A;  1GZ6 A;  1UIL A;  1A1H A;  1UHZ A;  4B3M E;  4JI5 E;  3JU0 A;  2R1F A;  4NXN E;  2ADR A;  1XNQ E;  1WRJ A;  2EPO A;  4HEI A;  3KWR A;  4GKK E;  2B3T B;  3HTX A;  5AE3 A;  2YU5 A;  2ODR D;  2VQE E;  3VYY A;  1KYQ A;  2EM4 A;  1YPN A;  2EN7 A;  2K4V A;  2YTO A;  3OML A;  2RTX A;  4DR4 E;  1NEI A;  2JXP A;  4ZYE A;  4M2Z A;  2EL6 A;  2EM7 A;  2V89 A;  1T39 A;  4X66 E;  3LLH A;  2EMG A;  2HHH E;  2EN3 A;  2ODR C;  2EOQ A;  2IHR 1;  2JYA A;  2EM0 A;  2EOS A;  4R03 A;  2FGG A;  4Q28 A;  5AE2 A;  1ZR9 A;  4BBY A;  4DR2 E;  2YTI A;  1TF3 A;  5FLX C;  2EPL X;  5KL5 A;  2EL4 A;  2YTN A;  2EN1 A;  2LJH A;  4NZV A;  2WBT A;  1STU A;  4NHR A;  2EMA A;  2EPC A;  4KWY A;  1Z1B A;  4LFA E;  2DSY A;  3AUZ A;  2F4V E;  1X5W A;  1G2F C;  4IJD A;  2B7V A;  2UU9 E;  3JAM C;  3BID A;  2EOF A;  2J7J A;  3AV0 A;  4P78 A;  2YRM A;  4WYQ B;  4OOG C;  2A25 A;  3T1Y E;  1N32 E;  1XMO E;  5A6A A;  5LMU E;  2JP9 A;  2EMK A;  5AAS A;  1AAY A;  4M30 A;  4Q35 B;  2WBU A;  2ZM6 E;  4GZN C;  2ENA A;  4O4K A;  1IBM E;  2YWQ A;  4R2C A;  1ZBQ A;  1SFE A;  1LLM C;  2EZ6 A;  3ADI A;  1X6F A;  2EN8 A;  2MKD A;  5T6J A;  3EPJ A;  1XNR E;  2EPU A;  1HNX E;  2L2K B;  2BB8 A;  4ZYH A;  4YY3 E;  2UUA E;  1A1I A;  1X6H A;  4IS1 C;  4F54 A;  2D9H A;  2GHF A;  1IBK E;  3EPH A;  4LF5 E;  1BB8 A;  4LF8 E;  2JWO A;  3DF6 A;  2EPK X;  2EM2 A;  3HPZ A;  3HXL A;  2V83 A;  4WSP A;  2RSI A;  2RQL A;  2CPN A;  2YSO A;  2FTX B;  1O0W A;  2KHX A;  3HPS A;  2ENH A;  1B69 A;  2LE2 A;  5TSE A;  2EN2 A;  2LO3 A;  2K7I A;  2I9I A;  4R2Q A;  2EN6 A;  1HNZ E;  3ADJ A;  3F6H A;  3VYX A;  2ENC A;  5AC5 A;  4F9A B;  2EL5 A;  3EPK A;  3C4T A;  4HTG A;  4LF6 E;  4KZS A;  1IBL E;  4LF9 E;  2RPC A;  2EMB A;  2EOR A;  4DV2 E;  4NXM E;  4OX9 E;  1JK1 A;  4R2A A;  2B9D A;  4K0K E;  1TN9 A;  2LJU A;  4LFB E;  2V88 A;  2L2N A;  1A1J A;  4JI4 E;  2L3C A;  4LF7 E;  3T1H E;  3JTZ A;  5KL6 A;  1RMD A;  4R2D A;  2YU8 A;  2MC6 A;  2V87 A;  3EQ1 A;  4P7D A;  1X6E A;  5A2Q C;  2LRS A;  5A6K A;  4F9C B;  3IWD A;  5ADZ A;  2DGC A;  1YYO A;  1BBG A;  4F9B B;  2UUC E;  2KOU A;  1DI2 A;  2EOH A;  3C4B A;  4DR7 E;  2JVA A;  3M99 B;  5LLQ A;  1N33 E;  2NAB A;  1WHQ A;  2MC5 A;  4DV3 E;  4WSG A;  1F2I G;  1IMU A;  2LVH A;  4YHH E;  3BF2 A;  2WCC 3;  4JI2 E;  4BS9 A;  3VHT B;  1I94 E;  2EML A;  1SR9 A;  3ADL A;  2V85 A;  3MHS C;  1PJT A;  2YTQ A;  2EMH A;  2ELY A;  5BR8 E;  2VF1 A;  1A1G A;  2EM3 A;  2EMY A;  1MGT A;  2GPI A;  1QU6 A;  4DKK A;  1YYK A;  2YTJ A;  2JPA A;  2NA2 A;  1J26 A;  2E1M A;  2LUQ A;  1T4O A;  3UK3 C;  3ADG A;  1EH6 A;  5KL2 A;  4ZYD A;  2G7H A;  4JI6 E;  4GKJ E;  2M4I A;  2EJ4 A;  4JV5 E;  4B3S E;  2BBG A;  2L6M A;  4J8Z A;  2EPX A;  2HJJ A;  3FIG A;  1RC7 A;  4WXC A;  1X48 A;  2LV2 A;  1KJK A;  2LT7 A;  3H09 A;  2YTP A;  4DR6 E;  3MSW A;  2EMX A;  2EE8 A;  4FK5 C;  2MKN A;  2YSP A;  2M1S A;  2N3H A;  2JOX A;  2YT4 A;  2H36 X;  1L4S A;  3KZY A;  4WPY A;  1A1F A;  2EOE A;  3TQM A;  2YZT A;  4F6M A;  3MHH C;  5IWA E;  2L33 A;  5DNY A;  2LTR A;  3C6K A;  1HR0 E;  2GLI A;  4DV0 E;  4MLQ A;  1A1L A;  2MDR A;  2FV4 B;  1EH8 A;  2L3J A;  4X8W A;  5A69 A;  2YPN A;  1N34 E;  5AC4 A;  1YSA C;  2DB2 A;  1T4N A;  3ECR A;  1X3C A;  1X49 A;  2EM9 A;  1ZAA C;  2DRP A;  2EOJ A;  4BHB A;  1ZU1 A;  4RH8 A;  2LTS A;  2YTE A;  4DMI A;  2UUB E;  3OTO E;  4L8N A;  2VRD A;  4MLV A;  2L8T A;  2EPP A;  5A6B A;  4R2E A;  1TF6 A;  4BC7 A;  1T38 A;  4BHC A;  2EMF A;  1N36 E;  4X9J A;  4DUY E;  2EOI A;  3DJW A;  2Q8U A;  1N3G A;  2B7T A;  2WBS A;  2EOO A;  4JI8 E;  1YUJ A;  4DR1 E;  5F3W A;  1YZ9 A;  4KHP E;  2EOM A;  2EPA A;  3J81 C;  4TUG A;  2YRH A;  4WX9 A;  2DMI A;  2M7Q A;  4R2R A;  1IQS A;  2VE7 C;  2CSH A;  1DQ3 A;  4LU9 A;  1YYW A;  2JR1 A;  4DR3 E;  1YUI A;  4R2P A;  2UXB E;  4GEQ B;  3J7A G;  1WJP A;  2EMZ A;  2YTF A;  2L92 A;  2NUE A;  2DMY A;  4B3T E;  1DGC A;  4WXD A;  3THO B;  2EM8 A;  2EPR A;  3ZOQ B;  2UXD E;  3HQ1 A;  3C6M A;  5LMN E;  2EWL A;  1GQE A;  1IQO A;  2V8Q B;  1A1K A;  2EQ0 A;  2EPM X;  2EOZ A;  4B3R E;  4JI1 E;  3P1X A;  2YTG A;  3THN A;  4LFC E;  2V86 A;  4JI3 E;  2R76 A;  5KL3 A;  4DV7 E;  5LL6 R;  3KZZ A;  3RMP A;  4R2S A;  2PRT A;  4JI7 E;  1UBD C;  2HC5 A;  3LML A;  1AH5 A;  5AE1 A;  2HGH A;  2CT1 A;  2RS7 A;  2EOY A;  5IXM B;  3J7Y p;  1YFH A;  1WXR A;  1PKP A;  2L2M A;  4X65 E;  5CFF E;  1EKZ A;  3BBG A;  1G2D C;  2N8X A;  1PDA A;  4F2J C;  2EOX A;  4R8O A;  4DV5 E;  1JK2 A;  4DV6 E;  2JY9 A;  4X64 E;  4WFT A;  3K6Q A;  4BMJ A;  2LUP B;  4TUI A;  2NUF A;  5A6B D;  2DLK A;  4DUZ E;  5KL7 A;  3J80 C;  1RQ0 A;  2YRK A;  4ZYG A;  2UXC E;  2NUG A;  2DLQ A;  4RHB B;  1ZBT A;  3F6G A;  3EPL A;  3QG5 C;  2EPZ A;  2EQ1 A;  3IWC A;  2JOB A;  2N3G A;  2KON A;  2I13 A;  2DIX A;  2VQF E;  1P47 A;  4M9V C;  1NCS A;  3IWB A;  1WHN A;  4DV4 E;  1J5E E;  2ELZ A;  2LBS B;  1FKA E;  2EM6 A;  2M9A A;  2RS6 A;  4F6N A;  2MDG A;  2F8B A;  2EQ3 A;  2EMI A;  3L00 A;  4I8O A;  4X62 E;  1UN6 B; 
#chains in the Genus database with same CATH homology
 4WSG A;  2EMK A;  2LCE A;  2JP9 A;  1AAY A;  1F2I G;  2WBU A;  2LVH A;  4GZN C;  2EMF A;  2E72 A;  2WCC 3;  2EMW A;  4X9J A;  2EOI A;  2EN4 A;  2ENA A;  3VHT B;  2EML A;  3MHS C;  2YTQ A;  2EMH A;  2ELY A;  1A1G A;  4R2C A;  2EOO A;  2WBS A;  1YUJ A;  2EM3 A;  2EMY A;  2EM5 A;  2EOM A;  2YTJ A;  2EPA A;  2JPA A;  2EMC A;  2EP3 A;  2YRH A;  1LLM C;  2DMI A;  2CTD A;  1X6F A;  4R2R A;  2EN8 A;  2MKD A;  1BBO A;  3EPJ A;  3UK3 C;  2CSH A;  2EPU A;  5KL2 A;  1MEY C;  4R2P A;  1YUI A;  2BB8 A;  2YTD A;  5KL4 A;  1WJP A;  2EMZ A;  2EJ4 A;  2YTF A;  1A1I A;  1X6H A;  4IS1 C;  2D9H A;  2GHF A;  1DGC A;  2EM8 A;  2EPR A;  2EPX A;  3EPH A;  1BB8 A;  1A1H A;  1A1K A;  2R1F A;  2EQ0 A;  2LV2 A;  1KJK A;  2EOZ A;  2EM2 A;  2ADR A;  2LT7 A;  2YTP A;  2RSI A;  2EMX A;  2YSO A;  2EE8 A;  2YTG A;  4FK5 C;  2ENH A;  1B69 A;  2EN2 A;  2MKN A;  5KL3 A;  2LO3 A;  2YSP A;  4R2S A;  2YU5 A;  2PRT A;  1UBD C;  4R2Q A;  2HGH A;  2CT1 A;  2EM4 A;  2EN6 A;  2EN7 A;  2EOY A;  2YTO A;  1A1F A;  2EOE A;  2ENC A;  1G2D C;  2EL5 A;  4F2J C;  3EPK A;  2EL6 A;  2EOX A;  4F6M A;  2RPC A;  2EM7 A;  1JK2 A;  3MHH C;  2EMB A;  2EOR A;  2EMG A;  2GLI A;  2EN3 A;  2EOQ A;  1JK1 A;  2DLK A;  4R2A A;  1A1L A;  2EM0 A;  2EOS A;  5KL7 A;  1TN9 A;  2YRK A;  1ZR9 A;  2DLQ A;  2YTI A;  1A1J A;  1TF3 A;  3EPL A;  2EPZ A;  2EQ1 A;  5KL5 A;  2EL4 A;  2I13 A;  2YTN A;  1RMD A;  5KL6 A;  2EN1 A;  4R2D A;  2YU8 A;  1Z1B A;  2WBT A;  2EMA A;  2EPC A;  1P47 A;  1YSA C;  1X6E A;  4M9V C;  1NCS A;  1X3C A;  2EM9 A;  1ZAA C;  2DRP A;  2EOJ A;  2ELZ A;  1X5W A;  1G2F C;  2EM6 A;  1ZU1 A;  4IJD A;  2M9A A;  2DGC A;  2YTE A;  2EOF A;  2J7J A;  4F6N A;  2MDG A;  2VRD A;  2YRM A;  2EQ3 A;  2EMI A;  2EOH A;  2EPP A;  3M99 B;  1UN6 B;  2NAB A;  4R2E A;  2A25 A;  1TF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...