2EM4A

Solution structure of the c2h2 type zinc finger (region 724-756) of human zinc finger protein 28 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGQRPYECIECGKAFKTKSSLICHRRSHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 28 homolog
publication title Solution structure of the C2H2 type zinc finger (region 724-756) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13912 zf-C2H2_6 C2H2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em4A01
2EP3A 2CTDA 2ELZA 2EPAA 2YRMA 1A1JA 1A1KA 2EE8A 2PRTA 1JK1A 2EMCA 2MKDA 4R2PA 2HGHA 2R1FA 2EOZA 1YUIA 2EL6A 2EMLA 2EOYA 1ZU1A 2MKNA 1P47A 2EMYA 2WBUA 2YSOA 4R2AA 2JP9A 4R2QA 1A1FA 4IJDA 1X3CA 2EORA 4F2JC 2A25A 1A1HA 2EOIA 4R2EA 4X9JA 2EL5A 1X6HA 2YTPA 2EMHA 1LLMC 2LO3A 2WBTA 1TF6A 2EPCA 2EM4A 2LV2A 1TF3A 4F6MA 2YTOA 1ZR9A 2ELYA 2DLKA 2EN8A 2YTGA 4M9VC 3VHTB 2LCEA 2LVHA 2YTDA 2E72A 2YTJA 2CT1A 1A1LA 1G2FC 1MEYC 2EPZA 2EMBA 2YTNA 1A1GA 2DLQA 2EPRA 2EN4A 2YU5A 2EMZA 2EL4A 2EMWA 2YRKA 3EPJA 3UK3C 2M9AA 1UN6B 2EM5A 2J7JA 5KL6A 2YTFA 2EMFA 2EQ1A 2EOSA 2NABA 4R2DA 1ZAAC 2DGCA 2GLIA 2EM9A 2GHFA 2EN6A 1RMDA 2EMGA 2ENCA 2EN7A 4R2SA 2EN1A 2EPUA 2ADRA 2EM3A 2EN3A 1TN9A 2EN2A 2EM6A 2RSIA 2YTQA 1DGCA 2VRDA 1BB8A 2YTIA 4WSGA 1JK2A 1AAYA 2YTEA 2EOJA 4FK5C 5KL3A 2EM7A 2EOOA 4IS1C 1B69A 2EMIA 3MHHC 2EPPA 3M99B 3MHSC 3EPLA 1KJKA 1Z1BA 2D9HA 2JPAA 4R2CA 1G2DC 2DMIA 1YSAC 1A1IA 2ENHA 2EMXA 4GZNC 2DRPA 2CSHA 2YRHA 4F6NA 1UBDC 2EPXA 1NCSA 2I13A 1WJPA 2WBSA 2EM2A 2YU8A 1X5WA 2EM8A 2EOQA 2LT7A 5KL2A 5KL7A 2EMAA 1F2IG 2MDGA 4R2RA 5KL4A 3EPKA 2EOMA 2EM0A 1YUJA 2BB8A 2EOEA 5KL5A 2EQ0A 2YSPA 2EQ3A 2EJ4A 3EPHA 1X6EA 2EMKA 2EOXA 2RPCA 1BBOA 2ENAA 1X6FA 2WCC3 2EOFA 2EOHA
chains in the Genus database with same CATH superfamily
1X47A 2CTDA 3ADGA 2JR1A 3BF2A 4WYQB 1N36E 1A1JA 1A1KA 2VE7C 4F9BB 2HHHE 2ODRD 2EOZA 2EMLA 3VK6A 4MLQA 2EOYA 4L8NA 4DR1E 3J81C 4ZYHA 2RS6A 2L2MA 4RHBB 4LF9E 4F2JC 2L92A 2V83A 4R2EA 4NZVA 2JOXA 4I8OA 2MC5A 2V88A 2EMHA 1N3GA 2H36X 2LO3A 2EPMX 2DSYA 1IBLE 2DB2A 2EM4A 1YYOA 2EWLA 1DI2A 2YTOA 4O43A 2YTGA 2M4IA 3VHTB 2LVHA 1HNWE 1G2FC 1FKAE 2V85A 2YTNA 4DV2E 1I94E 4LFBE 1XNQE 2BBGA 5A6KA 2EPRA 4DR3E 5A6AA 4BC7A 1UHZA 2EMZA 1YPNA 4DUYE 4JI4E 2EMFA 3ECRA 1YYKA 3IWCA 3BIDA 4JI0E 2NABA 3THNA 4JV5E 5IXMB 2EPLX 2EM9A 2GHFA 2EMGA 4M2ZA 2V86A 2RSIA 2EM6A 2VRDA 2B9DA 4NXNE 1N32E 4NHRA 3HPZA 3L00A 3H09A 3IWBA 5ADZA 4B3RE 3MHSC 1J26A 2GPIA 1KJKA 1EH8A 4ZYEA 2N3GA 4LFAE 2DMIA 2EPOA 2RTXA 5CFFE 2B7VA 2ENHA 2EMXA 1PKPA 5FLXC 5AC4A 4JI5E 4X65E 1WJPA 2WBSA 1YZ9A 2JYAA 4HEIA 2LT7A 5KL7A 1T4NA 5TSEA 3J7Yp 1X48A 1PJSA 2L8TA 1YUJA 4J8ZA 4JI1E 2VQFE 2EOEA 2RS7A 2NA2A 5LMNE 4KHPE 4LTYA 2YZTA 2YSPA 2R76A 2EQ3A 4HTGA 1X6EA 2EOXA 1BBOA 4R03A 4TUIA 4OOGC 2LBSB 2VF1A 2WZOA 4LFCE 2YTJA 2WCC3 2YWQA 2EOHA 3OMLA 2UUCE 1AH5A 2EPAA 1GTKA 2PRTA 5A69A 1X49A 2F8BA 4B3SE 4P78A 2L2NA 4MLVA 5IV8B 2KHXA 1ZU1A 2MKNA 3HTXA 3KZYA 2WBUA 4R2AA 3F6HA 4YHHE 1A1FA 4GEQB 2EORA 3LLHA 1A1HA 4X8WA 1SFEA 4KWYA 5LLQA 2EL5A 2JVAA 4DUZE 3BGHA 2JY9A 1O0WA 4X62E 2EPCA 1TF6A 4GKJE 1TF3A 4TUGA 1T39A 2MDRA 2LE2A 2N8XA 2ELYA 3C4TA 4M9VC 2LCEA 2RSMA 2K4VA 2EPNA 2CT1A 2JOBA 4WXDA 1MGTA 2DIXA 3JAMC 1A1GA 2LJUA 3T1YE 2NUEA 1PJQA 2DLQA 1YFHA 2EN4A 2YU5A 1BBGA 1IBKE 5AE2A 3EPJA 3KZZA 3UK3C 2B3TB 2LUPB 3DF6A 1UN6B 5KL6A 4DR2E 1HNZE 3EQ1A 2EQ1A 2DGCA 4R2DA 4JI7E 5AE3A 4O4KA 1RMDA 2FTXB 3P1XA 4LF7E 3FIGA 2EN2A 1TN9A 5F3WA 2HC5A 2YTQA 2UUAE 1BB8A 2V87A 4FK5C 2L3CA 5KL3A 2EM7A 4IS1C 4B3TE 3MHHC 5IT9C 3HPSA 1G2DC 2ZM6E 2N3HA 1N33E 4GZNC 4P7DA 2YRHA 4DV4E 3J80C 1UBDC 1NCSA 2LUQA 4DV1E 1X5WA 2EOQA 1QU6A 2UXCE 1YYWA 1WHQA 4WXCA 2EOMA 2EM0A 2KOUA 2YPNA 3RMPA 2EQ0A 2VQEE 2EJ4A 3EPHA 3MSWA 5BR8E 3C4BA 2EOFA 4Q28A 4DR5E 4DR4E 2YRMA 1JK1A 4F54A 4WFTA 5AC5A 1HNXE 2HJJA 2MKDA 4DKKA 2LMZA 4BBYA 4R2PA 2EPKX 2HGHA 3ADIA 2EL6A 2I9IA 5T6JA 4N4RB 1T4OA 3HXLA 4KZSA 2EMYA 2IHR1 2YSOA 3TQMA 2EZ6A 4R2QA 4IJDA 1X3CA 4X9JA 2M7QA 1XNRE 4BC9A 1LLMC 3K6QA 4M0VA 2E1MA 3C6MA 4F6MA 1IQOA 1ZR9A 2DLKA 5A6JA 2YTDA 2UUBE 4NXME 2ODRC 1MEYC 1A1LA 1KYQA 2KONA 5A6BD 4RH8A 4DV5E 5DNYA 1J5EE 2L33A 2YRKA 4R8OA 2M9AA 2EM5A 4JI8E 2YTFA 1RC7A 3AUZA 1ZAAC 2E5LE 4GKKE 4LF6E 1PDAA 2EN7A 2EN1A 2ADRA 2EN3A 2L2KB 1DGCA 1DQ3A 1JK2A 4WSPA 2YTEA 3THOB 1EKZA 2EOOA 2EMIA 2M1SA 5AE1A 2MC6A 1T4LB 4B3ME 4DR6E 3EPLA 4R2CA 3ADJA 1YSAC 1A1IA 4K0KE 2CSHA 2Q8UA 2I13A 5IWAE 4AQYE 1PJTA 3KWRA 2EM2A 4LF8E 5KL2A 2MDGA 2V8QB 2YT4A 4LF4E 3C6KA 2F4VE 2BB8A 2NUGA 3ADLA 5KL5A 4JYAE 2JXPA 4DV0E 4O24A 3IWDA 2EMKA 2ENAA 4BMJA 1WHNA 1X6FA 4BHBA 4ZYGA 4ZYDA 2EP3A 2JWOA 2FGGA 1SR9A 2ELZA 4O5GA 1IQSA 2RQLA 2EE8A 3LMLA 2L3JA 1IMUA 1T38A 2V89A 2L6MA 4F9AB 2EMCA 4DMIA 2R1FA 4L5NC 1YUIA 4BHCA 1P47A 4JI6E 2JP9A 1ZBQA 1EH6A 2A25A 2UXDE 2EOIA 1XMOE 1L4SA 2B7TA 1X6HA 2YTPA 3BBGA 3T1HE 4YY3E 4OX9E 2UXBE 3DJWA 2WBTA 1EH7A 4BCAA 2LV2A 5A2QC 3OTOE 3QG5C 2LTSA 1NEIA 5LMUE 1FJGE 2EN8A 2E72A 4WPYA 2EPZA 2EMBA 2LTRA 2K7IA 4LU9A 2EL4A 2EMWA 1UILA 2J7JA 4F9CB 1GQEA 1STUA 4JI2E 1QNTA 4DV6E 5LL6R 2NUFA 2EOSA 2GLIA 2EN6A 2ENCA 4X64E 3AV0A 4R2SA 2FV4B 2EPUA 4X66E 2EM3A 1ZBTA 2YTIA 4WSGA 2UU9E 3HQ1A 1AAYA 2EOJA 1GZ6A 2LJHA 1B69A 3VYXA 2LRSA 2EPPA 3M99B 3JU0A 1Z1BA 1WRJA 2D9HA 2JPAA 4DR7E 2CPNA 4WX9A 2DRPA 4F6NA 3F6GA 3ZOQB 2EPXA 4JI3E 1HR0E 2YU8A 2EM8A 4Q35B 4M30A 2EMAA 1XMQE 1N34E 4R2RA 1F2IG 5KL4A 3EPKA 3J7AG 4DV7E 1IBME 5AASA 4LF5E 4DV3E 3JTZA 1WXRA 2RPCA 1RQ0A 4BS9A 5A6BA 3VYYA 2G7HA 2DMYA
chains in the Genus database with same CATH topology
2EP3A 2CTDA 2ELZA 2EPAA 2YRMA 1A1JA 1A1KA 2EE8A 2PRTA 1JK1A 2EMCA 2MKDA 4R2PA 2HGHA 2R1FA 2EOZA 1YUIA 2EL6A 2EMLA 2EOYA 1ZU1A 2MKNA 1P47A 2EMYA 2WBUA 2YSOA 4R2AA 2JP9A 4R2QA 1A1FA 4IJDA 1X3CA 2EORA 4F2JC 2A25A 1A1HA 2EOIA 4R2EA 4X9JA 2EL5A 1X6HA 2YTPA 2EMHA 1LLMC 2LO3A 2WBTA 1TF6A 2EPCA 2EM4A 2LV2A 1TF3A 4F6MA 2YTOA 1ZR9A 2ELYA 2DLKA 2EN8A 2YTGA 4M9VC 3VHTB 2LCEA 2LVHA 2YTDA 2E72A 2YTJA 2CT1A 1A1LA 1G2FC 1MEYC 2EPZA 2EMBA 2YTNA 1A1GA 2DLQA 2EPRA 2EN4A 2YU5A 2EMZA 2EL4A 2EMWA 2YRKA 3EPJA 3UK3C 2M9AA 1UN6B 2EM5A 2J7JA 5KL6A 2YTFA 2EMFA 2EQ1A 2EOSA 2NABA 4R2DA 1ZAAC 2DGCA 2GLIA 2EM9A 2GHFA 2EN6A 1RMDA 2EMGA 2ENCA 2EN7A 4R2SA 2EN1A 2EPUA 2ADRA 2EM3A 2EN3A 1TN9A 2EN2A 2EM6A 2RSIA 2YTQA 1DGCA 2VRDA 1BB8A 2YTIA 4WSGA 1JK2A 1AAYA 2YTEA 2EOJA 4FK5C 5KL3A 2EM7A 2EOOA 4IS1C 1B69A 2EMIA 3MHHC 2EPPA 3M99B 3MHSC 3EPLA 1KJKA 1Z1BA 2D9HA 2JPAA 4R2CA 1G2DC 2DMIA 1YSAC 1A1IA 2ENHA 2EMXA 4GZNC 2DRPA 2CSHA 2YRHA 4F6NA 1UBDC 2EPXA 1NCSA 2I13A 1WJPA 2WBSA 2EM2A 2YU8A 1X5WA 2EM8A 2EOQA 2LT7A 5KL2A 5KL7A 2EMAA 1F2IG 2MDGA 4R2RA 5KL4A 3EPKA 2EOMA 2EM0A 1YUJA 2BB8A 2EOEA 5KL5A 2EQ0A 2YSPA 2EQ3A 2EJ4A 3EPHA 1X6EA 2EMKA 2EOXA 2RPCA 1BBOA 2ENAA 1X6FA 2WCC3 2EOFA 2EOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EP3 A;  2CTD A;  2ELZ A;  2EPA A;  2YRM A;  1A1J A;  1A1K A;  2EE8 A;  2PRT A;  1JK1 A;  2EMC A;  2MKD A;  4R2P A;  2HGH A;  2R1F A;  2EOZ A;  1YUI A;  2EL6 A;  2EML A;  2EOY A;  1ZU1 A;  2MKN A;  1P47 A;  2EMY A;  2WBU A;  2YSO A;  4R2A A;  2JP9 A;  4R2Q A;  1A1F A;  4IJD A;  1X3C A;  2EOR A;  4F2J C;  2A25 A;  1A1H A;  2EOI A;  4R2E A;  4X9J A;  2EL5 A;  1X6H A;  2YTP A;  2EMH A;  1LLM C;  2LO3 A;  2WBT A;  1TF6 A;  2EPC A;  2EM4 A;  2LV2 A;  1TF3 A;  4F6M A;  2YTO A;  1ZR9 A;  2ELY A;  2DLK A;  2EN8 A;  2YTG A;  4M9V C;  3VHT B;  2LCE A;  2LVH A;  2YTD A;  2E72 A;  2YTJ A;  2CT1 A;  1A1L A;  1G2F C;  1MEY C;  2EPZ A;  2EMB A;  2YTN A;  1A1G A;  2DLQ A;  2EPR A;  2EN4 A;  2YU5 A;  2EMZ A;  2EL4 A;  2EMW A;  2YRK A;  3EPJ A;  3UK3 C;  2M9A A;  1UN6 B;  2EM5 A;  2J7J A;  5KL6 A;  2YTF A;  2EMF A;  2EQ1 A;  2EOS A;  2NAB A;  4R2D A;  1ZAA C;  2DGC A;  2GLI A;  2EM9 A;  2GHF A;  2EN6 A;  1RMD A;  2EMG A;  2ENC A;  2EN7 A;  4R2S A;  2EN1 A;  2EPU A;  2ADR A;  2EM3 A;  2EN3 A;  1TN9 A;  2EN2 A;  2EM6 A;  2RSI A;  2YTQ A;  1DGC A;  2VRD A;  1BB8 A;  2YTI A;  4WSG A;  1JK2 A;  1AAY A;  2YTE A;  2EOJ A;  4FK5 C;  5KL3 A;  2EM7 A;  2EOO A;  4IS1 C;  1B69 A;  2EMI A;  3MHH C;  2EPP A;  3M99 B;  3MHS C;  3EPL A;  1KJK A;  1Z1B A;  2D9H A;  2JPA A;  4R2C A;  1G2D C;  2DMI A;  1YSA C;  1A1I A;  2ENH A;  2EMX A;  4GZN C;  2DRP A;  2CSH A;  2YRH A;  4F6N A;  1UBD C;  2EPX A;  1NCS A;  2I13 A;  1WJP A;  2WBS A;  2EM2 A;  2YU8 A;  1X5W A;  2EM8 A;  2EOQ A;  2LT7 A;  5KL2 A;  5KL7 A;  2EMA A;  1F2I G;  2MDG A;  4R2R A;  5KL4 A;  3EPK A;  2EOM A;  2EM0 A;  1YUJ A;  2BB8 A;  2EOE A;  5KL5 A;  2EQ0 A;  2YSP A;  2EQ3 A;  2EJ4 A;  3EPH A;  1X6E A;  2EMK A;  2EOX A;  2RPC A;  1BBO A;  2ENA A;  1X6F A;  2WCC 3;  2EOF A;  2EOH A; 
#chains in the Genus database with same CATH topology
 1X47 A;  2CTD A;  3ADG A;  2JR1 A;  3BF2 A;  4WYQ B;  1N36 E;  1A1J A;  1A1K A;  2VE7 C;  4F9B B;  2HHH E;  2ODR D;  2EOZ A;  2EML A;  3VK6 A;  4MLQ A;  2EOY A;  4L8N A;  4DR1 E;  3J81 C;  4ZYH A;  2RS6 A;  2L2M A;  4RHB B;  4LF9 E;  4F2J C;  2L92 A;  2V83 A;  4R2E A;  4NZV A;  2JOX A;  4I8O A;  2MC5 A;  2V88 A;  2EMH A;  1N3G A;  2H36 X;  2LO3 A;  2EPM X;  2DSY A;  1IBL E;  2DB2 A;  2EM4 A;  1YYO A;  2EWL A;  1DI2 A;  2YTO A;  4O43 A;  2YTG A;  2M4I A;  3VHT B;  2LVH A;  1HNW E;  1G2F C;  1FKA E;  2V85 A;  2YTN A;  4DV2 E;  1I94 E;  4LFB E;  1XNQ E;  2BBG A;  5A6K A;  2EPR A;  4DR3 E;  5A6A A;  4BC7 A;  1UHZ A;  2EMZ A;  1YPN A;  4DUY E;  4JI4 E;  2EMF A;  3ECR A;  1YYK A;  3IWC A;  3BID A;  4JI0 E;  2NAB A;  3THN A;  4JV5 E;  5IXM B;  2EPL X;  2EM9 A;  2GHF A;  2EMG A;  4M2Z A;  2V86 A;  2RSI A;  2EM6 A;  2VRD A;  2B9D A;  4NXN E;  1N32 E;  4NHR A;  3HPZ A;  3L00 A;  3H09 A;  3IWB A;  5ADZ A;  4B3R E;  3MHS C;  1J26 A;  2GPI A;  1KJK A;  1EH8 A;  4ZYE A;  2N3G A;  4LFA E;  2DMI A;  2EPO A;  2RTX A;  5CFF E;  2B7V A;  2ENH A;  2EMX A;  1PKP A;  5FLX C;  5AC4 A;  4JI5 E;  4X65 E;  1WJP A;  2WBS A;  1YZ9 A;  2JYA A;  4HEI A;  2LT7 A;  5KL7 A;  1T4N A;  5TSE A;  3J7Y p;  1X48 A;  1PJS A;  2L8T A;  1YUJ A;  4J8Z A;  4JI1 E;  2VQF E;  2EOE A;  2RS7 A;  2NA2 A;  5LMN E;  4KHP E;  4LTY A;  2YZT A;  2YSP A;  2R76 A;  2EQ3 A;  4HTG A;  1X6E A;  2EOX A;  1BBO A;  4R03 A;  4TUI A;  4OOG C;  2LBS B;  2VF1 A;  2WZO A;  4LFC E;  2YTJ A;  2WCC 3;  2YWQ A;  2EOH A;  3OML A;  2UUC E;  1AH5 A;  2EPA A;  1GTK A;  2PRT A;  5A69 A;  1X49 A;  2F8B A;  4B3S E;  4P78 A;  2L2N A;  4MLV A;  5IV8 B;  2KHX A;  1ZU1 A;  2MKN A;  3HTX A;  3KZY A;  2WBU A;  4R2A A;  3F6H A;  4YHH E;  1A1F A;  4GEQ B;  2EOR A;  3LLH A;  1A1H A;  4X8W A;  1SFE A;  4KWY A;  5LLQ A;  2EL5 A;  2JVA A;  4DUZ E;  3BGH A;  2JY9 A;  1O0W A;  4X62 E;  2EPC A;  1TF6 A;  4GKJ E;  1TF3 A;  4TUG A;  1T39 A;  2MDR A;  2LE2 A;  2N8X A;  2ELY A;  3C4T A;  4M9V C;  2LCE A;  2RSM A;  2K4V A;  2EPN A;  2CT1 A;  2JOB A;  4WXD A;  1MGT A;  2DIX A;  3JAM C;  1A1G A;  2LJU A;  3T1Y E;  2NUE A;  1PJQ A;  2DLQ A;  1YFH A;  2EN4 A;  2YU5 A;  1BBG A;  1IBK E;  5AE2 A;  3EPJ A;  3KZZ A;  3UK3 C;  2B3T B;  2LUP B;  3DF6 A;  1UN6 B;  5KL6 A;  4DR2 E;  1HNZ E;  3EQ1 A;  2EQ1 A;  2DGC A;  4R2D A;  4JI7 E;  5AE3 A;  4O4K A;  1RMD A;  2FTX B;  3P1X A;  4LF7 E;  3FIG A;  2EN2 A;  1TN9 A;  5F3W A;  2HC5 A;  2YTQ A;  2UUA E;  1BB8 A;  2V87 A;  4FK5 C;  2L3C A;  5KL3 A;  2EM7 A;  4IS1 C;  4B3T E;  3MHH C;  5IT9 C;  3HPS A;  1G2D C;  2ZM6 E;  2N3H A;  1N33 E;  4GZN C;  4P7D A;  2YRH A;  4DV4 E;  3J80 C;  1UBD C;  1NCS A;  2LUQ A;  4DV1 E;  1X5W A;  2EOQ A;  1QU6 A;  2UXC E;  1YYW A;  1WHQ A;  4WXC A;  2EOM A;  2EM0 A;  2KOU A;  2YPN A;  3RMP A;  2EQ0 A;  2VQE E;  2EJ4 A;  3EPH A;  3MSW A;  5BR8 E;  3C4B A;  2EOF A;  4Q28 A;  4DR5 E;  4DR4 E;  2YRM A;  1JK1 A;  4F54 A;  4WFT A;  5AC5 A;  1HNX E;  2HJJ A;  2MKD A;  4DKK A;  2LMZ A;  4BBY A;  4R2P A;  2EPK X;  2HGH A;  3ADI A;  2EL6 A;  2I9I A;  5T6J A;  4N4R B;  1T4O A;  3HXL A;  4KZS A;  2EMY A;  2IHR 1;  2YSO A;  3TQM A;  2EZ6 A;  4R2Q A;  4IJD A;  1X3C A;  4X9J A;  2M7Q A;  1XNR E;  4BC9 A;  1LLM C;  3K6Q A;  4M0V A;  2E1M A;  3C6M A;  4F6M A;  1IQO A;  1ZR9 A;  2DLK A;  5A6J A;  2YTD A;  2UUB E;  4NXM E;  2ODR C;  1MEY C;  1A1L A;  1KYQ A;  2KON A;  5A6B D;  4RH8 A;  4DV5 E;  5DNY A;  1J5E E;  2L33 A;  2YRK A;  4R8O A;  2M9A A;  2EM5 A;  4JI8 E;  2YTF A;  1RC7 A;  3AUZ A;  1ZAA C;  2E5L E;  4GKK E;  4LF6 E;  1PDA A;  2EN7 A;  2EN1 A;  2ADR A;  2EN3 A;  2L2K B;  1DGC A;  1DQ3 A;  1JK2 A;  4WSP A;  2YTE A;  3THO B;  1EKZ A;  2EOO A;  2EMI A;  2M1S A;  5AE1 A;  2MC6 A;  1T4L B;  4B3M E;  4DR6 E;  3EPL A;  4R2C A;  3ADJ A;  1YSA C;  1A1I A;  4K0K E;  2CSH A;  2Q8U A;  2I13 A;  5IWA E;  4AQY E;  1PJT A;  3KWR A;  2EM2 A;  4LF8 E;  5KL2 A;  2MDG A;  2V8Q B;  2YT4 A;  4LF4 E;  3C6K A;  2F4V E;  2BB8 A;  2NUG A;  3ADL A;  5KL5 A;  4JYA E;  2JXP A;  4DV0 E;  4O24 A;  3IWD A;  2EMK A;  2ENA A;  4BMJ A;  1WHN A;  1X6F A;  4BHB A;  4ZYG A;  4ZYD A;  2EP3 A;  2JWO A;  2FGG A;  1SR9 A;  2ELZ A;  4O5G A;  1IQS A;  2RQL A;  2EE8 A;  3LML A;  2L3J A;  1IMU A;  1T38 A;  2V89 A;  2L6M A;  4F9A B;  2EMC A;  4DMI A;  2R1F A;  4L5N C;  1YUI A;  4BHC A;  1P47 A;  4JI6 E;  2JP9 A;  1ZBQ A;  1EH6 A;  2A25 A;  2UXD E;  2EOI A;  1XMO E;  1L4S A;  2B7T A;  1X6H A;  2YTP A;  3BBG A;  3T1H E;  4YY3 E;  4OX9 E;  2UXB E;  3DJW A;  2WBT A;  1EH7 A;  4BCA A;  2LV2 A;  5A2Q C;  3OTO E;  3QG5 C;  2LTS A;  1NEI A;  5LMU E;  1FJG E;  2EN8 A;  2E72 A;  4WPY A;  2EPZ A;  2EMB A;  2LTR A;  2K7I A;  4LU9 A;  2EL4 A;  2EMW A;  1UIL A;  2J7J A;  4F9C B;  1GQE A;  1STU A;  4JI2 E;  1QNT A;  4DV6 E;  5LL6 R;  2NUF A;  2EOS A;  2GLI A;  2EN6 A;  2ENC A;  4X64 E;  3AV0 A;  4R2S A;  2FV4 B;  2EPU A;  4X66 E;  2EM3 A;  1ZBT A;  2YTI A;  4WSG A;  2UU9 E;  3HQ1 A;  1AAY A;  2EOJ A;  1GZ6 A;  2LJH A;  1B69 A;  3VYX A;  2LRS A;  2EPP A;  3M99 B;  3JU0 A;  1Z1B A;  1WRJ A;  2D9H A;  2JPA A;  4DR7 E;  2CPN A;  4WX9 A;  2DRP A;  4F6N A;  3F6G A;  3ZOQ B;  2EPX A;  4JI3 E;  1HR0 E;  2YU8 A;  2EM8 A;  4Q35 B;  4M30 A;  2EMA A;  1XMQ E;  1N34 E;  4R2R A;  1F2I G;  5KL4 A;  3EPK A;  3J7A G;  4DV7 E;  1IBM E;  5AAS A;  4LF5 E;  4DV3 E;  3JTZ A;  1WXR A;  2RPC A;  1RQ0 A;  4BS9 A;  5A6B A;  3VYY A;  2G7H A;  2DMY A; 
#chains in the Genus database with same CATH homology
 2EP3 A;  2CTD A;  2ELZ A;  2EPA A;  2YRM A;  1A1J A;  1A1K A;  2EE8 A;  2PRT A;  1JK1 A;  2EMC A;  2MKD A;  4R2P A;  2HGH A;  2R1F A;  2EOZ A;  1YUI A;  2EL6 A;  2EML A;  2EOY A;  1ZU1 A;  2MKN A;  1P47 A;  2EMY A;  2WBU A;  2YSO A;  4R2A A;  2JP9 A;  4R2Q A;  1A1F A;  4IJD A;  1X3C A;  2EOR A;  4F2J C;  2A25 A;  1A1H A;  2EOI A;  4R2E A;  4X9J A;  2EL5 A;  1X6H A;  2YTP A;  2EMH A;  1LLM C;  2LO3 A;  2WBT A;  1TF6 A;  2EPC A;  2EM4 A;  2LV2 A;  1TF3 A;  4F6M A;  2YTO A;  1ZR9 A;  2ELY A;  2DLK A;  2EN8 A;  2YTG A;  4M9V C;  3VHT B;  2LCE A;  2LVH A;  2YTD A;  2E72 A;  2YTJ A;  2CT1 A;  1A1L A;  1G2F C;  1MEY C;  2EPZ A;  2EMB A;  2YTN A;  1A1G A;  2DLQ A;  2EPR A;  2EN4 A;  2YU5 A;  2EMZ A;  2EL4 A;  2EMW A;  2YRK A;  3EPJ A;  3UK3 C;  2M9A A;  1UN6 B;  2EM5 A;  2J7J A;  5KL6 A;  2YTF A;  2EMF A;  2EQ1 A;  2EOS A;  2NAB A;  4R2D A;  1ZAA C;  2DGC A;  2GLI A;  2EM9 A;  2GHF A;  2EN6 A;  1RMD A;  2EMG A;  2ENC A;  2EN7 A;  4R2S A;  2EN1 A;  2EPU A;  2ADR A;  2EM3 A;  2EN3 A;  1TN9 A;  2EN2 A;  2EM6 A;  2RSI A;  2YTQ A;  1DGC A;  2VRD A;  1BB8 A;  2YTI A;  4WSG A;  1JK2 A;  1AAY A;  2YTE A;  2EOJ A;  4FK5 C;  5KL3 A;  2EM7 A;  2EOO A;  4IS1 C;  1B69 A;  2EMI A;  3MHH C;  2EPP A;  3M99 B;  3MHS C;  3EPL A;  1KJK A;  1Z1B A;  2D9H A;  2JPA A;  4R2C A;  1G2D C;  2DMI A;  1YSA C;  1A1I A;  2ENH A;  2EMX A;  4GZN C;  2DRP A;  2CSH A;  2YRH A;  4F6N A;  1UBD C;  2EPX A;  1NCS A;  2I13 A;  1WJP A;  2WBS A;  2EM2 A;  2YU8 A;  1X5W A;  2EM8 A;  2EOQ A;  2LT7 A;  5KL2 A;  5KL7 A;  2EMA A;  1F2I G;  2MDG A;  4R2R A;  5KL4 A;  3EPK A;  2EOM A;  2EM0 A;  1YUJ A;  2BB8 A;  2EOE A;  5KL5 A;  2EQ0 A;  2YSP A;  2EQ3 A;  2EJ4 A;  3EPH A;  1X6E A;  2EMK A;  2EOX A;  2RPC A;  1BBO A;  2ENA A;  1X6F A;  2WCC 3;  2EOF A;  2EOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...