2EM8A

Solution structure of the c2h2 type zinc finger (region 423-455) of human zinc finger protein 224
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKPYKCVECGKGYKRRLDLDFHQRVHTGEKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 423-455) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em8A01
2EN6A 2ELZA 2CSHA 2YTEA 4M9VC 2WBTA 1RMDA 1NCSA 2EM6A 2EMFA 2EOMA 3MHSC 2YRHA 2JPAA 4F2JC 4R2CA 1YUIA 2YRMA 2EMZA 2JP9A 5KL5A 1G2FC 5KL4A 2DGCA 2EMCA 2EM5A 4IJDA 2EPXA 4R2QA 1X3CA 3EPLA 1ZU1A 2EE8A 1LLMC 2RPCA 1A1LA 2YSOA 2EOSA 2EOHA 4F6MA 2MKNA 2ENCA 2PRTA 2GHFA 2EPRA 2MDGA 2EN4A 1X6EA 2EOXA 2EOYA 2EQ1A 2RSIA 4GZNC 1ZR9A 4FK5C 1YUJA 2J7JA 2YU5A 2ENAA 3EPHA 2EM2A 3EPJA 2ENHA 1A1HA 5KL2A 2EQ3A 3VHTB 2LV2A 2EMLA 4WSGA 1WJPA 2EN3A 2YTFA 1A1FA 2EMYA 2YTQA 3MHHC 2EPUA 2YTGA 1A1GA 2EN7A 4R2SA 4IS1C 5KL6A 2YU8A 2EOZA 1Z1BA 1TF3A 2YTPA 1X5WA 1AAYA 1B69A 1YSAC 1MEYC 2E72A 1A1JA 2EN2A 2EQ0A 2YTIA 2EM3A 1UN6B 1TF6A 2GLIA 4R2AA 1BBOA 2DLKA 1A1IA 2EN8A 2EOJA 3M99B 2R1FA 1G2DC 2EL4A 1UBDC 2YSPA 5KL3A 2EOQA 2EOOA 2EPCA 2EORA 2YTOA 2EMKA 4F6NA 2EPPA 3UK3C 2EOFA 2NABA 2YTJA 2YTNA 2EL6A 4R2RA 2CTDA 5KL7A 2I13A 2EMXA 2YTDA 2EMBA 2EMHA 4R2DA 2DLQA 2EL5A 2EN1A 2A25A 2EMIA 2VRDA 2EM4A 2EPZA 1BB8A 2MKDA 1P47A 2EMWA 2LVHA 2EOEA 2EJ4A 2DRPA 2WCC3 2EM8A 3EPKA 4R2EA 1ZAAC 2EM0A 2LCEA 2EM7A 2CT1A 4R2PA 2LT7A 1F2IG 2YRKA 1JK1A 1DGCA 2WBSA 4X9JA 1JK2A 2EOIA 2ADRA 1X6HA 1X6FA 2D9HA 2LO3A 1TN9A 2EMAA 2EP3A 2HGHA 2EPAA 1KJKA 2BB8A 2M9AA 2EMGA 2DMIA 2WBUA 1A1KA 2EM9A 2ELYA
chains in the Genus database with same CATH superfamily
3RMPA 4JI3E 2ELZA 4BHCA 2CSHA 2YTEA 4M9VC 1FKAE 4DMIA 1NCSA 3VYYA 4F2JC 3JAMC 2LTSA 2LUPB 4BBYA 2B7VA 3KWRA 2V85A 2M7QA 5KL5A 2DGCA 3BBGA 4DR4E 2EM5A 2L2KB 1X3CA 4X62E 2RPCA 1FJGE 1J5EE 2ODRC 2EWLA 2MKNA 1O0WA 1UHZA 2MDGA 3C4TA 1EKZA 3JU0A 5F3WA 5AE1A 2EOXA 2EQ1A 2RSIA 4GZNC 1T4OA 4N4RB 1YUJA 2ENAA 2LUQA 1PDAA 1YYWA 2K7IA 3VHTB 3LLHA 1WJPA 1T38A 2EN3A 2YWQA 2YTFA 4JYAE 2E5LE 2UUBE 2YTGA 4M2ZA 2EOZA 1B69A 4WFTA 2L2MA 2IHR1 2UUCE 2YTIA 1UN6B 4DV5E 2WZOA 3EQ1A 4ZYEA 3HQ1A 4B3SE 4KWYA 1L4SA 2YTOA 5LLQA 4F6NA 1X49A 1EH7A 2NABA 3ECRA 2DSYA 2KONA 2V8QB 1XMOE 2B7TA 3ADIA 2CTDA 5KL7A 4DV3E 1YZ9A 2I13A 2DIXA 2KOUA 2EMXA 1HNXE 4DV0E 2EMHA 1WXRA 3L00A 2YPNA 2A25A 4WXCA 2EM4A 2EPOA 1P47A 2EOEA 1XNRE 3KZYA 3EPKA 2EM0A 5A6BA 2LTRA 2CPNA 4DV2E 2UXDE 2EOIA 2EPLX 5LL6R 4LFBE 3H09A 4LU9A 5IXMB 2EP3A 1N3GA 2EMGA 2ELYA 1RC7A 4DV1E 4BHBA 1N33E 4JV5E 2WBTA 1RMDA 4Q28A 2EM6A 2EMFA 3MHSC 2M4IA 4DR3E 4LFCE 1J26A 1G2FC 2L3CA 4JI8E 4DR6E 2YZTA 1IBLE 4IJDA 1IQOA 1PKPA 4DV4E 5T6JA 2YSOA 4BS9A 5IWAE 5A69A 2FGGA 2ENCA 2EPRA 2UU9E 4LF7E 2EN4A 1PJTA 2RS6A 2EOYA 4O43A 4WPYA 5AC5A 2J7JA 3ZOQB 3MSWA 1QU6A 1A1HA 4MLQA 4F9BB 4JI4E 3JTZA 2V83A 3KZZA 2YTQA 3MHHC 2LE2A 1A1GA 1PJQA 2EN7A 4IS1C 4GKKE 4B3ME 2RTXA 1AAYA 4DKKA 4DV6E 1MEYC 3HXLA 2LJHA 1TF6A 2HHHE 4DR2E 1BBOA 5ADZA 2M1SA 2EOJA 2RSMA 2R1FA 2V88A 1G2DC 2EL4A 2EPKX 2VE7C 2YSPA 4L8NA 5A6BD 5KL3A 3QG5C 1RQ0A 3HPSA 2EPPA 2UXCE 1PJSA 1XNQE 3IWBA 2YTJA 1BBGA 1WHQA 4GEQB 3J7AG 2DMYA 3HTXA 3T1HE 2YTDA 4R2DA 2JYAA 2DLQA 5IT9C 1GTKA 4J8ZA 2VRDA 2NUGA 2EPZA 4KHPE 2I9IA 2RQLA 2EJ4A 2DRPA 2WCC3 2YT4A 3AUZA 2CT1A 3BF2A 2LT7A 1IMUA 1F2IG 4NXME 2YRKA 1DI2A 4HTGA 2MC5A 4M30A 2NUFA 3TQMA 4JI1E 1YYOA 1X6HA 2D9HA 2LO3A 5BR8E 2EMAA 4M0VA 1KJKA 1NEIA 2BB8A 5AC4A 2DMIA 5A2QC 1T4NA 5A6KA 4L5NC 1A1KA 1HR0E 4P7DA 3ADJA 4MLVA 4LF8E 2LJUA 4K0KE 2UXBE 1IBME 1IQSA 3OTOE 2Q8UA 1HNWE 2YRHA 4R2CA 1WRJA 4X64E 2JP9A 4JI5E 2L6MA 4WSPA 2EMCA 2MDRA 2EPXA 3EPLA 1LLMC 3OMLA 1A1LA 2JXPA 3IWCA 2EOSA 2EOHA 4F6MA 2PRTA 2GHFA 2ZM6E 2EPMX 2F4VE 1X6EA 2E1MA 2F8BA 1I94E 4F9AB 1YPNA 1ZR9A 4FK5C 4P78A 4JI2E 1HNZE 3EPJA 3F6GA 5KL2A 2DB2A 2JOBA 2LV2A 4WSGA 2JWOA 1YFHA 1A1FA 5AASA 1XMQE 2EPUA 4GKJE 4R2SA 2YU8A 2K4VA 1TF3A 4NHRA 5TSEA 2NUEA 4LFAE 4Q35B 1ZBQA 4DUZE 2V86A 2L33A 4OX9E 2LRSA 2E72A 4BMJA 2EN2A 3C6MA 5CFFE 4AQYE 2V89A 4ZYGA 2DLKA 4BC9A 2L8TA 2FTXB 1A1IA 2ODRD 1N36E 2LMZA 1EH6A 4HEIA 4OOGC 1N34E 2EPCA 2EOOA 2EORA 1YYKA 3VYXA 2EMKA 4O4KA 3UK3C 2EOFA 2VF1A 4LF6E 1WHNA 1UILA 2EMBA 4F54A 2EL5A 2H36X 2G7HA 1AH5A 2VQEE 2MKDA 4LF5E 2LVHA 3DJWA 1ZAAC 2EM8A 2EM7A 3DF6A 2RS7A 4O24A 1JK1A 1DGCA 4R03A 2L92A 2VQFE 4I8OA 4X9JA 1KYQA 1JK2A 1X47A 1IBKE 2ADRA 1X6FA 2JOXA 2B3TB 2M9AA 2KHXA 4BCAA 2HJJA 2EN6A 5A6JA 3K6QA 4DR5E 2JVAA 4O5GA 4NXNE 2EOMA 2JPAA 4YY3E 1YUIA 2YRMA 2EMZA 5AE3A 3ADGA 2MC6A 5KL4A 4JI6E 4DR1E 3BGHA 2L2NA 3C4BA 4R2QA 1ZU1A 2EE8A 3J80C 3AV0A 1SR9A 3HPZA 4KZSA 1MGTA 4TUGA 5DNYA 2UUAE 2FV4B 3IWDA 4ZYHA 4X66E 4YHHE 5FLXC 4DUYE 2EZ6A 4LF4E 4WX9A 2EPNA 4X65E 4DV7E 2YU5A 4JI7E 3EPHA 3ADLA 2EM2A 2B9DA 4F9CB 3T1YE 2ENHA 3LMLA 2EQ3A 4NZVA 2N8XA 1SFEA 2EMLA 1X48A 3P1XA 1GZ6A 4DR7E 4X8WA 2EMYA 4B3RE 4ZYDA 2BBGA 3THOB 5KL6A 4JI0E 1Z1BA 2YTPA 1X5WA 5IV8B 1YSAC 3J7Yp 1A1JA 3VK6A 2EQ0A 1DQ3A 4WYQB 5LMUE 2EM3A 2GPIA 2JR1A 4LTYA 2GLIA 4R2AA 2LBSB 4LF9E 5AE2A 2EN8A 3M99B 4B3TE 1UBDC 2EOQA 3BIDA 4RHBB 2YTNA 2EL6A 4R2RA 1STUA 3FIGA 1T39A 3J81C 4TUIA 1T4LB 4BC7A 2L3JA 2EN1A 4WXDA 1GQEA 4RH8A 2EMIA 2HC5A 1BB8A 2N3HA 2R76A 1QNTA 2EMWA 2JY9A 4R2EA 4R2PA 2LCEA 3C6KA 3THNA 3F6HA 1ZBTA 1N32E 2WBSA 5A6AA 5LMNE 2NA2A 2N3GA 4R8OA 1TN9A 2HGHA 2EPAA 2V87A 2WBUA 1EH8A 2EM9A
chains in the Genus database with same CATH topology
2EN6A 2ELZA 2CSHA 2YTEA 4M9VC 2WBTA 1RMDA 1NCSA 2EM6A 2EMFA 2EOMA 3MHSC 2YRHA 2JPAA 4F2JC 4R2CA 1YUIA 2YRMA 2EMZA 2JP9A 5KL5A 1G2FC 5KL4A 2DGCA 2EMCA 2EM5A 4IJDA 2EPXA 4R2QA 1X3CA 3EPLA 1ZU1A 2EE8A 1LLMC 2RPCA 1A1LA 2YSOA 2EOSA 2EOHA 4F6MA 2MKNA 2ENCA 2PRTA 2GHFA 2EPRA 2MDGA 2EN4A 1X6EA 2EOXA 2EOYA 2EQ1A 2RSIA 4GZNC 1ZR9A 4FK5C 1YUJA 2J7JA 2YU5A 2ENAA 3EPHA 2EM2A 3EPJA 2ENHA 1A1HA 5KL2A 2EQ3A 3VHTB 2LV2A 2EMLA 4WSGA 1WJPA 2EN3A 2YTFA 1A1FA 2EMYA 2YTQA 3MHHC 2EPUA 2YTGA 1A1GA 2EN7A 4R2SA 4IS1C 5KL6A 2YU8A 2EOZA 1Z1BA 1TF3A 2YTPA 1X5WA 1AAYA 1B69A 1YSAC 1MEYC 2E72A 1A1JA 2EN2A 2EQ0A 2YTIA 2EM3A 1UN6B 1TF6A 2GLIA 4R2AA 1BBOA 2DLKA 1A1IA 2EN8A 2EOJA 3M99B 2R1FA 1G2DC 2EL4A 1UBDC 2YSPA 5KL3A 2EOQA 2EOOA 2EPCA 2EORA 2YTOA 2EMKA 4F6NA 2EPPA 3UK3C 2EOFA 2NABA 2YTJA 2YTNA 2EL6A 4R2RA 2CTDA 5KL7A 2I13A 2EMXA 2YTDA 2EMBA 2EMHA 4R2DA 2DLQA 2EL5A 2EN1A 2A25A 2EMIA 2VRDA 2EM4A 2EPZA 1BB8A 2MKDA 1P47A 2EMWA 2LVHA 2EOEA 2EJ4A 2DRPA 2WCC3 2EM8A 3EPKA 4R2EA 1ZAAC 2EM0A 2LCEA 2EM7A 2CT1A 4R2PA 2LT7A 1F2IG 2YRKA 1JK1A 1DGCA 2WBSA 4X9JA 1JK2A 2EOIA 2ADRA 1X6HA 1X6FA 2D9HA 2LO3A 1TN9A 2EMAA 2EP3A 2HGHA 2EPAA 1KJKA 2BB8A 2M9AA 2EMGA 2DMIA 2WBUA 1A1KA 2EM9A 2ELYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EN6 A;  2ELZ A;  2CSH A;  2YTE A;  4M9V C;  2WBT A;  1RMD A;  1NCS A;  2EM6 A;  2EMF A;  2EOM A;  3MHS C;  2YRH A;  2JPA A;  4F2J C;  4R2C A;  1YUI A;  2YRM A;  2EMZ A;  2JP9 A;  5KL5 A;  1G2F C;  5KL4 A;  2DGC A;  2EMC A;  2EM5 A;  4IJD A;  2EPX A;  4R2Q A;  1X3C A;  3EPL A;  1ZU1 A;  2EE8 A;  1LLM C;  2RPC A;  1A1L A;  2YSO A;  2EOS A;  2EOH A;  4F6M A;  2MKN A;  2ENC A;  2PRT A;  2GHF A;  2EPR A;  2MDG A;  2EN4 A;  1X6E A;  2EOX A;  2EOY A;  2EQ1 A;  2RSI A;  4GZN C;  1ZR9 A;  4FK5 C;  1YUJ A;  2J7J A;  2YU5 A;  2ENA A;  3EPH A;  2EM2 A;  3EPJ A;  2ENH A;  1A1H A;  5KL2 A;  2EQ3 A;  3VHT B;  2LV2 A;  2EML A;  4WSG A;  1WJP A;  2EN3 A;  2YTF A;  1A1F A;  2EMY A;  2YTQ A;  3MHH C;  2EPU A;  2YTG A;  1A1G A;  2EN7 A;  4R2S A;  4IS1 C;  5KL6 A;  2YU8 A;  2EOZ A;  1Z1B A;  1TF3 A;  2YTP A;  1X5W A;  1AAY A;  1B69 A;  1YSA C;  1MEY C;  2E72 A;  1A1J A;  2EN2 A;  2EQ0 A;  2YTI A;  2EM3 A;  1UN6 B;  1TF6 A;  2GLI A;  4R2A A;  1BBO A;  2DLK A;  1A1I A;  2EN8 A;  2EOJ A;  3M99 B;  2R1F A;  1G2D C;  2EL4 A;  1UBD C;  2YSP A;  5KL3 A;  2EOQ A;  2EOO A;  2EPC A;  2EOR A;  2YTO A;  2EMK A;  4F6N A;  2EPP A;  3UK3 C;  2EOF A;  2NAB A;  2YTJ A;  2YTN A;  2EL6 A;  4R2R A;  2CTD A;  5KL7 A;  2I13 A;  2EMX A;  2YTD A;  2EMB A;  2EMH A;  4R2D A;  2DLQ A;  2EL5 A;  2EN1 A;  2A25 A;  2EMI A;  2VRD A;  2EM4 A;  2EPZ A;  1BB8 A;  2MKD A;  1P47 A;  2EMW A;  2LVH A;  2EOE A;  2EJ4 A;  2DRP A;  2WCC 3;  2EM8 A;  3EPK A;  4R2E A;  1ZAA C;  2EM0 A;  2LCE A;  2EM7 A;  2CT1 A;  4R2P A;  2LT7 A;  1F2I G;  2YRK A;  1JK1 A;  1DGC A;  2WBS A;  4X9J A;  1JK2 A;  2EOI A;  2ADR A;  1X6H A;  1X6F A;  2D9H A;  2LO3 A;  1TN9 A;  2EMA A;  2EP3 A;  2HGH A;  2EPA A;  1KJK A;  2BB8 A;  2M9A A;  2EMG A;  2DMI A;  2WBU A;  1A1K A;  2EM9 A;  2ELY A; 
#chains in the Genus database with same CATH topology
 3RMP A;  4JI3 E;  2ELZ A;  4BHC A;  2CSH A;  2YTE A;  4M9V C;  1FKA E;  4DMI A;  1NCS A;  3VYY A;  4F2J C;  3JAM C;  2LTS A;  2LUP B;  4BBY A;  2B7V A;  3KWR A;  2V85 A;  2M7Q A;  5KL5 A;  2DGC A;  3BBG A;  4DR4 E;  2EM5 A;  2L2K B;  1X3C A;  4X62 E;  2RPC A;  1FJG E;  1J5E E;  2ODR C;  2EWL A;  2MKN A;  1O0W A;  1UHZ A;  2MDG A;  3C4T A;  1EKZ A;  3JU0 A;  5F3W A;  5AE1 A;  2EOX A;  2EQ1 A;  2RSI A;  4GZN C;  1T4O A;  4N4R B;  1YUJ A;  2ENA A;  2LUQ A;  1PDA A;  1YYW A;  2K7I A;  3VHT B;  3LLH A;  1WJP A;  1T38 A;  2EN3 A;  2YWQ A;  2YTF A;  4JYA E;  2E5L E;  2UUB E;  2YTG A;  4M2Z A;  2EOZ A;  1B69 A;  4WFT A;  2L2M A;  2IHR 1;  2UUC E;  2YTI A;  1UN6 B;  4DV5 E;  2WZO A;  3EQ1 A;  4ZYE A;  3HQ1 A;  4B3S E;  4KWY A;  1L4S A;  2YTO A;  5LLQ A;  4F6N A;  1X49 A;  1EH7 A;  2NAB A;  3ECR A;  2DSY A;  2KON A;  2V8Q B;  1XMO E;  2B7T A;  3ADI A;  2CTD A;  5KL7 A;  4DV3 E;  1YZ9 A;  2I13 A;  2DIX A;  2KOU A;  2EMX A;  1HNX E;  4DV0 E;  2EMH A;  1WXR A;  3L00 A;  2YPN A;  2A25 A;  4WXC A;  2EM4 A;  2EPO A;  1P47 A;  2EOE A;  1XNR E;  3KZY A;  3EPK A;  2EM0 A;  5A6B A;  2LTR A;  2CPN A;  4DV2 E;  2UXD E;  2EOI A;  2EPL X;  5LL6 R;  4LFB E;  3H09 A;  4LU9 A;  5IXM B;  2EP3 A;  1N3G A;  2EMG A;  2ELY A;  1RC7 A;  4DV1 E;  4BHB A;  1N33 E;  4JV5 E;  2WBT A;  1RMD A;  4Q28 A;  2EM6 A;  2EMF A;  3MHS C;  2M4I A;  4DR3 E;  4LFC E;  1J26 A;  1G2F C;  2L3C A;  4JI8 E;  4DR6 E;  2YZT A;  1IBL E;  4IJD A;  1IQO A;  1PKP A;  4DV4 E;  5T6J A;  2YSO A;  4BS9 A;  5IWA E;  5A69 A;  2FGG A;  2ENC A;  2EPR A;  2UU9 E;  4LF7 E;  2EN4 A;  1PJT A;  2RS6 A;  2EOY A;  4O43 A;  4WPY A;  5AC5 A;  2J7J A;  3ZOQ B;  3MSW A;  1QU6 A;  1A1H A;  4MLQ A;  4F9B B;  4JI4 E;  3JTZ A;  2V83 A;  3KZZ A;  2YTQ A;  3MHH C;  2LE2 A;  1A1G A;  1PJQ A;  2EN7 A;  4IS1 C;  4GKK E;  4B3M E;  2RTX A;  1AAY A;  4DKK A;  4DV6 E;  1MEY C;  3HXL A;  2LJH A;  1TF6 A;  2HHH E;  4DR2 E;  1BBO A;  5ADZ A;  2M1S A;  2EOJ A;  2RSM A;  2R1F A;  2V88 A;  1G2D C;  2EL4 A;  2EPK X;  2VE7 C;  2YSP A;  4L8N A;  5A6B D;  5KL3 A;  3QG5 C;  1RQ0 A;  3HPS A;  2EPP A;  2UXC E;  1PJS A;  1XNQ E;  3IWB A;  2YTJ A;  1BBG A;  1WHQ A;  4GEQ B;  3J7A G;  2DMY A;  3HTX A;  3T1H E;  2YTD A;  4R2D A;  2JYA A;  2DLQ A;  5IT9 C;  1GTK A;  4J8Z A;  2VRD A;  2NUG A;  2EPZ A;  4KHP E;  2I9I A;  2RQL A;  2EJ4 A;  2DRP A;  2WCC 3;  2YT4 A;  3AUZ A;  2CT1 A;  3BF2 A;  2LT7 A;  1IMU A;  1F2I G;  4NXM E;  2YRK A;  1DI2 A;  4HTG A;  2MC5 A;  4M30 A;  2NUF A;  3TQM A;  4JI1 E;  1YYO A;  1X6H A;  2D9H A;  2LO3 A;  5BR8 E;  2EMA A;  4M0V A;  1KJK A;  1NEI A;  2BB8 A;  5AC4 A;  2DMI A;  5A2Q C;  1T4N A;  5A6K A;  4L5N C;  1A1K A;  1HR0 E;  4P7D A;  3ADJ A;  4MLV A;  4LF8 E;  2LJU A;  4K0K E;  2UXB E;  1IBM E;  1IQS A;  3OTO E;  2Q8U A;  1HNW E;  2YRH A;  4R2C A;  1WRJ A;  4X64 E;  2JP9 A;  4JI5 E;  2L6M A;  4WSP A;  2EMC A;  2MDR A;  2EPX A;  3EPL A;  1LLM C;  3OML A;  1A1L A;  2JXP A;  3IWC A;  2EOS A;  2EOH A;  4F6M A;  2PRT A;  2GHF A;  2ZM6 E;  2EPM X;  2F4V E;  1X6E A;  2E1M A;  2F8B A;  1I94 E;  4F9A B;  1YPN A;  1ZR9 A;  4FK5 C;  4P78 A;  4JI2 E;  1HNZ E;  3EPJ A;  3F6G A;  5KL2 A;  2DB2 A;  2JOB A;  2LV2 A;  4WSG A;  2JWO A;  1YFH A;  1A1F A;  5AAS A;  1XMQ E;  2EPU A;  4GKJ E;  4R2S A;  2YU8 A;  2K4V A;  1TF3 A;  4NHR A;  5TSE A;  2NUE A;  4LFA E;  4Q35 B;  1ZBQ A;  4DUZ E;  2V86 A;  2L33 A;  4OX9 E;  2LRS A;  2E72 A;  4BMJ A;  2EN2 A;  3C6M A;  5CFF E;  4AQY E;  2V89 A;  4ZYG A;  2DLK A;  4BC9 A;  2L8T A;  2FTX B;  1A1I A;  2ODR D;  1N36 E;  2LMZ A;  1EH6 A;  4HEI A;  4OOG C;  1N34 E;  2EPC A;  2EOO A;  2EOR A;  1YYK A;  3VYX A;  2EMK A;  4O4K A;  3UK3 C;  2EOF A;  2VF1 A;  4LF6 E;  1WHN A;  1UIL A;  2EMB A;  4F54 A;  2EL5 A;  2H36 X;  2G7H A;  1AH5 A;  2VQE E;  2MKD A;  4LF5 E;  2LVH A;  3DJW A;  1ZAA C;  2EM8 A;  2EM7 A;  3DF6 A;  2RS7 A;  4O24 A;  1JK1 A;  1DGC A;  4R03 A;  2L92 A;  2VQF E;  4I8O A;  4X9J A;  1KYQ A;  1JK2 A;  1X47 A;  1IBK E;  2ADR A;  1X6F A;  2JOX A;  2B3T B;  2M9A A;  2KHX A;  4BCA A;  2HJJ A;  2EN6 A;  5A6J A;  3K6Q A;  4DR5 E;  2JVA A;  4O5G A;  4NXN E;  2EOM A;  2JPA A;  4YY3 E;  1YUI A;  2YRM A;  2EMZ A;  5AE3 A;  3ADG A;  2MC6 A;  5KL4 A;  4JI6 E;  4DR1 E;  3BGH A;  2L2N A;  3C4B A;  4R2Q A;  1ZU1 A;  2EE8 A;  3J80 C;  3AV0 A;  1SR9 A;  3HPZ A;  4KZS A;  1MGT A;  4TUG A;  5DNY A;  2UUA E;  2FV4 B;  3IWD A;  4ZYH A;  4X66 E;  4YHH E;  5FLX C;  4DUY E;  2EZ6 A;  4LF4 E;  4WX9 A;  2EPN A;  4X65 E;  4DV7 E;  2YU5 A;  4JI7 E;  3EPH A;  3ADL A;  2EM2 A;  2B9D A;  4F9C B;  3T1Y E;  2ENH A;  3LML A;  2EQ3 A;  4NZV A;  2N8X A;  1SFE A;  2EML A;  1X48 A;  3P1X A;  1GZ6 A;  4DR7 E;  4X8W A;  2EMY A;  4B3R E;  4ZYD A;  2BBG A;  3THO B;  5KL6 A;  4JI0 E;  1Z1B A;  2YTP A;  1X5W A;  5IV8 B;  1YSA C;  3J7Y p;  1A1J A;  3VK6 A;  2EQ0 A;  1DQ3 A;  4WYQ B;  5LMU E;  2EM3 A;  2GPI A;  2JR1 A;  4LTY A;  2GLI A;  4R2A A;  2LBS B;  4LF9 E;  5AE2 A;  2EN8 A;  3M99 B;  4B3T E;  1UBD C;  2EOQ A;  3BID A;  4RHB B;  2YTN A;  2EL6 A;  4R2R A;  1STU A;  3FIG A;  1T39 A;  3J81 C;  4TUI A;  1T4L B;  4BC7 A;  2L3J A;  2EN1 A;  4WXD A;  1GQE A;  4RH8 A;  2EMI A;  2HC5 A;  1BB8 A;  2N3H A;  2R76 A;  1QNT A;  2EMW A;  2JY9 A;  4R2E A;  4R2P A;  2LCE A;  3C6K A;  3THN A;  3F6H A;  1ZBT A;  1N32 E;  2WBS A;  5A6A A;  5LMN E;  2NA2 A;  2N3G A;  4R8O A;  1TN9 A;  2HGH A;  2EPA A;  2V87 A;  2WBU A;  1EH8 A;  2EM9 A; 
#chains in the Genus database with same CATH homology
 2EN6 A;  2ELZ A;  2CSH A;  2YTE A;  4M9V C;  2WBT A;  1RMD A;  1NCS A;  2EM6 A;  2EMF A;  2EOM A;  3MHS C;  2YRH A;  2JPA A;  4F2J C;  4R2C A;  1YUI A;  2YRM A;  2EMZ A;  2JP9 A;  5KL5 A;  1G2F C;  5KL4 A;  2DGC A;  2EMC A;  2EM5 A;  4IJD A;  2EPX A;  4R2Q A;  1X3C A;  3EPL A;  1ZU1 A;  2EE8 A;  1LLM C;  2RPC A;  1A1L A;  2YSO A;  2EOS A;  2EOH A;  4F6M A;  2MKN A;  2ENC A;  2PRT A;  2GHF A;  2EPR A;  2MDG A;  2EN4 A;  1X6E A;  2EOX A;  2EOY A;  2EQ1 A;  2RSI A;  4GZN C;  1ZR9 A;  4FK5 C;  1YUJ A;  2J7J A;  2YU5 A;  2ENA A;  3EPH A;  2EM2 A;  3EPJ A;  2ENH A;  1A1H A;  5KL2 A;  2EQ3 A;  3VHT B;  2LV2 A;  2EML A;  4WSG A;  1WJP A;  2EN3 A;  2YTF A;  1A1F A;  2EMY A;  2YTQ A;  3MHH C;  2EPU A;  2YTG A;  1A1G A;  2EN7 A;  4R2S A;  4IS1 C;  5KL6 A;  2YU8 A;  2EOZ A;  1Z1B A;  1TF3 A;  2YTP A;  1X5W A;  1AAY A;  1B69 A;  1YSA C;  1MEY C;  2E72 A;  1A1J A;  2EN2 A;  2EQ0 A;  2YTI A;  2EM3 A;  1UN6 B;  1TF6 A;  2GLI A;  4R2A A;  1BBO A;  2DLK A;  1A1I A;  2EN8 A;  2EOJ A;  3M99 B;  2R1F A;  1G2D C;  2EL4 A;  1UBD C;  2YSP A;  5KL3 A;  2EOQ A;  2EOO A;  2EPC A;  2EOR A;  2YTO A;  2EMK A;  4F6N A;  2EPP A;  3UK3 C;  2EOF A;  2NAB A;  2YTJ A;  2YTN A;  2EL6 A;  4R2R A;  2CTD A;  5KL7 A;  2I13 A;  2EMX A;  2YTD A;  2EMB A;  2EMH A;  4R2D A;  2DLQ A;  2EL5 A;  2EN1 A;  2A25 A;  2EMI A;  2VRD A;  2EM4 A;  2EPZ A;  1BB8 A;  2MKD A;  1P47 A;  2EMW A;  2LVH A;  2EOE A;  2EJ4 A;  2DRP A;  2WCC 3;  2EM8 A;  3EPK A;  4R2E A;  1ZAA C;  2EM0 A;  2LCE A;  2EM7 A;  2CT1 A;  4R2P A;  2LT7 A;  1F2I G;  2YRK A;  1JK1 A;  1DGC A;  2WBS A;  4X9J A;  1JK2 A;  2EOI A;  2ADR A;  1X6H A;  1X6F A;  2D9H A;  2LO3 A;  1TN9 A;  2EMA A;  2EP3 A;  2HGH A;  2EPA A;  1KJK A;  2BB8 A;  2M9A A;  2EMG A;  2DMI A;  2WBU A;  1A1K A;  2EM9 A;  2ELY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...