2EM8A

Solution structure of the c2h2 type zinc finger (region 423-455) of human zinc finger protein 224
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKPYKCVECGKGYKRRLDLDFHQRVHTGEKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 423-455) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 9
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em8A01
2EM8A 1KJKA 2YTPA 2ADRA 1A1KA 4FK5C 2EPPA 4R2RA 3MHHC 3EPKA 1A1GA 4R2PA 5KL6A 4IS1C 2EOOA 2ENAA 2DMIA 4IJDA 2EPRA 4F6MA 2EM3A 2EOIA 1YSAC 1A1JA 1JK1A 1X6EA 2EMFA 2YSOA 1X6HA 2EL4A 2EM6A 2EN4A 2GLIA 2EQ3A 2EP3A 2CT1A 2DRPA 5KL5A 2EN8A 2YTDA 2I13A 1TF3A 1AAYA 1ZU1A 2EMHA 2RSIA 2MKNA 1BBOA 2YTIA 2EMWA 2EMKA 2EN7A 1UN6B 1YUJA 2EPAA 1NCSA 2YRKA 2WBSA 2YTFA 2JPAA 2EOYA 2EOZA 2EN6A 2EOSA 2BB8A 2YTNA 2EMAA 2YSPA 2EM7A 2YRMA 3EPLA 1A1HA 1LLMC 2E72A 2YRHA 1X6FA 2EN2A 2ELZA 2EM5A 2MKDA 1TN9A 1G2DC 2EM2A 2M9AA 1TF6A 1X3CA 1RMDA 1MEYC 2EPUA 2EN1A 3EPHA 4R2EA 2YTEA 2EPZA 1A1LA 2EOFA 2YTOA 2YTQA 4R2SA 2EN3A 2EMIA 2EOHA 2NABA 5KL7A 1G2FC 2LT7A 2EOJA 2EL6A 2EMXA 2LVHA 2MDGA 1DGCA 1UBDC 2EMYA 2GHFA 1WJPA 4GZNC 2EE8A 2HGHA 3VHTB 3EPJA 2EOXA 2RPCA 2LO3A 1Z1BA 2R1FA 2YU5A 2EOEA 4R2CA 2YU8A 2DLKA 4M9VC 1BB8A 1JK2A 2PRTA 2EJ4A 3MHSC 2YTGA 4F2JC 3M99B 2ENHA 2VRDA 2J7JA 2EM4A 2EMGA 2DLQA 2CSHA 3UK3C 1X5WA 2EM0A 2EMZA 5KL2A 2EOQA 2EORA 2EQ1A 2EMCA 4R2DA 2JP9A 2YTJA 2A25A 2ENCA 1A1FA 2D9HA 5KL4A 4R2QA 1P47A 2ELYA 2LCEA 4X9JA 2LV2A 1ZAAC 2DGCA 2EOMA 1A1IA 1ZR9A 4WSGA 2EMLA 2WBTA 4R2AA 1B69A 2CTDA 2EPCA 2WCC3 1YUIA 2EL5A 2EM9A 2EQ0A 4F6NA 2WBUA 5KL3A 2EMBA 2EPXA 1F2IG
chains in the Genus database with same CATH superfamily
4B3ME 4JI1E 3AV0A 2ZM6E 3J7Yp 4R2PA 1YZ9A 4IS1C 2V88A 1WHQA 2JVAA 4DR4E 5AASA 4OOGC 2JYAA 3IWCA 2EPRA 3EQ1A 2B9DA 2RSMA 1YFHA 2EMFA 3VYYA 4B3SE 1MGTA 2EPNA 2I9IA 2DRPA 5KL5A 2YTDA 5AC4A 5T6JA 4JI3E 2MKNA 2R76A 2L2KB 1XNRE 2EPAA 3IWBA 1YYWA 2EOZA 2JWOA 4X64E 5DNYA 4WPYA 2YTNA 3KZYA 4LF4E 3C4TA 1LLMC 4F9AB 2MC6A 2ELZA 3ADJA 2E5LE 2EM2A 1HNZE 2L92A 1J26A 1RMDA 4X8WA 2EPUA 1AH5A 2EN1A 4BC7A 4BS9A 3AUZA 5LMUE 2YTEA 2EPZA 1X47A 1A1LA 2EOFA 2N3GA 2YTQA 2YTOA 4R2SA 4DR1E 2EN3A 1XMQE 2EMIA 2L8TA 4LFBE 2BBGA 1DGCA 2V83A 4BBYA 2UXBE 4DKKA 2N3HA 2MDRA 4GZNC 3BGHA 1I94E 4LF8E 1N3GA 4I8OA 3VHTB 3L00A 4F9BB 4TUGA 3J7AG 3EPJA 1FKAE 2RPCA 3KWRA 2UXDE 2LO3A 1Z1BA 2YU5A 5FLXC 2DLKA 2PRTA 4RH8A 2LRSA 5AE3A 4LU9A 2NUEA 2EMGA 2CSHA 1FJGE 5KL2A 1T4OA 2EORA 2E1MA 3IWDA 4R2DA 4O24A 2FTXB 4DR5E 3HPSA 1N34E 2KOUA 4R2QA 3OTOE 3HTXA 4LFCE 4DUZE 4ZYHA 5LL6R 4P78A 2WCC3 1IQOA 4BHCA 1X48A 3VK6A 2HJJA 1KJKA 4DV7E 1EH6A 4GEQB 2LTSA 2HC5A 4FK5C 1IBLE 4RHBB 4R2RA 1T38A 1A1GA 2EPOA 1QU6A 4DV6E 1EKZA 2DMIA 4IJDA 2VQFE 2ODRD 1YSAC 3BF2A 5ADZA 1A1JA 2DB2A 1X6HA 2LE2A 2EN4A 3BIDA 1SFEA 4LTYA 3HQ1A 2EN8A 1AAYA 2JY9A 1IBKE 3H09A 2EMWA 4O5GA 1L4SA 4JYAE 1X49A 2YTFA 4Q35B 4JI8E 2EOYA 2HHHE 4M2ZA 2VQEE 4TUIA 1N32E 2YPNA 2WZOA 3F6GA 2YSPA 2YRMA 1A1HA 4R8OA 1PDAA 2L2NA 1ZBQA 5BR8E 5A6AA 2MKDA 2LTRA 1TN9A 1STUA 2M9AA 2UUCE 4J8ZA 3ADIA 4R2EA 5F3WA 2B7TA 3LLHA 1T4NA 1DQ3A 4NXME 2NA2A 1G2FC 4LFAE 2LVHA 1UBDC 2GHFA 2HGHA 2UU9E 4NZVA 5A6BD 1PJSA 3THNA 1RC7A 4DR3E 2R1FA 4O4KA 2B3TB 4GKKE 2F8BA 4JI2E 3ECRA 2N8XA 2LJHA 2EPLX 2FV4B 2K7IA 4JI4E 2VRDA 1IBME 4NHRA 1YYKA 2EM4A 2L33A 1X5WA 3JAMC 2V8QB 4DR6E 1HR0E 2ENCA 1A1FA 1IQSA 1PJTA 5AE2A 1WRJA 2ELYA 2M4IA 3ZOQB 2DGCA 2EOMA 3JTZA 4WSGA 2NUGA 2EPCA 4F54A 5AC5A 2EM9A 2YT4A 2V87A 2VF1A 5A6JA 5KL3A 4MLVA 2L3CA 2EPXA 5KL4A 4ZYGA 2JOBA 2MC5A 2EM8A 1PJQA 2ADRA 1A1KA 4O43A 1YYOA 4DV5E 4NXNE 2RS7A 5KL6A 2B7VA 2EOOA 2ENAA 1T39A 3OMLA 4F9CB 2H36X 1JK1A 2EL4A 1XMOE 2GLIA 2EQ3A 1GTKA 2CT1A 4K0KE 4R03A 2KHXA 4WXCA 1TF3A 1ZU1A 2M7QA 2EMHA 4DUYE 1BBOA 2YTIA 2K4VA 4YY3E 2EN7A 2EMKA 2YZTA 2G7HA 1YUJA 3K6QA 1NCSA 1WXRA 1O0WA 2Q8UA 2EMAA 2EM7A 3EPLA 5AE1A 2E72A 2JOXA 1GQEA 1G2DC 2LUQA 1MEYC 5A69A 3HXLA 3EPHA 2JXPA 2RQLA 4MLQA 4DV4E 4L5NC 2EOHA 4LF7E 5KL7A 5IV8B 2LT7A 3J80C 2ODRC 2EMYA 4JI7E 1EH8A 2CPNA 4HTGA 4M0VA 2L6MA 5IT9C 4BHBA 1YPNA 2EOEA 4R2CA 2RTXA 5A6KA 4M9VC 1JK2A 4X62E 5IXMB 2EJ4A 2YTGA 4F2JC 5LLQA 1PKPA 2J7JA 3KZZA 3RMPA 5IWAE 3QG5C 2UXCE 3UK3C 2LMZA 5A6BA 2EMCA 4B3RE 3C4BA 5LMNE 2M1SA 2D9HA 2F4VE 3T1HE 4N4RB 4WYQB 4DMIA 2LCEA 4X9JA 1RQ0A 3J81C 1ZR9A 4WSPA 4R2AA 2EL5A 2UUBE 1GZ6A 2WBUA 2EMBA 4JI0E 2DMYA 1F2IG 2YTPA 3THOB 4YHHE 2EPPA 3MHHC 3EPKA 4AQYE 4LF5E 2EPMX 2DIXA 3MSWA 3TQMA 4DV2E 4LF9E 4DR2E 4F6MA 2EM3A 2EOIA 2EPKX 1BBGA 1X6EA 2DSYA 2YSOA 5TSEA 2EM6A 2L3JA 4Q28A 4GKJE 2EP3A 4KWYA 4DV1E 1HNWE 2I13A 2V86A 2GPIA 1N36E 2RSIA 2V85A 1HNXE 3FIGA 2L2MA 2NUFA 4X65E 5A2QC 4M30A 1UN6B 2YRKA 2WBSA 4JV5E 2JPAA 1XNQE 2EN6A 2EOSA 4P7DA 2FGGA 2BB8A 2LBSB 1KYQA 4WX9A 4DV0E 2YRHA 1X6FA 2EN2A 4OX9E 2EM5A 4X66E 3DJWA 1TF6A 1X3CA 4WXDA 3T1YE 4KZSA 2UUAE 3P1XA 1ZBTA 2NABA 3LMLA 2EOJA 2EL6A 2EMXA 2MDGA 1WJPA 1NEIA 2EE8A 2LUPB 4B3TE 1N33E 2V89A 2EOXA 5CFFE 3ADLA 1IMUA 3BBGA 1UILA 3DF6A 4ZYDA 2EWLA 2RS6A 2YU8A 1BB8A 1UHZA 1J5EE 4JI6E 3MHSC 3M99B 2ENHA 1WHNA 3VYXA 4KHPE 2DLQA 1DI2A 4JI5E 2LJUA 2YWQA 2EM0A 2EMZA 2JR1A 2EOQA 4HEIA 2EQ1A 2JP9A 4DV3E 1T4LB 2YTJA 2A25A 1QNTA 2EZ6A 4WFTA 3C6MA 1P47A 1EH7A 3F6HA 2LV2A 2VE7C 4BC9A 1ZAAC 1SR9A 1A1IA 4LF6E 3ADGA 2EMLA 2WBTA 4L8NA 1B69A 2CTDA 1YUIA 3JU0A 2EQ0A 2KONA 4BCAA 4F6NA 4BMJA 3C6KA 2IHR1 4ZYEA 4DR7E 3HPZA
chains in the Genus database with same CATH topology
2EM8A 1KJKA 2YTPA 2ADRA 1A1KA 4FK5C 2EPPA 4R2RA 3MHHC 3EPKA 1A1GA 4R2PA 5KL6A 4IS1C 2EOOA 2ENAA 2DMIA 4IJDA 2EPRA 4F6MA 2EM3A 2EOIA 1YSAC 1A1JA 1JK1A 1X6EA 2EMFA 2YSOA 1X6HA 2EL4A 2EM6A 2EN4A 2GLIA 2EQ3A 2EP3A 2CT1A 2DRPA 5KL5A 2EN8A 2YTDA 2I13A 1TF3A 1AAYA 1ZU1A 2EMHA 2RSIA 2MKNA 1BBOA 2YTIA 2EMWA 2EMKA 2EN7A 1UN6B 1YUJA 2EPAA 1NCSA 2YRKA 2WBSA 2YTFA 2JPAA 2EOYA 2EOZA 2EN6A 2EOSA 2BB8A 2YTNA 2EMAA 2YSPA 2EM7A 2YRMA 3EPLA 1A1HA 1LLMC 2E72A 2YRHA 1X6FA 2EN2A 2ELZA 2EM5A 2MKDA 1TN9A 1G2DC 2EM2A 2M9AA 1TF6A 1X3CA 1RMDA 1MEYC 2EPUA 2EN1A 3EPHA 4R2EA 2YTEA 2EPZA 1A1LA 2EOFA 2YTOA 2YTQA 4R2SA 2EN3A 2EMIA 2EOHA 2NABA 5KL7A 1G2FC 2LT7A 2EOJA 2EL6A 2EMXA 2LVHA 2MDGA 1DGCA 1UBDC 2EMYA 2GHFA 1WJPA 4GZNC 2EE8A 2HGHA 3VHTB 3EPJA 2EOXA 2RPCA 2LO3A 1Z1BA 2R1FA 2YU5A 2EOEA 4R2CA 2YU8A 2DLKA 4M9VC 1BB8A 1JK2A 2PRTA 2EJ4A 3MHSC 2YTGA 4F2JC 3M99B 2ENHA 2VRDA 2J7JA 2EM4A 2EMGA 2DLQA 2CSHA 3UK3C 1X5WA 2EM0A 2EMZA 5KL2A 2EOQA 2EORA 2EQ1A 2EMCA 4R2DA 2JP9A 2YTJA 2A25A 2ENCA 1A1FA 2D9HA 5KL4A 4R2QA 1P47A 2ELYA 2LCEA 4X9JA 2LV2A 1ZAAC 2DGCA 2EOMA 1A1IA 1ZR9A 4WSGA 2EMLA 2WBTA 4R2AA 1B69A 2CTDA 2EPCA 2WCC3 1YUIA 2EL5A 2EM9A 2EQ0A 4F6NA 2WBUA 5KL3A 2EMBA 2EPXA 1F2IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EM8 A;  1KJK A;  2YTP A;  2ADR A;  1A1K A;  4FK5 C;  2EPP A;  4R2R A;  3MHH C;  3EPK A;  1A1G A;  4R2P A;  5KL6 A;  4IS1 C;  2EOO A;  2ENA A;  2DMI A;  4IJD A;  2EPR A;  4F6M A;  2EM3 A;  2EOI A;  1YSA C;  1A1J A;  1JK1 A;  1X6E A;  2EMF A;  2YSO A;  1X6H A;  2EL4 A;  2EM6 A;  2EN4 A;  2GLI A;  2EQ3 A;  2EP3 A;  2CT1 A;  2DRP A;  5KL5 A;  2EN8 A;  2YTD A;  2I13 A;  1TF3 A;  1AAY A;  1ZU1 A;  2EMH A;  2RSI A;  2MKN A;  1BBO A;  2YTI A;  2EMW A;  2EMK A;  2EN7 A;  1UN6 B;  1YUJ A;  2EPA A;  1NCS A;  2YRK A;  2WBS A;  2YTF A;  2JPA A;  2EOY A;  2EOZ A;  2EN6 A;  2EOS A;  2BB8 A;  2YTN A;  2EMA A;  2YSP A;  2EM7 A;  2YRM A;  3EPL A;  1A1H A;  1LLM C;  2E72 A;  2YRH A;  1X6F A;  2EN2 A;  2ELZ A;  2EM5 A;  2MKD A;  1TN9 A;  1G2D C;  2EM2 A;  2M9A A;  1TF6 A;  1X3C A;  1RMD A;  1MEY C;  2EPU A;  2EN1 A;  3EPH A;  4R2E A;  2YTE A;  2EPZ A;  1A1L A;  2EOF A;  2YTO A;  2YTQ A;  4R2S A;  2EN3 A;  2EMI A;  2EOH A;  2NAB A;  5KL7 A;  1G2F C;  2LT7 A;  2EOJ A;  2EL6 A;  2EMX A;  2LVH A;  2MDG A;  1DGC A;  1UBD C;  2EMY A;  2GHF A;  1WJP A;  4GZN C;  2EE8 A;  2HGH A;  3VHT B;  3EPJ A;  2EOX A;  2RPC A;  2LO3 A;  1Z1B A;  2R1F A;  2YU5 A;  2EOE A;  4R2C A;  2YU8 A;  2DLK A;  4M9V C;  1BB8 A;  1JK2 A;  2PRT A;  2EJ4 A;  3MHS C;  2YTG A;  4F2J C;  3M99 B;  2ENH A;  2VRD A;  2J7J A;  2EM4 A;  2EMG A;  2DLQ A;  2CSH A;  3UK3 C;  1X5W A;  2EM0 A;  2EMZ A;  5KL2 A;  2EOQ A;  2EOR A;  2EQ1 A;  2EMC A;  4R2D A;  2JP9 A;  2YTJ A;  2A25 A;  2ENC A;  1A1F A;  2D9H A;  5KL4 A;  4R2Q A;  1P47 A;  2ELY A;  2LCE A;  4X9J A;  2LV2 A;  1ZAA C;  2DGC A;  2EOM A;  1A1I A;  1ZR9 A;  4WSG A;  2EML A;  2WBT A;  4R2A A;  1B69 A;  2CTD A;  2EPC A;  2WCC 3;  1YUI A;  2EL5 A;  2EM9 A;  2EQ0 A;  4F6N A;  2WBU A;  5KL3 A;  2EMB A;  2EPX A;  1F2I G; 
#chains in the Genus database with same CATH topology
 4B3M E;  4JI1 E;  3AV0 A;  2ZM6 E;  3J7Y p;  4R2P A;  1YZ9 A;  4IS1 C;  2V88 A;  1WHQ A;  2JVA A;  4DR4 E;  5AAS A;  4OOG C;  2JYA A;  3IWC A;  2EPR A;  3EQ1 A;  2B9D A;  2RSM A;  1YFH A;  2EMF A;  3VYY A;  4B3S E;  1MGT A;  2EPN A;  2I9I A;  2DRP A;  5KL5 A;  2YTD A;  5AC4 A;  5T6J A;  4JI3 E;  2MKN A;  2R76 A;  2L2K B;  1XNR E;  2EPA A;  3IWB A;  1YYW A;  2EOZ A;  2JWO A;  4X64 E;  5DNY A;  4WPY A;  2YTN A;  3KZY A;  4LF4 E;  3C4T A;  1LLM C;  4F9A B;  2MC6 A;  2ELZ A;  3ADJ A;  2E5L E;  2EM2 A;  1HNZ E;  2L92 A;  1J26 A;  1RMD A;  4X8W A;  2EPU A;  1AH5 A;  2EN1 A;  4BC7 A;  4BS9 A;  3AUZ A;  5LMU E;  2YTE A;  2EPZ A;  1X47 A;  1A1L A;  2EOF A;  2N3G A;  2YTQ A;  2YTO A;  4R2S A;  4DR1 E;  2EN3 A;  1XMQ E;  2EMI A;  2L8T A;  4LFB E;  2BBG A;  1DGC A;  2V83 A;  4BBY A;  2UXB E;  4DKK A;  2N3H A;  2MDR A;  4GZN C;  3BGH A;  1I94 E;  4LF8 E;  1N3G A;  4I8O A;  3VHT B;  3L00 A;  4F9B B;  4TUG A;  3J7A G;  3EPJ A;  1FKA E;  2RPC A;  3KWR A;  2UXD E;  2LO3 A;  1Z1B A;  2YU5 A;  5FLX C;  2DLK A;  2PRT A;  4RH8 A;  2LRS A;  5AE3 A;  4LU9 A;  2NUE A;  2EMG A;  2CSH A;  1FJG E;  5KL2 A;  1T4O A;  2EOR A;  2E1M A;  3IWD A;  4R2D A;  4O24 A;  2FTX B;  4DR5 E;  3HPS A;  1N34 E;  2KOU A;  4R2Q A;  3OTO E;  3HTX A;  4LFC E;  4DUZ E;  4ZYH A;  5LL6 R;  4P78 A;  2WCC 3;  1IQO A;  4BHC A;  1X48 A;  3VK6 A;  2HJJ A;  1KJK A;  4DV7 E;  1EH6 A;  4GEQ B;  2LTS A;  2HC5 A;  4FK5 C;  1IBL E;  4RHB B;  4R2R A;  1T38 A;  1A1G A;  2EPO A;  1QU6 A;  4DV6 E;  1EKZ A;  2DMI A;  4IJD A;  2VQF E;  2ODR D;  1YSA C;  3BF2 A;  5ADZ A;  1A1J A;  2DB2 A;  1X6H A;  2LE2 A;  2EN4 A;  3BID A;  1SFE A;  4LTY A;  3HQ1 A;  2EN8 A;  1AAY A;  2JY9 A;  1IBK E;  3H09 A;  2EMW A;  4O5G A;  1L4S A;  4JYA E;  1X49 A;  2YTF A;  4Q35 B;  4JI8 E;  2EOY A;  2HHH E;  4M2Z A;  2VQE E;  4TUI A;  1N32 E;  2YPN A;  2WZO A;  3F6G A;  2YSP A;  2YRM A;  1A1H A;  4R8O A;  1PDA A;  2L2N A;  1ZBQ A;  5BR8 E;  5A6A A;  2MKD A;  2LTR A;  1TN9 A;  1STU A;  2M9A A;  2UUC E;  4J8Z A;  3ADI A;  4R2E A;  5F3W A;  2B7T A;  3LLH A;  1T4N A;  1DQ3 A;  4NXM E;  2NA2 A;  1G2F C;  4LFA E;  2LVH A;  1UBD C;  2GHF A;  2HGH A;  2UU9 E;  4NZV A;  5A6B D;  1PJS A;  3THN A;  1RC7 A;  4DR3 E;  2R1F A;  4O4K A;  2B3T B;  4GKK E;  2F8B A;  4JI2 E;  3ECR A;  2N8X A;  2LJH A;  2EPL X;  2FV4 B;  2K7I A;  4JI4 E;  2VRD A;  1IBM E;  4NHR A;  1YYK A;  2EM4 A;  2L33 A;  1X5W A;  3JAM C;  2V8Q B;  4DR6 E;  1HR0 E;  2ENC A;  1A1F A;  1IQS A;  1PJT A;  5AE2 A;  1WRJ A;  2ELY A;  2M4I A;  3ZOQ B;  2DGC A;  2EOM A;  3JTZ A;  4WSG A;  2NUG A;  2EPC A;  4F54 A;  5AC5 A;  2EM9 A;  2YT4 A;  2V87 A;  2VF1 A;  5A6J A;  5KL3 A;  4MLV A;  2L3C A;  2EPX A;  5KL4 A;  4ZYG A;  2JOB A;  2MC5 A;  2EM8 A;  1PJQ A;  2ADR A;  1A1K A;  4O43 A;  1YYO A;  4DV5 E;  4NXN E;  2RS7 A;  5KL6 A;  2B7V A;  2EOO A;  2ENA A;  1T39 A;  3OML A;  4F9C B;  2H36 X;  1JK1 A;  2EL4 A;  1XMO E;  2GLI A;  2EQ3 A;  1GTK A;  2CT1 A;  4K0K E;  4R03 A;  2KHX A;  4WXC A;  1TF3 A;  1ZU1 A;  2M7Q A;  2EMH A;  4DUY E;  1BBO A;  2YTI A;  2K4V A;  4YY3 E;  2EN7 A;  2EMK A;  2YZT A;  2G7H A;  1YUJ A;  3K6Q A;  1NCS A;  1WXR A;  1O0W A;  2Q8U A;  2EMA A;  2EM7 A;  3EPL A;  5AE1 A;  2E72 A;  2JOX A;  1GQE A;  1G2D C;  2LUQ A;  1MEY C;  5A69 A;  3HXL A;  3EPH A;  2JXP A;  2RQL A;  4MLQ A;  4DV4 E;  4L5N C;  2EOH A;  4LF7 E;  5KL7 A;  5IV8 B;  2LT7 A;  3J80 C;  2ODR C;  2EMY A;  4JI7 E;  1EH8 A;  2CPN A;  4HTG A;  4M0V A;  2L6M A;  5IT9 C;  4BHB A;  1YPN A;  2EOE A;  4R2C A;  2RTX A;  5A6K A;  4M9V C;  1JK2 A;  4X62 E;  5IXM B;  2EJ4 A;  2YTG A;  4F2J C;  5LLQ A;  1PKP A;  2J7J A;  3KZZ A;  3RMP A;  5IWA E;  3QG5 C;  2UXC E;  3UK3 C;  2LMZ A;  5A6B A;  2EMC A;  4B3R E;  3C4B A;  5LMN E;  2M1S A;  2D9H A;  2F4V E;  3T1H E;  4N4R B;  4WYQ B;  4DMI A;  2LCE A;  4X9J A;  1RQ0 A;  3J81 C;  1ZR9 A;  4WSP A;  4R2A A;  2EL5 A;  2UUB E;  1GZ6 A;  2WBU A;  2EMB A;  4JI0 E;  2DMY A;  1F2I G;  2YTP A;  3THO B;  4YHH E;  2EPP A;  3MHH C;  3EPK A;  4AQY E;  4LF5 E;  2EPM X;  2DIX A;  3MSW A;  3TQM A;  4DV2 E;  4LF9 E;  4DR2 E;  4F6M A;  2EM3 A;  2EOI A;  2EPK X;  1BBG A;  1X6E A;  2DSY A;  2YSO A;  5TSE A;  2EM6 A;  2L3J A;  4Q28 A;  4GKJ E;  2EP3 A;  4KWY A;  4DV1 E;  1HNW E;  2I13 A;  2V86 A;  2GPI A;  1N36 E;  2RSI A;  2V85 A;  1HNX E;  3FIG A;  2L2M A;  2NUF A;  4X65 E;  5A2Q C;  4M30 A;  1UN6 B;  2YRK A;  2WBS A;  4JV5 E;  2JPA A;  1XNQ E;  2EN6 A;  2EOS A;  4P7D A;  2FGG A;  2BB8 A;  2LBS B;  1KYQ A;  4WX9 A;  4DV0 E;  2YRH A;  1X6F A;  2EN2 A;  4OX9 E;  2EM5 A;  4X66 E;  3DJW A;  1TF6 A;  1X3C A;  4WXD A;  3T1Y E;  4KZS A;  2UUA E;  3P1X A;  1ZBT A;  2NAB A;  3LML A;  2EOJ A;  2EL6 A;  2EMX A;  2MDG A;  1WJP A;  1NEI A;  2EE8 A;  2LUP B;  4B3T E;  1N33 E;  2V89 A;  2EOX A;  5CFF E;  3ADL A;  1IMU A;  3BBG A;  1UIL A;  3DF6 A;  4ZYD A;  2EWL A;  2RS6 A;  2YU8 A;  1BB8 A;  1UHZ A;  1J5E E;  4JI6 E;  3MHS C;  3M99 B;  2ENH A;  1WHN A;  3VYX A;  4KHP E;  2DLQ A;  1DI2 A;  4JI5 E;  2LJU A;  2YWQ A;  2EM0 A;  2EMZ A;  2JR1 A;  2EOQ A;  4HEI A;  2EQ1 A;  2JP9 A;  4DV3 E;  1T4L B;  2YTJ A;  2A25 A;  1QNT A;  2EZ6 A;  4WFT A;  3C6M A;  1P47 A;  1EH7 A;  3F6H A;  2LV2 A;  2VE7 C;  4BC9 A;  1ZAA C;  1SR9 A;  1A1I A;  4LF6 E;  3ADG A;  2EML A;  2WBT A;  4L8N A;  1B69 A;  2CTD A;  1YUI A;  3JU0 A;  2EQ0 A;  2KON A;  4BCA A;  4F6N A;  4BMJ A;  3C6K A;  2IHR 1;  4ZYE A;  4DR7 E;  3HPZ A; 
#chains in the Genus database with same CATH homology
 2EM8 A;  1KJK A;  2YTP A;  2ADR A;  1A1K A;  4FK5 C;  2EPP A;  4R2R A;  3MHH C;  3EPK A;  1A1G A;  4R2P A;  5KL6 A;  4IS1 C;  2EOO A;  2ENA A;  2DMI A;  4IJD A;  2EPR A;  4F6M A;  2EM3 A;  2EOI A;  1YSA C;  1A1J A;  1JK1 A;  1X6E A;  2EMF A;  2YSO A;  1X6H A;  2EL4 A;  2EM6 A;  2EN4 A;  2GLI A;  2EQ3 A;  2EP3 A;  2CT1 A;  2DRP A;  5KL5 A;  2EN8 A;  2YTD A;  2I13 A;  1TF3 A;  1AAY A;  1ZU1 A;  2EMH A;  2RSI A;  2MKN A;  1BBO A;  2YTI A;  2EMW A;  2EMK A;  2EN7 A;  1UN6 B;  1YUJ A;  2EPA A;  1NCS A;  2YRK A;  2WBS A;  2YTF A;  2JPA A;  2EOY A;  2EOZ A;  2EN6 A;  2EOS A;  2BB8 A;  2YTN A;  2EMA A;  2YSP A;  2EM7 A;  2YRM A;  3EPL A;  1A1H A;  1LLM C;  2E72 A;  2YRH A;  1X6F A;  2EN2 A;  2ELZ A;  2EM5 A;  2MKD A;  1TN9 A;  1G2D C;  2EM2 A;  2M9A A;  1TF6 A;  1X3C A;  1RMD A;  1MEY C;  2EPU A;  2EN1 A;  3EPH A;  4R2E A;  2YTE A;  2EPZ A;  1A1L A;  2EOF A;  2YTO A;  2YTQ A;  4R2S A;  2EN3 A;  2EMI A;  2EOH A;  2NAB A;  5KL7 A;  1G2F C;  2LT7 A;  2EOJ A;  2EL6 A;  2EMX A;  2LVH A;  2MDG A;  1DGC A;  1UBD C;  2EMY A;  2GHF A;  1WJP A;  4GZN C;  2EE8 A;  2HGH A;  3VHT B;  3EPJ A;  2EOX A;  2RPC A;  2LO3 A;  1Z1B A;  2R1F A;  2YU5 A;  2EOE A;  4R2C A;  2YU8 A;  2DLK A;  4M9V C;  1BB8 A;  1JK2 A;  2PRT A;  2EJ4 A;  3MHS C;  2YTG A;  4F2J C;  3M99 B;  2ENH A;  2VRD A;  2J7J A;  2EM4 A;  2EMG A;  2DLQ A;  2CSH A;  3UK3 C;  1X5W A;  2EM0 A;  2EMZ A;  5KL2 A;  2EOQ A;  2EOR A;  2EQ1 A;  2EMC A;  4R2D A;  2JP9 A;  2YTJ A;  2A25 A;  2ENC A;  1A1F A;  2D9H A;  5KL4 A;  4R2Q A;  1P47 A;  2ELY A;  2LCE A;  4X9J A;  2LV2 A;  1ZAA C;  2DGC A;  2EOM A;  1A1I A;  1ZR9 A;  4WSG A;  2EML A;  2WBT A;  4R2A A;  1B69 A;  2CTD A;  2EPC A;  2WCC 3;  1YUI A;  2EL5 A;  2EM9 A;  2EQ0 A;  4F6N A;  2WBU A;  5KL3 A;  2EMB A;  2EPX A;  1F2I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...