2EM8A

Solution structure of the c2h2 type zinc finger (region 423-455) of human zinc finger protein 224
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGSGEKPYKCVECGKGYKRRLDLDFHQRVHTGEKLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 423-455) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em8A01
2YRKA 2ELYA 2YTGA 2LT7A 1A1IA 2EP3A 2BB8A 2CT1A 2EM7A 4F6NA 2I13A 2EOMA 2MKDA 2EOHA 2EM9A 1B69A 1YSAC 1ZAAC 2EM5A 2ELZA 2YTJA 1ZR9A 2YRMA 2EMXA 2YTFA 2EPPA 2LCEA 1JK2A 2EM6A 1YUJA 2EMFA 2LVHA 2RSIA 4WSGA 2EN4A 2EE8A 1X6EA 2YTIA 3EPKA 2EQ0A 3M99B 4X9JA 4F2JC 2EMGA 2EORA 4IS1C 1UBDC 2EOFA 2EPUA 2EMAA 3UK3C 2EOEA 2YU8A 1A1GA 2EN1A 2EOSA 2YTEA 2WBSA 4R2EA 1YUIA 3EPJA 3VHTB 4IJDA 1KJKA 2YTOA 2EM4A 2RPCA 2EM0A 2EOXA 2EMCA 2EN7A 2EOIA 2JPAA 2E72A 2EN8A 2GLIA 2D9HA 2EMWA 2CSHA 3MHHC 5KL4A 2EM8A 1JK1A 1A1JA 3EPHA 2EPZA 2YSOA 1X3CA 4GZNC 2YTPA 1BB8A 2EMBA 2J7JA 2EPCA 1A1FA 1G2FC 2YRHA 2MKNA 2EL6A 2YU5A 1BBOA 1F2IG 2EM2A 4R2RA 2EQ1A 2EMYA 2PRTA 2DMIA 1AAYA 2A25A 2LO3A 1X6FA 2YTDA 4R2CA 1TF3A 5KL6A 1TF6A 2EN6A 2R1FA 2YTNA 4F6MA 1Z1BA 1UN6B 1P47A 2DLKA 1NCSA 2YSPA 2WCC3 5KL5A 1MEYC 1A1KA 3MHSC 2EMLA 1WJPA 2EMKA 2EOQA 2EN3A 2EOZA 2EOYA 2LV2A 2EQ3A 2EOJA 1A1HA 2DLQA 2EL4A 2ENHA 2YTQA 3EPLA 1DGCA 1G2DC 2DRPA 2WBTA 2EM3A 2M9AA 2WBUA 2DGCA 2JP9A 5KL3A 4FK5C 2EN2A 2EOOA 1RMDA 2VRDA 2HGHA 2ADRA 4R2QA 1X5WA 1TN9A 2EJ4A 4R2DA 1X6HA 2NABA 2EPRA 2EMZA 2EPXA 5KL2A 2EL5A 5KL7A 4M9VC 2CTDA 2ENCA 1ZU1A 4R2PA 2EMIA 2MDGA 1LLMC 2EMHA 4R2AA 2GHFA 2ENAA 1A1LA 2EPAA 4R2SA
chains in the Genus database with same CATH superfamily
5T6JA 2LT7A 1A1IA 2ODRC 1DI2A 4BHCA 2EOMA 2MKDA 2KOUA 1XNRE 2FGGA 1ZAAC 4DV5E 5LMUE 2ZM6E 3IWCA 4BC7A 4F9CB 1YUJA 2LVHA 4NXME 2EE8A 1X6EA 4F54A 2UU9E 3EPKA 2EORA 3AUZA 4WPYA 1L4SA 2YU8A 4X8WA 2LRSA 2MC5A 2EOSA 2YTEA 3BF2A 5IT9C 4R2EA 1YUIA 3IWDA 4O24A 5TSEA 2N3GA 3HPZA 2EM4A 1RC7A 1X47A 2NUGA 3AV0A 4DUYE 2E72A 2EN8A 1HNWE 3T1YE 5IXMB 5KL4A 1A1JA 4DR3E 2EPZA 3TQMA 2DMYA 3BIDA 4GZNC 1N33E 2EMBA 2EPCA 1A1FA 4OOGC 1WXRA 2RTXA 1XNQE 2G7HA 1STUA 2PRTA 1YPNA 2YT4A 1WHNA 2V88A 2YTDA 1TF3A 2V83A 4RHBB 3OMLA 2FV4B 2UXDE 2M1SA 2WCC3 2DSYA 1AH5A 1ZBTA 1MEYC 2CPNA 3MHSC 2EMLA 1QU6A 2F8BA 2EMKA 5ADZA 2V86A 2V89A 5LL6R 4NXNE 5LLQA 1A1HA 2YTQA 3EPLA 2DRPA 2VF1A 1HNXE 1I94E 2DGCA 2JP9A 4TUIA 3H09A 4FK5C 2NA2A 2IHR1 5AASA 4JI0E 1MGTA 4WFTA 1T4NA 2EJ4A 2F4VE 1EH6A 2LTSA 2EPRA 5KL2A 3IWBA 4Q35B 1EKZA 4MLQA 4JI5E 3JTZA 3FIGA 2MDGA 4BC9A 4JI1E 2L2KB 2GHFA 2ENAA 4DKKA 2EPAA 4R2SA 2JWOA 4LF9E 3F6GA 3KZYA 3ADIA 3C6KA 2I13A 4YHHE 1X48A 2EM9A 2VE7C 3J7AG 2JVAA 1T4OA 2RS7A 1IMUA 4DR4E 2R76A 2EMXA 2YTFA 3VYYA 4DUZE 3HQ1A 3ADJA 2RSIA 2EN4A 2LE2A 4JI6E 2UXCE 4GKKE 2YTIA 2EQ0A 4X9JA 2EOFA 2RS6A 5AE1A 2EOEA 2GPIA 2WZOA 4ZYDA 2EN1A 1IQSA 4GKJE 2MDRA 2WBSA 2JOBA 3EPJA 1YFHA 4IJDA 4WXCA 2EMCA 2EN7A 4B3ME 2GLIA 1YYOA 5A6KA 1X3CA 2YTPA 4O5GA 4BMJA 1NEIA 2YPNA 2EL6A 2HC5A 1BBGA 4L5NC 1F2IG 3P1XA 2EM2A 2L33A 4OX9E 1N32E 4DV6E 4R2RA 2DMIA 2M7QA 2A25A 1PJTA 4JI4E 1X6FA 4LF6E 1T39A 4DR6E 4F6MA 1Z1BA 5LMNE 1UN6B 2DLKA 2KHXA 2YSPA 4R03A 2JR1A 4ZYHA 4NHRA 2EZ6A 3C4TA 4N4RB 4B3TE 1WJPA 1XMQE 2EN3A 2L8TA 2LV2A 4HEIA 1WRJA 4JI7E 4LFAE 4K0KE 1G2DC 2JY9A 2V8QB 2VQEE 4YY3E 2L2NA 4ZYEA 1N36E 2EN2A 2H36X 2ADRA 4JI2E 2I9IA 4LF8E 2L3JA 1IBKE 2B7VA 4WX9A 5A69A 1EH8A 3VK6A 4F9BB 5KL7A 4M9VC 2CTDA 1ZU1A 4LU9A 3HPSA 4R2PA 2VQFE 4X62E 1PKPA 4BBYA 2DB2A 4M0VA 2CT1A 2EM7A 4F6NA 3ZOQB 4DR7E 1B69A 2JOXA 1YSAC 4R8OA 3HXLA 3K6QA 1HR0E 1ZR9A 2V85A 1QNTA 3BGHA 4DV1E 2L6MA 2YRMA 3THOB 3BBGA 1GTKA 4WSGA 3HTXA 2V87A 5FLXC 4F2JC 5F3WA 1UBDC 2EPUA 3DF6A 2EMAA 3UK3C 2ODRD 5A6JA 3ADLA 1A1GA 1J26A 4WXDA 4M2ZA 1IBLE 2N3HA 4HTGA 1KJKA 4ZYGA 2EM0A 2EOXA 2EOIA 3KWRA 1KYQA 2L92A 1T4LB 2K7IA 3J81C 4DV2E 1FJGE 2D9HA 2JYAA 2CSHA 1N34E 2RQLA 1YYWA 2N8XA 2EM8A 3EPHA 2LJUA 5CFFE 1PJSA 2Q8UA 5AE3A 2J7JA 1G2FC 4Q28A 1T38A 1UILA 4TUGA 2LTRA 1DQ3A 4O4KA 2YU5A 1PDAA 1BBOA 1IQOA 1YZ9A 5AC5A 1AAYA 1UHZA 1TF6A 2DIXA 4LFBE 2EN6A 5AE2A 2YTNA 2EWLA 1P47A 4B3SE 2KONA 2K4VA 4BCAA 5KL5A 4JI8E 1RQ0A 3ADGA 2E5LE 2EOQA 2YZTA 3L00A 4WYQB 4LFCE 2EOYA 2EQ3A 4NZVA 4KWYA 1FKAE 2EL4A 4AQYE 5BR8E 1N3GA 2WBTA 2B9DA 2WBUA 4I8OA 4J8ZA 5KL3A 2L3CA 2NUEA 1PJQA 4WSPA 1RMDA 4R2QA 4X66E 4M30A 3LMLA 1TN9A 3J80C 4R2DA 1X6HA 2JXPA 1XMOE 4DV0E 3EQ1A 4DV3E 2UUBE 4LF5E 2EPXA 2EL5A 2ENCA 3LLHA 2LMZA 2HHHE 3MSWA 4R2AA 3C6MA 1A1LA 2YRKA 2ELYA 2YTGA 2EP3A 2BB8A 5A2QC 2EOHA 2UUAE 4GEQB 4KHPE 2UXBE 1O0WA 2E1MA 2EM5A 3QG5C 2ELZA 2YTJA 4P78A 4BHBA 2EPPA 2LCEA 1JK2A 2EM6A 3T1HE 2EMFA 4F9AB 1EH7A 3DJWA 2EPNA 3M99B 2EMGA 4IS1C 2NUFA 3JU0A 2LUQA 4B3RE 4MLVA 3VHTB 2YTOA 2RPCA 3JAMC 4RH8A 2LUPB 4X65E 2JPAA 2MC6A 2EMWA 3MHHC 5A6AA 1JK1A 2YSOA 4O43A 2HJJA 3VYXA 1BB8A 5A6BA 2YRHA 2MKNA 3ECRA 4DR5E 3RMPA 2B3TB 4P7DA 4DR2E 2EQ1A 2EMYA 4DMIA 4L8NA 2M4IA 2LO3A 4R2CA 2RSMA 5KL6A 1ZBQA 2R1FA 3C4BA 4LF4E 2EPLX 4JV5E 1J5EE 1NCSA 3J7Yp 3F6HA 3OTOE 1SR9A 1A1KA 1GZ6A 5A6BD 1YYKA 1IBME 2EOZA 4LTYA 5DNYA 4BS9A 2EOJA 4KZSA 2DLQA 4X64E 2LBSB 1HNZE 1DGCA 2ENHA 4JI3E 2EPMX 2EM3A 2M9AA 2UUCE 2FTXB 4JYAE 1GQEA 1WHQA 5IWAE 2L2MA 2B7TA 2EOOA 5AC4A 2VRDA 2HGHA 1X5WA 2NABA 2EMZA 4DR1E 3KZZA 2EPOA 4LF7E 2YWQA 3THNA 2EMIA 2LJHA 1LLMC 4DV7E 2EMHA 2BBGA 2EPKX 1SFEA 5IV8B 1X49A 4DV4E
chains in the Genus database with same CATH topology
2YRKA 2ELYA 2YTGA 2LT7A 1A1IA 2EP3A 2BB8A 2CT1A 2EM7A 4F6NA 2I13A 2EOMA 2MKDA 2EOHA 2EM9A 1B69A 1YSAC 1ZAAC 2EM5A 2ELZA 2YTJA 1ZR9A 2YRMA 2EMXA 2YTFA 2EPPA 2LCEA 1JK2A 2EM6A 1YUJA 2EMFA 2LVHA 2RSIA 4WSGA 2EN4A 2EE8A 1X6EA 2YTIA 3EPKA 2EQ0A 3M99B 4X9JA 4F2JC 2EMGA 2EORA 4IS1C 1UBDC 2EOFA 2EPUA 2EMAA 3UK3C 2EOEA 2YU8A 1A1GA 2EN1A 2EOSA 2YTEA 2WBSA 4R2EA 1YUIA 3EPJA 3VHTB 4IJDA 1KJKA 2YTOA 2EM4A 2RPCA 2EM0A 2EOXA 2EMCA 2EN7A 2EOIA 2JPAA 2E72A 2EN8A 2GLIA 2D9HA 2EMWA 2CSHA 3MHHC 5KL4A 2EM8A 1JK1A 1A1JA 3EPHA 2EPZA 2YSOA 1X3CA 4GZNC 2YTPA 1BB8A 2EMBA 2J7JA 2EPCA 1A1FA 1G2FC 2YRHA 2MKNA 2EL6A 2YU5A 1BBOA 1F2IG 2EM2A 4R2RA 2EQ1A 2EMYA 2PRTA 2DMIA 1AAYA 2A25A 2LO3A 1X6FA 2YTDA 4R2CA 1TF3A 5KL6A 1TF6A 2EN6A 2R1FA 2YTNA 4F6MA 1Z1BA 1UN6B 1P47A 2DLKA 1NCSA 2YSPA 2WCC3 5KL5A 1MEYC 1A1KA 3MHSC 2EMLA 1WJPA 2EMKA 2EOQA 2EN3A 2EOZA 2EOYA 2LV2A 2EQ3A 2EOJA 1A1HA 2DLQA 2EL4A 2ENHA 2YTQA 3EPLA 1DGCA 1G2DC 2DRPA 2WBTA 2EM3A 2M9AA 2WBUA 2DGCA 2JP9A 5KL3A 4FK5C 2EN2A 2EOOA 1RMDA 2VRDA 2HGHA 2ADRA 4R2QA 1X5WA 1TN9A 2EJ4A 4R2DA 1X6HA 2NABA 2EPRA 2EMZA 2EPXA 5KL2A 2EL5A 5KL7A 4M9VC 2CTDA 2ENCA 1ZU1A 4R2PA 2EMIA 2MDGA 1LLMC 2EMHA 4R2AA 2GHFA 2ENAA 1A1LA 2EPAA 4R2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YRK A;  2ELY A;  2YTG A;  2LT7 A;  1A1I A;  2EP3 A;  2BB8 A;  2CT1 A;  2EM7 A;  4F6N A;  2I13 A;  2EOM A;  2MKD A;  2EOH A;  2EM9 A;  1B69 A;  1YSA C;  1ZAA C;  2EM5 A;  2ELZ A;  2YTJ A;  1ZR9 A;  2YRM A;  2EMX A;  2YTF A;  2EPP A;  2LCE A;  1JK2 A;  2EM6 A;  1YUJ A;  2EMF A;  2LVH A;  2RSI A;  4WSG A;  2EN4 A;  2EE8 A;  1X6E A;  2YTI A;  3EPK A;  2EQ0 A;  3M99 B;  4X9J A;  4F2J C;  2EMG A;  2EOR A;  4IS1 C;  1UBD C;  2EOF A;  2EPU A;  2EMA A;  3UK3 C;  2EOE A;  2YU8 A;  1A1G A;  2EN1 A;  2EOS A;  2YTE A;  2WBS A;  4R2E A;  1YUI A;  3EPJ A;  3VHT B;  4IJD A;  1KJK A;  2YTO A;  2EM4 A;  2RPC A;  2EM0 A;  2EOX A;  2EMC A;  2EN7 A;  2EOI A;  2JPA A;  2E72 A;  2EN8 A;  2GLI A;  2D9H A;  2EMW A;  2CSH A;  3MHH C;  5KL4 A;  2EM8 A;  1JK1 A;  1A1J A;  3EPH A;  2EPZ A;  2YSO A;  1X3C A;  4GZN C;  2YTP A;  1BB8 A;  2EMB A;  2J7J A;  2EPC A;  1A1F A;  1G2F C;  2YRH A;  2MKN A;  2EL6 A;  2YU5 A;  1BBO A;  1F2I G;  2EM2 A;  4R2R A;  2EQ1 A;  2EMY A;  2PRT A;  2DMI A;  1AAY A;  2A25 A;  2LO3 A;  1X6F A;  2YTD A;  4R2C A;  1TF3 A;  5KL6 A;  1TF6 A;  2EN6 A;  2R1F A;  2YTN A;  4F6M A;  1Z1B A;  1UN6 B;  1P47 A;  2DLK A;  1NCS A;  2YSP A;  2WCC 3;  5KL5 A;  1MEY C;  1A1K A;  3MHS C;  2EML A;  1WJP A;  2EMK A;  2EOQ A;  2EN3 A;  2EOZ A;  2EOY A;  2LV2 A;  2EQ3 A;  2EOJ A;  1A1H A;  2DLQ A;  2EL4 A;  2ENH A;  2YTQ A;  3EPL A;  1DGC A;  1G2D C;  2DRP A;  2WBT A;  2EM3 A;  2M9A A;  2WBU A;  2DGC A;  2JP9 A;  5KL3 A;  4FK5 C;  2EN2 A;  2EOO A;  1RMD A;  2VRD A;  2HGH A;  2ADR A;  4R2Q A;  1X5W A;  1TN9 A;  2EJ4 A;  4R2D A;  1X6H A;  2NAB A;  2EPR A;  2EMZ A;  2EPX A;  5KL2 A;  2EL5 A;  5KL7 A;  4M9V C;  2CTD A;  2ENC A;  1ZU1 A;  4R2P A;  2EMI A;  2MDG A;  1LLM C;  2EMH A;  4R2A A;  2GHF A;  2ENA A;  1A1L A;  2EPA A;  4R2S A; 
#chains in the Genus database with same CATH topology
 5T6J A;  2LT7 A;  1A1I A;  2ODR C;  1DI2 A;  4BHC A;  2EOM A;  2MKD A;  2KOU A;  1XNR E;  2FGG A;  1ZAA C;  4DV5 E;  5LMU E;  2ZM6 E;  3IWC A;  4BC7 A;  4F9C B;  1YUJ A;  2LVH A;  4NXM E;  2EE8 A;  1X6E A;  4F54 A;  2UU9 E;  3EPK A;  2EOR A;  3AUZ A;  4WPY A;  1L4S A;  2YU8 A;  4X8W A;  2LRS A;  2MC5 A;  2EOS A;  2YTE A;  3BF2 A;  5IT9 C;  4R2E A;  1YUI A;  3IWD A;  4O24 A;  5TSE A;  2N3G A;  3HPZ A;  2EM4 A;  1RC7 A;  1X47 A;  2NUG A;  3AV0 A;  4DUY E;  2E72 A;  2EN8 A;  1HNW E;  3T1Y E;  5IXM B;  5KL4 A;  1A1J A;  4DR3 E;  2EPZ A;  3TQM A;  2DMY A;  3BID A;  4GZN C;  1N33 E;  2EMB A;  2EPC A;  1A1F A;  4OOG C;  1WXR A;  2RTX A;  1XNQ E;  2G7H A;  1STU A;  2PRT A;  1YPN A;  2YT4 A;  1WHN A;  2V88 A;  2YTD A;  1TF3 A;  2V83 A;  4RHB B;  3OML A;  2FV4 B;  2UXD E;  2M1S A;  2WCC 3;  2DSY A;  1AH5 A;  1ZBT A;  1MEY C;  2CPN A;  3MHS C;  2EML A;  1QU6 A;  2F8B A;  2EMK A;  5ADZ A;  2V86 A;  2V89 A;  5LL6 R;  4NXN E;  5LLQ A;  1A1H A;  2YTQ A;  3EPL A;  2DRP A;  2VF1 A;  1HNX E;  1I94 E;  2DGC A;  2JP9 A;  4TUI A;  3H09 A;  4FK5 C;  2NA2 A;  2IHR 1;  5AAS A;  4JI0 E;  1MGT A;  4WFT A;  1T4N A;  2EJ4 A;  2F4V E;  1EH6 A;  2LTS A;  2EPR A;  5KL2 A;  3IWB A;  4Q35 B;  1EKZ A;  4MLQ A;  4JI5 E;  3JTZ A;  3FIG A;  2MDG A;  4BC9 A;  4JI1 E;  2L2K B;  2GHF A;  2ENA A;  4DKK A;  2EPA A;  4R2S A;  2JWO A;  4LF9 E;  3F6G A;  3KZY A;  3ADI A;  3C6K A;  2I13 A;  4YHH E;  1X48 A;  2EM9 A;  2VE7 C;  3J7A G;  2JVA A;  1T4O A;  2RS7 A;  1IMU A;  4DR4 E;  2R76 A;  2EMX A;  2YTF A;  3VYY A;  4DUZ E;  3HQ1 A;  3ADJ A;  2RSI A;  2EN4 A;  2LE2 A;  4JI6 E;  2UXC E;  4GKK E;  2YTI A;  2EQ0 A;  4X9J A;  2EOF A;  2RS6 A;  5AE1 A;  2EOE A;  2GPI A;  2WZO A;  4ZYD A;  2EN1 A;  1IQS A;  4GKJ E;  2MDR A;  2WBS A;  2JOB A;  3EPJ A;  1YFH A;  4IJD A;  4WXC A;  2EMC A;  2EN7 A;  4B3M E;  2GLI A;  1YYO A;  5A6K A;  1X3C A;  2YTP A;  4O5G A;  4BMJ A;  1NEI A;  2YPN A;  2EL6 A;  2HC5 A;  1BBG A;  4L5N C;  1F2I G;  3P1X A;  2EM2 A;  2L33 A;  4OX9 E;  1N32 E;  4DV6 E;  4R2R A;  2DMI A;  2M7Q A;  2A25 A;  1PJT A;  4JI4 E;  1X6F A;  4LF6 E;  1T39 A;  4DR6 E;  4F6M A;  1Z1B A;  5LMN E;  1UN6 B;  2DLK A;  2KHX A;  2YSP A;  4R03 A;  2JR1 A;  4ZYH A;  4NHR A;  2EZ6 A;  3C4T A;  4N4R B;  4B3T E;  1WJP A;  1XMQ E;  2EN3 A;  2L8T A;  2LV2 A;  4HEI A;  1WRJ A;  4JI7 E;  4LFA E;  4K0K E;  1G2D C;  2JY9 A;  2V8Q B;  2VQE E;  4YY3 E;  2L2N A;  4ZYE A;  1N36 E;  2EN2 A;  2H36 X;  2ADR A;  4JI2 E;  2I9I A;  4LF8 E;  2L3J A;  1IBK E;  2B7V A;  4WX9 A;  5A69 A;  1EH8 A;  3VK6 A;  4F9B B;  5KL7 A;  4M9V C;  2CTD A;  1ZU1 A;  4LU9 A;  3HPS A;  4R2P A;  2VQF E;  4X62 E;  1PKP A;  4BBY A;  2DB2 A;  4M0V A;  2CT1 A;  2EM7 A;  4F6N A;  3ZOQ B;  4DR7 E;  1B69 A;  2JOX A;  1YSA C;  4R8O A;  3HXL A;  3K6Q A;  1HR0 E;  1ZR9 A;  2V85 A;  1QNT A;  3BGH A;  4DV1 E;  2L6M A;  2YRM A;  3THO B;  3BBG A;  1GTK A;  4WSG A;  3HTX A;  2V87 A;  5FLX C;  4F2J C;  5F3W A;  1UBD C;  2EPU A;  3DF6 A;  2EMA A;  3UK3 C;  2ODR D;  5A6J A;  3ADL A;  1A1G A;  1J26 A;  4WXD A;  4M2Z A;  1IBL E;  2N3H A;  4HTG A;  1KJK A;  4ZYG A;  2EM0 A;  2EOX A;  2EOI A;  3KWR A;  1KYQ A;  2L92 A;  1T4L B;  2K7I A;  3J81 C;  4DV2 E;  1FJG E;  2D9H A;  2JYA A;  2CSH A;  1N34 E;  2RQL A;  1YYW A;  2N8X A;  2EM8 A;  3EPH A;  2LJU A;  5CFF E;  1PJS A;  2Q8U A;  5AE3 A;  2J7J A;  1G2F C;  4Q28 A;  1T38 A;  1UIL A;  4TUG A;  2LTR A;  1DQ3 A;  4O4K A;  2YU5 A;  1PDA A;  1BBO A;  1IQO A;  1YZ9 A;  5AC5 A;  1AAY A;  1UHZ A;  1TF6 A;  2DIX A;  4LFB E;  2EN6 A;  5AE2 A;  2YTN A;  2EWL A;  1P47 A;  4B3S E;  2KON A;  2K4V A;  4BCA A;  5KL5 A;  4JI8 E;  1RQ0 A;  3ADG A;  2E5L E;  2EOQ A;  2YZT A;  3L00 A;  4WYQ B;  4LFC E;  2EOY A;  2EQ3 A;  4NZV A;  4KWY A;  1FKA E;  2EL4 A;  4AQY E;  5BR8 E;  1N3G A;  2WBT A;  2B9D A;  2WBU A;  4I8O A;  4J8Z A;  5KL3 A;  2L3C A;  2NUE A;  1PJQ A;  4WSP A;  1RMD A;  4R2Q A;  4X66 E;  4M30 A;  3LML A;  1TN9 A;  3J80 C;  4R2D A;  1X6H A;  2JXP A;  1XMO E;  4DV0 E;  3EQ1 A;  4DV3 E;  2UUB E;  4LF5 E;  2EPX A;  2EL5 A;  2ENC A;  3LLH A;  2LMZ A;  2HHH E;  3MSW A;  4R2A A;  3C6M A;  1A1L A;  2YRK A;  2ELY A;  2YTG A;  2EP3 A;  2BB8 A;  5A2Q C;  2EOH A;  2UUA E;  4GEQ B;  4KHP E;  2UXB E;  1O0W A;  2E1M A;  2EM5 A;  3QG5 C;  2ELZ A;  2YTJ A;  4P78 A;  4BHB A;  2EPP A;  2LCE A;  1JK2 A;  2EM6 A;  3T1H E;  2EMF A;  4F9A B;  1EH7 A;  3DJW A;  2EPN A;  3M99 B;  2EMG A;  4IS1 C;  2NUF A;  3JU0 A;  2LUQ A;  4B3R E;  4MLV A;  3VHT B;  2YTO A;  2RPC A;  3JAM C;  4RH8 A;  2LUP B;  4X65 E;  2JPA A;  2MC6 A;  2EMW A;  3MHH C;  5A6A A;  1JK1 A;  2YSO A;  4O43 A;  2HJJ A;  3VYX A;  1BB8 A;  5A6B A;  2YRH A;  2MKN A;  3ECR A;  4DR5 E;  3RMP A;  2B3T B;  4P7D A;  4DR2 E;  2EQ1 A;  2EMY A;  4DMI A;  4L8N A;  2M4I A;  2LO3 A;  4R2C A;  2RSM A;  5KL6 A;  1ZBQ A;  2R1F A;  3C4B A;  4LF4 E;  2EPL X;  4JV5 E;  1J5E E;  1NCS A;  3J7Y p;  3F6H A;  3OTO E;  1SR9 A;  1A1K A;  1GZ6 A;  5A6B D;  1YYK A;  1IBM E;  2EOZ A;  4LTY A;  5DNY A;  4BS9 A;  2EOJ A;  4KZS A;  2DLQ A;  4X64 E;  2LBS B;  1HNZ E;  1DGC A;  2ENH A;  4JI3 E;  2EPM X;  2EM3 A;  2M9A A;  2UUC E;  2FTX B;  4JYA E;  1GQE A;  1WHQ A;  5IWA E;  2L2M A;  2B7T A;  2EOO A;  5AC4 A;  2VRD A;  2HGH A;  1X5W A;  2NAB A;  2EMZ A;  4DR1 E;  3KZZ A;  2EPO A;  4LF7 E;  2YWQ A;  3THN A;  2EMI A;  2LJH A;  1LLM C;  4DV7 E;  2EMH A;  2BBG A;  2EPK X;  1SFE A;  5IV8 B;  1X49 A;  4DV4 E; 
#chains in the Genus database with same CATH homology
 2YRK A;  2ELY A;  2YTG A;  2LT7 A;  1A1I A;  2EP3 A;  2BB8 A;  2CT1 A;  2EM7 A;  4F6N A;  2I13 A;  2EOM A;  2MKD A;  2EOH A;  2EM9 A;  1B69 A;  1YSA C;  1ZAA C;  2EM5 A;  2ELZ A;  2YTJ A;  1ZR9 A;  2YRM A;  2EMX A;  2YTF A;  2EPP A;  2LCE A;  1JK2 A;  2EM6 A;  1YUJ A;  2EMF A;  2LVH A;  2RSI A;  4WSG A;  2EN4 A;  2EE8 A;  1X6E A;  2YTI A;  3EPK A;  2EQ0 A;  3M99 B;  4X9J A;  4F2J C;  2EMG A;  2EOR A;  4IS1 C;  1UBD C;  2EOF A;  2EPU A;  2EMA A;  3UK3 C;  2EOE A;  2YU8 A;  1A1G A;  2EN1 A;  2EOS A;  2YTE A;  2WBS A;  4R2E A;  1YUI A;  3EPJ A;  3VHT B;  4IJD A;  1KJK A;  2YTO A;  2EM4 A;  2RPC A;  2EM0 A;  2EOX A;  2EMC A;  2EN7 A;  2EOI A;  2JPA A;  2E72 A;  2EN8 A;  2GLI A;  2D9H A;  2EMW A;  2CSH A;  3MHH C;  5KL4 A;  2EM8 A;  1JK1 A;  1A1J A;  3EPH A;  2EPZ A;  2YSO A;  1X3C A;  4GZN C;  2YTP A;  1BB8 A;  2EMB A;  2J7J A;  2EPC A;  1A1F A;  1G2F C;  2YRH A;  2MKN A;  2EL6 A;  2YU5 A;  1BBO A;  1F2I G;  2EM2 A;  4R2R A;  2EQ1 A;  2EMY A;  2PRT A;  2DMI A;  1AAY A;  2A25 A;  2LO3 A;  1X6F A;  2YTD A;  4R2C A;  1TF3 A;  5KL6 A;  1TF6 A;  2EN6 A;  2R1F A;  2YTN A;  4F6M A;  1Z1B A;  1UN6 B;  1P47 A;  2DLK A;  1NCS A;  2YSP A;  2WCC 3;  5KL5 A;  1MEY C;  1A1K A;  3MHS C;  2EML A;  1WJP A;  2EMK A;  2EOQ A;  2EN3 A;  2EOZ A;  2EOY A;  2LV2 A;  2EQ3 A;  2EOJ A;  1A1H A;  2DLQ A;  2EL4 A;  2ENH A;  2YTQ A;  3EPL A;  1DGC A;  1G2D C;  2DRP A;  2WBT A;  2EM3 A;  2M9A A;  2WBU A;  2DGC A;  2JP9 A;  5KL3 A;  4FK5 C;  2EN2 A;  2EOO A;  1RMD A;  2VRD A;  2HGH A;  2ADR A;  4R2Q A;  1X5W A;  1TN9 A;  2EJ4 A;  4R2D A;  1X6H A;  2NAB A;  2EPR A;  2EMZ A;  2EPX A;  5KL2 A;  2EL5 A;  5KL7 A;  4M9V C;  2CTD A;  2ENC A;  1ZU1 A;  4R2P A;  2EMI A;  2MDG A;  1LLM C;  2EMH A;  4R2A A;  2GHF A;  2ENA A;  1A1L A;  2EPA A;  4R2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...