2EM8A

Solution structure of the c2h2 type zinc finger (region 423-455) of human zinc finger protein 224
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKPYKCVECGKGYKRRLDLDFHQRVHTGEKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 224
publication title Solution structure of the C2H2 type zinc finger (region 423-455) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em8A01
2RSIA 1A1LA 2EN6A 1JK2A 2EPRA 2J7JA 2EMCA 1BBOA 2EM0A 2EOYA 4R2QA 4F2JC 3MHSC 2GLIA 4FK5C 1NCSA 1ZR9A 2MKNA 1G2FC 2EOOA 2EPXA 1RMDA 2EMYA 2EMWA 2NABA 4R2AA 1A1GA 2EOZA 2EMFA 2A25A 2EM7A 1YUJA 2EM3A 2EPUA 2YTDA 1X3CA 2JP9A 2BB8A 4F6MA 4R2EA 2DMIA 1P47A 2WBUA 4R2SA 2EJ4A 2EL5A 2EN8A 2YTEA 2YTNA 2EM9A 2D9HA 2EL6A 2EMLA 2YTQA 1TF3A 4X9JA 1AAYA 4M9VC 2EMGA 2EPPA 2EM5A 2EM6A 2ENAA 2EOXA 2CSHA 2RPCA 2EPAA 2GHFA 5KL5A 1A1IA 2EOHA 2EQ3A 2LCEA 2EORA 2EE8A 2EN3A 2EMBA 2ELZA 1A1FA 2CTDA 4IJDA 3VHTB 2DLQA 2EOIA 2YTPA 4GZNC 5KL3A 2YTOA 2EOEA 2EQ0A 2R1FA 2EN4A 2EQ1A 2WCC3 4R2DA 4F6NA 2EM8A 2E72A 2EMXA 1UN6B 1Z1BA 2WBTA 4R2PA 2CT1A 2YTFA 2EOQA 2EOJA 2EL4A 2EMIA 2EPCA 1TN9A 2EP3A 4R2RA 2EM4A 3EPHA 5KL2A 2DGCA 2YTJA 2YTIA 2EOMA 4R2CA 5KL4A 3UK3C 2YU5A 1UBDC 2PRTA 3M99B 2ADRA 2EMAA 1G2DC 2EMKA 2EMHA 3EPLA 2WBSA 2DLKA 1YUIA 1A1KA 2EN7A 1LLMC 2YRHA 1X6FA 2DRPA 2I13A 2MDGA 2ENHA 1WJPA 2YSPA 1TF6A 1BB8A 2HGHA 1MEYC 1B69A 1A1JA 2MKDA 2YSOA 5KL7A 2EPZA 1A1HA 3EPJA 1ZAAC 1X6HA 2LV2A 2EN1A 2YRMA 5KL6A 2EOFA 2YTGA 2EMZA 2YRKA 2JPAA 3MHHC 2M9AA 1X5WA 2YU8A 2LVHA 2EN2A 4IS1C 2EOSA 2ELYA 1F2IG 1X6EA 1KJKA 2VRDA 1ZU1A 2LT7A 2LO3A 2EM2A 1DGCA 4WSGA 1YSAC 3EPKA 1JK1A 2ENCA
chains in the Genus database with same CATH superfamily
2JXPA 2L3JA 4BHCA 2RTXA 1IQOA 2EM0A 2EOYA 4R2QA 3MHSC 2GPIA 1N36E 4FK5C 3ADLA 1NCSA 4RHBB 3THNA 2G7HA 2EPXA 4DR1E 3EQ1A 3T1YE 2EMWA 2NABA 2DSYA 3IWBA 4JI7E 4LF4E 5AE1A 2WBUA 4B3SE 3KZYA 3J81C 1PJSA 2EM9A 2D9HA 2LE2A 3ECRA 5F3WA 2V86A 1AAYA 3IWDA 4BCAA 4KHPE 2M4IA 2ODRC 2RPCA 2CSHA 2EPAA 2JY9A 5A6BA 4JYAE 2JWOA 1EKZA 5A6KA 2YZTA 1SR9A 2EMBA 4DV4E 1GTKA 2HHHE 4WPYA 2YPNA 4YHHE 5A2QC 4GKKE 4OX9E 3KWRA 2WCC3 2EN4A 2EM8A 1DI2A 4Q35B 4GKJE 2CT1A 4X8WA 1KYQA 2EMIA 2Q8UA 4DKKA 1TN9A 2N8XA 2EM4A 3EPHA 4N4RB 4JI0E 2IHR1 4DUYE 2DGCA 4DR2E 2YTIA 2EOMA 4WSPA 1N3GA 5AC5A 3UK3C 3HXLA 4LF7E 2YU5A 2RS7A 3BBGA 4B3TE 3BIDA 4YY3E 4DV0E 1GZ6A 2KONA 2MC5A 3EPLA 2N3HA 2DLKA 2V83A 1T39A 4MLQA 2I13A 2R76A 4O43A 4O24A 4TUIA 1J5EE 1ZBQA 3LLHA 1A1JA 2YSOA 1HNZE 1QU6A 5TSEA 3EPJA 1ZAAC 1X6HA 3AV0A 2EN1A 5BR8E 1AH5A 2YTGA 2EMZA 4I8OA 3MHHC 2M9AA 2L6MA 2K7IA 2L8TA 2EN2A 5AASA 1PKPA 2LO3A 5IV8B 1DGCA 1T4NA 2E5LE 2NUFA 4JI2E 4F6MA 1XNQE 1IBKE 5A6BD 1N33E 1A1LA 5CFFE 4F2JC 2YT4A 1N34E 2B7VA 2MKNA 1G2FC 2MDRA 1EH8A 5DNYA 2VF1A 3MSWA 4LFBE 3J7AG 2EOZA 2EMFA 2A25A 2EM3A 4LF6E 1BBGA 3HTXA 4R2EA 2DMIA 4DR5E 2YTNA 3P1XA 3FIGA 4WXDA 2F8BA 1TF3A 3OTOE 1YPNA 4BMJA 2EPPA 1WHNA 4M9VC 5A6AA 2EM6A 5IT9C 4M2ZA 2EOXA 1WRJA 4LF8E 4WYQB 2EORA 1IMUA 1ZBTA 2LUQA 2EE8A 2EN3A 2B7TA 3VHTB 2M7QA 2B9DA 1DQ3A 2EQ0A 1YYOA 2EQ1A 2E72A 3C6MA 2EMXA 2LMZA 4BC9A 4JI8E 4R2PA 1PJQA 2EOQA 2ZM6E 1X49A 3HPZA 5KL2A 4DUZE 3F6HA 2ODRD 2NUEA 1T38A 2M1SA 2YTJA 4F9BB 2HJJA 4R2CA 5KL4A 3C4TA 4R8OA 4R03A 1G2DC 1X48A 2WBSA 1A1KA 2EN7A 4L5NC 4NXME 3THOB 2YRHA 2DRPA 1FJGE 2LTRA 2RS6A 4KZSA 2YSPA 1TF6A 2JVAA 1BB8A 1WXRA 1B69A 2B3TB 2KHXA 2MKDA 5KL7A 2FV4B 3IWCA 2EPZA 1A1HA 4WFTA 5AE2A 2V8QB 1GQEA 2LJUA 2L2KB 2EPLX 5ADZA 2LTSA 1UHZA 1L4SA 4BS9A 4IS1C 1F2IG 1SFEA 1X6EA 3AUZA 2V85A 4BBYA 1EH7A 2EM2A 3TQMA 1YSAC 5LMUE 1HNWE 2H36X 2ENCA 2JR1A 2RSIA 2EN6A 2EPRA 2J7JA 1HNXE 2EMCA 1X47A 1BBOA 4Q28A 3VYXA 4DV6E 1XMQE 2RQLA 2V89A 5IXMB 2FGGA 1PJTA 4DMIA 2NUGA 5FLXC 4K0KE 4HTGA 4R2AA 1YUJA 2EM7A 2YTDA 2BB8A 2N3GA 3H09A 1J26A 4BHBA 4F9CB 2EL5A 2EN8A 2RSMA 3ADJA 2YTQA 2EPNA 4X9JA 4M30A 4JI5E 2ENAA 3ADIA 1YYKA 1N32E 4JI6E 2E1MA 1A1IA 3LMLA 1IQSA 4LTYA 1IBLE 2L3CA 4DV7E 2CTDA 4IJDA 2DLQA 2EOIA 2YTPA 4NHRA 4JI3E 1HR0E 2EOEA 2R1FA 2UXDE 1XNRE 2WZOA 4LU9A 3JAMC 1UN6B 4GEQB 3HPSA 1Z1BA 2WBTA 2EOJA 4M0VA 2EL4A 3C4BA 4R2RA 4JI1E 2V88A 2VE7C 2UUAE 4F54A 4WXCA 1XMOE 2L33A 2PRTA 3M99B 4L8NA 2EZ6A 2CPNA 1YUIA 3BGHA 2L2NA 5LLQA 4DV3E 2VQEE 3KZZA 4J8ZA 2DB2A 1T4OA 4JV5E 2MDGA 1WJPA 2HGHA 1FKAE 2EWLA 3ADGA 2JOXA 4MLVA 3HQ1A 1IBME 1UILA 2LV2A 2MC6A 2I9IA 4TUGA 3OMLA 4NXNE 1EH6A 2L2MA 4ZYEA 2YU8A 2LVHA 2EOSA 2ELYA 4B3ME 2VRDA 1ZU1A 2LT7A 4ZYHA 2DIXA 4WSGA 4JI4E 1JK1A 3T1HE 5AE3A 1JK2A 3F6GA 4DR6E 1WHQA 2GLIA 1ZR9A 4WX9A 2EOOA 5IWAE 4RH8A 3C6KA 1RMDA 3BF2A 2EMYA 3DJWA 1A1GA 2VQFE 4B3RE 2LBSB 2EPUA 2FTXB 4P7DA 2LUPB 4DV2E 2JP9A 1X3CA 2NA2A 2HC5A 1P47A 3QG5C 4R2SA 2EJ4A 2YTEA 2V87A 2YWQA 2EL6A 2EMLA 2DMYA 3VK6A 2EMGA 2EM5A 5A69A 2JOBA 4NZVA 2GHFA 5KL5A 2EOHA 2EQ3A 1YFHA 2LCEA 4DR3E 3JU0A 4X65E 2ELZA 4AQYE 1I94E 1A1FA 4GZNC 2UUBE 2UXBE 4KWYA 5KL3A 1O0WA 2YTOA 1PDAA 5AC4A 4X64E 4F6NA 4R2DA 2JYAA 4F9AB 1YZ9A 3J80C 2YTFA 4LF5E 2UU9E 2EPCA 4BC7A 2EP3A 4LF9E 4DV1E 4DV5E 4ZYGA 4X66E 1QNTA 3RMPA 3K6QA 1UBDC 1MGTA 2L92A 1RQ0A 2EPKX 4O4KA 2UXCE 2ADRA 2K4VA 2EMAA 2KOUA 4ZYDA 1NEIA 4X62E 2EMKA 2EMHA 2LRSA 1LLMC 1X6FA 1YYWA 4LFCE 5LL6R 2ENHA 2EPOA 1RC7A 1MEYC 1T4LB 1STUA 4DR7E 4OOGC 3DF6A 3JTZA 4DR4E 2EPMX 3L00A 2YRMA 5KL6A 4HEIA 5LMNE 2EOFA 2YRKA 2JPAA 2LJHA 3VYYA 5A6JA 4O5GA 4LFAE 5T6JA 3J7Yp 3ZOQB 1X5WA 4P78A 1KJKA 2BBGA 2F4VE 3EPKA 2UUCE
chains in the Genus database with same CATH topology
2RSIA 1A1LA 2EN6A 1JK2A 2EPRA 2J7JA 2EMCA 1BBOA 2EM0A 2EOYA 4R2QA 4F2JC 3MHSC 2GLIA 4FK5C 1NCSA 1ZR9A 2MKNA 1G2FC 2EOOA 2EPXA 1RMDA 2EMYA 2EMWA 2NABA 4R2AA 1A1GA 2EOZA 2EMFA 2A25A 2EM7A 1YUJA 2EM3A 2EPUA 2YTDA 1X3CA 2JP9A 2BB8A 4F6MA 4R2EA 2DMIA 1P47A 2WBUA 4R2SA 2EJ4A 2EL5A 2EN8A 2YTEA 2YTNA 2EM9A 2D9HA 2EL6A 2EMLA 2YTQA 1TF3A 4X9JA 1AAYA 4M9VC 2EMGA 2EPPA 2EM5A 2EM6A 2ENAA 2EOXA 2CSHA 2RPCA 2EPAA 2GHFA 5KL5A 1A1IA 2EOHA 2EQ3A 2LCEA 2EORA 2EE8A 2EN3A 2EMBA 2ELZA 1A1FA 2CTDA 4IJDA 3VHTB 2DLQA 2EOIA 2YTPA 4GZNC 5KL3A 2YTOA 2EOEA 2EQ0A 2R1FA 2EN4A 2EQ1A 2WCC3 4R2DA 4F6NA 2EM8A 2E72A 2EMXA 1UN6B 1Z1BA 2WBTA 4R2PA 2CT1A 2YTFA 2EOQA 2EOJA 2EL4A 2EMIA 2EPCA 1TN9A 2EP3A 4R2RA 2EM4A 3EPHA 5KL2A 2DGCA 2YTJA 2YTIA 2EOMA 4R2CA 5KL4A 3UK3C 2YU5A 1UBDC 2PRTA 3M99B 2ADRA 2EMAA 1G2DC 2EMKA 2EMHA 3EPLA 2WBSA 2DLKA 1YUIA 1A1KA 2EN7A 1LLMC 2YRHA 1X6FA 2DRPA 2I13A 2MDGA 2ENHA 1WJPA 2YSPA 1TF6A 1BB8A 2HGHA 1MEYC 1B69A 1A1JA 2MKDA 2YSOA 5KL7A 2EPZA 1A1HA 3EPJA 1ZAAC 1X6HA 2LV2A 2EN1A 2YRMA 5KL6A 2EOFA 2YTGA 2EMZA 2YRKA 2JPAA 3MHHC 2M9AA 1X5WA 2YU8A 2LVHA 2EN2A 4IS1C 2EOSA 2ELYA 1F2IG 1X6EA 1KJKA 2VRDA 1ZU1A 2LT7A 2LO3A 2EM2A 1DGCA 4WSGA 1YSAC 3EPKA 1JK1A 2ENCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSI A;  1A1L A;  2EN6 A;  1JK2 A;  2EPR A;  2J7J A;  2EMC A;  1BBO A;  2EM0 A;  2EOY A;  4R2Q A;  4F2J C;  3MHS C;  2GLI A;  4FK5 C;  1NCS A;  1ZR9 A;  2MKN A;  1G2F C;  2EOO A;  2EPX A;  1RMD A;  2EMY A;  2EMW A;  2NAB A;  4R2A A;  1A1G A;  2EOZ A;  2EMF A;  2A25 A;  2EM7 A;  1YUJ A;  2EM3 A;  2EPU A;  2YTD A;  1X3C A;  2JP9 A;  2BB8 A;  4F6M A;  4R2E A;  2DMI A;  1P47 A;  2WBU A;  4R2S A;  2EJ4 A;  2EL5 A;  2EN8 A;  2YTE A;  2YTN A;  2EM9 A;  2D9H A;  2EL6 A;  2EML A;  2YTQ A;  1TF3 A;  4X9J A;  1AAY A;  4M9V C;  2EMG A;  2EPP A;  2EM5 A;  2EM6 A;  2ENA A;  2EOX A;  2CSH A;  2RPC A;  2EPA A;  2GHF A;  5KL5 A;  1A1I A;  2EOH A;  2EQ3 A;  2LCE A;  2EOR A;  2EE8 A;  2EN3 A;  2EMB A;  2ELZ A;  1A1F A;  2CTD A;  4IJD A;  3VHT B;  2DLQ A;  2EOI A;  2YTP A;  4GZN C;  5KL3 A;  2YTO A;  2EOE A;  2EQ0 A;  2R1F A;  2EN4 A;  2EQ1 A;  2WCC 3;  4R2D A;  4F6N A;  2EM8 A;  2E72 A;  2EMX A;  1UN6 B;  1Z1B A;  2WBT A;  4R2P A;  2CT1 A;  2YTF A;  2EOQ A;  2EOJ A;  2EL4 A;  2EMI A;  2EPC A;  1TN9 A;  2EP3 A;  4R2R A;  2EM4 A;  3EPH A;  5KL2 A;  2DGC A;  2YTJ A;  2YTI A;  2EOM A;  4R2C A;  5KL4 A;  3UK3 C;  2YU5 A;  1UBD C;  2PRT A;  3M99 B;  2ADR A;  2EMA A;  1G2D C;  2EMK A;  2EMH A;  3EPL A;  2WBS A;  2DLK A;  1YUI A;  1A1K A;  2EN7 A;  1LLM C;  2YRH A;  1X6F A;  2DRP A;  2I13 A;  2MDG A;  2ENH A;  1WJP A;  2YSP A;  1TF6 A;  1BB8 A;  2HGH A;  1MEY C;  1B69 A;  1A1J A;  2MKD A;  2YSO A;  5KL7 A;  2EPZ A;  1A1H A;  3EPJ A;  1ZAA C;  1X6H A;  2LV2 A;  2EN1 A;  2YRM A;  5KL6 A;  2EOF A;  2YTG A;  2EMZ A;  2YRK A;  2JPA A;  3MHH C;  2M9A A;  1X5W A;  2YU8 A;  2LVH A;  2EN2 A;  4IS1 C;  2EOS A;  2ELY A;  1F2I G;  1X6E A;  1KJK A;  2VRD A;  1ZU1 A;  2LT7 A;  2LO3 A;  2EM2 A;  1DGC A;  4WSG A;  1YSA C;  3EPK A;  1JK1 A;  2ENC A; 
#chains in the Genus database with same CATH topology
 2JXP A;  2L3J A;  4BHC A;  2RTX A;  1IQO A;  2EM0 A;  2EOY A;  4R2Q A;  3MHS C;  2GPI A;  1N36 E;  4FK5 C;  3ADL A;  1NCS A;  4RHB B;  3THN A;  2G7H A;  2EPX A;  4DR1 E;  3EQ1 A;  3T1Y E;  2EMW A;  2NAB A;  2DSY A;  3IWB A;  4JI7 E;  4LF4 E;  5AE1 A;  2WBU A;  4B3S E;  3KZY A;  3J81 C;  1PJS A;  2EM9 A;  2D9H A;  2LE2 A;  3ECR A;  5F3W A;  2V86 A;  1AAY A;  3IWD A;  4BCA A;  4KHP E;  2M4I A;  2ODR C;  2RPC A;  2CSH A;  2EPA A;  2JY9 A;  5A6B A;  4JYA E;  2JWO A;  1EKZ A;  5A6K A;  2YZT A;  1SR9 A;  2EMB A;  4DV4 E;  1GTK A;  2HHH E;  4WPY A;  2YPN A;  4YHH E;  5A2Q C;  4GKK E;  4OX9 E;  3KWR A;  2WCC 3;  2EN4 A;  2EM8 A;  1DI2 A;  4Q35 B;  4GKJ E;  2CT1 A;  4X8W A;  1KYQ A;  2EMI A;  2Q8U A;  4DKK A;  1TN9 A;  2N8X A;  2EM4 A;  3EPH A;  4N4R B;  4JI0 E;  2IHR 1;  4DUY E;  2DGC A;  4DR2 E;  2YTI A;  2EOM A;  4WSP A;  1N3G A;  5AC5 A;  3UK3 C;  3HXL A;  4LF7 E;  2YU5 A;  2RS7 A;  3BBG A;  4B3T E;  3BID A;  4YY3 E;  4DV0 E;  1GZ6 A;  2KON A;  2MC5 A;  3EPL A;  2N3H A;  2DLK A;  2V83 A;  1T39 A;  4MLQ A;  2I13 A;  2R76 A;  4O43 A;  4O24 A;  4TUI A;  1J5E E;  1ZBQ A;  3LLH A;  1A1J A;  2YSO A;  1HNZ E;  1QU6 A;  5TSE A;  3EPJ A;  1ZAA C;  1X6H A;  3AV0 A;  2EN1 A;  5BR8 E;  1AH5 A;  2YTG A;  2EMZ A;  4I8O A;  3MHH C;  2M9A A;  2L6M A;  2K7I A;  2L8T A;  2EN2 A;  5AAS A;  1PKP A;  2LO3 A;  5IV8 B;  1DGC A;  1T4N A;  2E5L E;  2NUF A;  4JI2 E;  4F6M A;  1XNQ E;  1IBK E;  5A6B D;  1N33 E;  1A1L A;  5CFF E;  4F2J C;  2YT4 A;  1N34 E;  2B7V A;  2MKN A;  1G2F C;  2MDR A;  1EH8 A;  5DNY A;  2VF1 A;  3MSW A;  4LFB E;  3J7A G;  2EOZ A;  2EMF A;  2A25 A;  2EM3 A;  4LF6 E;  1BBG A;  3HTX A;  4R2E A;  2DMI A;  4DR5 E;  2YTN A;  3P1X A;  3FIG A;  4WXD A;  2F8B A;  1TF3 A;  3OTO E;  1YPN A;  4BMJ A;  2EPP A;  1WHN A;  4M9V C;  5A6A A;  2EM6 A;  5IT9 C;  4M2Z A;  2EOX A;  1WRJ A;  4LF8 E;  4WYQ B;  2EOR A;  1IMU A;  1ZBT A;  2LUQ A;  2EE8 A;  2EN3 A;  2B7T A;  3VHT B;  2M7Q A;  2B9D A;  1DQ3 A;  2EQ0 A;  1YYO A;  2EQ1 A;  2E72 A;  3C6M A;  2EMX A;  2LMZ A;  4BC9 A;  4JI8 E;  4R2P A;  1PJQ A;  2EOQ A;  2ZM6 E;  1X49 A;  3HPZ A;  5KL2 A;  4DUZ E;  3F6H A;  2ODR D;  2NUE A;  1T38 A;  2M1S A;  2YTJ A;  4F9B B;  2HJJ A;  4R2C A;  5KL4 A;  3C4T A;  4R8O A;  4R03 A;  1G2D C;  1X48 A;  2WBS A;  1A1K A;  2EN7 A;  4L5N C;  4NXM E;  3THO B;  2YRH A;  2DRP A;  1FJG E;  2LTR A;  2RS6 A;  4KZS A;  2YSP A;  1TF6 A;  2JVA A;  1BB8 A;  1WXR A;  1B69 A;  2B3T B;  2KHX A;  2MKD A;  5KL7 A;  2FV4 B;  3IWC A;  2EPZ A;  1A1H A;  4WFT A;  5AE2 A;  2V8Q B;  1GQE A;  2LJU A;  2L2K B;  2EPL X;  5ADZ A;  2LTS A;  1UHZ A;  1L4S A;  4BS9 A;  4IS1 C;  1F2I G;  1SFE A;  1X6E A;  3AUZ A;  2V85 A;  4BBY A;  1EH7 A;  2EM2 A;  3TQM A;  1YSA C;  5LMU E;  1HNW E;  2H36 X;  2ENC A;  2JR1 A;  2RSI A;  2EN6 A;  2EPR A;  2J7J A;  1HNX E;  2EMC A;  1X47 A;  1BBO A;  4Q28 A;  3VYX A;  4DV6 E;  1XMQ E;  2RQL A;  2V89 A;  5IXM B;  2FGG A;  1PJT A;  4DMI A;  2NUG A;  5FLX C;  4K0K E;  4HTG A;  4R2A A;  1YUJ A;  2EM7 A;  2YTD A;  2BB8 A;  2N3G A;  3H09 A;  1J26 A;  4BHB A;  4F9C B;  2EL5 A;  2EN8 A;  2RSM A;  3ADJ A;  2YTQ A;  2EPN A;  4X9J A;  4M30 A;  4JI5 E;  2ENA A;  3ADI A;  1YYK A;  1N32 E;  4JI6 E;  2E1M A;  1A1I A;  3LML A;  1IQS A;  4LTY A;  1IBL E;  2L3C A;  4DV7 E;  2CTD A;  4IJD A;  2DLQ A;  2EOI A;  2YTP A;  4NHR A;  4JI3 E;  1HR0 E;  2EOE A;  2R1F A;  2UXD E;  1XNR E;  2WZO A;  4LU9 A;  3JAM C;  1UN6 B;  4GEQ B;  3HPS A;  1Z1B A;  2WBT A;  2EOJ A;  4M0V A;  2EL4 A;  3C4B A;  4R2R A;  4JI1 E;  2V88 A;  2VE7 C;  2UUA E;  4F54 A;  4WXC A;  1XMO E;  2L33 A;  2PRT A;  3M99 B;  4L8N A;  2EZ6 A;  2CPN A;  1YUI A;  3BGH A;  2L2N A;  5LLQ A;  4DV3 E;  2VQE E;  3KZZ A;  4J8Z A;  2DB2 A;  1T4O A;  4JV5 E;  2MDG A;  1WJP A;  2HGH A;  1FKA E;  2EWL A;  3ADG A;  2JOX A;  4MLV A;  3HQ1 A;  1IBM E;  1UIL A;  2LV2 A;  2MC6 A;  2I9I A;  4TUG A;  3OML A;  4NXN E;  1EH6 A;  2L2M A;  4ZYE A;  2YU8 A;  2LVH A;  2EOS A;  2ELY A;  4B3M E;  2VRD A;  1ZU1 A;  2LT7 A;  4ZYH A;  2DIX A;  4WSG A;  4JI4 E;  1JK1 A;  3T1H E;  5AE3 A;  1JK2 A;  3F6G A;  4DR6 E;  1WHQ A;  2GLI A;  1ZR9 A;  4WX9 A;  2EOO A;  5IWA E;  4RH8 A;  3C6K A;  1RMD A;  3BF2 A;  2EMY A;  3DJW A;  1A1G A;  2VQF E;  4B3R E;  2LBS B;  2EPU A;  2FTX B;  4P7D A;  2LUP B;  4DV2 E;  2JP9 A;  1X3C A;  2NA2 A;  2HC5 A;  1P47 A;  3QG5 C;  4R2S A;  2EJ4 A;  2YTE A;  2V87 A;  2YWQ A;  2EL6 A;  2EML A;  2DMY A;  3VK6 A;  2EMG A;  2EM5 A;  5A69 A;  2JOB A;  4NZV A;  2GHF A;  5KL5 A;  2EOH A;  2EQ3 A;  1YFH A;  2LCE A;  4DR3 E;  3JU0 A;  4X65 E;  2ELZ A;  4AQY E;  1I94 E;  1A1F A;  4GZN C;  2UUB E;  2UXB E;  4KWY A;  5KL3 A;  1O0W A;  2YTO A;  1PDA A;  5AC4 A;  4X64 E;  4F6N A;  4R2D A;  2JYA A;  4F9A B;  1YZ9 A;  3J80 C;  2YTF A;  4LF5 E;  2UU9 E;  2EPC A;  4BC7 A;  2EP3 A;  4LF9 E;  4DV1 E;  4DV5 E;  4ZYG A;  4X66 E;  1QNT A;  3RMP A;  3K6Q A;  1UBD C;  1MGT A;  2L92 A;  1RQ0 A;  2EPK X;  4O4K A;  2UXC E;  2ADR A;  2K4V A;  2EMA A;  2KOU A;  4ZYD A;  1NEI A;  4X62 E;  2EMK A;  2EMH A;  2LRS A;  1LLM C;  1X6F A;  1YYW A;  4LFC E;  5LL6 R;  2ENH A;  2EPO A;  1RC7 A;  1MEY C;  1T4L B;  1STU A;  4DR7 E;  4OOG C;  3DF6 A;  3JTZ A;  4DR4 E;  2EPM X;  3L00 A;  2YRM A;  5KL6 A;  4HEI A;  5LMN E;  2EOF A;  2YRK A;  2JPA A;  2LJH A;  3VYY A;  5A6J A;  4O5G A;  4LFA E;  5T6J A;  3J7Y p;  3ZOQ B;  1X5W A;  4P78 A;  1KJK A;  2BBG A;  2F4V E;  3EPK A;  2UUC E; 
#chains in the Genus database with same CATH homology
 2RSI A;  1A1L A;  2EN6 A;  1JK2 A;  2EPR A;  2J7J A;  2EMC A;  1BBO A;  2EM0 A;  2EOY A;  4R2Q A;  4F2J C;  3MHS C;  2GLI A;  4FK5 C;  1NCS A;  1ZR9 A;  2MKN A;  1G2F C;  2EOO A;  2EPX A;  1RMD A;  2EMY A;  2EMW A;  2NAB A;  4R2A A;  1A1G A;  2EOZ A;  2EMF A;  2A25 A;  2EM7 A;  1YUJ A;  2EM3 A;  2EPU A;  2YTD A;  1X3C A;  2JP9 A;  2BB8 A;  4F6M A;  4R2E A;  2DMI A;  1P47 A;  2WBU A;  4R2S A;  2EJ4 A;  2EL5 A;  2EN8 A;  2YTE A;  2YTN A;  2EM9 A;  2D9H A;  2EL6 A;  2EML A;  2YTQ A;  1TF3 A;  4X9J A;  1AAY A;  4M9V C;  2EMG A;  2EPP A;  2EM5 A;  2EM6 A;  2ENA A;  2EOX A;  2CSH A;  2RPC A;  2EPA A;  2GHF A;  5KL5 A;  1A1I A;  2EOH A;  2EQ3 A;  2LCE A;  2EOR A;  2EE8 A;  2EN3 A;  2EMB A;  2ELZ A;  1A1F A;  2CTD A;  4IJD A;  3VHT B;  2DLQ A;  2EOI A;  2YTP A;  4GZN C;  5KL3 A;  2YTO A;  2EOE A;  2EQ0 A;  2R1F A;  2EN4 A;  2EQ1 A;  2WCC 3;  4R2D A;  4F6N A;  2EM8 A;  2E72 A;  2EMX A;  1UN6 B;  1Z1B A;  2WBT A;  4R2P A;  2CT1 A;  2YTF A;  2EOQ A;  2EOJ A;  2EL4 A;  2EMI A;  2EPC A;  1TN9 A;  2EP3 A;  4R2R A;  2EM4 A;  3EPH A;  5KL2 A;  2DGC A;  2YTJ A;  2YTI A;  2EOM A;  4R2C A;  5KL4 A;  3UK3 C;  2YU5 A;  1UBD C;  2PRT A;  3M99 B;  2ADR A;  2EMA A;  1G2D C;  2EMK A;  2EMH A;  3EPL A;  2WBS A;  2DLK A;  1YUI A;  1A1K A;  2EN7 A;  1LLM C;  2YRH A;  1X6F A;  2DRP A;  2I13 A;  2MDG A;  2ENH A;  1WJP A;  2YSP A;  1TF6 A;  1BB8 A;  2HGH A;  1MEY C;  1B69 A;  1A1J A;  2MKD A;  2YSO A;  5KL7 A;  2EPZ A;  1A1H A;  3EPJ A;  1ZAA C;  1X6H A;  2LV2 A;  2EN1 A;  2YRM A;  5KL6 A;  2EOF A;  2YTG A;  2EMZ A;  2YRK A;  2JPA A;  3MHH C;  2M9A A;  1X5W A;  2YU8 A;  2LVH A;  2EN2 A;  4IS1 C;  2EOS A;  2ELY A;  1F2I G;  1X6E A;  1KJK A;  2VRD A;  1ZU1 A;  2LT7 A;  2LO3 A;  2EM2 A;  1DGC A;  4WSG A;  1YSA C;  3EPK A;  1JK1 A;  2ENC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...