2EM8A

Solution structure of the c2h2 type zinc finger (region 423-455) of human zinc finger protein 224
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
46
structure length
46
Chain Sequence
GSSGSSGSGEKPYKCVECGKGYKRRLDLDFHQRVHTGEKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 423-455) of human Zinc finger protein 224
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 224
total genus 9
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2em8A01
2E72A 2EMGA 1RMDA 2RSIA 2DRPA 1WJPA 2EP3A 4F6MA 1UBDC 2EPCA 2CTDA 2EMAA 2EM3A 2EOYA 1X6EA 2VRDA 2CT1A 4M9VC 2R1FA 1G2DC 2EM5A 2J7JA 2EM2A 2RPCA 4R2DA 2EM4A 2A25A 2LV2A 2YSOA 2LO3A 5KL3A 1JK2A 5KL7A 3EPJA 2ELYA 2EN8A 2EM9A 2YTQA 2EPPA 1TN9A 2EMIA 2YTNA 2DMIA 4R2EA 4F2JC 2EOQA 2EL4A 2BB8A 1ZAAC 2EMZA 1F2IG 2ENHA 1A1LA 2EQ1A 4R2CA 1A1GA 4GZNC 2EOFA 1X3CA 1ZU1A 2EN6A 2EOMA 4R2QA 2MKNA 5KL5A 2EPXA 2GLIA 2NABA 1YSAC 2YTOA 3EPHA 4X9JA 2LT7A 1A1HA 1KJKA 2ELZA 1X6HA 1DGCA 2EM7A 2YSPA 2EOEA 4R2AA 2HGHA 2DGCA 2EL6A 2EOOA 1YUJA 2YTIA 2EM0A 2YTGA 5KL4A 2EN2A 2EMHA 2DLKA 2YRHA 1AAYA 2EOXA 3EPLA 2EN3A 1TF6A 2WBTA 2ENAA 2EMCA 1JK1A 2M9AA 4WSGA 2D9HA 2EPAA 1YUIA 2ADRA 4R2RA 2YU5A 2ENCA 4IJDA 1BBOA 2EMWA 5KL2A 2EM8A 1NCSA 2EOZA 3UK3C 2EPRA 2YRKA 1A1JA 2WCC3 1A1KA 1MEYC 2EPUA 2EMXA 2EMLA 2EMBA 2EOIA 3M99B 4R2SA 4F6NA 2EOJA 3MHHC 2WBUA 2EJ4A 4FK5C 2YTEA 5KL6A 2EMFA 2EM6A 2YTDA 2EE8A 1B69A 2EN7A 1BB8A 2EPZA 2YTPA 4IS1C 3MHSC 4R2PA 1UN6B 2EN4A 2CSHA 1A1FA 2EMKA 2EMYA 2EQ3A 2YTJA 2LVHA 2EN1A 2EOSA 2WBSA 2MKDA 1A1IA 1ZR9A 2EORA 2JPAA 2LCEA 1P47A 2GHFA 2EQ0A 1X5WA 1TF3A 2YTFA 2MDGA 2EOHA 1Z1BA 3EPKA 1X6FA 3VHTB 2YU8A 2YRMA 2PRTA 2JP9A 2I13A 1LLMC 1G2FC 2DLQA 2EL5A
chains in the Genus database with same CATH superfamily
2LMZA 4B3RE 1RMDA 2L2KB 4F6MA 2L3CA 4KWYA 3OMLA 2K7IA 2EM3A 3BGHA 2VRDA 1EH6A 2DSYA 4JI6E 1QU6A 3AV0A 3LLHA 2YSOA 1FKAE 3C4BA 1WHNA 1JK2A 2LJHA 2UUAE 2EN8A 4BCAA 2YTNA 2LTSA 2DMIA 1XMQE 3ZOQB 2BB8A 2VQEE 1YPNA 2FV4B 4R2CA 1ZU1A 4X65E 2MKNA 3L00A 5A6JA 2GLIA 2EPOA 4RHBB 3EPHA 2HHHE 1A1HA 2ELZA 4LF6E 1DGCA 4B3TE 2UXCE 4JI3E 2YSPA 5A6BD 4R2AA 1DI2A 3C6KA 4LF4E 3VK6A 2KOUA 2EL6A 1EKZA 1YUJA 4LFAE 1HNZE 2YTIA 2YTGA 1GQEA 2RSMA 4L5NC 2EMHA 5LLQA 2V88A 1N34E 4JI7E 1TF6A 1N36E 2WBTA 4TUGA 2ODRC 3HPZA 1JK1A 1YYOA 2DMYA 5AASA 2FGGA 2JR1A 2ENCA 3HXLA 3C4TA 4F9CB 2EMWA 2EOZA 2JWOA 2EPRA 3IWBA 4LF9E 2L6MA 1RQ0A 2EMXA 4WXCA 2EOJA 2WBUA 2M4IA 3C6MA 2YTEA 2B7VA 2MDRA 4DMIA 2EM6A 4X64E 3P1XA 2YTPA 2B9DA 4R2PA 2V87A 1IMUA 2B7TA 3THOB 4YY3E 2V86A 5TSEA 2GHFA 2EQ0A 2MDGA 1KYQA 4DR2E 2LBSB 1IQOA 1QNTA 4OX9E 2IHR1 2JP9A 2I13A 1GZ6A 2DLQA 1ZBTA 1MGTA 2RSIA 2EP3A 5BR8E 5A6AA 2EPCA 4LF8E 1I94E 4L8NA 4P7DA 2HC5A 2UUBE 2F8BA 1X6EA 2CT1A 2R1FA 1X49A 2E1MA 2J7JA 2N3HA 2RPCA 2YWQA 2JXPA 2LUQA 2A25A 4OOGC 2LO3A 5KL3A 2HJJA 1J5EE 5CFFE 2EPPA 2EMIA 4R2EA 4F2JC 2EL4A 4DR5E 3ADLA 2LJUA 2EMZA 4M0VA 1F2IG 2Q8UA 1A1LA 4K0KE 2YZTA 2EQ1A 2LE2A 2EN6A 2V85A 1J26A 4TUIA 2ZM6E 5DNYA 2LT7A 1KJKA 4DV5E 4P78A 1X6HA 3JAMC 2EOEA 1WXRA 3RMPA 2DGCA 2EOOA 3FIGA 4JI5E 4DR3E 4DV6E 2EOXA 1AAYA 4JI0E 2EMCA 2M9AA 4O24A 2D9HA 3JTZA 4BS9A 1SFEA 2L92A 3THNA 1N33E 1BBGA 4Q28A 3JU0A 4DR4E 4X62E 1WRJA 4LU9A 2V89A 4DV4E 1A1JA 4DR7E 4NHRA 2M7QA 1HR0E 2WCC3 3MSWA 2BBGA 2EOIA 4R2SA 4DUZE 5AE3A 3MHHC 4F6NA 4GEQB 5AE2A 5KL6A 2UU9E 2EMFA 2EPLX 2EE8A 1BB8A 3DF6A 4WXDA 3MHSC 2VQFE 3EQ1A 4WSPA 3HQ1A 4M2ZA 1UN6B 2NUEA 4DV3E 2EN4A 2EZ6A 2CSHA 2RS7A 2EMYA 2LVHA 2EN1A 3J81C 1XNQE 1T38A 1A1IA 1ZR9A 2JPAA 1P47A 4I8OA 1IBME 2JOXA 1X6FA 2CPNA 3VYXA 2NUFA 2YU8A 3ADIA 2YRMA 2PRTA 2L2NA 4KHPE 3T1HE 3F6GA 1O0WA 2EMGA 3BF2A 1UHZA 3J7Yp 3ADJA 4BC9A 4O5GA 4JI2E 1FJGE 4R8OA 4M9VC 1G2DC 2EM5A 3KZZA 2V8QB 4ZYDA 4GKKE 4R2DA 2DIXA 4BC7A 2H36X 3J80C 1X48A 3EPJA 2ELYA 2EM9A 2YTQA 1TN9A 3BBGA 2EOQA 1ZAAC 1A1GA 4GZNC 3QG5C 4ZYHA 1X3CA 3BIDA 4RH8A 1IBKE 2B3TB 5A69A 1RC7A 2EPXA 1YYKA 3VYYA 4YHHE 1IBLE 1YSAC 4X8WA 5A6KA 2YTOA 4LFCE 2VE7C 4GKJE 3F6HA 2I9IA 2EM7A 1DQ3A 2YPNA 2HGHA 1EH8A 4WPYA 2EN2A 5KL4A 3TQMA 2YRHA 3EPLA 3T1YE 5A2QC 4JI1E 2RS6A 2EN3A 1PJTA 4F54A 1X47A 2JYAA 2KONA 4WX9A 1YUIA 2ADRA 4R2RA 4O4KA 4ZYEA 1YFHA 4IJDA 1BBOA 4F9AB 4JI4E 2UUCE 2V83A 1PDAA 3HTXA 4LFBE 2JY9A 4LF5E 5T6JA 2RTXA 2L2MA 2ODRD 2EMBA 2N3GA 3M99B 4NZVA 1EH7A 2EJ4A 4MLVA 2E5LE 2YTDA 4ZYGA 1T4LB 1YZ9A 1YYWA 1AH5A 2EN7A 1T4OA 4B3ME 2K4VA 5LMNE 2F4VE 1A1FA 4N4RB 1PKPA 2YTJA 5A6BA 4B3SE 1UILA 1XNRE 4JI8E 2VF1A 4NXNE 3ECRA 3IWDA 2EOSA 4HEIA 4F9BB 2MKDA 2YT4A 1HNWE 1WHQA 2EORA 2UXBE 5IWAE 1TF3A 1Z1BA 3VHTB 4LTYA 2UXDE 3KWRA 4DKKA 2MC6A 5LMUE 4DR1E 1LLMC 1G2FC 2EL5A 2G7HA 2E72A 4JYAE 2DRPA 5AE1A 1WJPA 1UBDC 2EPMX 2CTDA 2EMAA 4MLQA 4Q35B 1PJSA 2EOYA 5FLXC 4NXME 4J8ZA 2GPIA 2KHXA 5LL6R 2EM2A 3LMLA 1STUA 2EM4A 2LV2A 2LRSA 5AC4A 5IXMB 1SR9A 5KL7A 1IQSA 2EPKX 1NEIA 4KZSA 3DJWA 4R03A 2ENHA 1HNXE 5IV8B 2LUPB 2EOFA 4R2QA 2EOMA 1GTKA 4DV2E 5KL5A 3IWCA 4DUYE 4WFTA 2NABA 3H09A 4X9JA 4BBYA 4X66E 2DB2A 2NUGA 1N3GA 5ADZA 2DLKA 4BHBA 3ADGA 2JOBA 1PJQA 3AUZA 2ENAA 2WZOA 2L8TA 4WSGA 2EPAA 4HTGA 2YU5A 4DR6E 2LTRA 4AQYE 5KL2A 2EM8A 1NCSA 3UK3C 2YRKA 2MC5A 1A1KA 1MEYC 2EPUA 2EWLA 2EMLA 2M1SA 4BHCA 4JV5E 5IT9C 1N32E 1XMOE 1T39A 4FK5C 4BMJA 2FTXB 2L33A 1L4SA 1B69A 5AC5A 2EPZA 2RQLA 4IS1C 4DV0E 2EPNA 2JVAA 2N8XA 2NA2A 3K6QA 3HPSA 2EMKA 2EQ3A 2WBSA 4O43A 4LF7E 2LCEA 3KZYA 1ZBQA 4DV7E 1X5WA 1T4NA 4WYQB 2YTFA 4DV1E 2EOHA 3EPKA 3J7AG 5F3WA 2L3JA 2R76A 4M30A 3OTOE 2EM0A
chains in the Genus database with same CATH topology
2E72A 2EMGA 1RMDA 2RSIA 2DRPA 1WJPA 2EP3A 4F6MA 1UBDC 2EPCA 2CTDA 2EMAA 2EM3A 2EOYA 1X6EA 2VRDA 2CT1A 4M9VC 2R1FA 1G2DC 2EM5A 2J7JA 2EM2A 2RPCA 4R2DA 2EM4A 2A25A 2LV2A 2YSOA 2LO3A 5KL3A 1JK2A 5KL7A 3EPJA 2ELYA 2EN8A 2EM9A 2YTQA 2EPPA 1TN9A 2EMIA 2YTNA 2DMIA 4R2EA 4F2JC 2EOQA 2EL4A 2BB8A 1ZAAC 2EMZA 1F2IG 2ENHA 1A1LA 2EQ1A 4R2CA 1A1GA 4GZNC 2EOFA 1X3CA 1ZU1A 2EN6A 2EOMA 4R2QA 2MKNA 5KL5A 2EPXA 2GLIA 2NABA 1YSAC 2YTOA 3EPHA 4X9JA 2LT7A 1A1HA 1KJKA 2ELZA 1X6HA 1DGCA 2EM7A 2YSPA 2EOEA 4R2AA 2HGHA 2DGCA 2EL6A 2EOOA 1YUJA 2YTIA 2EM0A 2YTGA 5KL4A 2EN2A 2EMHA 2DLKA 2YRHA 1AAYA 2EOXA 3EPLA 2EN3A 1TF6A 2WBTA 2ENAA 2EMCA 1JK1A 2M9AA 4WSGA 2D9HA 2EPAA 1YUIA 2ADRA 4R2RA 2YU5A 2ENCA 4IJDA 1BBOA 2EMWA 5KL2A 2EM8A 1NCSA 2EOZA 3UK3C 2EPRA 2YRKA 1A1JA 2WCC3 1A1KA 1MEYC 2EPUA 2EMXA 2EMLA 2EMBA 2EOIA 3M99B 4R2SA 4F6NA 2EOJA 3MHHC 2WBUA 2EJ4A 4FK5C 2YTEA 5KL6A 2EMFA 2EM6A 2YTDA 2EE8A 1B69A 2EN7A 1BB8A 2EPZA 2YTPA 4IS1C 3MHSC 4R2PA 1UN6B 2EN4A 2CSHA 1A1FA 2EMKA 2EMYA 2EQ3A 2YTJA 2LVHA 2EN1A 2EOSA 2WBSA 2MKDA 1A1IA 1ZR9A 2EORA 2JPAA 2LCEA 1P47A 2GHFA 2EQ0A 1X5WA 1TF3A 2YTFA 2MDGA 2EOHA 1Z1BA 3EPKA 1X6FA 3VHTB 2YU8A 2YRMA 2PRTA 2JP9A 2I13A 1LLMC 1G2FC 2DLQA 2EL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E72 A;  2EMG A;  1RMD A;  2RSI A;  2DRP A;  1WJP A;  2EP3 A;  4F6M A;  1UBD C;  2EPC A;  2CTD A;  2EMA A;  2EM3 A;  2EOY A;  1X6E A;  2VRD A;  2CT1 A;  4M9V C;  2R1F A;  1G2D C;  2EM5 A;  2J7J A;  2EM2 A;  2RPC A;  4R2D A;  2EM4 A;  2A25 A;  2LV2 A;  2YSO A;  2LO3 A;  5KL3 A;  1JK2 A;  5KL7 A;  3EPJ A;  2ELY A;  2EN8 A;  2EM9 A;  2YTQ A;  2EPP A;  1TN9 A;  2EMI A;  2YTN A;  2DMI A;  4R2E A;  4F2J C;  2EOQ A;  2EL4 A;  2BB8 A;  1ZAA C;  2EMZ A;  1F2I G;  2ENH A;  1A1L A;  2EQ1 A;  4R2C A;  1A1G A;  4GZN C;  2EOF A;  1X3C A;  1ZU1 A;  2EN6 A;  2EOM A;  4R2Q A;  2MKN A;  5KL5 A;  2EPX A;  2GLI A;  2NAB A;  1YSA C;  2YTO A;  3EPH A;  4X9J A;  2LT7 A;  1A1H A;  1KJK A;  2ELZ A;  1X6H A;  1DGC A;  2EM7 A;  2YSP A;  2EOE A;  4R2A A;  2HGH A;  2DGC A;  2EL6 A;  2EOO A;  1YUJ A;  2YTI A;  2EM0 A;  2YTG A;  5KL4 A;  2EN2 A;  2EMH A;  2DLK A;  2YRH A;  1AAY A;  2EOX A;  3EPL A;  2EN3 A;  1TF6 A;  2WBT A;  2ENA A;  2EMC A;  1JK1 A;  2M9A A;  4WSG A;  2D9H A;  2EPA A;  1YUI A;  2ADR A;  4R2R A;  2YU5 A;  2ENC A;  4IJD A;  1BBO A;  2EMW A;  5KL2 A;  2EM8 A;  1NCS A;  2EOZ A;  3UK3 C;  2EPR A;  2YRK A;  1A1J A;  2WCC 3;  1A1K A;  1MEY C;  2EPU A;  2EMX A;  2EML A;  2EMB A;  2EOI A;  3M99 B;  4R2S A;  4F6N A;  2EOJ A;  3MHH C;  2WBU A;  2EJ4 A;  4FK5 C;  2YTE A;  5KL6 A;  2EMF A;  2EM6 A;  2YTD A;  2EE8 A;  1B69 A;  2EN7 A;  1BB8 A;  2EPZ A;  2YTP A;  4IS1 C;  3MHS C;  4R2P A;  1UN6 B;  2EN4 A;  2CSH A;  1A1F A;  2EMK A;  2EMY A;  2EQ3 A;  2YTJ A;  2LVH A;  2EN1 A;  2EOS A;  2WBS A;  2MKD A;  1A1I A;  1ZR9 A;  2EOR A;  2JPA A;  2LCE A;  1P47 A;  2GHF A;  2EQ0 A;  1X5W A;  1TF3 A;  2YTF A;  2MDG A;  2EOH A;  1Z1B A;  3EPK A;  1X6F A;  3VHT B;  2YU8 A;  2YRM A;  2PRT A;  2JP9 A;  2I13 A;  1LLM C;  1G2F C;  2DLQ A;  2EL5 A; 
#chains in the Genus database with same CATH topology
 2LMZ A;  4B3R E;  1RMD A;  2L2K B;  4F6M A;  2L3C A;  4KWY A;  3OML A;  2K7I A;  2EM3 A;  3BGH A;  2VRD A;  1EH6 A;  2DSY A;  4JI6 E;  1QU6 A;  3AV0 A;  3LLH A;  2YSO A;  1FKA E;  3C4B A;  1WHN A;  1JK2 A;  2LJH A;  2UUA E;  2EN8 A;  4BCA A;  2YTN A;  2LTS A;  2DMI A;  1XMQ E;  3ZOQ B;  2BB8 A;  2VQE E;  1YPN A;  2FV4 B;  4R2C A;  1ZU1 A;  4X65 E;  2MKN A;  3L00 A;  5A6J A;  2GLI A;  2EPO A;  4RHB B;  3EPH A;  2HHH E;  1A1H A;  2ELZ A;  4LF6 E;  1DGC A;  4B3T E;  2UXC E;  4JI3 E;  2YSP A;  5A6B D;  4R2A A;  1DI2 A;  3C6K A;  4LF4 E;  3VK6 A;  2KOU A;  2EL6 A;  1EKZ A;  1YUJ A;  4LFA E;  1HNZ E;  2YTI A;  2YTG A;  1GQE A;  2RSM A;  4L5N C;  2EMH A;  5LLQ A;  2V88 A;  1N34 E;  4JI7 E;  1TF6 A;  1N36 E;  2WBT A;  4TUG A;  2ODR C;  3HPZ A;  1JK1 A;  1YYO A;  2DMY A;  5AAS A;  2FGG A;  2JR1 A;  2ENC A;  3HXL A;  3C4T A;  4F9C B;  2EMW A;  2EOZ A;  2JWO A;  2EPR A;  3IWB A;  4LF9 E;  2L6M A;  1RQ0 A;  2EMX A;  4WXC A;  2EOJ A;  2WBU A;  2M4I A;  3C6M A;  2YTE A;  2B7V A;  2MDR A;  4DMI A;  2EM6 A;  4X64 E;  3P1X A;  2YTP A;  2B9D A;  4R2P A;  2V87 A;  1IMU A;  2B7T A;  3THO B;  4YY3 E;  2V86 A;  5TSE A;  2GHF A;  2EQ0 A;  2MDG A;  1KYQ A;  4DR2 E;  2LBS B;  1IQO A;  1QNT A;  4OX9 E;  2IHR 1;  2JP9 A;  2I13 A;  1GZ6 A;  2DLQ A;  1ZBT A;  1MGT A;  2RSI A;  2EP3 A;  5BR8 E;  5A6A A;  2EPC A;  4LF8 E;  1I94 E;  4L8N A;  4P7D A;  2HC5 A;  2UUB E;  2F8B A;  1X6E A;  2CT1 A;  2R1F A;  1X49 A;  2E1M A;  2J7J A;  2N3H A;  2RPC A;  2YWQ A;  2JXP A;  2LUQ A;  2A25 A;  4OOG C;  2LO3 A;  5KL3 A;  2HJJ A;  1J5E E;  5CFF E;  2EPP A;  2EMI A;  4R2E A;  4F2J C;  2EL4 A;  4DR5 E;  3ADL A;  2LJU A;  2EMZ A;  4M0V A;  1F2I G;  2Q8U A;  1A1L A;  4K0K E;  2YZT A;  2EQ1 A;  2LE2 A;  2EN6 A;  2V85 A;  1J26 A;  4TUI A;  2ZM6 E;  5DNY A;  2LT7 A;  1KJK A;  4DV5 E;  4P78 A;  1X6H A;  3JAM C;  2EOE A;  1WXR A;  3RMP A;  2DGC A;  2EOO A;  3FIG A;  4JI5 E;  4DR3 E;  4DV6 E;  2EOX A;  1AAY A;  4JI0 E;  2EMC A;  2M9A A;  4O24 A;  2D9H A;  3JTZ A;  4BS9 A;  1SFE A;  2L92 A;  3THN A;  1N33 E;  1BBG A;  4Q28 A;  3JU0 A;  4DR4 E;  4X62 E;  1WRJ A;  4LU9 A;  2V89 A;  4DV4 E;  1A1J A;  4DR7 E;  4NHR A;  2M7Q A;  1HR0 E;  2WCC 3;  3MSW A;  2BBG A;  2EOI A;  4R2S A;  4DUZ E;  5AE3 A;  3MHH C;  4F6N A;  4GEQ B;  5AE2 A;  5KL6 A;  2UU9 E;  2EMF A;  2EPL X;  2EE8 A;  1BB8 A;  3DF6 A;  4WXD A;  3MHS C;  2VQF E;  3EQ1 A;  4WSP A;  3HQ1 A;  4M2Z A;  1UN6 B;  2NUE A;  4DV3 E;  2EN4 A;  2EZ6 A;  2CSH A;  2RS7 A;  2EMY A;  2LVH A;  2EN1 A;  3J81 C;  1XNQ E;  1T38 A;  1A1I A;  1ZR9 A;  2JPA A;  1P47 A;  4I8O A;  1IBM E;  2JOX A;  1X6F A;  2CPN A;  3VYX A;  2NUF A;  2YU8 A;  3ADI A;  2YRM A;  2PRT A;  2L2N A;  4KHP E;  3T1H E;  3F6G A;  1O0W A;  2EMG A;  3BF2 A;  1UHZ A;  3J7Y p;  3ADJ A;  4BC9 A;  4O5G A;  4JI2 E;  1FJG E;  4R8O A;  4M9V C;  1G2D C;  2EM5 A;  3KZZ A;  2V8Q B;  4ZYD A;  4GKK E;  4R2D A;  2DIX A;  4BC7 A;  2H36 X;  3J80 C;  1X48 A;  3EPJ A;  2ELY A;  2EM9 A;  2YTQ A;  1TN9 A;  3BBG A;  2EOQ A;  1ZAA C;  1A1G A;  4GZN C;  3QG5 C;  4ZYH A;  1X3C A;  3BID A;  4RH8 A;  1IBK E;  2B3T B;  5A69 A;  1RC7 A;  2EPX A;  1YYK A;  3VYY A;  4YHH E;  1IBL E;  1YSA C;  4X8W A;  5A6K A;  2YTO A;  4LFC E;  2VE7 C;  4GKJ E;  3F6H A;  2I9I A;  2EM7 A;  1DQ3 A;  2YPN A;  2HGH A;  1EH8 A;  4WPY A;  2EN2 A;  5KL4 A;  3TQM A;  2YRH A;  3EPL A;  3T1Y E;  5A2Q C;  4JI1 E;  2RS6 A;  2EN3 A;  1PJT A;  4F54 A;  1X47 A;  2JYA A;  2KON A;  4WX9 A;  1YUI A;  2ADR A;  4R2R A;  4O4K A;  4ZYE A;  1YFH A;  4IJD A;  1BBO A;  4F9A B;  4JI4 E;  2UUC E;  2V83 A;  1PDA A;  3HTX A;  4LFB E;  2JY9 A;  4LF5 E;  5T6J A;  2RTX A;  2L2M A;  2ODR D;  2EMB A;  2N3G A;  3M99 B;  4NZV A;  1EH7 A;  2EJ4 A;  4MLV A;  2E5L E;  2YTD A;  4ZYG A;  1T4L B;  1YZ9 A;  1YYW A;  1AH5 A;  2EN7 A;  1T4O A;  4B3M E;  2K4V A;  5LMN E;  2F4V E;  1A1F A;  4N4R B;  1PKP A;  2YTJ A;  5A6B A;  4B3S E;  1UIL A;  1XNR E;  4JI8 E;  2VF1 A;  4NXN E;  3ECR A;  3IWD A;  2EOS A;  4HEI A;  4F9B B;  2MKD A;  2YT4 A;  1HNW E;  1WHQ A;  2EOR A;  2UXB E;  5IWA E;  1TF3 A;  1Z1B A;  3VHT B;  4LTY A;  2UXD E;  3KWR A;  4DKK A;  2MC6 A;  5LMU E;  4DR1 E;  1LLM C;  1G2F C;  2EL5 A;  2G7H A;  2E72 A;  4JYA E;  2DRP A;  5AE1 A;  1WJP A;  1UBD C;  2EPM X;  2CTD A;  2EMA A;  4MLQ A;  4Q35 B;  1PJS A;  2EOY A;  5FLX C;  4NXM E;  4J8Z A;  2GPI A;  2KHX A;  5LL6 R;  2EM2 A;  3LML A;  1STU A;  2EM4 A;  2LV2 A;  2LRS A;  5AC4 A;  5IXM B;  1SR9 A;  5KL7 A;  1IQS A;  2EPK X;  1NEI A;  4KZS A;  3DJW A;  4R03 A;  2ENH A;  1HNX E;  5IV8 B;  2LUP B;  2EOF A;  4R2Q A;  2EOM A;  1GTK A;  4DV2 E;  5KL5 A;  3IWC A;  4DUY E;  4WFT A;  2NAB A;  3H09 A;  4X9J A;  4BBY A;  4X66 E;  2DB2 A;  2NUG A;  1N3G A;  5ADZ A;  2DLK A;  4BHB A;  3ADG A;  2JOB A;  1PJQ A;  3AUZ A;  2ENA A;  2WZO A;  2L8T A;  4WSG A;  2EPA A;  4HTG A;  2YU5 A;  4DR6 E;  2LTR A;  4AQY E;  5KL2 A;  2EM8 A;  1NCS A;  3UK3 C;  2YRK A;  2MC5 A;  1A1K A;  1MEY C;  2EPU A;  2EWL A;  2EML A;  2M1S A;  4BHC A;  4JV5 E;  5IT9 C;  1N32 E;  1XMO E;  1T39 A;  4FK5 C;  4BMJ A;  2FTX B;  2L33 A;  1L4S A;  1B69 A;  5AC5 A;  2EPZ A;  2RQL A;  4IS1 C;  4DV0 E;  2EPN A;  2JVA A;  2N8X A;  2NA2 A;  3K6Q A;  3HPS A;  2EMK A;  2EQ3 A;  2WBS A;  4O43 A;  4LF7 E;  2LCE A;  3KZY A;  1ZBQ A;  4DV7 E;  1X5W A;  1T4N A;  4WYQ B;  2YTF A;  4DV1 E;  2EOH A;  3EPK A;  3J7A G;  5F3W A;  2L3J A;  2R76 A;  4M30 A;  3OTO E;  2EM0 A; 
#chains in the Genus database with same CATH homology
 2E72 A;  2EMG A;  1RMD A;  2RSI A;  2DRP A;  1WJP A;  2EP3 A;  4F6M A;  1UBD C;  2EPC A;  2CTD A;  2EMA A;  2EM3 A;  2EOY A;  1X6E A;  2VRD A;  2CT1 A;  4M9V C;  2R1F A;  1G2D C;  2EM5 A;  2J7J A;  2EM2 A;  2RPC A;  4R2D A;  2EM4 A;  2A25 A;  2LV2 A;  2YSO A;  2LO3 A;  5KL3 A;  1JK2 A;  5KL7 A;  3EPJ A;  2ELY A;  2EN8 A;  2EM9 A;  2YTQ A;  2EPP A;  1TN9 A;  2EMI A;  2YTN A;  2DMI A;  4R2E A;  4F2J C;  2EOQ A;  2EL4 A;  2BB8 A;  1ZAA C;  2EMZ A;  1F2I G;  2ENH A;  1A1L A;  2EQ1 A;  4R2C A;  1A1G A;  4GZN C;  2EOF A;  1X3C A;  1ZU1 A;  2EN6 A;  2EOM A;  4R2Q A;  2MKN A;  5KL5 A;  2EPX A;  2GLI A;  2NAB A;  1YSA C;  2YTO A;  3EPH A;  4X9J A;  2LT7 A;  1A1H A;  1KJK A;  2ELZ A;  1X6H A;  1DGC A;  2EM7 A;  2YSP A;  2EOE A;  4R2A A;  2HGH A;  2DGC A;  2EL6 A;  2EOO A;  1YUJ A;  2YTI A;  2EM0 A;  2YTG A;  5KL4 A;  2EN2 A;  2EMH A;  2DLK A;  2YRH A;  1AAY A;  2EOX A;  3EPL A;  2EN3 A;  1TF6 A;  2WBT A;  2ENA A;  2EMC A;  1JK1 A;  2M9A A;  4WSG A;  2D9H A;  2EPA A;  1YUI A;  2ADR A;  4R2R A;  2YU5 A;  2ENC A;  4IJD A;  1BBO A;  2EMW A;  5KL2 A;  2EM8 A;  1NCS A;  2EOZ A;  3UK3 C;  2EPR A;  2YRK A;  1A1J A;  2WCC 3;  1A1K A;  1MEY C;  2EPU A;  2EMX A;  2EML A;  2EMB A;  2EOI A;  3M99 B;  4R2S A;  4F6N A;  2EOJ A;  3MHH C;  2WBU A;  2EJ4 A;  4FK5 C;  2YTE A;  5KL6 A;  2EMF A;  2EM6 A;  2YTD A;  2EE8 A;  1B69 A;  2EN7 A;  1BB8 A;  2EPZ A;  2YTP A;  4IS1 C;  3MHS C;  4R2P A;  1UN6 B;  2EN4 A;  2CSH A;  1A1F A;  2EMK A;  2EMY A;  2EQ3 A;  2YTJ A;  2LVH A;  2EN1 A;  2EOS A;  2WBS A;  2MKD A;  1A1I A;  1ZR9 A;  2EOR A;  2JPA A;  2LCE A;  1P47 A;  2GHF A;  2EQ0 A;  1X5W A;  1TF3 A;  2YTF A;  2MDG A;  2EOH A;  1Z1B A;  3EPK A;  1X6F A;  3VHT B;  2YU8 A;  2YRM A;  2PRT A;  2JP9 A;  2I13 A;  1LLM C;  1G2F C;  2DLQ A;  2EL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...