2EMKA

Solution structure of the c2h2 type zinc finger (region 668-700) of human zinc finger protein 28 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYECKECGKAFSQTTHLIQHQRVHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 28 homolog
publication title Solution structure of the C2H2 type zinc finger (region 668-700) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emkA01
1X6FA 3UK3C 2EM6A 2BB8A 1MEYC 2ELYA 1X6HA 2ENHA 2VRDA 1B69A 2EN6A 1LLMC 3EPLA 2EQ1A 1A1JA 1A1HA 2J7JA 2EOOA 2LV2A 2EM2A 2EJ4A 2ADRA 1Z1BA 3EPHA 4R2RA 2WBSA 2EM8A 2YRKA 1UN6B 2EM5A 5KL7A 1A1FA 2EMIA 2EOEA 1ZR9A 2EPPA 4R2QA 2EPUA 2YTFA 2EORA 5KL5A 2MDGA 4IJDA 1UBDC 2EOQA 1WJPA 3MHHC 2EOHA 2EMGA 2M9AA 4GZNC 1A1IA 2GHFA 4F6NA 1X6EA 3VHTB 4R2SA 2LO3A 2DLKA 2LCEA 4R2AA 1DGCA 4R2DA 2EL4A 2DLQA 5KL2A 4F2JC 2DGCA 2DMIA 2EMBA 2YRHA 1BB8A 1X5WA 2A25A 2EMLA 1G2DC 2EM7A 2EMYA 2EMWA 1YUJA 2JPAA 2EMCA 2EE8A 2EMZA 2EPZA 3EPKA 2YTGA 1G2FC 2EM9A 1ZU1A 2EL5A 2R1FA 2WCC3 4WSGA 2EOSA 2YSPA 4IS1C 2EN3A 1KJKA 2EN4A 2EOYA 3M99B 2EP3A 2YTIA 2E72A 2WBTA 4R2CA 2JP9A 2YTQA 2EM0A 2YSOA 2EQ3A 4X9JA 1YUIA 2YTJA 1AAYA 2WBUA 3EPJA 2YTOA 2EOIA 2RPCA 2I13A 2EMKA 2PRTA 2EPCA 2DRPA 2EQ0A 1TF6A 2NABA 4M9VC 5KL3A 2ENCA 4F6MA 2EPXA 2EMHA 1ZAAC 1A1LA 2YU8A 1BBOA 4R2PA 2CTDA 1P47A 1TF3A 2YTPA 2YU5A 2GLIA 2RSIA 2EN1A 2EPRA 2LVHA 2EN8A 2EOZA 1JK1A 2YRMA 1TN9A 2EM4A 4R2EA 5KL4A 2MKDA 2EN2A 3MHSC 2ENAA 2D9HA 2EMXA 1F2IG 1A1GA 2YTEA 2CSHA 2EOJA 2EOMA 2MKNA 1JK2A 2YTNA 2EMFA 4FK5C 2EL6A 2YTDA 1NCSA 1A1KA 1X3CA 1RMDA 2EOXA 5KL6A 2EOFA 1YSAC 2EPAA 2EN7A 2HGHA 2CT1A 2ELZA 2EMAA 2LT7A 2EM3A
chains in the Genus database with same CATH superfamily
1X6FA 3UK3C 4BS9A 5AC5A 2ELYA 1X6HA 1PKPA 2EN6A 4LU9A 4OOGC 2EPOA 1XMQE 2LJHA 4LF4E 2J7JA 2MC6A 1Z1BA 4O43A 1HNXE 2YRKA 2JR1A 2JVAA 1HR0E 2YZTA 4B3TE 2JWOA 2YWQA 2UUAE 4R2QA 4DUYE 3K6QA 1IBLE 4B3ME 1WJPA 4NXNE 4O24A 2EMGA 4LFAE 1A1IA 4ZYDA 2LTSA 2LO3A 5AE3A 4F9CB 3J7AG 2KOUA 5TSEA 3ADJA 4RH8A 4F2JC 2N3HA 2DGCA 1BB8A 4BC9A 1EH6A 3DF6A 2Q8UA 1XNQE 2EMYA 2EMWA 2GPIA 2B3TB 2JPAA 4JI2E 1N32E 4LFCE 2EPZA 3BIDA 3EPKA 1IBKE 2LUPB 4AQYE 4N4RB 4LTYA 2VQFE 1YYOA 5A6BA 4Q28A 4DV1E 2EN3A 1PJSA 2EN4A 2EOYA 3ADLA 2JP9A 1WXRA 5ADZA 2YSOA 2EQ3A 2V86A 1PDAA 2EOIA 2RPCA 1T4OA 5LMNE 2DRPA 2EQ0A 3VYXA 4DR4E 4F6MA 2EMHA 1A1LA 2V89A 2RSIA 2EPRA 4JI1E 4JI5E 4WFTA 2F4VE 2EOZA 1JK1A 4R2EA 2E5LE 2MKDA 1T38A 4B3SE 2DMYA 2L2NA 5LMUE 4WSPA 1N3GA 4WXDA 1F2IG 2CSHA 2V88A 2MKNA 5AC4A 2L92A 5IV8B 4FK5C 1NCSA 1X3CA 5KL6A 2NA2A 1ZBTA 2CT1A 2JY9A 2EMAA 4BHCA 2EM6A 2F8BA 2L2MA 2YT4A 2ENHA 3MSWA 2VRDA 2LTRA 2LE2A 1B69A 2L33A 3EPLA 1SR9A 2B7TA 4MLVA 2EQ1A 3JTZA 4JI4E 1A1HA 2EOOA 3C4BA 2UXDE 2EPLX 2WBSA 4NXME 1UN6B 2NUEA 4LF9E 2EM5A 3IWDA 1HNWE 3F6HA 4B3RE 1GTKA 4DUZE 4ZYGA 4ZYHA 5KL5A 3C4TA 4IJDA 1XMOE 1UBDC 1UHZA 4RHBB 1O0WA 1IQSA 4GZNC 3L00A 5A6JA 4TUIA 1X48A 1T39A 4YHHE 4F6NA 1FKAE 2VQEE 5CFFE 4R2SA 2HJJA 1L4SA 4Q35B 1DGCA 5AE1A 2EL4A 4LF6E 2DMIA 2V85A 2EPMX 3AV0A 5A69A 1IBME 3ECRA 2MC5A 5FLXC 1QNTA 3J81C 3C6MA 2YTGA 1X49A 4R8OA 1G2FC 3HTXA 2YPNA 2CPNA 3JU0A 3KWRA 4OX9E 2YTIA 4DV2E 1AAYA 4JI8E 3EPJA 1FJGE 2YTOA 4F9BB 2I13A 3F6GA 4X66E 1TF6A 3H09A 4M9VC 2RSMA 2FV4B 2L8TA 1BBOA 3VYYA 4DV7E 1P47A 4JV5E 1KYQA 2YTPA 2LBSB 2GLIA 1QU6A 4DMIA 1UILA 2V83A 3BF2A 2EN8A 1NEIA 4DR5E 2EM4A 4M30A 2K4VA 4WX9A 4MLQA 4DR3E 3QG5C 1PJTA 3VK6A 2EOJA 1YPNA 5AE2A 3IWCA 4KHPE 2YTDA 1A1KA 3P1XA 2EOXA 1YSAC 2EOFA 4WPYA 1MGTA 3LLHA 4NHRA 2BB8A 5A6BD 1MEYC 1XNRE 5DNYA 1X47A 4L5NC 1LLMC 4DKKA 2RS7A 5F3WA 2EZ6A 2M7QA 4F9AB 4BC7A 4DR1E 2EM2A 2EJ4A 2ADRA 2NUGA 2EM8A 2N3GA 3KZZA 2DSYA 2M1SA 4J8ZA 3RMPA 5A6KA 1A1FA 2EOEA 4P78A 2E1MA 2FGGA 1ZR9A 2FTXB 4M0VA 3ADGA 5BR8E 2EPNA 1N36E 2EPUA 4JI7E 1EH8A 2EOQA 3MHHC 4DR2E 1BBGA 4BCAA 2RS6A 2DLKA 2LCEA 2DLQA 5KL2A 4I8OA 2EWLA 1DQ3A 4O4KA 4LF8E 2YRHA 1YYWA 1SFEA 3HPZA 1X5WA 2A25A 3THOB 4GKJE 4DV4E 4LFBE 2HC5A 2EMCA 2EE8A 2EMZA 2JOXA 2EM9A 3JAMC 3ADIA 4WSGA 1YFHA 3DJWA 2EOSA 5LLQA 1KJKA 2KONA 2MDRA 2IHR1 2EP3A 2E72A 4R2CA 4DV5E 1GQEA 2EM0A 2YTQA 4X9JA 1YUIA 3IWBA 2WBUA 1T4LB 2L3JA 4WXCA 1WHNA 4GEQB 2PRTA 4JI3E 4TUGA 2NABA 3HXLA 3HQ1A 2EPXA 2EPKX 2YU8A 2CTDA 1TF3A 4HEIA 3ZOQB 2JXPA 2LVHA 2L2KB 3AUZA 2JYAA 4LF7E 1YZ9A 1TN9A 3HPSA 4ZYEA 4KZSA 1N34E 2ENAA 2UUBE 4X64E 3TQMA 2YTEA 2EOMA 1JK2A 2YTNA 2EMFA 4LF5E 2DIXA 5A2QC 1RMDA 2DB2A 4M2ZA 1WRJA 2EPAA 2HGHA 2UXCE 2LT7A 4L8NA 2LMZA 2RTXA 2KHXA 1IMUA 1GZ6A 3THNA 1HNZE 2ZM6E 1RC7A 2JOBA 1A1JA 2LV2A 3C6KA 5AASA 2UXBE 2ODRD 4NZVA 2V87A 3KZYA 5IT9C 4DV6E 3EPHA 4JYAE 2G7HA 1STUA 2VF1A 4R2RA 1I94E 2K7IA 1RQ0A 1J26A 4F54A 2UUCE 4BBYA 2HHHE 5KL7A 2EMIA 2VE7C 4R03A 2EPPA 2V8QB 4JI0E 1T4NA 2L6MA 2YTFA 2EORA 1AH5A 3FIGA 2MDGA 2B9DA 3OTOE 4X8WA 3T1HE 2EOHA 2M9AA 2GHFA 5IXMB 1X6EA 4DV0E 3VHTB 4DV3E 2WZOA 1YYKA 4R2AA 3EQ1A 4R2DA 2LUQA 3T1YE 2EMBA 3LMLA 3OMLA 4K0KE 4O5GA 2EMLA 1G2DC 2EM7A 3J7Yp 1J5EE 4WYQB 1YUJA 1ZBQA 2ODRC 4KWYA 2LJUA 1N33E 1ZU1A 2EL5A 4YY3E 2R1FA 5LL6R 2WCC3 4GKKE 4P7DA 2UU9E 2YSPA 2BBGA 4IS1C 4JI6E 2N8XA 5IWAE 3M99B 2L3CA 2H36X 2WBTA 4HTGA 2NUFA 2YTJA 3BGHA 2EMKA 2M4IA 4BMJA 2EPCA 4BHBA 5KL3A 2ENCA 1ZAAC 1EKZA 4R2PA 2YU5A 2EN1A 4X65E 1WHQA 1PJQA 3BBGA 3J80C 2YRMA 2RQLA 5A6AA 1EH7A 5KL4A 1IQOA 4X62E 2EN2A 3MHSC 4DR6E 5T6JA 2EMXA 2B7VA 2D9HA 1A1GA 2LRSA 2R76A 2EL6A 1DI2A 2EN7A 2I9IA 2ELZA 4DR7E 2EM3A
chains in the Genus database with same CATH topology
1X6FA 3UK3C 2EM6A 2BB8A 1MEYC 2ELYA 1X6HA 2ENHA 2VRDA 1B69A 2EN6A 1LLMC 3EPLA 2EQ1A 1A1JA 1A1HA 2J7JA 2EOOA 2LV2A 2EM2A 2EJ4A 2ADRA 1Z1BA 3EPHA 4R2RA 2WBSA 2EM8A 2YRKA 1UN6B 2EM5A 5KL7A 1A1FA 2EMIA 2EOEA 1ZR9A 2EPPA 4R2QA 2EPUA 2YTFA 2EORA 5KL5A 2MDGA 4IJDA 1UBDC 2EOQA 1WJPA 3MHHC 2EOHA 2EMGA 2M9AA 4GZNC 1A1IA 2GHFA 4F6NA 1X6EA 3VHTB 4R2SA 2LO3A 2DLKA 2LCEA 4R2AA 1DGCA 4R2DA 2EL4A 2DLQA 5KL2A 4F2JC 2DGCA 2DMIA 2EMBA 2YRHA 1BB8A 1X5WA 2A25A 2EMLA 1G2DC 2EM7A 2EMYA 2EMWA 1YUJA 2JPAA 2EMCA 2EE8A 2EMZA 2EPZA 3EPKA 2YTGA 1G2FC 2EM9A 1ZU1A 2EL5A 2R1FA 2WCC3 4WSGA 2EOSA 2YSPA 4IS1C 2EN3A 1KJKA 2EN4A 2EOYA 3M99B 2EP3A 2YTIA 2E72A 2WBTA 4R2CA 2JP9A 2YTQA 2EM0A 2YSOA 2EQ3A 4X9JA 1YUIA 2YTJA 1AAYA 2WBUA 3EPJA 2YTOA 2EOIA 2RPCA 2I13A 2EMKA 2PRTA 2EPCA 2DRPA 2EQ0A 1TF6A 2NABA 4M9VC 5KL3A 2ENCA 4F6MA 2EPXA 2EMHA 1ZAAC 1A1LA 2YU8A 1BBOA 4R2PA 2CTDA 1P47A 1TF3A 2YTPA 2YU5A 2GLIA 2RSIA 2EN1A 2EPRA 2LVHA 2EN8A 2EOZA 1JK1A 2YRMA 1TN9A 2EM4A 4R2EA 5KL4A 2MKDA 2EN2A 3MHSC 2ENAA 2D9HA 2EMXA 1F2IG 1A1GA 2YTEA 2CSHA 2EOJA 2EOMA 2MKNA 1JK2A 2YTNA 2EMFA 4FK5C 2EL6A 2YTDA 1NCSA 1A1KA 1X3CA 1RMDA 2EOXA 5KL6A 2EOFA 1YSAC 2EPAA 2EN7A 2HGHA 2CT1A 2ELZA 2EMAA 2LT7A 2EM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6F A;  3UK3 C;  2EM6 A;  2BB8 A;  1MEY C;  2ELY A;  1X6H A;  2ENH A;  2VRD A;  1B69 A;  2EN6 A;  1LLM C;  3EPL A;  2EQ1 A;  1A1J A;  1A1H A;  2J7J A;  2EOO A;  2LV2 A;  2EM2 A;  2EJ4 A;  2ADR A;  1Z1B A;  3EPH A;  4R2R A;  2WBS A;  2EM8 A;  2YRK A;  1UN6 B;  2EM5 A;  5KL7 A;  1A1F A;  2EMI A;  2EOE A;  1ZR9 A;  2EPP A;  4R2Q A;  2EPU A;  2YTF A;  2EOR A;  5KL5 A;  2MDG A;  4IJD A;  1UBD C;  2EOQ A;  1WJP A;  3MHH C;  2EOH A;  2EMG A;  2M9A A;  4GZN C;  1A1I A;  2GHF A;  4F6N A;  1X6E A;  3VHT B;  4R2S A;  2LO3 A;  2DLK A;  2LCE A;  4R2A A;  1DGC A;  4R2D A;  2EL4 A;  2DLQ A;  5KL2 A;  4F2J C;  2DGC A;  2DMI A;  2EMB A;  2YRH A;  1BB8 A;  1X5W A;  2A25 A;  2EML A;  1G2D C;  2EM7 A;  2EMY A;  2EMW A;  1YUJ A;  2JPA A;  2EMC A;  2EE8 A;  2EMZ A;  2EPZ A;  3EPK A;  2YTG A;  1G2F C;  2EM9 A;  1ZU1 A;  2EL5 A;  2R1F A;  2WCC 3;  4WSG A;  2EOS A;  2YSP A;  4IS1 C;  2EN3 A;  1KJK A;  2EN4 A;  2EOY A;  3M99 B;  2EP3 A;  2YTI A;  2E72 A;  2WBT A;  4R2C A;  2JP9 A;  2YTQ A;  2EM0 A;  2YSO A;  2EQ3 A;  4X9J A;  1YUI A;  2YTJ A;  1AAY A;  2WBU A;  3EPJ A;  2YTO A;  2EOI A;  2RPC A;  2I13 A;  2EMK A;  2PRT A;  2EPC A;  2DRP A;  2EQ0 A;  1TF6 A;  2NAB A;  4M9V C;  5KL3 A;  2ENC A;  4F6M A;  2EPX A;  2EMH A;  1ZAA C;  1A1L A;  2YU8 A;  1BBO A;  4R2P A;  2CTD A;  1P47 A;  1TF3 A;  2YTP A;  2YU5 A;  2GLI A;  2RSI A;  2EN1 A;  2EPR A;  2LVH A;  2EN8 A;  2EOZ A;  1JK1 A;  2YRM A;  1TN9 A;  2EM4 A;  4R2E A;  5KL4 A;  2MKD A;  2EN2 A;  3MHS C;  2ENA A;  2D9H A;  2EMX A;  1F2I G;  1A1G A;  2YTE A;  2CSH A;  2EOJ A;  2EOM A;  2MKN A;  1JK2 A;  2YTN A;  2EMF A;  4FK5 C;  2EL6 A;  2YTD A;  1NCS A;  1A1K A;  1X3C A;  1RMD A;  2EOX A;  5KL6 A;  2EOF A;  1YSA C;  2EPA A;  2EN7 A;  2HGH A;  2CT1 A;  2ELZ A;  2EMA A;  2LT7 A;  2EM3 A; 
#chains in the Genus database with same CATH topology
 1X6F A;  3UK3 C;  4BS9 A;  5AC5 A;  2ELY A;  1X6H A;  1PKP A;  2EN6 A;  4LU9 A;  4OOG C;  2EPO A;  1XMQ E;  2LJH A;  4LF4 E;  2J7J A;  2MC6 A;  1Z1B A;  4O43 A;  1HNX E;  2YRK A;  2JR1 A;  2JVA A;  1HR0 E;  2YZT A;  4B3T E;  2JWO A;  2YWQ A;  2UUA E;  4R2Q A;  4DUY E;  3K6Q A;  1IBL E;  4B3M E;  1WJP A;  4NXN E;  4O24 A;  2EMG A;  4LFA E;  1A1I A;  4ZYD A;  2LTS A;  2LO3 A;  5AE3 A;  4F9C B;  3J7A G;  2KOU A;  5TSE A;  3ADJ A;  4RH8 A;  4F2J C;  2N3H A;  2DGC A;  1BB8 A;  4BC9 A;  1EH6 A;  3DF6 A;  2Q8U A;  1XNQ E;  2EMY A;  2EMW A;  2GPI A;  2B3T B;  2JPA A;  4JI2 E;  1N32 E;  4LFC E;  2EPZ A;  3BID A;  3EPK A;  1IBK E;  2LUP B;  4AQY E;  4N4R B;  4LTY A;  2VQF E;  1YYO A;  5A6B A;  4Q28 A;  4DV1 E;  2EN3 A;  1PJS A;  2EN4 A;  2EOY A;  3ADL A;  2JP9 A;  1WXR A;  5ADZ A;  2YSO A;  2EQ3 A;  2V86 A;  1PDA A;  2EOI A;  2RPC A;  1T4O A;  5LMN E;  2DRP A;  2EQ0 A;  3VYX A;  4DR4 E;  4F6M A;  2EMH A;  1A1L A;  2V89 A;  2RSI A;  2EPR A;  4JI1 E;  4JI5 E;  4WFT A;  2F4V E;  2EOZ A;  1JK1 A;  4R2E A;  2E5L E;  2MKD A;  1T38 A;  4B3S E;  2DMY A;  2L2N A;  5LMU E;  4WSP A;  1N3G A;  4WXD A;  1F2I G;  2CSH A;  2V88 A;  2MKN A;  5AC4 A;  2L92 A;  5IV8 B;  4FK5 C;  1NCS A;  1X3C A;  5KL6 A;  2NA2 A;  1ZBT A;  2CT1 A;  2JY9 A;  2EMA A;  4BHC A;  2EM6 A;  2F8B A;  2L2M A;  2YT4 A;  2ENH A;  3MSW A;  2VRD A;  2LTR A;  2LE2 A;  1B69 A;  2L33 A;  3EPL A;  1SR9 A;  2B7T A;  4MLV A;  2EQ1 A;  3JTZ A;  4JI4 E;  1A1H A;  2EOO A;  3C4B A;  2UXD E;  2EPL X;  2WBS A;  4NXM E;  1UN6 B;  2NUE A;  4LF9 E;  2EM5 A;  3IWD A;  1HNW E;  3F6H A;  4B3R E;  1GTK A;  4DUZ E;  4ZYG A;  4ZYH A;  5KL5 A;  3C4T A;  4IJD A;  1XMO E;  1UBD C;  1UHZ A;  4RHB B;  1O0W A;  1IQS A;  4GZN C;  3L00 A;  5A6J A;  4TUI A;  1X48 A;  1T39 A;  4YHH E;  4F6N A;  1FKA E;  2VQE E;  5CFF E;  4R2S A;  2HJJ A;  1L4S A;  4Q35 B;  1DGC A;  5AE1 A;  2EL4 A;  4LF6 E;  2DMI A;  2V85 A;  2EPM X;  3AV0 A;  5A69 A;  1IBM E;  3ECR A;  2MC5 A;  5FLX C;  1QNT A;  3J81 C;  3C6M A;  2YTG A;  1X49 A;  4R8O A;  1G2F C;  3HTX A;  2YPN A;  2CPN A;  3JU0 A;  3KWR A;  4OX9 E;  2YTI A;  4DV2 E;  1AAY A;  4JI8 E;  3EPJ A;  1FJG E;  2YTO A;  4F9B B;  2I13 A;  3F6G A;  4X66 E;  1TF6 A;  3H09 A;  4M9V C;  2RSM A;  2FV4 B;  2L8T A;  1BBO A;  3VYY A;  4DV7 E;  1P47 A;  4JV5 E;  1KYQ A;  2YTP A;  2LBS B;  2GLI A;  1QU6 A;  4DMI A;  1UIL A;  2V83 A;  3BF2 A;  2EN8 A;  1NEI A;  4DR5 E;  2EM4 A;  4M30 A;  2K4V A;  4WX9 A;  4MLQ A;  4DR3 E;  3QG5 C;  1PJT A;  3VK6 A;  2EOJ A;  1YPN A;  5AE2 A;  3IWC A;  4KHP E;  2YTD A;  1A1K A;  3P1X A;  2EOX A;  1YSA C;  2EOF A;  4WPY A;  1MGT A;  3LLH A;  4NHR A;  2BB8 A;  5A6B D;  1MEY C;  1XNR E;  5DNY A;  1X47 A;  4L5N C;  1LLM C;  4DKK A;  2RS7 A;  5F3W A;  2EZ6 A;  2M7Q A;  4F9A B;  4BC7 A;  4DR1 E;  2EM2 A;  2EJ4 A;  2ADR A;  2NUG A;  2EM8 A;  2N3G A;  3KZZ A;  2DSY A;  2M1S A;  4J8Z A;  3RMP A;  5A6K A;  1A1F A;  2EOE A;  4P78 A;  2E1M A;  2FGG A;  1ZR9 A;  2FTX B;  4M0V A;  3ADG A;  5BR8 E;  2EPN A;  1N36 E;  2EPU A;  4JI7 E;  1EH8 A;  2EOQ A;  3MHH C;  4DR2 E;  1BBG A;  4BCA A;  2RS6 A;  2DLK A;  2LCE A;  2DLQ A;  5KL2 A;  4I8O A;  2EWL A;  1DQ3 A;  4O4K A;  4LF8 E;  2YRH A;  1YYW A;  1SFE A;  3HPZ A;  1X5W A;  2A25 A;  3THO B;  4GKJ E;  4DV4 E;  4LFB E;  2HC5 A;  2EMC A;  2EE8 A;  2EMZ A;  2JOX A;  2EM9 A;  3JAM C;  3ADI A;  4WSG A;  1YFH A;  3DJW A;  2EOS A;  5LLQ A;  1KJK A;  2KON A;  2MDR A;  2IHR 1;  2EP3 A;  2E72 A;  4R2C A;  4DV5 E;  1GQE A;  2EM0 A;  2YTQ A;  4X9J A;  1YUI A;  3IWB A;  2WBU A;  1T4L B;  2L3J A;  4WXC A;  1WHN A;  4GEQ B;  2PRT A;  4JI3 E;  4TUG A;  2NAB A;  3HXL A;  3HQ1 A;  2EPX A;  2EPK X;  2YU8 A;  2CTD A;  1TF3 A;  4HEI A;  3ZOQ B;  2JXP A;  2LVH A;  2L2K B;  3AUZ A;  2JYA A;  4LF7 E;  1YZ9 A;  1TN9 A;  3HPS A;  4ZYE A;  4KZS A;  1N34 E;  2ENA A;  2UUB E;  4X64 E;  3TQM A;  2YTE A;  2EOM A;  1JK2 A;  2YTN A;  2EMF A;  4LF5 E;  2DIX A;  5A2Q C;  1RMD A;  2DB2 A;  4M2Z A;  1WRJ A;  2EPA A;  2HGH A;  2UXC E;  2LT7 A;  4L8N A;  2LMZ A;  2RTX A;  2KHX A;  1IMU A;  1GZ6 A;  3THN A;  1HNZ E;  2ZM6 E;  1RC7 A;  2JOB A;  1A1J A;  2LV2 A;  3C6K A;  5AAS A;  2UXB E;  2ODR D;  4NZV A;  2V87 A;  3KZY A;  5IT9 C;  4DV6 E;  3EPH A;  4JYA E;  2G7H A;  1STU A;  2VF1 A;  4R2R A;  1I94 E;  2K7I A;  1RQ0 A;  1J26 A;  4F54 A;  2UUC E;  4BBY A;  2HHH E;  5KL7 A;  2EMI A;  2VE7 C;  4R03 A;  2EPP A;  2V8Q B;  4JI0 E;  1T4N A;  2L6M A;  2YTF A;  2EOR A;  1AH5 A;  3FIG A;  2MDG A;  2B9D A;  3OTO E;  4X8W A;  3T1H E;  2EOH A;  2M9A A;  2GHF A;  5IXM B;  1X6E A;  4DV0 E;  3VHT B;  4DV3 E;  2WZO A;  1YYK A;  4R2A A;  3EQ1 A;  4R2D A;  2LUQ A;  3T1Y E;  2EMB A;  3LML A;  3OML A;  4K0K E;  4O5G A;  2EML A;  1G2D C;  2EM7 A;  3J7Y p;  1J5E E;  4WYQ B;  1YUJ A;  1ZBQ A;  2ODR C;  4KWY A;  2LJU A;  1N33 E;  1ZU1 A;  2EL5 A;  4YY3 E;  2R1F A;  5LL6 R;  2WCC 3;  4GKK E;  4P7D A;  2UU9 E;  2YSP A;  2BBG A;  4IS1 C;  4JI6 E;  2N8X A;  5IWA E;  3M99 B;  2L3C A;  2H36 X;  2WBT A;  4HTG A;  2NUF A;  2YTJ A;  3BGH A;  2EMK A;  2M4I A;  4BMJ A;  2EPC A;  4BHB A;  5KL3 A;  2ENC A;  1ZAA C;  1EKZ A;  4R2P A;  2YU5 A;  2EN1 A;  4X65 E;  1WHQ A;  1PJQ A;  3BBG A;  3J80 C;  2YRM A;  2RQL A;  5A6A A;  1EH7 A;  5KL4 A;  1IQO A;  4X62 E;  2EN2 A;  3MHS C;  4DR6 E;  5T6J A;  2EMX A;  2B7V A;  2D9H A;  1A1G A;  2LRS A;  2R76 A;  2EL6 A;  1DI2 A;  2EN7 A;  2I9I A;  2ELZ A;  4DR7 E;  2EM3 A; 
#chains in the Genus database with same CATH homology
 1X6F A;  3UK3 C;  2EM6 A;  2BB8 A;  1MEY C;  2ELY A;  1X6H A;  2ENH A;  2VRD A;  1B69 A;  2EN6 A;  1LLM C;  3EPL A;  2EQ1 A;  1A1J A;  1A1H A;  2J7J A;  2EOO A;  2LV2 A;  2EM2 A;  2EJ4 A;  2ADR A;  1Z1B A;  3EPH A;  4R2R A;  2WBS A;  2EM8 A;  2YRK A;  1UN6 B;  2EM5 A;  5KL7 A;  1A1F A;  2EMI A;  2EOE A;  1ZR9 A;  2EPP A;  4R2Q A;  2EPU A;  2YTF A;  2EOR A;  5KL5 A;  2MDG A;  4IJD A;  1UBD C;  2EOQ A;  1WJP A;  3MHH C;  2EOH A;  2EMG A;  2M9A A;  4GZN C;  1A1I A;  2GHF A;  4F6N A;  1X6E A;  3VHT B;  4R2S A;  2LO3 A;  2DLK A;  2LCE A;  4R2A A;  1DGC A;  4R2D A;  2EL4 A;  2DLQ A;  5KL2 A;  4F2J C;  2DGC A;  2DMI A;  2EMB A;  2YRH A;  1BB8 A;  1X5W A;  2A25 A;  2EML A;  1G2D C;  2EM7 A;  2EMY A;  2EMW A;  1YUJ A;  2JPA A;  2EMC A;  2EE8 A;  2EMZ A;  2EPZ A;  3EPK A;  2YTG A;  1G2F C;  2EM9 A;  1ZU1 A;  2EL5 A;  2R1F A;  2WCC 3;  4WSG A;  2EOS A;  2YSP A;  4IS1 C;  2EN3 A;  1KJK A;  2EN4 A;  2EOY A;  3M99 B;  2EP3 A;  2YTI A;  2E72 A;  2WBT A;  4R2C A;  2JP9 A;  2YTQ A;  2EM0 A;  2YSO A;  2EQ3 A;  4X9J A;  1YUI A;  2YTJ A;  1AAY A;  2WBU A;  3EPJ A;  2YTO A;  2EOI A;  2RPC A;  2I13 A;  2EMK A;  2PRT A;  2EPC A;  2DRP A;  2EQ0 A;  1TF6 A;  2NAB A;  4M9V C;  5KL3 A;  2ENC A;  4F6M A;  2EPX A;  2EMH A;  1ZAA C;  1A1L A;  2YU8 A;  1BBO A;  4R2P A;  2CTD A;  1P47 A;  1TF3 A;  2YTP A;  2YU5 A;  2GLI A;  2RSI A;  2EN1 A;  2EPR A;  2LVH A;  2EN8 A;  2EOZ A;  1JK1 A;  2YRM A;  1TN9 A;  2EM4 A;  4R2E A;  5KL4 A;  2MKD A;  2EN2 A;  3MHS C;  2ENA A;  2D9H A;  2EMX A;  1F2I G;  1A1G A;  2YTE A;  2CSH A;  2EOJ A;  2EOM A;  2MKN A;  1JK2 A;  2YTN A;  2EMF A;  4FK5 C;  2EL6 A;  2YTD A;  1NCS A;  1A1K A;  1X3C A;  1RMD A;  2EOX A;  5KL6 A;  2EOF A;  1YSA C;  2EPA A;  2EN7 A;  2HGH A;  2CT1 A;  2ELZ A;  2EMA A;  2LT7 A;  2EM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...