2EMLA

Solution structure of the c2h2 type zinc finger (region 752-784) of human zinc finger protein 28 homolog
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYECSVCGKAFSHRQSLSVHQRIHSGKKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 752-784) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 28 homolog
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emlA01
2M9AA 2YTQA 3EPKA 2RPCA 2EMLA 2LV2A 1A1LA 2EMBA 2EQ1A 1KJKA 3MHSC 5KL5A 2EOEA 2ADRA 1WJPA 2WBUA 2ELYA 2EPXA 1UN6B 2EQ0A 1X6EA 1DGCA 1A1IA 2EMAA 2RSIA 5KL6A 2JP9A 2EL5A 2EOOA 1ZAAC 1ZU1A 4F6MA 1BB8A 1A1JA 1YUJA 2EM9A 2I13A 1A1FA 4R2PA 2YTFA 3EPLA 1YUIA 4R2EA 2EMYA 1A1GA 2ENCA 2R1FA 2YSPA 5KL4A 2EOHA 3VHTB 2EPRA 2EOSA 4IS1C 2EMKA 2MDGA 3MHHC 2EM8A 2ENHA 2EQ3A 1BBOA 2YTPA 4GZNC 2EP3A 2EOMA 2A25A 1LLMC 2YTJA 2YTDA 2PRTA 2J7JA 4IJDA 2LVHA 2EOFA 2DLQA 2LCEA 4R2QA 2DRPA 2VRDA 2BB8A 1X6FA 2E72A 2WBSA 1NCSA 2EOZA 2EMCA 4FK5C 2LT7A 2NABA 2EM3A 2EM5A 4R2RA 5KL3A 1TN9A 1G2FC 1AAYA 2EMFA 1TF6A 1UBDC 1F2IG 1Z1BA 2YTGA 1ZR9A 2EL4A 2EN1A 2EM0A 2MKDA 1YSAC 2GHFA 2EMGA 4R2AA 2YSOA 1P47A 2MKNA 2EMZA 2YTOA 4M9VC 2EM7A 1X6HA 2EMWA 2EMHA 2EOIA 1A1HA 2GLIA 3EPJA 2EM2A 2YTNA 3UK3C 2EPAA 2EORA 4F6NA 2EPCA 2EN7A 2LO3A 1X3CA 1X5WA 2EOQA 2EOYA 4R2DA 1MEYC 2WBTA 2EPUA 4R2SA 2ELZA 2EN2A 2EMXA 1RMDA 3M99B 2DLKA 2EL6A 2WCC3 5KL7A 2YTIA 2EPZA 2EM4A 2DMIA 2EOXA 5KL2A 2EJ4A 2CT1A 2YRMA 1B69A 1G2DC 2YRKA 4X9JA 1JK1A 2DGCA 1TF3A 2JPAA 2EM6A 2CSHA 2YTEA 1JK2A 2EPPA 2EE8A 3EPHA 2EN3A 2EN4A 4WSGA 2YU8A 2CTDA 2ENAA 2EOJA 4F2JC 2EN8A 2EN6A 4R2CA 1A1KA 2HGHA 2D9HA 2YU5A 2EMIA 2YRHA
chains in the Genus database with same CATH superfamily
1GQEA 2RPCA 2V87A 1YYKA 4TUGA 2IHR1 3LMLA 3MHSC 5KL5A 2YWQA 1BBGA 2H36X 2JOBA 2LBSB 1WJPA 2WBUA 5A69A 1XNRE 2EQ0A 4X64E 1DGCA 2JY9A 2EMAA 2ZM6E 3J81C 2Q8UA 1A1JA 2EPKX 5IWAE 4DR2E 1A1FA 4F54A 4R2PA 1YUIA 4JI0E 5BR8E 5KL4A 3VHTB 2EPRA 2M4IA 2EOSA 1WHNA 4DV1E 4DV5E 2F8BA 4OX9E 2EM8A 2B7VA 2YTPA 3HPZA 2A25A 3ADGA 1I94E 4O24A 1YYOA 2NUEA 4OOGC 2YTDA 1HNXE 2J7JA 2MDRA 4IJDA 2LVHA 2HJJA 2DLQA 4DR6E 4R2QA 4WPYA 2VRDA 2E72A 1QNTA 1WHQA 3C6KA 2WBSA 3T1HE 1EKZA 1T39A 4JI3E 5AC5A 2B7TA 4R03A 1N3GA 5ADZA 4R2RA 4BHBA 2EMFA 4WYQB 2VQFE 1TF6A 2LJHA 4M2ZA 2YTGA 4JV5E 2EN1A 2GHFA 2V83A 3JAMC 1N36E 3L00A 4AQYE 4KHPE 2EMHA 5AC4A 2K7IA 1IBLE 3EPJA 2VF1A 2EORA 4F6NA 3TQMA 4JI8E 5AE3A 4B3SE 1X5WA 1N33E 3KZZA 4R2DA 1MEYC 4BS9A 1XMOE 2B3TB 1X48A 2NUGA 3ADIA 5IV8B 2EN2A 1YFHA 1L4SA 3EQ1A 5KL7A 2DSYA 2UUAE 2EPZA 4O4KA 5KL2A 2CT1A 4DV2E 2N3GA 2YRKA 1JK1A 2EM6A 2ODRD 4BC9A 5CFFE 4Q35B 4BHCA 2EPNA 2L33A 3J7Yp 2UU9E 2ENAA 2EPMX 2L3CA 1A1KA 4ZYGA 2YU5A 3BF2A 1Z1BA 1IQSA 2M9AA 1EH7A 1YPNA 1A1LA 4ZYDA 4Q28A 4MLVA 4WXDA 1PJQA 2LJUA 2EOEA 2ADRA 4X8WA 3C6MA 3HPSA 4F9CB 4DR4E 4B3ME 4ZYEA 2B9DA 1A1IA 2VQEE 4DR1E 2JP9A 2EL5A 5LL6R 4NHRA 4F6MA 2V88A 2EPLX 2EMYA 4GKJE 4NZVA 2L2MA 2YSPA 4JI1E 4JI5E 4DR5E 1J5EE 2EQ3A 2E5LE 4O43A 4JI7E 2UXDE 2V85A 4LF5E 4LU9A 1WXRA 1RQ0A 2DIXA 1YYWA 2K4VA 2EM3A 4ZYHA 4BC7A 3ADLA 3HTXA 2LUQA 5KL3A 1TN9A 4F9AB 2V86A 1UBDC 1F2IG 1SFEA 4HTGA 1MGTA 1ZR9A 2EL4A 5AE1A 1YSAC 2DMYA 1STUA 4R2AA 4X65E 1P47A 1IBKE 2MKNA 2YTOA 4M9VC 2EM7A 1X6HA 2L6MA 1A1HA 3JTZA 2GLIA 2EM2A 2EPOA 1PJSA 2LTRA 3JU0A 2EOQA 2M1SA 4R2SA 2EMXA 2YTIA 3IWBA 2EOXA 4LFCE 5LMUE 5F3WA 2DGCA 2JPAA 1HNWE 2YTEA 2NA2A 1JK2A 2EPPA 3OTOE 2EE8A 4DV3E 3QG5C 2M7QA 4P78A 2EOJA 4F2JC 1J26A 2EN8A 2EN6A 1T4LB 1PDAA 1X47A 4KWYA 3BGHA 4JI6E 5IXMB 2YRHA 3H09A 4LF7E 4NXME 2LV2A 3J80C 1RC7A 3VYYA 2EMBA 2EQ1A 1KJKA 5DNYA 2N3HA 4DV4E 4DV6E 2DB2A 4GKKE 4WX9A 1FKAE 1X6EA 4YY3E 2L2NA 4LF4E 2RSIA 2RS6A 5KL6A 5IT9C 4BMJA 4DR3E 2EOOA 4DUYE 1BB8A 3IWDA 1YUJA 3THNA 4M0VA 2FV4B 2YTFA 3IWCA 5A6KA 4P7DA 2JOXA 4R2EA 1A1GA 2R1FA 4JI4E 2EOHA 4K0KE 1UHZA 4DKKA 3DF6A 5A2QC 4IS1C 5A6BA 1WRJA 2EMKA 2MDGA 2ENHA 5TSEA 2EP3A 2EOMA 3BBGA 4BBYA 4L8NA 2YTJA 1UILA 2I9IA 2EOFA 3DJWA 3AV0A 4J8ZA 4MLQA 2UUBE 2LCEA 1X49A 3AUZA 1X6FA 1GTKA 2EOZA 4N4RB 3K6QA 2MC5A 2EM5A 1EH6A 2JVAA 3MSWA 1IMUA 1NEIA 2ODRC 2G7HA 4KZSA 4NXNE 4B3TE 1YZ9A 1AH5A 2MKDA 1ZBQA 2EMGA 2YSOA 4JYAE 5AE2A 3HXLA 2FGGA 5FLXC 3J7AG 4JI2E 3ECRA 4LF9E 2JXPA 2EPAA 2EN7A 2JR1A 2LO3A 1X3CA 2EOYA 2EZ6A 1IQOA 2EPUA 4BCAA 2ELZA 2N8XA 2KOUA 2L2KB 2LUPB 4X66E 1T4NA 3FIGA 3KWRA 2DMIA 2GPIA 2YRMA 3BIDA 1G2DC 4X9JA 1QU6A 2UXCE 2KHXA 2L3JA 2RQLA 3EPHA 3HQ1A 2HGHA 2EWLA 2BBGA 2EMIA 4LF6E 2YPNA 2YTQA 3EPKA 4LFBE 2EMLA 2V89A 4WFTA 2MC6A 4DV0E 2HC5A 4GEQB 4R8OA 3F6HA 2ELYA 2EPXA 3VK6A 1UN6B 1N32E 1PKPA 4LFAE 2JWOA 1ZAAC 1ZU1A 5AASA 2EM9A 4HEIA 2UUCE 3KZYA 1EH8A 2I13A 3EPLA 1N34E 2ENCA 4L5NC 4F9BB 4O5GA 4I8OA 4M30A 3MHHC 2F4VE 4YHHE 1BBOA 4GZNC 3C4BA 2LE2A 1LLMC 2FTXB 2LMZA 2NUFA 2PRTA 1XNQE 1T38A 2CPNA 5LLQA 4DR7E 3P1XA 2R76A 2DRPA 2BB8A 2HHHE 2VE7C 1NCSA 2EMCA 3ADJA 4FK5C 2LT7A 3C4TA 2NABA 4WSPA 4LTYA 1XMQE 4DUZE 1G2FC 4X62E 1O0WA 1AAYA 1PJTA 2RTXA 1GZ6A 2LTSA 2V8QB 3THOB 5A6BD 2JYAA 1IBME 2RS7A 2EM0A 1HNZE 5T6JA 1SR9A 4DV7E 2EMZA 2YT4A 2EMWA 2EOIA 3T1YE 2YTNA 3UK3C 5A6JA 2EPCA 4DMIA 2L92A 1DQ3A 3RMPA 3F6GA 4RH8A 2RSMA 4LF8E 3LLHA 5LMNE 2WBTA 1RMDA 3M99B 1HR0E 1FJGE 2EL6A 2L8TA 5A6AA 2WCC3 4RHBB 2UXBE 2EM4A 2EJ4A 1B69A 4B3RE 2KONA 2LRSA 1TF3A 4WXCA 2CSHA 1DI2A 2WZOA 1KYQA 3ZOQB 1ZBTA 2EN3A 2EN4A 4WSGA 2YU8A 2CTDA 1T4OA 3VYXA 4R2CA 2D9HA 3OMLA 2E1MA 2DLKA 4TUIA 2YZTA
chains in the Genus database with same CATH topology
2M9AA 2YTQA 3EPKA 2RPCA 2EMLA 2LV2A 1A1LA 2EMBA 2EQ1A 1KJKA 3MHSC 5KL5A 2EOEA 2ADRA 1WJPA 2WBUA 2ELYA 2EPXA 1UN6B 2EQ0A 1X6EA 1DGCA 1A1IA 2EMAA 2RSIA 5KL6A 2JP9A 2EL5A 2EOOA 1ZAAC 1ZU1A 4F6MA 1BB8A 1A1JA 1YUJA 2EM9A 2I13A 1A1FA 4R2PA 2YTFA 3EPLA 1YUIA 4R2EA 2EMYA 1A1GA 2ENCA 2R1FA 2YSPA 5KL4A 2EOHA 3VHTB 2EPRA 2EOSA 4IS1C 2EMKA 2MDGA 3MHHC 2EM8A 2ENHA 2EQ3A 1BBOA 2YTPA 4GZNC 2EP3A 2EOMA 2A25A 1LLMC 2YTJA 2YTDA 2PRTA 2J7JA 4IJDA 2LVHA 2EOFA 2DLQA 2LCEA 4R2QA 2DRPA 2VRDA 2BB8A 1X6FA 2E72A 2WBSA 1NCSA 2EOZA 2EMCA 4FK5C 2LT7A 2NABA 2EM3A 2EM5A 4R2RA 5KL3A 1TN9A 1G2FC 1AAYA 2EMFA 1TF6A 1UBDC 1F2IG 1Z1BA 2YTGA 1ZR9A 2EL4A 2EN1A 2EM0A 2MKDA 1YSAC 2GHFA 2EMGA 4R2AA 2YSOA 1P47A 2MKNA 2EMZA 2YTOA 4M9VC 2EM7A 1X6HA 2EMWA 2EMHA 2EOIA 1A1HA 2GLIA 3EPJA 2EM2A 2YTNA 3UK3C 2EPAA 2EORA 4F6NA 2EPCA 2EN7A 2LO3A 1X3CA 1X5WA 2EOQA 2EOYA 4R2DA 1MEYC 2WBTA 2EPUA 4R2SA 2ELZA 2EN2A 2EMXA 1RMDA 3M99B 2DLKA 2EL6A 2WCC3 5KL7A 2YTIA 2EPZA 2EM4A 2DMIA 2EOXA 5KL2A 2EJ4A 2CT1A 2YRMA 1B69A 1G2DC 2YRKA 4X9JA 1JK1A 2DGCA 1TF3A 2JPAA 2EM6A 2CSHA 2YTEA 1JK2A 2EPPA 2EE8A 3EPHA 2EN3A 2EN4A 4WSGA 2YU8A 2CTDA 2ENAA 2EOJA 4F2JC 2EN8A 2EN6A 4R2CA 1A1KA 2HGHA 2D9HA 2YU5A 2EMIA 2YRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9A A;  2YTQ A;  3EPK A;  2RPC A;  2EML A;  2LV2 A;  1A1L A;  2EMB A;  2EQ1 A;  1KJK A;  3MHS C;  5KL5 A;  2EOE A;  2ADR A;  1WJP A;  2WBU A;  2ELY A;  2EPX A;  1UN6 B;  2EQ0 A;  1X6E A;  1DGC A;  1A1I A;  2EMA A;  2RSI A;  5KL6 A;  2JP9 A;  2EL5 A;  2EOO A;  1ZAA C;  1ZU1 A;  4F6M A;  1BB8 A;  1A1J A;  1YUJ A;  2EM9 A;  2I13 A;  1A1F A;  4R2P A;  2YTF A;  3EPL A;  1YUI A;  4R2E A;  2EMY A;  1A1G A;  2ENC A;  2R1F A;  2YSP A;  5KL4 A;  2EOH A;  3VHT B;  2EPR A;  2EOS A;  4IS1 C;  2EMK A;  2MDG A;  3MHH C;  2EM8 A;  2ENH A;  2EQ3 A;  1BBO A;  2YTP A;  4GZN C;  2EP3 A;  2EOM A;  2A25 A;  1LLM C;  2YTJ A;  2YTD A;  2PRT A;  2J7J A;  4IJD A;  2LVH A;  2EOF A;  2DLQ A;  2LCE A;  4R2Q A;  2DRP A;  2VRD A;  2BB8 A;  1X6F A;  2E72 A;  2WBS A;  1NCS A;  2EOZ A;  2EMC A;  4FK5 C;  2LT7 A;  2NAB A;  2EM3 A;  2EM5 A;  4R2R A;  5KL3 A;  1TN9 A;  1G2F C;  1AAY A;  2EMF A;  1TF6 A;  1UBD C;  1F2I G;  1Z1B A;  2YTG A;  1ZR9 A;  2EL4 A;  2EN1 A;  2EM0 A;  2MKD A;  1YSA C;  2GHF A;  2EMG A;  4R2A A;  2YSO A;  1P47 A;  2MKN A;  2EMZ A;  2YTO A;  4M9V C;  2EM7 A;  1X6H A;  2EMW A;  2EMH A;  2EOI A;  1A1H A;  2GLI A;  3EPJ A;  2EM2 A;  2YTN A;  3UK3 C;  2EPA A;  2EOR A;  4F6N A;  2EPC A;  2EN7 A;  2LO3 A;  1X3C A;  1X5W A;  2EOQ A;  2EOY A;  4R2D A;  1MEY C;  2WBT A;  2EPU A;  4R2S A;  2ELZ A;  2EN2 A;  2EMX A;  1RMD A;  3M99 B;  2DLK A;  2EL6 A;  2WCC 3;  5KL7 A;  2YTI A;  2EPZ A;  2EM4 A;  2DMI A;  2EOX A;  5KL2 A;  2EJ4 A;  2CT1 A;  2YRM A;  1B69 A;  1G2D C;  2YRK A;  4X9J A;  1JK1 A;  2DGC A;  1TF3 A;  2JPA A;  2EM6 A;  2CSH A;  2YTE A;  1JK2 A;  2EPP A;  2EE8 A;  3EPH A;  2EN3 A;  2EN4 A;  4WSG A;  2YU8 A;  2CTD A;  2ENA A;  2EOJ A;  4F2J C;  2EN8 A;  2EN6 A;  4R2C A;  1A1K A;  2HGH A;  2D9H A;  2YU5 A;  2EMI A;  2YRH A; 
#chains in the Genus database with same CATH topology
 1GQE A;  2RPC A;  2V87 A;  1YYK A;  4TUG A;  2IHR 1;  3LML A;  3MHS C;  5KL5 A;  2YWQ A;  1BBG A;  2H36 X;  2JOB A;  2LBS B;  1WJP A;  2WBU A;  5A69 A;  1XNR E;  2EQ0 A;  4X64 E;  1DGC A;  2JY9 A;  2EMA A;  2ZM6 E;  3J81 C;  2Q8U A;  1A1J A;  2EPK X;  5IWA E;  4DR2 E;  1A1F A;  4F54 A;  4R2P A;  1YUI A;  4JI0 E;  5BR8 E;  5KL4 A;  3VHT B;  2EPR A;  2M4I A;  2EOS A;  1WHN A;  4DV1 E;  4DV5 E;  2F8B A;  4OX9 E;  2EM8 A;  2B7V A;  2YTP A;  3HPZ A;  2A25 A;  3ADG A;  1I94 E;  4O24 A;  1YYO A;  2NUE A;  4OOG C;  2YTD A;  1HNX E;  2J7J A;  2MDR A;  4IJD A;  2LVH A;  2HJJ A;  2DLQ A;  4DR6 E;  4R2Q A;  4WPY A;  2VRD A;  2E72 A;  1QNT A;  1WHQ A;  3C6K A;  2WBS A;  3T1H E;  1EKZ A;  1T39 A;  4JI3 E;  5AC5 A;  2B7T A;  4R03 A;  1N3G A;  5ADZ A;  4R2R A;  4BHB A;  2EMF A;  4WYQ B;  2VQF E;  1TF6 A;  2LJH A;  4M2Z A;  2YTG A;  4JV5 E;  2EN1 A;  2GHF A;  2V83 A;  3JAM C;  1N36 E;  3L00 A;  4AQY E;  4KHP E;  2EMH A;  5AC4 A;  2K7I A;  1IBL E;  3EPJ A;  2VF1 A;  2EOR A;  4F6N A;  3TQM A;  4JI8 E;  5AE3 A;  4B3S E;  1X5W A;  1N33 E;  3KZZ A;  4R2D A;  1MEY C;  4BS9 A;  1XMO E;  2B3T B;  1X48 A;  2NUG A;  3ADI A;  5IV8 B;  2EN2 A;  1YFH A;  1L4S A;  3EQ1 A;  5KL7 A;  2DSY A;  2UUA E;  2EPZ A;  4O4K A;  5KL2 A;  2CT1 A;  4DV2 E;  2N3G A;  2YRK A;  1JK1 A;  2EM6 A;  2ODR D;  4BC9 A;  5CFF E;  4Q35 B;  4BHC A;  2EPN A;  2L33 A;  3J7Y p;  2UU9 E;  2ENA A;  2EPM X;  2L3C A;  1A1K A;  4ZYG A;  2YU5 A;  3BF2 A;  1Z1B A;  1IQS A;  2M9A A;  1EH7 A;  1YPN A;  1A1L A;  4ZYD A;  4Q28 A;  4MLV A;  4WXD A;  1PJQ A;  2LJU A;  2EOE A;  2ADR A;  4X8W A;  3C6M A;  3HPS A;  4F9C B;  4DR4 E;  4B3M E;  4ZYE A;  2B9D A;  1A1I A;  2VQE E;  4DR1 E;  2JP9 A;  2EL5 A;  5LL6 R;  4NHR A;  4F6M A;  2V88 A;  2EPL X;  2EMY A;  4GKJ E;  4NZV A;  2L2M A;  2YSP A;  4JI1 E;  4JI5 E;  4DR5 E;  1J5E E;  2EQ3 A;  2E5L E;  4O43 A;  4JI7 E;  2UXD E;  2V85 A;  4LF5 E;  4LU9 A;  1WXR A;  1RQ0 A;  2DIX A;  1YYW A;  2K4V A;  2EM3 A;  4ZYH A;  4BC7 A;  3ADL A;  3HTX A;  2LUQ A;  5KL3 A;  1TN9 A;  4F9A B;  2V86 A;  1UBD C;  1F2I G;  1SFE A;  4HTG A;  1MGT A;  1ZR9 A;  2EL4 A;  5AE1 A;  1YSA C;  2DMY A;  1STU A;  4R2A A;  4X65 E;  1P47 A;  1IBK E;  2MKN A;  2YTO A;  4M9V C;  2EM7 A;  1X6H A;  2L6M A;  1A1H A;  3JTZ A;  2GLI A;  2EM2 A;  2EPO A;  1PJS A;  2LTR A;  3JU0 A;  2EOQ A;  2M1S A;  4R2S A;  2EMX A;  2YTI A;  3IWB A;  2EOX A;  4LFC E;  5LMU E;  5F3W A;  2DGC A;  2JPA A;  1HNW E;  2YTE A;  2NA2 A;  1JK2 A;  2EPP A;  3OTO E;  2EE8 A;  4DV3 E;  3QG5 C;  2M7Q A;  4P78 A;  2EOJ A;  4F2J C;  1J26 A;  2EN8 A;  2EN6 A;  1T4L B;  1PDA A;  1X47 A;  4KWY A;  3BGH A;  4JI6 E;  5IXM B;  2YRH A;  3H09 A;  4LF7 E;  4NXM E;  2LV2 A;  3J80 C;  1RC7 A;  3VYY A;  2EMB A;  2EQ1 A;  1KJK A;  5DNY A;  2N3H A;  4DV4 E;  4DV6 E;  2DB2 A;  4GKK E;  4WX9 A;  1FKA E;  1X6E A;  4YY3 E;  2L2N A;  4LF4 E;  2RSI A;  2RS6 A;  5KL6 A;  5IT9 C;  4BMJ A;  4DR3 E;  2EOO A;  4DUY E;  1BB8 A;  3IWD A;  1YUJ A;  3THN A;  4M0V A;  2FV4 B;  2YTF A;  3IWC A;  5A6K A;  4P7D A;  2JOX A;  4R2E A;  1A1G A;  2R1F A;  4JI4 E;  2EOH A;  4K0K E;  1UHZ A;  4DKK A;  3DF6 A;  5A2Q C;  4IS1 C;  5A6B A;  1WRJ A;  2EMK A;  2MDG A;  2ENH A;  5TSE A;  2EP3 A;  2EOM A;  3BBG A;  4BBY A;  4L8N A;  2YTJ A;  1UIL A;  2I9I A;  2EOF A;  3DJW A;  3AV0 A;  4J8Z A;  4MLQ A;  2UUB E;  2LCE A;  1X49 A;  3AUZ A;  1X6F A;  1GTK A;  2EOZ A;  4N4R B;  3K6Q A;  2MC5 A;  2EM5 A;  1EH6 A;  2JVA A;  3MSW A;  1IMU A;  1NEI A;  2ODR C;  2G7H A;  4KZS A;  4NXN E;  4B3T E;  1YZ9 A;  1AH5 A;  2MKD A;  1ZBQ A;  2EMG A;  2YSO A;  4JYA E;  5AE2 A;  3HXL A;  2FGG A;  5FLX C;  3J7A G;  4JI2 E;  3ECR A;  4LF9 E;  2JXP A;  2EPA A;  2EN7 A;  2JR1 A;  2LO3 A;  1X3C A;  2EOY A;  2EZ6 A;  1IQO A;  2EPU A;  4BCA A;  2ELZ A;  2N8X A;  2KOU A;  2L2K B;  2LUP B;  4X66 E;  1T4N A;  3FIG A;  3KWR A;  2DMI A;  2GPI A;  2YRM A;  3BID A;  1G2D C;  4X9J A;  1QU6 A;  2UXC E;  2KHX A;  2L3J A;  2RQL A;  3EPH A;  3HQ1 A;  2HGH A;  2EWL A;  2BBG A;  2EMI A;  4LF6 E;  2YPN A;  2YTQ A;  3EPK A;  4LFB E;  2EML A;  2V89 A;  4WFT A;  2MC6 A;  4DV0 E;  2HC5 A;  4GEQ B;  4R8O A;  3F6H A;  2ELY A;  2EPX A;  3VK6 A;  1UN6 B;  1N32 E;  1PKP A;  4LFA E;  2JWO A;  1ZAA C;  1ZU1 A;  5AAS A;  2EM9 A;  4HEI A;  2UUC E;  3KZY A;  1EH8 A;  2I13 A;  3EPL A;  1N34 E;  2ENC A;  4L5N C;  4F9B B;  4O5G A;  4I8O A;  4M30 A;  3MHH C;  2F4V E;  4YHH E;  1BBO A;  4GZN C;  3C4B A;  2LE2 A;  1LLM C;  2FTX B;  2LMZ A;  2NUF A;  2PRT A;  1XNQ E;  1T38 A;  2CPN A;  5LLQ A;  4DR7 E;  3P1X A;  2R76 A;  2DRP A;  2BB8 A;  2HHH E;  2VE7 C;  1NCS A;  2EMC A;  3ADJ A;  4FK5 C;  2LT7 A;  3C4T A;  2NAB A;  4WSP A;  4LTY A;  1XMQ E;  4DUZ E;  1G2F C;  4X62 E;  1O0W A;  1AAY A;  1PJT A;  2RTX A;  1GZ6 A;  2LTS A;  2V8Q B;  3THO B;  5A6B D;  2JYA A;  1IBM E;  2RS7 A;  2EM0 A;  1HNZ E;  5T6J A;  1SR9 A;  4DV7 E;  2EMZ A;  2YT4 A;  2EMW A;  2EOI A;  3T1Y E;  2YTN A;  3UK3 C;  5A6J A;  2EPC A;  4DMI A;  2L92 A;  1DQ3 A;  3RMP A;  3F6G A;  4RH8 A;  2RSM A;  4LF8 E;  3LLH A;  5LMN E;  2WBT A;  1RMD A;  3M99 B;  1HR0 E;  1FJG E;  2EL6 A;  2L8T A;  5A6A A;  2WCC 3;  4RHB B;  2UXB E;  2EM4 A;  2EJ4 A;  1B69 A;  4B3R E;  2KON A;  2LRS A;  1TF3 A;  4WXC A;  2CSH A;  1DI2 A;  2WZO A;  1KYQ A;  3ZOQ B;  1ZBT A;  2EN3 A;  2EN4 A;  4WSG A;  2YU8 A;  2CTD A;  1T4O A;  3VYX A;  4R2C A;  2D9H A;  3OML A;  2E1M A;  2DLK A;  4TUI A;  2YZT A; 
#chains in the Genus database with same CATH homology
 2M9A A;  2YTQ A;  3EPK A;  2RPC A;  2EML A;  2LV2 A;  1A1L A;  2EMB A;  2EQ1 A;  1KJK A;  3MHS C;  5KL5 A;  2EOE A;  2ADR A;  1WJP A;  2WBU A;  2ELY A;  2EPX A;  1UN6 B;  2EQ0 A;  1X6E A;  1DGC A;  1A1I A;  2EMA A;  2RSI A;  5KL6 A;  2JP9 A;  2EL5 A;  2EOO A;  1ZAA C;  1ZU1 A;  4F6M A;  1BB8 A;  1A1J A;  1YUJ A;  2EM9 A;  2I13 A;  1A1F A;  4R2P A;  2YTF A;  3EPL A;  1YUI A;  4R2E A;  2EMY A;  1A1G A;  2ENC A;  2R1F A;  2YSP A;  5KL4 A;  2EOH A;  3VHT B;  2EPR A;  2EOS A;  4IS1 C;  2EMK A;  2MDG A;  3MHH C;  2EM8 A;  2ENH A;  2EQ3 A;  1BBO A;  2YTP A;  4GZN C;  2EP3 A;  2EOM A;  2A25 A;  1LLM C;  2YTJ A;  2YTD A;  2PRT A;  2J7J A;  4IJD A;  2LVH A;  2EOF A;  2DLQ A;  2LCE A;  4R2Q A;  2DRP A;  2VRD A;  2BB8 A;  1X6F A;  2E72 A;  2WBS A;  1NCS A;  2EOZ A;  2EMC A;  4FK5 C;  2LT7 A;  2NAB A;  2EM3 A;  2EM5 A;  4R2R A;  5KL3 A;  1TN9 A;  1G2F C;  1AAY A;  2EMF A;  1TF6 A;  1UBD C;  1F2I G;  1Z1B A;  2YTG A;  1ZR9 A;  2EL4 A;  2EN1 A;  2EM0 A;  2MKD A;  1YSA C;  2GHF A;  2EMG A;  4R2A A;  2YSO A;  1P47 A;  2MKN A;  2EMZ A;  2YTO A;  4M9V C;  2EM7 A;  1X6H A;  2EMW A;  2EMH A;  2EOI A;  1A1H A;  2GLI A;  3EPJ A;  2EM2 A;  2YTN A;  3UK3 C;  2EPA A;  2EOR A;  4F6N A;  2EPC A;  2EN7 A;  2LO3 A;  1X3C A;  1X5W A;  2EOQ A;  2EOY A;  4R2D A;  1MEY C;  2WBT A;  2EPU A;  4R2S A;  2ELZ A;  2EN2 A;  2EMX A;  1RMD A;  3M99 B;  2DLK A;  2EL6 A;  2WCC 3;  5KL7 A;  2YTI A;  2EPZ A;  2EM4 A;  2DMI A;  2EOX A;  5KL2 A;  2EJ4 A;  2CT1 A;  2YRM A;  1B69 A;  1G2D C;  2YRK A;  4X9J A;  1JK1 A;  2DGC A;  1TF3 A;  2JPA A;  2EM6 A;  2CSH A;  2YTE A;  1JK2 A;  2EPP A;  2EE8 A;  3EPH A;  2EN3 A;  2EN4 A;  4WSG A;  2YU8 A;  2CTD A;  2ENA A;  2EOJ A;  4F2J C;  2EN8 A;  2EN6 A;  4R2C A;  1A1K A;  2HGH A;  2D9H A;  2YU5 A;  2EMI A;  2YRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...