2EMLA

Solution structure of the c2h2 type zinc finger (region 752-784) of human zinc finger protein 28 homolog
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYECSVCGKAFSHRQSLSVHQRIHSGKKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 752-784) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 28 homolog
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emlA01
1Z1BA 2EOJA 2YTQA 1A1JA 2EMAA 1UN6B 2EL5A 2GLIA 2HGHA 1B69A 1ZAAC 1JK2A 2J7JA 2DRPA 1WJPA 2ADRA 2D9HA 1F2IG 5KL6A 1NCSA 1YUIA 2JPAA 2EOSA 1MEYC 2ELYA 1X5WA 1X6EA 1AAYA 4IJDA 4X9JA 4F6NA 3EPHA 2EPAA 1TF3A 2RPCA 2EORA 2I13A 2DLKA 1X6FA 2EOXA 2EQ3A 2WCC3 1A1KA 2E72A 2MDGA 2CSHA 1X6HA 2ENAA 2YTIA 1A1FA 2DMIA 2ENHA 2YTEA 2EPXA 1ZR9A 2JP9A 2EM9A 1YSAC 2GHFA 5KL4A 1UBDC 2EOHA 2EM3A 3EPJA 1DGCA 1P47A 2LO3A 2EM8A 2R1FA 2EOFA 4FK5C 2EOEA 2MKDA 1BBOA 2YSOA 2EOOA 4R2DA 5KL3A 2EOYA 2YRKA 1A1IA 4IS1C 2EOZA 4R2AA 2NABA 4F2JC 3UK3C 5KL7A 2EOIA 2YTOA 2EM7A 2EN1A 2YTJA 2EPRA 4R2CA 2EL4A 2LV2A 1YUJA 2EMYA 2YRMA 2YU5A 1JK1A 2EJ4A 2WBSA 2EN6A 2M9AA 3VHTB 2WBTA 2EM0A 1A1HA 2EN7A 2DLQA 1RMDA 2EN2A 2EMFA 2EM6A 2LCEA 2YTNA 1TF6A 4R2PA 2EPUA 2EPZA 2EQ1A 1A1LA 2EOQA 1KJKA 2CTDA 2EE8A 2EM5A 2EMGA 2WBUA 4GZNC 2PRTA 3MHHC 2EP3A 1LLMC 1BB8A 2YU8A 2YTDA 2YTGA 5KL5A 4R2RA 2LT7A 4R2EA 2EM2A 2BB8A 2EMHA 2EMBA 4R2QA 2EOMA 1G2DC 4WSGA 2A25A 2YSPA 2LVHA 1X3CA 1A1GA 2EQ0A 5KL2A 3MHSC 3M99B 4R2SA 2EPPA 2VRDA 3EPKA 2EMXA 2YTPA 2EMIA 2YRHA 2EPCA 1TN9A 2EN8A 2MKNA 2ENCA 2EMWA 2EN4A 3EPLA 2ELZA 2EN3A 1ZU1A 2CT1A 2RSIA 2EMCA 2EMKA 2DGCA 2YTFA 4M9VC 2EMZA 1G2FC 4F6MA 2EMLA 2EL6A 2EM4A
chains in the Genus database with same CATH superfamily
1EH8A 1A1JA 4P78A 4L5NC 3KZZA 2GLIA 2HGHA 1FJGE 1UILA 3K6QA 1ZAAC 1X47A 4DV4E 2L2NA 2LTSA 3BF2A 4X8WA 2RTXA 3KZYA 4DV5E 1YUIA 2EOSA 1X5WA 5AC4A 4LF6E 1IBKE 2CPNA 3EPHA 2RPCA 1QU6A 1HNZE 2JVAA 4AQYE 2E72A 1X6HA 2EPLX 2MC5A 2ENAA 4O4KA 2EPMX 2YT4A 2YTEA 1ZR9A 3KWRA 2V85A 1T4OA 2EM3A 1DGCA 4LFAE 2LO3A 3JAMC 3ADIA 4DV1E 2MKDA 4WPYA 4LF4E 4R2DA 2NUEA 1J5EE 2JWOA 1A1IA 4IS1C 4JI1E 1HR0E 1YZ9A 4LF7E 1RQ0A 3L00A 2EM7A 2EN1A 4RH8A 2JR1A 2YRMA 5LL6R 4BC9A 2KONA 2EN6A 1A1HA 2EM0A 4JI6E 1L4SA 1N32E 1RMDA 3OTOE 3HPZA 3JU0A 1TF6A 2EPZA 2ODRD 1UHZA 2CTDA 2LRSA 4NZVA 2WBUA 2RS7A 4DV2E 2YU8A 5KL5A 2N8XA 2LT7A 4MLQA 4R2QA 2L6MA 4NHRA 5AASA 4TUIA 4HEIA 4LF5E 4DR4E 1YFHA 4P7DA 1I94E 3ADGA 2UXCE 2GPIA 2YRHA 1PDAA 4X64E 1TN9A 4DR2E 1STUA 5A6AA 4B3RE 3JTZA 1ZBTA 4JI7E 2K7IA 4NXNE 1ZU1A 2DGCA 2YTFA 4BHBA 4F6MA 4DR3E 5F3WA 4YY3E 2YTQA 1FKAE 4F9BB 4B3SE 2EL5A 1B69A 4WYQB 1YPNA 2J7JA 4R8OA 2D9HA 1XMOE 4M30A 2JPAA 4O43A 3VK6A 5BR8E 5A6BD 2LJUA 1DQ3A 4IJDA 1NEIA 1EKZA 2YWQA 2I13A 2NUGA 2DLKA 2JYAA 1PJQA 2L3JA 1A1KA 4M2ZA 5A6BA 4JI4E 2DMIA 2UU9E 2H36X 4WXDA 3J80C 5AE1A 5KL4A 2UUAE 2LE2A 5FLXC 2YZTA 4X65E 2R1FA 3C4TA 1WXRA 3ADLA 4FK5C 2EOEA 4LF8E 4DV0E 4DR5E 1YYOA 4F9CB 4O5GA 4B3ME 2N3GA 2RSMA 5KL7A 3FIGA 2YTOA 4JI2E 2EMYA 3J81C 1N34E 1ZBQA 4GKJE 1N33E 1JK1A 3DJWA 2NUFA 4OOGC 2FGGA 2YPNA 3VHTB 1WHQA 3P1XA 2DLQA 1SFEA 5LMNE 2EN2A 2EMFA 2EM6A 5LMUE 2EPUA 2EQ1A 1KJKA 2EM5A 3LMLA 4GZNC 2PRTA 2E5LE 2EP3A 2YTGA 1GQEA 4R2EA 3AUZA 2EMBA 2BB8A 4BC7A 1HNXE 5CFFE 1EH7A 4LF9E 2LTRA 1G2DC 1T4LB 2V86A 4WSGA 5AC5A 4ZYHA 1A1GA 2EQ0A 4BCAA 3M99B 2ZM6E 3EPKA 1N36E 1XMQE 2MKNA 2MDRA 4Q35B 4JI0E 2EMWA 2EN4A 2EPNA 2EPKX 2R76A 2RSIA 2VF1A 2EMKA 1T38A 4OX9E 4DUZE 2EMLA 4DR1E 1Z1BA 3RMPA 2EOJA 5A6JA 3IWCA 2LJHA 2E1MA 2BBGA 2V8QB 2V88A 4LFBE 5KL6A 4K0KE 2N3HA 1N3GA 1MEYC 2ELYA 2F4VE 1PKPA 2UUBE 1X6EA 4X9JA 4F6NA 1TF3A 5A6KA 3VYYA 3QG5C 2L33A 2EOXA 5TSEA 2EQ3A 1YYWA 5LLQA 2MDGA 2YTIA 4L8NA 5A2QC 3HQ1A 1A1FA 1IQOA 2B7TA 2B3TB 2EPXA 1YSAC 3F6GA 2IHR1 4GEQB 2F8BA 2M7QA 4DMIA 2L2MA 2EOFA 5IT9C 4KZSA 3LLHA 2YSOA 2EOOA 1WHNA 2YRKA 4DKKA 2LUQA 2HC5A 2V83A 2EOZA 4R2AA 3UK3C 1QNTA 2LMZA 4BHCA 2EOIA 4I8OA 2I9IA 2HHHE 2YTJA 2JY9A 2M1SA 2EPRA 4R2CA 3ECRA 1YUJA 1XNQE 2YU5A 4LFCE 3H09A 2DSYA 1J26A 4DV6E 2WBSA 4O24A 4Q28A 3HXLA 2M9AA 4WSPA 2VQFE 4J8ZA 1WRJA 2LCEA 1IQSA 2YTNA 4JYAE 2EOQA 4GKKE 2FV4B 1LLMC 1BB8A 3HTXA 2DIXA 4R2RA 1DI2A 2V87A 2EMHA 2EOMA 3BIDA 4WXCA 2EL6A 1RC7A 4WFTA 4DR6E 4JI8E 3TQMA 1X3CA 3VYXA 5KL2A 2M4IA 3OMLA 1BBGA 4R2SA 2EPPA 2VRDA 1IBLE 4JI3E 2NA2A 4X66E 2EPCA 4JI5E 3J7Yp 4TUGA 4BBYA 3EPLA 5AE3A 2EN3A 2UXBE 3C6KA 5ADZA 4LTYA 2EMCA 4M9VC 3IWBA 4RHBB 1G2FC 1YYKA 2EM4A 3MSWA 2DB2A 3EQ1A 2EMAA 4MLVA 1UN6B 2L8TA 1PJTA 1MGTA 5DNYA 2B7VA 2KOUA 1JK2A 2EPOA 2DRPA 1WJPA 2ADRA 1F2IG 1NCSA 5IV8B 3T1HE 2Q8UA 4M0VA 1GTKA 4DV7E 1AAYA 4DR7E 1PJSA 2EPAA 2EORA 2G7HA 5IXMB 1IBME 1X6FA 5IWAE 2WCC3 2DMYA 2CSHA 3ADJA 5AE2A 2ENHA 4N4RB 2JP9A 2EM9A 2GHFA 1UBDC 2EOHA 3EPJA 1X48A 2VE7C 3IWDA 1P47A 2RQLA 2EM8A 4DV3E 4B3TE 1IMUA 4F54A 1BBOA 1EH6A 1GZ6A 5KL3A 2EOYA 3C6MA 2NABA 4F2JC 4YHHE 2EWLA 2L2KB 2UXDE 2JOXA 2ODRC 3ZOQB 4BMJA 1XNRE 4X62E 5T6JA 2EL4A 2LV2A 2FTXB 4JV5E 2EJ4A 4KWYA 4WX9A 2HJJA 4DUYE 2V89A 4ZYGA 2WBTA 2EN7A 5A69A 2KHXA 4R2PA 2LUPB 2L92A 1A1LA 2EE8A 2EMGA 4F9AB 3THNA 2WZOA 3F6HA 4LU9A 2JXPA 3MHHC 2VQEE 1T39A 2YTDA 2EM2A 4BS9A 3DF6A 2L3CA 4NXME 3HPSA 3AV0A 3BBGA 3J7AG 2RS6A 2JOBA 4ZYDA 2A25A 3BGHA 2YSPA 4KHPE 2LVHA 3C4BA 1X49A 3MHSC 3T1YE 1T4NA 2EMXA 2YTPA 4ZYEA 2EZ6A 2EMIA 2MC6A 1HNWE 2EN8A 1SR9A 1AH5A 1KYQA 4HTGA 2ENCA 4R03A 2ELZA 2LBSB 2CT1A 3THOB 2K4VA 2EMZA 1O0WA 2UUCE 2B9DA
chains in the Genus database with same CATH topology
1Z1BA 2EOJA 2YTQA 1A1JA 2EMAA 1UN6B 2EL5A 2GLIA 2HGHA 1B69A 1ZAAC 1JK2A 2J7JA 2DRPA 1WJPA 2ADRA 2D9HA 1F2IG 5KL6A 1NCSA 1YUIA 2JPAA 2EOSA 1MEYC 2ELYA 1X5WA 1X6EA 1AAYA 4IJDA 4X9JA 4F6NA 3EPHA 2EPAA 1TF3A 2RPCA 2EORA 2I13A 2DLKA 1X6FA 2EOXA 2EQ3A 2WCC3 1A1KA 2E72A 2MDGA 2CSHA 1X6HA 2ENAA 2YTIA 1A1FA 2DMIA 2ENHA 2YTEA 2EPXA 1ZR9A 2JP9A 2EM9A 1YSAC 2GHFA 5KL4A 1UBDC 2EOHA 2EM3A 3EPJA 1DGCA 1P47A 2LO3A 2EM8A 2R1FA 2EOFA 4FK5C 2EOEA 2MKDA 1BBOA 2YSOA 2EOOA 4R2DA 5KL3A 2EOYA 2YRKA 1A1IA 4IS1C 2EOZA 4R2AA 2NABA 4F2JC 3UK3C 5KL7A 2EOIA 2YTOA 2EM7A 2EN1A 2YTJA 2EPRA 4R2CA 2EL4A 2LV2A 1YUJA 2EMYA 2YRMA 2YU5A 1JK1A 2EJ4A 2WBSA 2EN6A 2M9AA 3VHTB 2WBTA 2EM0A 1A1HA 2EN7A 2DLQA 1RMDA 2EN2A 2EMFA 2EM6A 2LCEA 2YTNA 1TF6A 4R2PA 2EPUA 2EPZA 2EQ1A 1A1LA 2EOQA 1KJKA 2CTDA 2EE8A 2EM5A 2EMGA 2WBUA 4GZNC 2PRTA 3MHHC 2EP3A 1LLMC 1BB8A 2YU8A 2YTDA 2YTGA 5KL5A 4R2RA 2LT7A 4R2EA 2EM2A 2BB8A 2EMHA 2EMBA 4R2QA 2EOMA 1G2DC 4WSGA 2A25A 2YSPA 2LVHA 1X3CA 1A1GA 2EQ0A 5KL2A 3MHSC 3M99B 4R2SA 2EPPA 2VRDA 3EPKA 2EMXA 2YTPA 2EMIA 2YRHA 2EPCA 1TN9A 2EN8A 2MKNA 2ENCA 2EMWA 2EN4A 3EPLA 2ELZA 2EN3A 1ZU1A 2CT1A 2RSIA 2EMCA 2EMKA 2DGCA 2YTFA 4M9VC 2EMZA 1G2FC 4F6MA 2EMLA 2EL6A 2EM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1B A;  2EOJ A;  2YTQ A;  1A1J A;  2EMA A;  1UN6 B;  2EL5 A;  2GLI A;  2HGH A;  1B69 A;  1ZAA C;  1JK2 A;  2J7J A;  2DRP A;  1WJP A;  2ADR A;  2D9H A;  1F2I G;  5KL6 A;  1NCS A;  1YUI A;  2JPA A;  2EOS A;  1MEY C;  2ELY A;  1X5W A;  1X6E A;  1AAY A;  4IJD A;  4X9J A;  4F6N A;  3EPH A;  2EPA A;  1TF3 A;  2RPC A;  2EOR A;  2I13 A;  2DLK A;  1X6F A;  2EOX A;  2EQ3 A;  2WCC 3;  1A1K A;  2E72 A;  2MDG A;  2CSH A;  1X6H A;  2ENA A;  2YTI A;  1A1F A;  2DMI A;  2ENH A;  2YTE A;  2EPX A;  1ZR9 A;  2JP9 A;  2EM9 A;  1YSA C;  2GHF A;  5KL4 A;  1UBD C;  2EOH A;  2EM3 A;  3EPJ A;  1DGC A;  1P47 A;  2LO3 A;  2EM8 A;  2R1F A;  2EOF A;  4FK5 C;  2EOE A;  2MKD A;  1BBO A;  2YSO A;  2EOO A;  4R2D A;  5KL3 A;  2EOY A;  2YRK A;  1A1I A;  4IS1 C;  2EOZ A;  4R2A A;  2NAB A;  4F2J C;  3UK3 C;  5KL7 A;  2EOI A;  2YTO A;  2EM7 A;  2EN1 A;  2YTJ A;  2EPR A;  4R2C A;  2EL4 A;  2LV2 A;  1YUJ A;  2EMY A;  2YRM A;  2YU5 A;  1JK1 A;  2EJ4 A;  2WBS A;  2EN6 A;  2M9A A;  3VHT B;  2WBT A;  2EM0 A;  1A1H A;  2EN7 A;  2DLQ A;  1RMD A;  2EN2 A;  2EMF A;  2EM6 A;  2LCE A;  2YTN A;  1TF6 A;  4R2P A;  2EPU A;  2EPZ A;  2EQ1 A;  1A1L A;  2EOQ A;  1KJK A;  2CTD A;  2EE8 A;  2EM5 A;  2EMG A;  2WBU A;  4GZN C;  2PRT A;  3MHH C;  2EP3 A;  1LLM C;  1BB8 A;  2YU8 A;  2YTD A;  2YTG A;  5KL5 A;  4R2R A;  2LT7 A;  4R2E A;  2EM2 A;  2BB8 A;  2EMH A;  2EMB A;  4R2Q A;  2EOM A;  1G2D C;  4WSG A;  2A25 A;  2YSP A;  2LVH A;  1X3C A;  1A1G A;  2EQ0 A;  5KL2 A;  3MHS C;  3M99 B;  4R2S A;  2EPP A;  2VRD A;  3EPK A;  2EMX A;  2YTP A;  2EMI A;  2YRH A;  2EPC A;  1TN9 A;  2EN8 A;  2MKN A;  2ENC A;  2EMW A;  2EN4 A;  3EPL A;  2ELZ A;  2EN3 A;  1ZU1 A;  2CT1 A;  2RSI A;  2EMC A;  2EMK A;  2DGC A;  2YTF A;  4M9V C;  2EMZ A;  1G2F C;  4F6M A;  2EML A;  2EL6 A;  2EM4 A; 
#chains in the Genus database with same CATH topology
 1EH8 A;  1A1J A;  4P78 A;  4L5N C;  3KZZ A;  2GLI A;  2HGH A;  1FJG E;  1UIL A;  3K6Q A;  1ZAA C;  1X47 A;  4DV4 E;  2L2N A;  2LTS A;  3BF2 A;  4X8W A;  2RTX A;  3KZY A;  4DV5 E;  1YUI A;  2EOS A;  1X5W A;  5AC4 A;  4LF6 E;  1IBK E;  2CPN A;  3EPH A;  2RPC A;  1QU6 A;  1HNZ E;  2JVA A;  4AQY E;  2E72 A;  1X6H A;  2EPL X;  2MC5 A;  2ENA A;  4O4K A;  2EPM X;  2YT4 A;  2YTE A;  1ZR9 A;  3KWR A;  2V85 A;  1T4O A;  2EM3 A;  1DGC A;  4LFA E;  2LO3 A;  3JAM C;  3ADI A;  4DV1 E;  2MKD A;  4WPY A;  4LF4 E;  4R2D A;  2NUE A;  1J5E E;  2JWO A;  1A1I A;  4IS1 C;  4JI1 E;  1HR0 E;  1YZ9 A;  4LF7 E;  1RQ0 A;  3L00 A;  2EM7 A;  2EN1 A;  4RH8 A;  2JR1 A;  2YRM A;  5LL6 R;  4BC9 A;  2KON A;  2EN6 A;  1A1H A;  2EM0 A;  4JI6 E;  1L4S A;  1N32 E;  1RMD A;  3OTO E;  3HPZ A;  3JU0 A;  1TF6 A;  2EPZ A;  2ODR D;  1UHZ A;  2CTD A;  2LRS A;  4NZV A;  2WBU A;  2RS7 A;  4DV2 E;  2YU8 A;  5KL5 A;  2N8X A;  2LT7 A;  4MLQ A;  4R2Q A;  2L6M A;  4NHR A;  5AAS A;  4TUI A;  4HEI A;  4LF5 E;  4DR4 E;  1YFH A;  4P7D A;  1I94 E;  3ADG A;  2UXC E;  2GPI A;  2YRH A;  1PDA A;  4X64 E;  1TN9 A;  4DR2 E;  1STU A;  5A6A A;  4B3R E;  3JTZ A;  1ZBT A;  4JI7 E;  2K7I A;  4NXN E;  1ZU1 A;  2DGC A;  2YTF A;  4BHB A;  4F6M A;  4DR3 E;  5F3W A;  4YY3 E;  2YTQ A;  1FKA E;  4F9B B;  4B3S E;  2EL5 A;  1B69 A;  4WYQ B;  1YPN A;  2J7J A;  4R8O A;  2D9H A;  1XMO E;  4M30 A;  2JPA A;  4O43 A;  3VK6 A;  5BR8 E;  5A6B D;  2LJU A;  1DQ3 A;  4IJD A;  1NEI A;  1EKZ A;  2YWQ A;  2I13 A;  2NUG A;  2DLK A;  2JYA A;  1PJQ A;  2L3J A;  1A1K A;  4M2Z A;  5A6B A;  4JI4 E;  2DMI A;  2UU9 E;  2H36 X;  4WXD A;  3J80 C;  5AE1 A;  5KL4 A;  2UUA E;  2LE2 A;  5FLX C;  2YZT A;  4X65 E;  2R1F A;  3C4T A;  1WXR A;  3ADL A;  4FK5 C;  2EOE A;  4LF8 E;  4DV0 E;  4DR5 E;  1YYO A;  4F9C B;  4O5G A;  4B3M E;  2N3G A;  2RSM A;  5KL7 A;  3FIG A;  2YTO A;  4JI2 E;  2EMY A;  3J81 C;  1N34 E;  1ZBQ A;  4GKJ E;  1N33 E;  1JK1 A;  3DJW A;  2NUF A;  4OOG C;  2FGG A;  2YPN A;  3VHT B;  1WHQ A;  3P1X A;  2DLQ A;  1SFE A;  5LMN E;  2EN2 A;  2EMF A;  2EM6 A;  5LMU E;  2EPU A;  2EQ1 A;  1KJK A;  2EM5 A;  3LML A;  4GZN C;  2PRT A;  2E5L E;  2EP3 A;  2YTG A;  1GQE A;  4R2E A;  3AUZ A;  2EMB A;  2BB8 A;  4BC7 A;  1HNX E;  5CFF E;  1EH7 A;  4LF9 E;  2LTR A;  1G2D C;  1T4L B;  2V86 A;  4WSG A;  5AC5 A;  4ZYH A;  1A1G A;  2EQ0 A;  4BCA A;  3M99 B;  2ZM6 E;  3EPK A;  1N36 E;  1XMQ E;  2MKN A;  2MDR A;  4Q35 B;  4JI0 E;  2EMW A;  2EN4 A;  2EPN A;  2EPK X;  2R76 A;  2RSI A;  2VF1 A;  2EMK A;  1T38 A;  4OX9 E;  4DUZ E;  2EML A;  4DR1 E;  1Z1B A;  3RMP A;  2EOJ A;  5A6J A;  3IWC A;  2LJH A;  2E1M A;  2BBG A;  2V8Q B;  2V88 A;  4LFB E;  5KL6 A;  4K0K E;  2N3H A;  1N3G A;  1MEY C;  2ELY A;  2F4V E;  1PKP A;  2UUB E;  1X6E A;  4X9J A;  4F6N A;  1TF3 A;  5A6K A;  3VYY A;  3QG5 C;  2L33 A;  2EOX A;  5TSE A;  2EQ3 A;  1YYW A;  5LLQ A;  2MDG A;  2YTI A;  4L8N A;  5A2Q C;  3HQ1 A;  1A1F A;  1IQO A;  2B7T A;  2B3T B;  2EPX A;  1YSA C;  3F6G A;  2IHR 1;  4GEQ B;  2F8B A;  2M7Q A;  4DMI A;  2L2M A;  2EOF A;  5IT9 C;  4KZS A;  3LLH A;  2YSO A;  2EOO A;  1WHN A;  2YRK A;  4DKK A;  2LUQ A;  2HC5 A;  2V83 A;  2EOZ A;  4R2A A;  3UK3 C;  1QNT A;  2LMZ A;  4BHC A;  2EOI A;  4I8O A;  2I9I A;  2HHH E;  2YTJ A;  2JY9 A;  2M1S A;  2EPR A;  4R2C A;  3ECR A;  1YUJ A;  1XNQ E;  2YU5 A;  4LFC E;  3H09 A;  2DSY A;  1J26 A;  4DV6 E;  2WBS A;  4O24 A;  4Q28 A;  3HXL A;  2M9A A;  4WSP A;  2VQF E;  4J8Z A;  1WRJ A;  2LCE A;  1IQS A;  2YTN A;  4JYA E;  2EOQ A;  4GKK E;  2FV4 B;  1LLM C;  1BB8 A;  3HTX A;  2DIX A;  4R2R A;  1DI2 A;  2V87 A;  2EMH A;  2EOM A;  3BID A;  4WXC A;  2EL6 A;  1RC7 A;  4WFT A;  4DR6 E;  4JI8 E;  3TQM A;  1X3C A;  3VYX A;  5KL2 A;  2M4I A;  3OML A;  1BBG A;  4R2S A;  2EPP A;  2VRD A;  1IBL E;  4JI3 E;  2NA2 A;  4X66 E;  2EPC A;  4JI5 E;  3J7Y p;  4TUG A;  4BBY A;  3EPL A;  5AE3 A;  2EN3 A;  2UXB E;  3C6K A;  5ADZ A;  4LTY A;  2EMC A;  4M9V C;  3IWB A;  4RHB B;  1G2F C;  1YYK A;  2EM4 A;  3MSW A;  2DB2 A;  3EQ1 A;  2EMA A;  4MLV A;  1UN6 B;  2L8T A;  1PJT A;  1MGT A;  5DNY A;  2B7V A;  2KOU A;  1JK2 A;  2EPO A;  2DRP A;  1WJP A;  2ADR A;  1F2I G;  1NCS A;  5IV8 B;  3T1H E;  2Q8U A;  4M0V A;  1GTK A;  4DV7 E;  1AAY A;  4DR7 E;  1PJS A;  2EPA A;  2EOR A;  2G7H A;  5IXM B;  1IBM E;  1X6F A;  5IWA E;  2WCC 3;  2DMY A;  2CSH A;  3ADJ A;  5AE2 A;  2ENH A;  4N4R B;  2JP9 A;  2EM9 A;  2GHF A;  1UBD C;  2EOH A;  3EPJ A;  1X48 A;  2VE7 C;  3IWD A;  1P47 A;  2RQL A;  2EM8 A;  4DV3 E;  4B3T E;  1IMU A;  4F54 A;  1BBO A;  1EH6 A;  1GZ6 A;  5KL3 A;  2EOY A;  3C6M A;  2NAB A;  4F2J C;  4YHH E;  2EWL A;  2L2K B;  2UXD E;  2JOX A;  2ODR C;  3ZOQ B;  4BMJ A;  1XNR E;  4X62 E;  5T6J A;  2EL4 A;  2LV2 A;  2FTX B;  4JV5 E;  2EJ4 A;  4KWY A;  4WX9 A;  2HJJ A;  4DUY E;  2V89 A;  4ZYG A;  2WBT A;  2EN7 A;  5A69 A;  2KHX A;  4R2P A;  2LUP B;  2L92 A;  1A1L A;  2EE8 A;  2EMG A;  4F9A B;  3THN A;  2WZO A;  3F6H A;  4LU9 A;  2JXP A;  3MHH C;  2VQE E;  1T39 A;  2YTD A;  2EM2 A;  4BS9 A;  3DF6 A;  2L3C A;  4NXM E;  3HPS A;  3AV0 A;  3BBG A;  3J7A G;  2RS6 A;  2JOB A;  4ZYD A;  2A25 A;  3BGH A;  2YSP A;  4KHP E;  2LVH A;  3C4B A;  1X49 A;  3MHS C;  3T1Y E;  1T4N A;  2EMX A;  2YTP A;  4ZYE A;  2EZ6 A;  2EMI A;  2MC6 A;  1HNW E;  2EN8 A;  1SR9 A;  1AH5 A;  1KYQ A;  4HTG A;  2ENC A;  4R03 A;  2ELZ A;  2LBS B;  2CT1 A;  3THO B;  2K4V A;  2EMZ A;  1O0W A;  2UUC E;  2B9D A; 
#chains in the Genus database with same CATH homology
 1Z1B A;  2EOJ A;  2YTQ A;  1A1J A;  2EMA A;  1UN6 B;  2EL5 A;  2GLI A;  2HGH A;  1B69 A;  1ZAA C;  1JK2 A;  2J7J A;  2DRP A;  1WJP A;  2ADR A;  2D9H A;  1F2I G;  5KL6 A;  1NCS A;  1YUI A;  2JPA A;  2EOS A;  1MEY C;  2ELY A;  1X5W A;  1X6E A;  1AAY A;  4IJD A;  4X9J A;  4F6N A;  3EPH A;  2EPA A;  1TF3 A;  2RPC A;  2EOR A;  2I13 A;  2DLK A;  1X6F A;  2EOX A;  2EQ3 A;  2WCC 3;  1A1K A;  2E72 A;  2MDG A;  2CSH A;  1X6H A;  2ENA A;  2YTI A;  1A1F A;  2DMI A;  2ENH A;  2YTE A;  2EPX A;  1ZR9 A;  2JP9 A;  2EM9 A;  1YSA C;  2GHF A;  5KL4 A;  1UBD C;  2EOH A;  2EM3 A;  3EPJ A;  1DGC A;  1P47 A;  2LO3 A;  2EM8 A;  2R1F A;  2EOF A;  4FK5 C;  2EOE A;  2MKD A;  1BBO A;  2YSO A;  2EOO A;  4R2D A;  5KL3 A;  2EOY A;  2YRK A;  1A1I A;  4IS1 C;  2EOZ A;  4R2A A;  2NAB A;  4F2J C;  3UK3 C;  5KL7 A;  2EOI A;  2YTO A;  2EM7 A;  2EN1 A;  2YTJ A;  2EPR A;  4R2C A;  2EL4 A;  2LV2 A;  1YUJ A;  2EMY A;  2YRM A;  2YU5 A;  1JK1 A;  2EJ4 A;  2WBS A;  2EN6 A;  2M9A A;  3VHT B;  2WBT A;  2EM0 A;  1A1H A;  2EN7 A;  2DLQ A;  1RMD A;  2EN2 A;  2EMF A;  2EM6 A;  2LCE A;  2YTN A;  1TF6 A;  4R2P A;  2EPU A;  2EPZ A;  2EQ1 A;  1A1L A;  2EOQ A;  1KJK A;  2CTD A;  2EE8 A;  2EM5 A;  2EMG A;  2WBU A;  4GZN C;  2PRT A;  3MHH C;  2EP3 A;  1LLM C;  1BB8 A;  2YU8 A;  2YTD A;  2YTG A;  5KL5 A;  4R2R A;  2LT7 A;  4R2E A;  2EM2 A;  2BB8 A;  2EMH A;  2EMB A;  4R2Q A;  2EOM A;  1G2D C;  4WSG A;  2A25 A;  2YSP A;  2LVH A;  1X3C A;  1A1G A;  2EQ0 A;  5KL2 A;  3MHS C;  3M99 B;  4R2S A;  2EPP A;  2VRD A;  3EPK A;  2EMX A;  2YTP A;  2EMI A;  2YRH A;  2EPC A;  1TN9 A;  2EN8 A;  2MKN A;  2ENC A;  2EMW A;  2EN4 A;  3EPL A;  2ELZ A;  2EN3 A;  1ZU1 A;  2CT1 A;  2RSI A;  2EMC A;  2EMK A;  2DGC A;  2YTF A;  4M9V C;  2EMZ A;  1G2F C;  4F6M A;  2EML A;  2EL6 A;  2EM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...