2EMLA

Solution structure of the c2h2 type zinc finger (region 752-784) of human zinc finger protein 28 homolog
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYECSVCGKAFSHRQSLSVHQRIHSGKKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 28 homolog
publication title Solution structure of the C2H2 type zinc finger (region 752-784) of human Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emlA01
2EOOA 4R2EA 2EM4A 2EMYA 2EPCA 1G2DC 2YTIA 2EM6A 2EOZA 4IS1C 5KL3A 1G2FC 2ELZA 1BBOA 4R2DA 2EM0A 1TN9A 1X6FA 2YTJA 2EMXA 2EM2A 1X6EA 2EM8A 2GLIA 2EPUA 2E72A 2EOFA 1F2IG 1A1KA 1A1IA 4FK5C 2EQ0A 2EOQA 2YRMA 2EN2A 1JK1A 4F2JC 2EPPA 2EM3A 1A1LA 2EN3A 2EMGA 4R2CA 2EN1A 2LT7A 4F6NA 1JK2A 2ENAA 2EPXA 2EMZA 2EMAA 4R2AA 1A1JA 5KL7A 2EL5A 1AAYA 4F6MA 2EOYA 3M99B 2JPAA 2M9AA 2DLKA 1YSAC 4R2PA 2LCEA 2BB8A 2YRHA 2EOHA 2HGHA 2EOEA 2EJ4A 1A1HA 1Z1BA 4WSGA 1NCSA 2YTPA 1A1GA 1A1FA 2YTGA 1KJKA 2LVHA 2EQ3A 2YU5A 5KL2A 2EQ1A 2EN8A 2EN4A 2R1FA 3MHHC 2JP9A 2MKDA 2EM5A 1YUJA 2EM7A 2DRPA 3UK3C 1P47A 2D9HA 1TF3A 2A25A 2EMKA 2YU8A 3EPJA 2CTDA 2ENHA 2RPCA 4IJDA 2EP3A 2PRTA 2MKNA 2MDGA 2YSOA 2EMIA 2YTOA 1BB8A 2EORA 2EOXA 2ENCA 3VHTB 2CT1A 3EPHA 4R2SA 2EL4A 2EOMA 1ZR9A 1UBDC 2EMHA 5KL6A 2YTEA 2EMCA 2CSHA 2EOIA 2EMLA 5KL5A 2DMIA 2EOSA 2EOJA 3MHSC 2RSIA 2EMBA 2WCC3 3EPLA 1X5WA 2LO3A 1LLMC 1TF6A 1B69A 2EMFA 4R2RA 2EN6A 2EPZA 4R2QA 1DGCA 2EL6A 2LV2A 2DGCA 1UN6B 1ZU1A 2EPAA 2YTFA 1ZAAC 1MEYC 2EPRA 1X3CA 2EM9A 5KL4A 2VRDA 2NABA 2WBUA 2EN7A 2WBSA 2YSPA 2YTDA 2EE8A 2YTQA 1RMDA 2J7JA 2ELYA 4GZNC 2EMWA 1YUIA 1X6HA 4M9VC 2ADRA 2I13A 3EPKA 4X9JA 2YTNA 2DLQA 1WJPA 2YRKA 2WBTA 2GHFA
chains in the Genus database with same CATH superfamily
4B3ME 2UXDE 2RTXA 2EM6A 3J7Yp 4JI4E 1G2FC 3OMLA 3ZOQB 2EPMX 2LTRA 1N36E 3EQ1A 4DUYE 2EMXA 1XNQE 4O24A 2V83A 1T4LB 1YFHA 3ADIA 2N3HA 3THNA 1F2IG 4FK5C 2K4VA 2EQ0A 3KZYA 4JI1E 1JK1A 4F2JC 2UU9E 4NXNE 4RHBB 4F6NA 2EMZA 1PKPA 4R2AA 3DJWA 4B3TE 4JV5E 4LF8E 4WYQB 2JPAA 4YY3E 3C4TA 2R76A 3LLHA 4L5NC 5A6AA 4DR3E 4WXDA 2YRHA 2EOHA 2HGHA 4AQYE 2JOBA 4F9AB 2EJ4A 2YTPA 5TSEA 1T4OA 1A1GA 5A69A 2YU5A 3BF2A 5KL2A 2UUCE 3F6HA 2L8TA 4ZYHA 1UILA 1X48A 1YUJA 4JYAE 3ADGA 2LMZA 4LU9A 4DV7E 2D9HA 5LLQA 1TF3A 2EMKA 3EPJA 2F8BA 3J80C 1GQEA 4P78A 4OOGC 2EMIA 1IMUA 3H09A 2LJHA 5CFFE 2ENCA 2E5LE 2L92A 2MDRA 2B9DA 3AV0A 2EMHA 4J8ZA 3QG5C 2V85A 2CSHA 2EOIA 5T6JA 4ZYGA 1XMOE 2EOJA 3MHSC 2V87A 4BCAA 2RSIA 1SR9A 2EWLA 3EPLA 4L8NA 1XNRE 1J5EE 1TF6A 4R2RA 2EN6A 2DB2A 2LV2A 4DKKA 2DGCA 2EPAA 4BHCA 1MEYC 4WSPA 2UXBE 2WBUA 2WBSA 2YSPA 2EE8A 4O5GA 1MGTA 1RMDA 4I8OA 2EMWA 5ADZA 2Q8UA 3FIGA 1T4NA 1WJPA 2YRKA 4WX9A 2GHFA 1SFEA 1EKZA 2EMYA 3VK6A 2EOZA 1HNZE 1X47A 4DV0E 2ELZA 4DV1E 4X65E 2HJJA 1YPNA 1BBOA 3JU0A 1TN9A 1T38A 2M1SA 1X6FA 5AC5A 4JI8E 1N33E 4TUIA 2ZM6E 2EPUA 1A1KA 1A1IA 4BC9A 1N3GA 2EOQA 2JWOA 4F9BB 2RSMA 5BR8E 2EMGA 4WXCA 4R2CA 4M30A 2EZ6A 2EPXA 2YT4A 2EPNA 4DV2E 2LUQA 3JAMC 1EH8A 1QNTA 3IWBA 4F6MA 1PJTA 3M99B 2B7VA 2LUPB 1RQ0A 4R2PA 4ZYDA 4DV5E 4K0KE 2L3JA 2BB8A 3J7AG 1A1HA 1Z1BA 3C6KA 2LJUA 2LVHA 2EQ3A 3AUZA 4NXME 4LF5E 2EN8A 2L2NA 1WHQA 2R1FA 3J81C 3MHHC 4LF4E 2MKDA 3C6MA 2DRPA 1HNXE 1P47A 4BHBA 4MLQA 4DR6E 2ENHA 2RPCA 3JTZA 2MDGA 2YTOA 2UUBE 1HR0E 2CPNA 5LMNE 3VHTB 2V89A 4R2SA 2GPIA 4DV3E 3LMLA 1UBDC 4JI3E 4N4RB 3T1HE 5A2QC 2EMCA 2JR1A 2DMYA 4DR7E 4X66E 2JY9A 3P1XA 2EMBA 1YYWA 1LLMC 3BIDA 1IQSA 2EMFA 1HNWE 4GEQB 3KZZA 1ZU1A 2YTFA 4P7DA 2EM9A 2MC6A 4ZYEA 2JVAA 4TUGA 4BS9A 2J7JA 2DSYA 4GZNC 1YUIA 3HPZA 3L00A 2DLQA 2LTSA 4JI5E 2EOOA 4R2EA 2EM4A 2V88A 2EPCA 2HC5A 5DNYA 1G2DC 3DF6A 1PJQA 5FLXC 4YHHE 2YTJA 1X6EA 2EM8A 2NA2A 2DIXA 2EOFA 2YZTA 2N8XA 4WPYA 2EN2A 2EPPA 1DQ3A 2EN3A 2EPLX 2B3TB 2EN1A 1JK2A 2NUGA 3K6QA 2EMAA 3OTOE 2V86A 5IWAE 1A1JA 2EL5A 1AAYA 2KHXA 2UUAE 1YZ9A 3IWDA 4BMJA 4LFAE 3ADJA 5AC4A 5LMUE 4LF7E 2DLKA 1J26A 2JXPA 4LFBE 2LCEA 1STUA 3HTXA 3VYXA 1RC7A 4R03A 1PDAA 2FTXB 4WSGA 1NCSA 1A1FA 2YTGA 1KJKA 2EQ1A 2L3CA 4LF6E 2JP9A 2BBGA 1NEIA 4LF9E 2FGGA 3BBGA 2EPOA 5IV8B 4NHRA 2YU8A 4JI6E 2CTDA 2KOUA 2LE2A 2I9IA 4IJDA 2EP3A 2PRTA 1BB8A 4BBYA 2F4VE 2CT1A 4M2ZA 3BGHA 4B3RE 1ZR9A 4LTYA 2LRSA 1X49A 5AE2A 2RS7A 1IQOA 2EMLA 4O4KA 4DR1E 4DMIA 1QU6A 1X5WA 2LO3A 1WXRA 4JI7E 5LL6R 1GTKA 2EPZA 2VE7C 3HPSA 2EL6A 3KWRA 4Q35B 2EPRA 3THOB 5KL4A 2M4IA 2NABA 5A6JA 5AE1A 2L2KB 2L33A 2YTDA 4JI0E 2YTQA 2ODRC 3HQ1A 2E1MA 4KWYA 3EPKA 2VF1A 1ZBTA 4X9JA 2YTNA 5AE3A 4HTGA 5A6BA 2NUEA 2YTIA 4F54A 4DV6E 1GZ6A 1AH5A 4KZSA 5KL3A 4IS1C 3C4BA 3TQMA 4R2DA 2EM0A 4X8WA 2L2MA 1ZBQA 4DV4E 2EM2A 2GLIA 4X64E 2IHR1 2E72A 2K7IA 1YYKA 4DR4E 2YRMA 1KYQA 4GKJE 1WHNA 2EM3A 1T39A 1A1LA 2H36X 2LT7A 2ENAA 2WZOA 5A6BD 2N3GA 4F9CB 5KL7A 1IBLE 2FV4B 2G7HA 3MSWA 2EOYA 1FKAE 2M9AA 4DR2E 3ECRA 1YSAC 2EPKX 3HXLA 1FJGE 4DR5E 2M7QA 2EOEA 1N34E 2ODRD 1EH6A 4GKKE 2L6MA 1L4SA 2EN4A 2HHHE 1YYOA 1O0WA 2EM5A 2EM7A 3RMPA 4HEIA 3UK3C 1BBGA 1IBME 2A25A 4B3SE 4X62E 2B7TA 4RH8A 2RQLA 2NUFA 4LFCE 2UXCE 3T1YE 2MKNA 2YSOA 3F6GA 1WRJA 2VQFE 4Q28A 2EORA 2EOXA 2V8QB 2JYAA 4BC7A 4R8OA 2LBSB 3VYYA 2JOXA 3EPHA 2EL4A 2EOMA 2MC5A 2YPNA 5KL6A 4NZVA 2YTEA 5IXMB 1I94E 4JI2E 3ADLA 4WFTA 2KONA 5KL5A 2DMIA 2EOSA 2WCC3 1IBKE 1B69A 1DI2A 4R2QA 1DGCA 1UN6B 4DUZE 1ZAAC 1PJSA 1X3CA 2VQEE 2VRDA 5IT9C 3IWCA 4MLVA 2EN7A 5A6KA 5F3WA 4KHPE 1EH7A 5AASA 1N32E 2ELYA 2YWQA 4M9VC 1X6HA 2ADRA 4M0VA 2I13A 4O43A 4OX9E 1UHZA 1XMQE 2WBTA 2RS6A
chains in the Genus database with same CATH topology
2EOOA 4R2EA 2EM4A 2EMYA 2EPCA 1G2DC 2YTIA 2EM6A 2EOZA 4IS1C 5KL3A 1G2FC 2ELZA 1BBOA 4R2DA 2EM0A 1TN9A 1X6FA 2YTJA 2EMXA 2EM2A 1X6EA 2EM8A 2GLIA 2EPUA 2E72A 2EOFA 1F2IG 1A1KA 1A1IA 4FK5C 2EQ0A 2EOQA 2YRMA 2EN2A 1JK1A 4F2JC 2EPPA 2EM3A 1A1LA 2EN3A 2EMGA 4R2CA 2EN1A 2LT7A 4F6NA 1JK2A 2ENAA 2EPXA 2EMZA 2EMAA 4R2AA 1A1JA 5KL7A 2EL5A 1AAYA 4F6MA 2EOYA 3M99B 2JPAA 2M9AA 2DLKA 1YSAC 4R2PA 2LCEA 2BB8A 2YRHA 2EOHA 2HGHA 2EOEA 2EJ4A 1A1HA 1Z1BA 4WSGA 1NCSA 2YTPA 1A1GA 1A1FA 2YTGA 1KJKA 2LVHA 2EQ3A 2YU5A 5KL2A 2EQ1A 2EN8A 2EN4A 2R1FA 3MHHC 2JP9A 2MKDA 2EM5A 1YUJA 2EM7A 2DRPA 3UK3C 1P47A 2D9HA 1TF3A 2A25A 2EMKA 2YU8A 3EPJA 2CTDA 2ENHA 2RPCA 4IJDA 2EP3A 2PRTA 2MKNA 2MDGA 2YSOA 2EMIA 2YTOA 1BB8A 2EORA 2EOXA 2ENCA 3VHTB 2CT1A 3EPHA 4R2SA 2EL4A 2EOMA 1ZR9A 1UBDC 2EMHA 5KL6A 2YTEA 2EMCA 2CSHA 2EOIA 2EMLA 5KL5A 2DMIA 2EOSA 2EOJA 3MHSC 2RSIA 2EMBA 2WCC3 3EPLA 1X5WA 2LO3A 1LLMC 1TF6A 1B69A 2EMFA 4R2RA 2EN6A 2EPZA 4R2QA 1DGCA 2EL6A 2LV2A 2DGCA 1UN6B 1ZU1A 2EPAA 2YTFA 1ZAAC 1MEYC 2EPRA 1X3CA 2EM9A 5KL4A 2VRDA 2NABA 2WBUA 2EN7A 2WBSA 2YSPA 2YTDA 2EE8A 2YTQA 1RMDA 2J7JA 2ELYA 4GZNC 2EMWA 1YUIA 1X6HA 4M9VC 2ADRA 2I13A 3EPKA 4X9JA 2YTNA 2DLQA 1WJPA 2YRKA 2WBTA 2GHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOO A;  4R2E A;  2EM4 A;  2EMY A;  2EPC A;  1G2D C;  2YTI A;  2EM6 A;  2EOZ A;  4IS1 C;  5KL3 A;  1G2F C;  2ELZ A;  1BBO A;  4R2D A;  2EM0 A;  1TN9 A;  1X6F A;  2YTJ A;  2EMX A;  2EM2 A;  1X6E A;  2EM8 A;  2GLI A;  2EPU A;  2E72 A;  2EOF A;  1F2I G;  1A1K A;  1A1I A;  4FK5 C;  2EQ0 A;  2EOQ A;  2YRM A;  2EN2 A;  1JK1 A;  4F2J C;  2EPP A;  2EM3 A;  1A1L A;  2EN3 A;  2EMG A;  4R2C A;  2EN1 A;  2LT7 A;  4F6N A;  1JK2 A;  2ENA A;  2EPX A;  2EMZ A;  2EMA A;  4R2A A;  1A1J A;  5KL7 A;  2EL5 A;  1AAY A;  4F6M A;  2EOY A;  3M99 B;  2JPA A;  2M9A A;  2DLK A;  1YSA C;  4R2P A;  2LCE A;  2BB8 A;  2YRH A;  2EOH A;  2HGH A;  2EOE A;  2EJ4 A;  1A1H A;  1Z1B A;  4WSG A;  1NCS A;  2YTP A;  1A1G A;  1A1F A;  2YTG A;  1KJK A;  2LVH A;  2EQ3 A;  2YU5 A;  5KL2 A;  2EQ1 A;  2EN8 A;  2EN4 A;  2R1F A;  3MHH C;  2JP9 A;  2MKD A;  2EM5 A;  1YUJ A;  2EM7 A;  2DRP A;  3UK3 C;  1P47 A;  2D9H A;  1TF3 A;  2A25 A;  2EMK A;  2YU8 A;  3EPJ A;  2CTD A;  2ENH A;  2RPC A;  4IJD A;  2EP3 A;  2PRT A;  2MKN A;  2MDG A;  2YSO A;  2EMI A;  2YTO A;  1BB8 A;  2EOR A;  2EOX A;  2ENC A;  3VHT B;  2CT1 A;  3EPH A;  4R2S A;  2EL4 A;  2EOM A;  1ZR9 A;  1UBD C;  2EMH A;  5KL6 A;  2YTE A;  2EMC A;  2CSH A;  2EOI A;  2EML A;  5KL5 A;  2DMI A;  2EOS A;  2EOJ A;  3MHS C;  2RSI A;  2EMB A;  2WCC 3;  3EPL A;  1X5W A;  2LO3 A;  1LLM C;  1TF6 A;  1B69 A;  2EMF A;  4R2R A;  2EN6 A;  2EPZ A;  4R2Q A;  1DGC A;  2EL6 A;  2LV2 A;  2DGC A;  1UN6 B;  1ZU1 A;  2EPA A;  2YTF A;  1ZAA C;  1MEY C;  2EPR A;  1X3C A;  2EM9 A;  5KL4 A;  2VRD A;  2NAB A;  2WBU A;  2EN7 A;  2WBS A;  2YSP A;  2YTD A;  2EE8 A;  2YTQ A;  1RMD A;  2J7J A;  2ELY A;  4GZN C;  2EMW A;  1YUI A;  1X6H A;  4M9V C;  2ADR A;  2I13 A;  3EPK A;  4X9J A;  2YTN A;  2DLQ A;  1WJP A;  2YRK A;  2WBT A;  2GHF A; 
#chains in the Genus database with same CATH topology
 4B3M E;  2UXD E;  2RTX A;  2EM6 A;  3J7Y p;  4JI4 E;  1G2F C;  3OML A;  3ZOQ B;  2EPM X;  2LTR A;  1N36 E;  3EQ1 A;  4DUY E;  2EMX A;  1XNQ E;  4O24 A;  2V83 A;  1T4L B;  1YFH A;  3ADI A;  2N3H A;  3THN A;  1F2I G;  4FK5 C;  2K4V A;  2EQ0 A;  3KZY A;  4JI1 E;  1JK1 A;  4F2J C;  2UU9 E;  4NXN E;  4RHB B;  4F6N A;  2EMZ A;  1PKP A;  4R2A A;  3DJW A;  4B3T E;  4JV5 E;  4LF8 E;  4WYQ B;  2JPA A;  4YY3 E;  3C4T A;  2R76 A;  3LLH A;  4L5N C;  5A6A A;  4DR3 E;  4WXD A;  2YRH A;  2EOH A;  2HGH A;  4AQY E;  2JOB A;  4F9A B;  2EJ4 A;  2YTP A;  5TSE A;  1T4O A;  1A1G A;  5A69 A;  2YU5 A;  3BF2 A;  5KL2 A;  2UUC E;  3F6H A;  2L8T A;  4ZYH A;  1UIL A;  1X48 A;  1YUJ A;  4JYA E;  3ADG A;  2LMZ A;  4LU9 A;  4DV7 E;  2D9H A;  5LLQ A;  1TF3 A;  2EMK A;  3EPJ A;  2F8B A;  3J80 C;  1GQE A;  4P78 A;  4OOG C;  2EMI A;  1IMU A;  3H09 A;  2LJH A;  5CFF E;  2ENC A;  2E5L E;  2L92 A;  2MDR A;  2B9D A;  3AV0 A;  2EMH A;  4J8Z A;  3QG5 C;  2V85 A;  2CSH A;  2EOI A;  5T6J A;  4ZYG A;  1XMO E;  2EOJ A;  3MHS C;  2V87 A;  4BCA A;  2RSI A;  1SR9 A;  2EWL A;  3EPL A;  4L8N A;  1XNR E;  1J5E E;  1TF6 A;  4R2R A;  2EN6 A;  2DB2 A;  2LV2 A;  4DKK A;  2DGC A;  2EPA A;  4BHC A;  1MEY C;  4WSP A;  2UXB E;  2WBU A;  2WBS A;  2YSP A;  2EE8 A;  4O5G A;  1MGT A;  1RMD A;  4I8O A;  2EMW A;  5ADZ A;  2Q8U A;  3FIG A;  1T4N A;  1WJP A;  2YRK A;  4WX9 A;  2GHF A;  1SFE A;  1EKZ A;  2EMY A;  3VK6 A;  2EOZ A;  1HNZ E;  1X47 A;  4DV0 E;  2ELZ A;  4DV1 E;  4X65 E;  2HJJ A;  1YPN A;  1BBO A;  3JU0 A;  1TN9 A;  1T38 A;  2M1S A;  1X6F A;  5AC5 A;  4JI8 E;  1N33 E;  4TUI A;  2ZM6 E;  2EPU A;  1A1K A;  1A1I A;  4BC9 A;  1N3G A;  2EOQ A;  2JWO A;  4F9B B;  2RSM A;  5BR8 E;  2EMG A;  4WXC A;  4R2C A;  4M30 A;  2EZ6 A;  2EPX A;  2YT4 A;  2EPN A;  4DV2 E;  2LUQ A;  3JAM C;  1EH8 A;  1QNT A;  3IWB A;  4F6M A;  1PJT A;  3M99 B;  2B7V A;  2LUP B;  1RQ0 A;  4R2P A;  4ZYD A;  4DV5 E;  4K0K E;  2L3J A;  2BB8 A;  3J7A G;  1A1H A;  1Z1B A;  3C6K A;  2LJU A;  2LVH A;  2EQ3 A;  3AUZ A;  4NXM E;  4LF5 E;  2EN8 A;  2L2N A;  1WHQ A;  2R1F A;  3J81 C;  3MHH C;  4LF4 E;  2MKD A;  3C6M A;  2DRP A;  1HNX E;  1P47 A;  4BHB A;  4MLQ A;  4DR6 E;  2ENH A;  2RPC A;  3JTZ A;  2MDG A;  2YTO A;  2UUB E;  1HR0 E;  2CPN A;  5LMN E;  3VHT B;  2V89 A;  4R2S A;  2GPI A;  4DV3 E;  3LML A;  1UBD C;  4JI3 E;  4N4R B;  3T1H E;  5A2Q C;  2EMC A;  2JR1 A;  2DMY A;  4DR7 E;  4X66 E;  2JY9 A;  3P1X A;  2EMB A;  1YYW A;  1LLM C;  3BID A;  1IQS A;  2EMF A;  1HNW E;  4GEQ B;  3KZZ A;  1ZU1 A;  2YTF A;  4P7D A;  2EM9 A;  2MC6 A;  4ZYE A;  2JVA A;  4TUG A;  4BS9 A;  2J7J A;  2DSY A;  4GZN C;  1YUI A;  3HPZ A;  3L00 A;  2DLQ A;  2LTS A;  4JI5 E;  2EOO A;  4R2E A;  2EM4 A;  2V88 A;  2EPC A;  2HC5 A;  5DNY A;  1G2D C;  3DF6 A;  1PJQ A;  5FLX C;  4YHH E;  2YTJ A;  1X6E A;  2EM8 A;  2NA2 A;  2DIX A;  2EOF A;  2YZT A;  2N8X A;  4WPY A;  2EN2 A;  2EPP A;  1DQ3 A;  2EN3 A;  2EPL X;  2B3T B;  2EN1 A;  1JK2 A;  2NUG A;  3K6Q A;  2EMA A;  3OTO E;  2V86 A;  5IWA E;  1A1J A;  2EL5 A;  1AAY A;  2KHX A;  2UUA E;  1YZ9 A;  3IWD A;  4BMJ A;  4LFA E;  3ADJ A;  5AC4 A;  5LMU E;  4LF7 E;  2DLK A;  1J26 A;  2JXP A;  4LFB E;  2LCE A;  1STU A;  3HTX A;  3VYX A;  1RC7 A;  4R03 A;  1PDA A;  2FTX B;  4WSG A;  1NCS A;  1A1F A;  2YTG A;  1KJK A;  2EQ1 A;  2L3C A;  4LF6 E;  2JP9 A;  2BBG A;  1NEI A;  4LF9 E;  2FGG A;  3BBG A;  2EPO A;  5IV8 B;  4NHR A;  2YU8 A;  4JI6 E;  2CTD A;  2KOU A;  2LE2 A;  2I9I A;  4IJD A;  2EP3 A;  2PRT A;  1BB8 A;  4BBY A;  2F4V E;  2CT1 A;  4M2Z A;  3BGH A;  4B3R E;  1ZR9 A;  4LTY A;  2LRS A;  1X49 A;  5AE2 A;  2RS7 A;  1IQO A;  2EML A;  4O4K A;  4DR1 E;  4DMI A;  1QU6 A;  1X5W A;  2LO3 A;  1WXR A;  4JI7 E;  5LL6 R;  1GTK A;  2EPZ A;  2VE7 C;  3HPS A;  2EL6 A;  3KWR A;  4Q35 B;  2EPR A;  3THO B;  5KL4 A;  2M4I A;  2NAB A;  5A6J A;  5AE1 A;  2L2K B;  2L33 A;  2YTD A;  4JI0 E;  2YTQ A;  2ODR C;  3HQ1 A;  2E1M A;  4KWY A;  3EPK A;  2VF1 A;  1ZBT A;  4X9J A;  2YTN A;  5AE3 A;  4HTG A;  5A6B A;  2NUE A;  2YTI A;  4F54 A;  4DV6 E;  1GZ6 A;  1AH5 A;  4KZS A;  5KL3 A;  4IS1 C;  3C4B A;  3TQM A;  4R2D A;  2EM0 A;  4X8W A;  2L2M A;  1ZBQ A;  4DV4 E;  2EM2 A;  2GLI A;  4X64 E;  2IHR 1;  2E72 A;  2K7I A;  1YYK A;  4DR4 E;  2YRM A;  1KYQ A;  4GKJ E;  1WHN A;  2EM3 A;  1T39 A;  1A1L A;  2H36 X;  2LT7 A;  2ENA A;  2WZO A;  5A6B D;  2N3G A;  4F9C B;  5KL7 A;  1IBL E;  2FV4 B;  2G7H A;  3MSW A;  2EOY A;  1FKA E;  2M9A A;  4DR2 E;  3ECR A;  1YSA C;  2EPK X;  3HXL A;  1FJG E;  4DR5 E;  2M7Q A;  2EOE A;  1N34 E;  2ODR D;  1EH6 A;  4GKK E;  2L6M A;  1L4S A;  2EN4 A;  2HHH E;  1YYO A;  1O0W A;  2EM5 A;  2EM7 A;  3RMP A;  4HEI A;  3UK3 C;  1BBG A;  1IBM E;  2A25 A;  4B3S E;  4X62 E;  2B7T A;  4RH8 A;  2RQL A;  2NUF A;  4LFC E;  2UXC E;  3T1Y E;  2MKN A;  2YSO A;  3F6G A;  1WRJ A;  2VQF E;  4Q28 A;  2EOR A;  2EOX A;  2V8Q B;  2JYA A;  4BC7 A;  4R8O A;  2LBS B;  3VYY A;  2JOX A;  3EPH A;  2EL4 A;  2EOM A;  2MC5 A;  2YPN A;  5KL6 A;  4NZV A;  2YTE A;  5IXM B;  1I94 E;  4JI2 E;  3ADL A;  4WFT A;  2KON A;  5KL5 A;  2DMI A;  2EOS A;  2WCC 3;  1IBK E;  1B69 A;  1DI2 A;  4R2Q A;  1DGC A;  1UN6 B;  4DUZ E;  1ZAA C;  1PJS A;  1X3C A;  2VQE E;  2VRD A;  5IT9 C;  3IWC A;  4MLV A;  2EN7 A;  5A6K A;  5F3W A;  4KHP E;  1EH7 A;  5AAS A;  1N32 E;  2ELY A;  2YWQ A;  4M9V C;  1X6H A;  2ADR A;  4M0V A;  2I13 A;  4O43 A;  4OX9 E;  1UHZ A;  1XMQ E;  2WBT A;  2RS6 A; 
#chains in the Genus database with same CATH homology
 2EOO A;  4R2E A;  2EM4 A;  2EMY A;  2EPC A;  1G2D C;  2YTI A;  2EM6 A;  2EOZ A;  4IS1 C;  5KL3 A;  1G2F C;  2ELZ A;  1BBO A;  4R2D A;  2EM0 A;  1TN9 A;  1X6F A;  2YTJ A;  2EMX A;  2EM2 A;  1X6E A;  2EM8 A;  2GLI A;  2EPU A;  2E72 A;  2EOF A;  1F2I G;  1A1K A;  1A1I A;  4FK5 C;  2EQ0 A;  2EOQ A;  2YRM A;  2EN2 A;  1JK1 A;  4F2J C;  2EPP A;  2EM3 A;  1A1L A;  2EN3 A;  2EMG A;  4R2C A;  2EN1 A;  2LT7 A;  4F6N A;  1JK2 A;  2ENA A;  2EPX A;  2EMZ A;  2EMA A;  4R2A A;  1A1J A;  5KL7 A;  2EL5 A;  1AAY A;  4F6M A;  2EOY A;  3M99 B;  2JPA A;  2M9A A;  2DLK A;  1YSA C;  4R2P A;  2LCE A;  2BB8 A;  2YRH A;  2EOH A;  2HGH A;  2EOE A;  2EJ4 A;  1A1H A;  1Z1B A;  4WSG A;  1NCS A;  2YTP A;  1A1G A;  1A1F A;  2YTG A;  1KJK A;  2LVH A;  2EQ3 A;  2YU5 A;  5KL2 A;  2EQ1 A;  2EN8 A;  2EN4 A;  2R1F A;  3MHH C;  2JP9 A;  2MKD A;  2EM5 A;  1YUJ A;  2EM7 A;  2DRP A;  3UK3 C;  1P47 A;  2D9H A;  1TF3 A;  2A25 A;  2EMK A;  2YU8 A;  3EPJ A;  2CTD A;  2ENH A;  2RPC A;  4IJD A;  2EP3 A;  2PRT A;  2MKN A;  2MDG A;  2YSO A;  2EMI A;  2YTO A;  1BB8 A;  2EOR A;  2EOX A;  2ENC A;  3VHT B;  2CT1 A;  3EPH A;  4R2S A;  2EL4 A;  2EOM A;  1ZR9 A;  1UBD C;  2EMH A;  5KL6 A;  2YTE A;  2EMC A;  2CSH A;  2EOI A;  2EML A;  5KL5 A;  2DMI A;  2EOS A;  2EOJ A;  3MHS C;  2RSI A;  2EMB A;  2WCC 3;  3EPL A;  1X5W A;  2LO3 A;  1LLM C;  1TF6 A;  1B69 A;  2EMF A;  4R2R A;  2EN6 A;  2EPZ A;  4R2Q A;  1DGC A;  2EL6 A;  2LV2 A;  2DGC A;  1UN6 B;  1ZU1 A;  2EPA A;  2YTF A;  1ZAA C;  1MEY C;  2EPR A;  1X3C A;  2EM9 A;  5KL4 A;  2VRD A;  2NAB A;  2WBU A;  2EN7 A;  2WBS A;  2YSP A;  2YTD A;  2EE8 A;  2YTQ A;  1RMD A;  2J7J A;  2ELY A;  4GZN C;  2EMW A;  1YUI A;  1X6H A;  4M9V C;  2ADR A;  2I13 A;  3EPK A;  4X9J A;  2YTN A;  2DLQ A;  1WJP A;  2YRK A;  2WBT A;  2GHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...