2EMLA

Solution structure of the c2h2 type zinc finger (region 752-784) of human zinc finger protein 28 homolog
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPYECSVCGKAFSHRQSLSVHQRIHSGKKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 752-784) of human Zinc finger protein 28 homolog
rcsb
molecule keywords Zinc finger protein 28 homolog
molecule tags Transcription
source organism Homo sapiens
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emlA01
2EMXA 2EL5A 2D9HA 2EORA 4R2QA 1Z1BA 1F2IG 3EPJA 2EMAA 1X6EA 4R2EA 2GLIA 4F2JC 1G2DC 2EE8A 2LVHA 1BB8A 2EN7A 2BB8A 2ELZA 1JK2A 2EP3A 2DMIA 2ENAA 2EN1A 2EOOA 2CT1A 2EM4A 2EOYA 2YRHA 2YTPA 1A1LA 2YU8A 5KL4A 1A1FA 3EPHA 2EMBA 2EMIA 5KL6A 1DGCA 2EM5A 3MHSC 4R2RA 2M9AA 2EMKA 2EMFA 3MHHC 1X6FA 1A1IA 3EPKA 1A1JA 2EN6A 2EOQA 1X3CA 1A1HA 2EPPA 2YRMA 1KJKA 1WJPA 2EPXA 1P47A 4R2DA 2EOMA 2EMZA 2YU5A 3M99B 5KL3A 2DLQA 2YTNA 2EPCA 2EJ4A 2EPRA 2EN2A 2ENHA 2ENCA 2EPAA 2YTGA 2EMHA 1G2FC 1NCSA 1UBDC 2DRPA 2EL6A 2EMLA 1B69A 1TF3A 2EMWA 1ZR9A 2EOJA 2RPCA 2YTDA 2YTIA 4GZNC 2PRTA 2YTEA 2EM9A 3EPLA 2CTDA 2MKNA 2EM6A 2EOFA 2EPZA 2YSOA 2WBUA 2EMCA 2ADRA 2EQ0A 1MEYC 1YUIA 4R2SA 1UN6B 1JK1A 4F6MA 2WCC3 2WBTA 2MDGA 2YTFA 2MKDA 2I13A 2NABA 2EQ3A 5KL5A 1YSAC 4IJDA 2VRDA 2EOIA 2EM2A 4R2CA 2DLKA 2EOZA 2JP9A 2A25A 2LCEA 1BBOA 1A1GA 2LV2A 2EM3A 2R1FA 1RMDA 2YTJA 2E72A 2EOHA 2GHFA 2LO3A 2YRKA 2EMGA 1X6HA 4R2PA 3VHTB 2ELYA 2EQ1A 2EM8A 4R2AA 1A1KA 4X9JA 2RSIA 2LT7A 2CSHA 2EN3A 5KL7A 2EL4A 4F6NA 1X5WA 4FK5C 2DGCA 2WBSA 2EN8A 1AAYA 1TN9A 2EOSA 2EN4A 1YUJA 2EOEA 1TF6A 1LLMC 2J7JA 4IS1C 4M9VC 2YSPA 1ZAAC 2EMYA 2YTQA 2YTOA 2HGHA 2EOXA 1ZU1A 4WSGA 3UK3C 2JPAA 2EM0A 5KL2A 2EPUA 2EM7A
chains in the Genus database with same CATH superfamily
2VQEE 1Z1BA 1F2IG 2EMAA 4LU9A 2I9IA 3DF6A 1G2DC 1YYKA 4K0KE 2EN7A 2V8QB 2ELZA 1EH8A 4DV2E 2DMIA 2ENAA 2EOOA 2R76A 2CT1A 1BBGA 2YU8A 4LFCE 2EMIA 5KL6A 4R8OA 4R2RA 2CPNA 4ZYHA 4TUIA 4JYAE 2EMKA 2EMFA 3C4BA 4BC9A 3EPKA 1A1JA 4LFBE 3VK6A 1X3CA 2EOQA 4NHRA 1KJKA 2EPXA 4R2DA 2E1MA 4X65E 2V87A 1PDAA 4GEQB 4P78A 2YWQA 4WXCA 2EJ4A 1FKAE 4N4RB 1NEIA 2ENCA 2YTGA 2DIXA 2RQLA 2UXBE 5IWAE 5FLXC 1TF3A 3BBGA 1HR0E 4LTYA 1ZR9A 4M0VA 2RPCA 1WHQA 2EPKX 3MSWA 1T38A 3QG5C 2EM6A 4B3SE 2RS7A 2N3GA 5BR8E 5A6KA 1XMQE 4LF5E 2JOXA 1I94E 2MDGA 3HTXA 2UU9E 2RSMA 2VQFE 2NABA 2EQ3A 2VE7C 1IMUA 4JI1E 4O24A 5LL6R 1N34E 2EOIA 4F54A 4DV4E 2ODRD 2A25A 2L8TA 1YFHA 2M4IA 4DR6E 2JR1A 2EWLA 2LV2A 1IBKE 2YTJA 1RMDA 2LO3A 2YRKA 4GKKE 4DR3E 4B3TE 2ELYA 2EM8A 4X9JA 5A6BA 2CSHA 2EN3A 4DV0E 1HNWE 2EL4A 4FK5C 4WPYA 1IBME 2WBSA 3ADJA 1AAYA 2F8BA 5IT9C 3J7AG 2V85A 2HHHE 3BGHA 2M7QA 4IS1C 4M9VC 1ZAAC 2EMYA 4DV3E 2EOXA 3UK3C 4O5GA 3J80C 2UUAE 5KL2A 4B3ME 3AV0A 4LFAE 2K7IA 2D9HA 2JYAA 3EPJA 2JWOA 2LRSA 4DR4E 2YTPA 4ZYGA 2EM4A 1A1LA 2V86A 2LMZA 2M9AA 5LMNE 3MHHC 4X64E 4DUZE 2EPPA 1EH7A 3T1YE 2DMYA 2YT4A 1PJTA 2EMZA 2YZTA 5IXMB 3M99B 5KL3A 3VYXA 2DLQA 3DJWA 1DQ3A 2FGGA 1UILA 2VF1A 3JU0A 1UBDC 2LTSA 1NCSA 3OMLA 2EMLA 2EMWA 1PJSA 2B9DA 2EOJA 2YTDA 4JI7E 4DUYE 3P1XA 3L00A 2MKNA 2EOFA 2EPZA 5A69A 4DR5E 4HEIA 4RH8A 1UN6B 4BMJA 3ADIA 2H36X 4OOGC 2V88A 2WBTA 1RC7A 2JXPA 5TSEA 2EPNA 2MKDA 4KHPE 2ODRC 1WXRA 2F4VE 4WXDA 4BS9A 2I13A 3KZZA 5A2QC 2VRDA 2YPNA 2EM2A 1O0WA 2DLKA 2EOZA 2JP9A 1L4SA 4JI6E 4JI2E 1T4LB 1A1GA 2R1FA 4NZVA 4ZYDA 1X6HA 4BC7A 3BIDA 1T39A 3THOB 1A1KA 3FIGA 1X47A 2GPIA 4M30A 3TQMA 2IHR1 2Q8UA 1AH5A 5ADZA 4DKKA 3OTOE 1FJGE 4BCAA 2DGCA 5AE1A 1TN9A 2MC5A 2EOEA 1TF6A 2K4VA 2LTRA 4LF6E 2V89A 5AE2A 3ZOQB 1GTKA 2YTOA 2HGHA 2NA2A 3JTZA 4WSGA 5F3WA 2KONA 3C6KA 2EM0A 4OX9E 2EPUA 2UXCE 2L6MA 5A6JA 4LF4E 5AE3A 4R2QA 4JI0E 4JI3E 1EH6A 4R2EA 3JAMC 3J7Yp 4TUGA 1PJQA 4F9BB 2GLIA 2JY9A 3BF2A 4F2JC 1YYOA 1J5EE 2B3TB 2LVHA 2E5LE 1JK2A 2EP3A 2EOYA 2YRHA 4AQYE 4NXME 4BBYA 2L2MA 1XNRE 2EMBA 4L8NA 1DGCA 2L2NA 3VYYA 3MHSC 1IQSA 4I8OA 3ADGA 1WHNA 3KZYA 1X6FA 1A1IA 2EPLX 4WYQB 4LF8E 1IQOA 2YU5A 2YTNA 2G7HA 2EPCA 2JVAA 2EPRA 3HXLA 2ENHA 2EPAA 3AUZA 2EMHA 1G2FC 3C6MA 2B7VA 3K6QA 2DSYA 5AC4A 1SR9A 1ZBQA 4KWYA 2LBSB 2EM9A 3EPLA 1N33E 2KHXA 3IWCA 3THNA 2WBUA 4X66E 1QU6A 1JK1A 4F6MA 4O4KA 2WCC3 5AASA 4F9CB 2KOUA 4Q35B 3KWRA 1STUA 3F6HA 1X49A 4R2CA 2L92A 2NUGA 2FTXB 4YHHE 3F6GA 2LCEA 3C4TA 2MDRA 2NUEA 2E72A 3ADLA 2EOHA 2GHFA 4X62E 2EMGA 4HTGA 4JV5E 4DR7E 4R2PA 4M2ZA 1SFEA 4WX9A 2RSIA 5CFFE 4F6NA 1X5WA 4DV6E 4DMIA 4JI8E 5IV8B 2ZM6E 2EOSA 1YUJA 3RMPA 5DNYA 4DR1E 2JOBA 4LF9E 1LLMC 4WFTA 5A6BD 2J7JA 3H09A 2DB2A 2L33A 2YTQA 3IWBA 5AC5A 1KYQA 1HNXE 4MLVA 2FV4B 3HQ1A 2EPMX 1P47A 4DV7E 1HNZE 2EMXA 2EL5A 2B7TA 2L3JA 2EORA 2MC6A 3ECRA 1X6EA 4J8ZA 1PKPA 1UHZA 4GKJE 2EE8A 1BB8A 1QNTA 2BB8A 1MGTA 1N32E 1XMOE 2EN1A 2HJJA 2UUBE 3EPHA 1ZBTA 5KL4A 1A1FA 1XNQE 2LJUA 2EM5A 2RTXA 2UXDE 2LUPB 2V83A 2EN6A 1A1HA 2YRMA 1WJPA 1WRJA 2EOMA 4BHCA 2EPOA 3T1HE 2EN2A 3IWDA 3HPSA 2DRPA 2EL6A 4NXNE 4O43A 1B69A 4R03A 1YZ9A 2YTIA 4GZNC 2PRTA 2YTEA 3HPZA 2CTDA 4B3RE 2LUQA 1X48A 3LLHA 2YSOA 2EMCA 2ADRA 3LMLA 2EQ0A 4JI4E 1MEYC 1N36E 1YUIA 4R2SA 1EKZA 4KZSA 1T4NA 2YTFA 5LMUE 1GQEA 4DR2E 4WSPA 4P7DA 2N8XA 2L3CA 5KL5A 5LLQA 4IJDA 1YSAC 5T6JA 2LJHA 4F9AB 3EQ1A 1T4OA 4Q28A 4MLQA 2UUCE 1BBOA 2EM3A 2EZ6A 1YPNA 4LF7E 1IBLE 1YYWA 4YY3E 4ZYEA 3VHTB 2EQ1A 4R2AA 2NUFA 2LT7A 1J26A 4BHBA 5KL7A 4RHBB 3J81C 4DV1E 2M1SA 2WZOA 1GZ6A 2RS6A 2EN8A 2BBGA 1N3GA 2EN4A 2HC5A 5A6AA 4DV5E 4JI5E 2YSPA 1ZU1A 4X8WA 1RQ0A 4L5NC 2JPAA 2N3HA 1DI2A 2L2KB 2LE2A 2EM7A
chains in the Genus database with same CATH topology
2EMXA 2EL5A 2D9HA 2EORA 4R2QA 1Z1BA 1F2IG 3EPJA 2EMAA 1X6EA 4R2EA 2GLIA 4F2JC 1G2DC 2EE8A 2LVHA 1BB8A 2EN7A 2BB8A 2ELZA 1JK2A 2EP3A 2DMIA 2ENAA 2EN1A 2EOOA 2CT1A 2EM4A 2EOYA 2YRHA 2YTPA 1A1LA 2YU8A 5KL4A 1A1FA 3EPHA 2EMBA 2EMIA 5KL6A 1DGCA 2EM5A 3MHSC 4R2RA 2M9AA 2EMKA 2EMFA 3MHHC 1X6FA 1A1IA 3EPKA 1A1JA 2EN6A 2EOQA 1X3CA 1A1HA 2EPPA 2YRMA 1KJKA 1WJPA 2EPXA 1P47A 4R2DA 2EOMA 2EMZA 2YU5A 3M99B 5KL3A 2DLQA 2YTNA 2EPCA 2EJ4A 2EPRA 2EN2A 2ENHA 2ENCA 2EPAA 2YTGA 2EMHA 1G2FC 1NCSA 1UBDC 2DRPA 2EL6A 2EMLA 1B69A 1TF3A 2EMWA 1ZR9A 2EOJA 2RPCA 2YTDA 2YTIA 4GZNC 2PRTA 2YTEA 2EM9A 3EPLA 2CTDA 2MKNA 2EM6A 2EOFA 2EPZA 2YSOA 2WBUA 2EMCA 2ADRA 2EQ0A 1MEYC 1YUIA 4R2SA 1UN6B 1JK1A 4F6MA 2WCC3 2WBTA 2MDGA 2YTFA 2MKDA 2I13A 2NABA 2EQ3A 5KL5A 1YSAC 4IJDA 2VRDA 2EOIA 2EM2A 4R2CA 2DLKA 2EOZA 2JP9A 2A25A 2LCEA 1BBOA 1A1GA 2LV2A 2EM3A 2R1FA 1RMDA 2YTJA 2E72A 2EOHA 2GHFA 2LO3A 2YRKA 2EMGA 1X6HA 4R2PA 3VHTB 2ELYA 2EQ1A 2EM8A 4R2AA 1A1KA 4X9JA 2RSIA 2LT7A 2CSHA 2EN3A 5KL7A 2EL4A 4F6NA 1X5WA 4FK5C 2DGCA 2WBSA 2EN8A 1AAYA 1TN9A 2EOSA 2EN4A 1YUJA 2EOEA 1TF6A 1LLMC 2J7JA 4IS1C 4M9VC 2YSPA 1ZAAC 2EMYA 2YTQA 2YTOA 2HGHA 2EOXA 1ZU1A 4WSGA 3UK3C 2JPAA 2EM0A 5KL2A 2EPUA 2EM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMX A;  2EL5 A;  2D9H A;  2EOR A;  4R2Q A;  1Z1B A;  1F2I G;  3EPJ A;  2EMA A;  1X6E A;  4R2E A;  2GLI A;  4F2J C;  1G2D C;  2EE8 A;  2LVH A;  1BB8 A;  2EN7 A;  2BB8 A;  2ELZ A;  1JK2 A;  2EP3 A;  2DMI A;  2ENA A;  2EN1 A;  2EOO A;  2CT1 A;  2EM4 A;  2EOY A;  2YRH A;  2YTP A;  1A1L A;  2YU8 A;  5KL4 A;  1A1F A;  3EPH A;  2EMB A;  2EMI A;  5KL6 A;  1DGC A;  2EM5 A;  3MHS C;  4R2R A;  2M9A A;  2EMK A;  2EMF A;  3MHH C;  1X6F A;  1A1I A;  3EPK A;  1A1J A;  2EN6 A;  2EOQ A;  1X3C A;  1A1H A;  2EPP A;  2YRM A;  1KJK A;  1WJP A;  2EPX A;  1P47 A;  4R2D A;  2EOM A;  2EMZ A;  2YU5 A;  3M99 B;  5KL3 A;  2DLQ A;  2YTN A;  2EPC A;  2EJ4 A;  2EPR A;  2EN2 A;  2ENH A;  2ENC A;  2EPA A;  2YTG A;  2EMH A;  1G2F C;  1NCS A;  1UBD C;  2DRP A;  2EL6 A;  2EML A;  1B69 A;  1TF3 A;  2EMW A;  1ZR9 A;  2EOJ A;  2RPC A;  2YTD A;  2YTI A;  4GZN C;  2PRT A;  2YTE A;  2EM9 A;  3EPL A;  2CTD A;  2MKN A;  2EM6 A;  2EOF A;  2EPZ A;  2YSO A;  2WBU A;  2EMC A;  2ADR A;  2EQ0 A;  1MEY C;  1YUI A;  4R2S A;  1UN6 B;  1JK1 A;  4F6M A;  2WCC 3;  2WBT A;  2MDG A;  2YTF A;  2MKD A;  2I13 A;  2NAB A;  2EQ3 A;  5KL5 A;  1YSA C;  4IJD A;  2VRD A;  2EOI A;  2EM2 A;  4R2C A;  2DLK A;  2EOZ A;  2JP9 A;  2A25 A;  2LCE A;  1BBO A;  1A1G A;  2LV2 A;  2EM3 A;  2R1F A;  1RMD A;  2YTJ A;  2E72 A;  2EOH A;  2GHF A;  2LO3 A;  2YRK A;  2EMG A;  1X6H A;  4R2P A;  3VHT B;  2ELY A;  2EQ1 A;  2EM8 A;  4R2A A;  1A1K A;  4X9J A;  2RSI A;  2LT7 A;  2CSH A;  2EN3 A;  5KL7 A;  2EL4 A;  4F6N A;  1X5W A;  4FK5 C;  2DGC A;  2WBS A;  2EN8 A;  1AAY A;  1TN9 A;  2EOS A;  2EN4 A;  1YUJ A;  2EOE A;  1TF6 A;  1LLM C;  2J7J A;  4IS1 C;  4M9V C;  2YSP A;  1ZAA C;  2EMY A;  2YTQ A;  2YTO A;  2HGH A;  2EOX A;  1ZU1 A;  4WSG A;  3UK3 C;  2JPA A;  2EM0 A;  5KL2 A;  2EPU A;  2EM7 A; 
#chains in the Genus database with same CATH topology
 2VQE E;  1Z1B A;  1F2I G;  2EMA A;  4LU9 A;  2I9I A;  3DF6 A;  1G2D C;  1YYK A;  4K0K E;  2EN7 A;  2V8Q B;  2ELZ A;  1EH8 A;  4DV2 E;  2DMI A;  2ENA A;  2EOO A;  2R76 A;  2CT1 A;  1BBG A;  2YU8 A;  4LFC E;  2EMI A;  5KL6 A;  4R8O A;  4R2R A;  2CPN A;  4ZYH A;  4TUI A;  4JYA E;  2EMK A;  2EMF A;  3C4B A;  4BC9 A;  3EPK A;  1A1J A;  4LFB E;  3VK6 A;  1X3C A;  2EOQ A;  4NHR A;  1KJK A;  2EPX A;  4R2D A;  2E1M A;  4X65 E;  2V87 A;  1PDA A;  4GEQ B;  4P78 A;  2YWQ A;  4WXC A;  2EJ4 A;  1FKA E;  4N4R B;  1NEI A;  2ENC A;  2YTG A;  2DIX A;  2RQL A;  2UXB E;  5IWA E;  5FLX C;  1TF3 A;  3BBG A;  1HR0 E;  4LTY A;  1ZR9 A;  4M0V A;  2RPC A;  1WHQ A;  2EPK X;  3MSW A;  1T38 A;  3QG5 C;  2EM6 A;  4B3S E;  2RS7 A;  2N3G A;  5BR8 E;  5A6K A;  1XMQ E;  4LF5 E;  2JOX A;  1I94 E;  2MDG A;  3HTX A;  2UU9 E;  2RSM A;  2VQF E;  2NAB A;  2EQ3 A;  2VE7 C;  1IMU A;  4JI1 E;  4O24 A;  5LL6 R;  1N34 E;  2EOI A;  4F54 A;  4DV4 E;  2ODR D;  2A25 A;  2L8T A;  1YFH A;  2M4I A;  4DR6 E;  2JR1 A;  2EWL A;  2LV2 A;  1IBK E;  2YTJ A;  1RMD A;  2LO3 A;  2YRK A;  4GKK E;  4DR3 E;  4B3T E;  2ELY A;  2EM8 A;  4X9J A;  5A6B A;  2CSH A;  2EN3 A;  4DV0 E;  1HNW E;  2EL4 A;  4FK5 C;  4WPY A;  1IBM E;  2WBS A;  3ADJ A;  1AAY A;  2F8B A;  5IT9 C;  3J7A G;  2V85 A;  2HHH E;  3BGH A;  2M7Q A;  4IS1 C;  4M9V C;  1ZAA C;  2EMY A;  4DV3 E;  2EOX A;  3UK3 C;  4O5G A;  3J80 C;  2UUA E;  5KL2 A;  4B3M E;  3AV0 A;  4LFA E;  2K7I A;  2D9H A;  2JYA A;  3EPJ A;  2JWO A;  2LRS A;  4DR4 E;  2YTP A;  4ZYG A;  2EM4 A;  1A1L A;  2V86 A;  2LMZ A;  2M9A A;  5LMN E;  3MHH C;  4X64 E;  4DUZ E;  2EPP A;  1EH7 A;  3T1Y E;  2DMY A;  2YT4 A;  1PJT A;  2EMZ A;  2YZT A;  5IXM B;  3M99 B;  5KL3 A;  3VYX A;  2DLQ A;  3DJW A;  1DQ3 A;  2FGG A;  1UIL A;  2VF1 A;  3JU0 A;  1UBD C;  2LTS A;  1NCS A;  3OML A;  2EML A;  2EMW A;  1PJS A;  2B9D A;  2EOJ A;  2YTD A;  4JI7 E;  4DUY E;  3P1X A;  3L00 A;  2MKN A;  2EOF A;  2EPZ A;  5A69 A;  4DR5 E;  4HEI A;  4RH8 A;  1UN6 B;  4BMJ A;  3ADI A;  2H36 X;  4OOG C;  2V88 A;  2WBT A;  1RC7 A;  2JXP A;  5TSE A;  2EPN A;  2MKD A;  4KHP E;  2ODR C;  1WXR A;  2F4V E;  4WXD A;  4BS9 A;  2I13 A;  3KZZ A;  5A2Q C;  2VRD A;  2YPN A;  2EM2 A;  1O0W A;  2DLK A;  2EOZ A;  2JP9 A;  1L4S A;  4JI6 E;  4JI2 E;  1T4L B;  1A1G A;  2R1F A;  4NZV A;  4ZYD A;  1X6H A;  4BC7 A;  3BID A;  1T39 A;  3THO B;  1A1K A;  3FIG A;  1X47 A;  2GPI A;  4M30 A;  3TQM A;  2IHR 1;  2Q8U A;  1AH5 A;  5ADZ A;  4DKK A;  3OTO E;  1FJG E;  4BCA A;  2DGC A;  5AE1 A;  1TN9 A;  2MC5 A;  2EOE A;  1TF6 A;  2K4V A;  2LTR A;  4LF6 E;  2V89 A;  5AE2 A;  3ZOQ B;  1GTK A;  2YTO A;  2HGH A;  2NA2 A;  3JTZ A;  4WSG A;  5F3W A;  2KON A;  3C6K A;  2EM0 A;  4OX9 E;  2EPU A;  2UXC E;  2L6M A;  5A6J A;  4LF4 E;  5AE3 A;  4R2Q A;  4JI0 E;  4JI3 E;  1EH6 A;  4R2E A;  3JAM C;  3J7Y p;  4TUG A;  1PJQ A;  4F9B B;  2GLI A;  2JY9 A;  3BF2 A;  4F2J C;  1YYO A;  1J5E E;  2B3T B;  2LVH A;  2E5L E;  1JK2 A;  2EP3 A;  2EOY A;  2YRH A;  4AQY E;  4NXM E;  4BBY A;  2L2M A;  1XNR E;  2EMB A;  4L8N A;  1DGC A;  2L2N A;  3VYY A;  3MHS C;  1IQS A;  4I8O A;  3ADG A;  1WHN A;  3KZY A;  1X6F A;  1A1I A;  2EPL X;  4WYQ B;  4LF8 E;  1IQO A;  2YU5 A;  2YTN A;  2G7H A;  2EPC A;  2JVA A;  2EPR A;  3HXL A;  2ENH A;  2EPA A;  3AUZ A;  2EMH A;  1G2F C;  3C6M A;  2B7V A;  3K6Q A;  2DSY A;  5AC4 A;  1SR9 A;  1ZBQ A;  4KWY A;  2LBS B;  2EM9 A;  3EPL A;  1N33 E;  2KHX A;  3IWC A;  3THN A;  2WBU A;  4X66 E;  1QU6 A;  1JK1 A;  4F6M A;  4O4K A;  2WCC 3;  5AAS A;  4F9C B;  2KOU A;  4Q35 B;  3KWR A;  1STU A;  3F6H A;  1X49 A;  4R2C A;  2L92 A;  2NUG A;  2FTX B;  4YHH E;  3F6G A;  2LCE A;  3C4T A;  2MDR A;  2NUE A;  2E72 A;  3ADL A;  2EOH A;  2GHF A;  4X62 E;  2EMG A;  4HTG A;  4JV5 E;  4DR7 E;  4R2P A;  4M2Z A;  1SFE A;  4WX9 A;  2RSI A;  5CFF E;  4F6N A;  1X5W A;  4DV6 E;  4DMI A;  4JI8 E;  5IV8 B;  2ZM6 E;  2EOS A;  1YUJ A;  3RMP A;  5DNY A;  4DR1 E;  2JOB A;  4LF9 E;  1LLM C;  4WFT A;  5A6B D;  2J7J A;  3H09 A;  2DB2 A;  2L33 A;  2YTQ A;  3IWB A;  5AC5 A;  1KYQ A;  1HNX E;  4MLV A;  2FV4 B;  3HQ1 A;  2EPM X;  1P47 A;  4DV7 E;  1HNZ E;  2EMX A;  2EL5 A;  2B7T A;  2L3J A;  2EOR A;  2MC6 A;  3ECR A;  1X6E A;  4J8Z A;  1PKP A;  1UHZ A;  4GKJ E;  2EE8 A;  1BB8 A;  1QNT A;  2BB8 A;  1MGT A;  1N32 E;  1XMO E;  2EN1 A;  2HJJ A;  2UUB E;  3EPH A;  1ZBT A;  5KL4 A;  1A1F A;  1XNQ E;  2LJU A;  2EM5 A;  2RTX A;  2UXD E;  2LUP B;  2V83 A;  2EN6 A;  1A1H A;  2YRM A;  1WJP A;  1WRJ A;  2EOM A;  4BHC A;  2EPO A;  3T1H E;  2EN2 A;  3IWD A;  3HPS A;  2DRP A;  2EL6 A;  4NXN E;  4O43 A;  1B69 A;  4R03 A;  1YZ9 A;  2YTI A;  4GZN C;  2PRT A;  2YTE A;  3HPZ A;  2CTD A;  4B3R E;  2LUQ A;  1X48 A;  3LLH A;  2YSO A;  2EMC A;  2ADR A;  3LML A;  2EQ0 A;  4JI4 E;  1MEY C;  1N36 E;  1YUI A;  4R2S A;  1EKZ A;  4KZS A;  1T4N A;  2YTF A;  5LMU E;  1GQE A;  4DR2 E;  4WSP A;  4P7D A;  2N8X A;  2L3C A;  5KL5 A;  5LLQ A;  4IJD A;  1YSA C;  5T6J A;  2LJH A;  4F9A B;  3EQ1 A;  1T4O A;  4Q28 A;  4MLQ A;  2UUC E;  1BBO A;  2EM3 A;  2EZ6 A;  1YPN A;  4LF7 E;  1IBL E;  1YYW A;  4YY3 E;  4ZYE A;  3VHT B;  2EQ1 A;  4R2A A;  2NUF A;  2LT7 A;  1J26 A;  4BHB A;  5KL7 A;  4RHB B;  3J81 C;  4DV1 E;  2M1S A;  2WZO A;  1GZ6 A;  2RS6 A;  2EN8 A;  2BBG A;  1N3G A;  2EN4 A;  2HC5 A;  5A6A A;  4DV5 E;  4JI5 E;  2YSP A;  1ZU1 A;  4X8W A;  1RQ0 A;  4L5N C;  2JPA A;  2N3H A;  1DI2 A;  2L2K B;  2LE2 A;  2EM7 A; 
#chains in the Genus database with same CATH homology
 2EMX A;  2EL5 A;  2D9H A;  2EOR A;  4R2Q A;  1Z1B A;  1F2I G;  3EPJ A;  2EMA A;  1X6E A;  4R2E A;  2GLI A;  4F2J C;  1G2D C;  2EE8 A;  2LVH A;  1BB8 A;  2EN7 A;  2BB8 A;  2ELZ A;  1JK2 A;  2EP3 A;  2DMI A;  2ENA A;  2EN1 A;  2EOO A;  2CT1 A;  2EM4 A;  2EOY A;  2YRH A;  2YTP A;  1A1L A;  2YU8 A;  5KL4 A;  1A1F A;  3EPH A;  2EMB A;  2EMI A;  5KL6 A;  1DGC A;  2EM5 A;  3MHS C;  4R2R A;  2M9A A;  2EMK A;  2EMF A;  3MHH C;  1X6F A;  1A1I A;  3EPK A;  1A1J A;  2EN6 A;  2EOQ A;  1X3C A;  1A1H A;  2EPP A;  2YRM A;  1KJK A;  1WJP A;  2EPX A;  1P47 A;  4R2D A;  2EOM A;  2EMZ A;  2YU5 A;  3M99 B;  5KL3 A;  2DLQ A;  2YTN A;  2EPC A;  2EJ4 A;  2EPR A;  2EN2 A;  2ENH A;  2ENC A;  2EPA A;  2YTG A;  2EMH A;  1G2F C;  1NCS A;  1UBD C;  2DRP A;  2EL6 A;  2EML A;  1B69 A;  1TF3 A;  2EMW A;  1ZR9 A;  2EOJ A;  2RPC A;  2YTD A;  2YTI A;  4GZN C;  2PRT A;  2YTE A;  2EM9 A;  3EPL A;  2CTD A;  2MKN A;  2EM6 A;  2EOF A;  2EPZ A;  2YSO A;  2WBU A;  2EMC A;  2ADR A;  2EQ0 A;  1MEY C;  1YUI A;  4R2S A;  1UN6 B;  1JK1 A;  4F6M A;  2WCC 3;  2WBT A;  2MDG A;  2YTF A;  2MKD A;  2I13 A;  2NAB A;  2EQ3 A;  5KL5 A;  1YSA C;  4IJD A;  2VRD A;  2EOI A;  2EM2 A;  4R2C A;  2DLK A;  2EOZ A;  2JP9 A;  2A25 A;  2LCE A;  1BBO A;  1A1G A;  2LV2 A;  2EM3 A;  2R1F A;  1RMD A;  2YTJ A;  2E72 A;  2EOH A;  2GHF A;  2LO3 A;  2YRK A;  2EMG A;  1X6H A;  4R2P A;  3VHT B;  2ELY A;  2EQ1 A;  2EM8 A;  4R2A A;  1A1K A;  4X9J A;  2RSI A;  2LT7 A;  2CSH A;  2EN3 A;  5KL7 A;  2EL4 A;  4F6N A;  1X5W A;  4FK5 C;  2DGC A;  2WBS A;  2EN8 A;  1AAY A;  1TN9 A;  2EOS A;  2EN4 A;  1YUJ A;  2EOE A;  1TF6 A;  1LLM C;  2J7J A;  4IS1 C;  4M9V C;  2YSP A;  1ZAA C;  2EMY A;  2YTQ A;  2YTO A;  2HGH A;  2EOX A;  1ZU1 A;  4WSG A;  3UK3 C;  2JPA A;  2EM0 A;  5KL2 A;  2EPU A;  2EM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...