2EMWA

Solution structure of the c2h2 type zinc finger (region 301-331) of human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
b'GSSGSSGEKPYGCNECGKDFSSKSYLIVHQRIHTGEKLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 301-331) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emwA01
2EMXA 2EPCA 3M99B 2YSOA 2EOFA 4X9JA 2A25A 2EP3A 1A1JA 2EN6A 2CTDA 2ADRA 2EN7A 3EPKA 4FK5C 2DGCA 1TF3A 2EM2A 1TF6A 1A1FA 2EM8A 2EM3A 2EN3A 2YTJA 2EL4A 2DRPA 2EPXA 3EPJA 1A1LA 2EPZA 5KL5A 1JK2A 3EPLA 2EL5A 4F6NA 5KL4A 2YTGA 2YU8A 2EMIA 1ZAAC 2EOIA 2CSHA 1P47A 2EQ0A 3UK3C 4R2RA 2EOQA 1YUJA 2EN1A 1YUIA 2MKNA 2EN2A 2DLQA 4IJDA 2EOJA 2M9AA 2EM4A 5KL2A 2EPRA 2R1FA 2YTOA 1A1IA 2PRTA 1X5WA 2EOXA 2NABA 1X6HA 4M9VC 3MHHC 2RSIA 2HGHA 2EM5A 2YTQA 2YTNA 2GLIA 2EOEA 2EMBA 2EOHA 4R2EA 1A1HA 3VHTB 1WJPA 2GHFA 2EM0A 2YTDA 2BB8A 2EMZA 2LO3A 4F2JC 2EMCA 1F2IG 2EMWA 2ELZA 2EQ1A 2VRDA 2EOMA 1KJKA 1G2FC 2I13A 1X3CA 2EMKA 1TN9A 1G2DC 2LV2A 1RMDA 2WCC3 2YRKA 2WBUA 2EM7A 2YRHA 2EQ3A 2ELYA 4R2SA 2JP9A 2EOOA 1BB8A 2ENHA 3MHSC 2EOYA 1NCSA 2YTFA 4R2DA 1AAYA 2EMHA 1JK1A 2EPUA 2EMYA 2LCEA 1A1GA 3EPHA 2EMLA 2EORA 2YRMA 4WSGA 1UN6B 2CT1A 1A1KA 2MKDA 4R2QA 2EE8A 1Z1BA 1YSAC 1X6FA 2EL6A 2ENAA 4IS1C 2YSPA 2ENCA 2WBTA 2EPPA 2EMFA 2E72A 2EN8A 2WBSA 2DMIA 1ZU1A 2YTEA 4F6MA 1B69A 1X6EA 4R2CA 2EOSA 1UBDC 2DLKA 1LLMC 2EM9A 5KL6A 1BBOA 4R2PA 1ZR9A 2J7JA 4R2AA 2EJ4A 4GZNC 2D9HA 2YTPA 1DGCA 5KL7A 2LT7A 2EMAA 2MDGA 2EOZA 5KL3A 2EMGA 2LVHA 2RPCA 2EN4A 2EPAA 2EM6A 1MEYC 2YTIA 2YU5A 2JPAA
chains in the Genus database with same CATH superfamily
2EPCA 2GPIA 2YSOA 2EP3A 2YT4A 2ADRA 2EN7A 5ADZA 1N33E 2UXBE 1IMUA 1WHNA 3JAMC 4DR4E 1X48A 2RS6A 4M30A 2UUAE 2V85A 1XMOE 3EPLA 2LRSA 5KL4A 2YU8A 2EMIA 1GTKA 1YUJA 2I9IA 2B3TB 2EN1A 1YUIA 2DLQA 4YHHE 2L3CA 2RQLA 2LMZA 2R76A 4WPYA 2V87A 1MGTA 2KONA 1EH7A 4LF7E 4KWYA 1X6HA 2LTRA 5DNYA 3MHHC 2RSIA 5CFFE 3IWCA 2YTDA 2EMCA 2VRDA 4NXNE 4WXCA 1TN9A 2YRKA 2EM7A 4OOGC 4GKJE 4DV6E 1T38A 3MHSC 2YTFA 2JVAA 3KZYA 4WSPA 2M1SA 2LCEA 2UUCE 3F6HA 3C6KA 2CT1A 4MLVA 1EKZA 2ODRC 2MKDA 1HNZE 2LUPB 1Z1BA 3TQMA 4IS1C 2ENCA 2WBTA 4L8NA 1RC7A 1PKPA 1YZ9A 2E72A 2V83A 2NA2A 4ZYEA 4GKKE 5A69A 2NUGA 2FGGA 1WRJA 4X62E 2UU9E 2M4IA 2EOSA 2HHHE 1T4LB 1KYQA 4X8WA 4R2PA 1PJSA 3J81C 4WFTA 1ZR9A 2J7JA 4B3TE 3VYXA 2YTPA 4DR2E 4X65E 2LT7A 4LFBE 4DV4E 4JI1E 2EOZA 4O5GA 2RPCA 4TUGA 4BC7A 3VK6A 2YTIA 4DV5E 3L00A 3ADLA 2EMXA 2EPOA 4LF8E 2EN6A 1T4NA 1QNTA 2JYAA 1IQSA 3T1HE 4FK5C 2MC5A 1TF6A 2MC6A 2EM8A 1YFHA 5T6JA 4RHBB 2V86A 3VYYA 2FV4B 2EPZA 3BIDA 3QG5C 2EL5A 4F6NA 1IBLE 2ZM6E 4YY3E 2EPMX 2CSHA 2NUFA 2LUQA 3UK3C 4JV5E 1T4OA 2M9AA 1J26A 2EM4A 4ZYHA 4JI5E 2DSYA 4DR3E 2JOXA 4LF4E 5KL2A 3LLHA 2YTOA 1A1IA 3C6MA 5A6JA 1YYWA 2PRTA 4KHPE 2EOXA 5IT9C 2DIXA 2L2NA 2EM5A 3J7Yp 2YTQA 4DV2E 2EOEA 5A6BA 2EM0A 4F2JC 3IWBA 1DQ3A 2M7QA 3JTZA 2V8QB 1KJKA 3HTXA 4X66E 1X3CA 2EMKA 2LV2A 1RMDA 2WCC3 2WBUA 1SR9A 2JR1A 2L6MA 4R2SA 1BB8A 4R8OA 4R2DA 1AAYA 2EMHA 1JK1A 2VQEE 2YRMA 4NXME 1A1KA 2EE8A 5A2QC 2G7HA 4N4RB 5AE1A 2EL6A 4I8OA 1ZBQA 2V89A 2L3JA 1EH6A 5AASA 2EWLA 2WBSA 2VQFE 2DMIA 3T1YE 1STUA 4BS9A 1B69A 4R2CA 4BCAA 4B3ME 3MSWA 1LLMC 4DV3E 3IWDA 2DMYA 4BHBA 4X64E 2RTXA 2F4VE 4DKKA 1XMQE 3HQ1A 5LL6R 1AH5A 5IWAE 5KL3A 2LVHA 2YPNA 2EPAA 2EM6A 1XNQE 1MEYC 1WHQA 2YU5A 4BC9A 2JPAA 1XNRE 3ZOQB 2EOFA 4X9JA 2A25A 5IXMB 4BBYA 3J80C 3EPKA 1O0WA 1J5EE 1HR0E 4AQYE 2DGCA 2EM3A 2YTJA 2EL4A 2ODRD 2EPXA 3EPJA 4O24A 5KL5A 2LJHA 1JK2A 3K6QA 4ZYGA 5A6BD 3HXLA 4LFAE 5AC4A 2K4VA 3AUZA 2YTGA 1YYKA 1EH8A 4WXDA 4P78A 1ZBTA 2E5LE 4WX9A 2EOQA 4R2RA 4DV7E 2MKNA 1GQEA 4IJDA 4NHRA 2EOJA 4LF9E 2H36X 2N3HA 3THOB 4DR5E 2JOBA 1UILA 1IQOA 2EPRA 4OX9E 2L92A 2R1FA 3EQ1A 4F9AB 3H09A 2NABA 4DR6E 2N8XA 2Q8UA 3C4BA 1GZ6A 2YTNA 4L5NC 4RH8A 4R2EA 1A1HA 3VHTB 3FIGA 2BB8A 2EMZA 2CPNA 2HJJA 4F54A 2EMWA 2ELZA 2EOMA 2I13A 4WYQB 3OTOE 1IBME 2EQ3A 4ZYDA 2ELYA 4DMIA 3BF2A 4R03A 4GEQB 4HTGA 4O43A 2EPUA 1A1GA 2UUBE 4LF6E 5LLQA 2EMLA 4B3RE 1UN6B 1I94E 3BGHA 4R2QA 1YSAC 1X6FA 4DR1E 2ENAA 2EPPA 5TSEA 5LMNE 2EMFA 5LMUE 4P7DA 2JY9A 4Q35B 4JI2E 2EN8A 2WZOA 2YWQA 4JI4E 4F6MA 1X6EA 4KZSA 5AC5A 1FJGE 2EM9A 1HNXE 3DF6A 3ADIA 3HPSA 2VE7C 2MDRA 4R2AA 2UXDE 2EJ4A 2VF1A 2K7IA 1DGCA 4O4KA 5KL7A 4M2ZA 1FKAE 3THNA 2MDGA 2B7TA 2KOUA 1SFEA 3KWRA 2N3GA 5A6KA 2LBSB 2V88A 4JYAE 1NEIA 2F8BA 2RSMA 3M99B 1A1JA 2EPKX 2CTDA 3J7AG 1X49A 1N34E 1PDAA 2FTXB 1YYOA 4LU9A 1TF3A 2EM2A 2JXPA 1A1FA 4LFCE 4HEIA 2BBGA 3F6GA 2IHR1 2EN3A 2EZ6A 2DRPA 1BBGA 4Q28A 1A1LA 2LE2A 4LF5E 2JWOA 4J8ZA 4DV0E 4B3SE 3P1XA 2L2MA 4F9CB 1ZAAC 2L2KB 2EOIA 1P47A 4JI7E 2EQ0A 2EN2A 1RQ0A 4BHCA 1PJQA 1WXRA 1N3GA 1N32E 1X5WA 3LMLA 2DB2A 4DV1E 4M9VC 2HGHA 3JU0A 2GLIA 2EMBA 5F3WA 2EOHA 1WJPA 2GHFA 2LTSA 2LO3A 4DUYE 3ADGA 5A6AA 1F2IG 2EQ1A 1G2FC 5IV8B 1G2DC 2YRHA 1T39A 2JP9A 2EOOA 2ENHA 1PJTA 4DR7E 2EOYA 3OMLA 3KZZA 1NCSA 4JI6E 2HC5A 1QU6A 2EMYA 2B9DA 4LTYA 3EPHA 3C4TA 1UHZA 2EORA 2L8TA 4WSGA 5AE3A 2EPNA 2LJUA 3DJWA 4M0VA 1L4SA 2NUEA 2EPLX 2L33A 1HNWE 2YSPA 3BBGA 3AV0A 4JI8E 1IBKE 1DI2A 3ECRA 4JI0E 4F9BB 4K0KE 4NZVA 1N36E 1X47A 1ZU1A 2YTEA 1UBDC 2DLKA 5KL6A 1BBOA 2YZTA 3ADJA 5AE2A 2B7VA 5BR8E 2UXCE 2KHXA 4GZNC 2D9HA 4JI3E 2EMAA 2E1MA 2EMGA 2RS7A 2EN4A 4DUZE 4BMJA 3HPZA 3RMPA 5FLXC 1YPNA 4TUIA 4MLQA
chains in the Genus database with same CATH topology
2EMXA 2EPCA 3M99B 2YSOA 2EOFA 4X9JA 2A25A 2EP3A 1A1JA 2EN6A 2CTDA 2ADRA 2EN7A 3EPKA 4FK5C 2DGCA 1TF3A 2EM2A 1TF6A 1A1FA 2EM8A 2EM3A 2EN3A 2YTJA 2EL4A 2DRPA 2EPXA 3EPJA 1A1LA 2EPZA 5KL5A 1JK2A 3EPLA 2EL5A 4F6NA 5KL4A 2YTGA 2YU8A 2EMIA 1ZAAC 2EOIA 2CSHA 1P47A 2EQ0A 3UK3C 4R2RA 2EOQA 1YUJA 2EN1A 1YUIA 2MKNA 2EN2A 2DLQA 4IJDA 2EOJA 2M9AA 2EM4A 5KL2A 2EPRA 2R1FA 2YTOA 1A1IA 2PRTA 1X5WA 2EOXA 2NABA 1X6HA 4M9VC 3MHHC 2RSIA 2HGHA 2EM5A 2YTQA 2YTNA 2GLIA 2EOEA 2EMBA 2EOHA 4R2EA 1A1HA 3VHTB 1WJPA 2GHFA 2EM0A 2YTDA 2BB8A 2EMZA 2LO3A 4F2JC 2EMCA 1F2IG 2EMWA 2ELZA 2EQ1A 2VRDA 2EOMA 1KJKA 1G2FC 2I13A 1X3CA 2EMKA 1TN9A 1G2DC 2LV2A 1RMDA 2WCC3 2YRKA 2WBUA 2EM7A 2YRHA 2EQ3A 2ELYA 4R2SA 2JP9A 2EOOA 1BB8A 2ENHA 3MHSC 2EOYA 1NCSA 2YTFA 4R2DA 1AAYA 2EMHA 1JK1A 2EPUA 2EMYA 2LCEA 1A1GA 3EPHA 2EMLA 2EORA 2YRMA 4WSGA 1UN6B 2CT1A 1A1KA 2MKDA 4R2QA 2EE8A 1Z1BA 1YSAC 1X6FA 2EL6A 2ENAA 4IS1C 2YSPA 2ENCA 2WBTA 2EPPA 2EMFA 2E72A 2EN8A 2WBSA 2DMIA 1ZU1A 2YTEA 4F6MA 1B69A 1X6EA 4R2CA 2EOSA 1UBDC 2DLKA 1LLMC 2EM9A 5KL6A 1BBOA 4R2PA 1ZR9A 2J7JA 4R2AA 2EJ4A 4GZNC 2D9HA 2YTPA 1DGCA 5KL7A 2LT7A 2EMAA 2MDGA 2EOZA 5KL3A 2EMGA 2LVHA 2RPCA 2EN4A 2EPAA 2EM6A 1MEYC 2YTIA 2YU5A 2JPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMX A;  2EPC A;  3M99 B;  2YSO A;  2EOF A;  4X9J A;  2A25 A;  2EP3 A;  1A1J A;  2EN6 A;  2CTD A;  2ADR A;  2EN7 A;  3EPK A;  4FK5 C;  2DGC A;  1TF3 A;  2EM2 A;  1TF6 A;  1A1F A;  2EM8 A;  2EM3 A;  2EN3 A;  2YTJ A;  2EL4 A;  2DRP A;  2EPX A;  3EPJ A;  1A1L A;  2EPZ A;  5KL5 A;  1JK2 A;  3EPL A;  2EL5 A;  4F6N A;  5KL4 A;  2YTG A;  2YU8 A;  2EMI A;  1ZAA C;  2EOI A;  2CSH A;  1P47 A;  2EQ0 A;  3UK3 C;  4R2R A;  2EOQ A;  1YUJ A;  2EN1 A;  1YUI A;  2MKN A;  2EN2 A;  2DLQ A;  4IJD A;  2EOJ A;  2M9A A;  2EM4 A;  5KL2 A;  2EPR A;  2R1F A;  2YTO A;  1A1I A;  2PRT A;  1X5W A;  2EOX A;  2NAB A;  1X6H A;  4M9V C;  3MHH C;  2RSI A;  2HGH A;  2EM5 A;  2YTQ A;  2YTN A;  2GLI A;  2EOE A;  2EMB A;  2EOH A;  4R2E A;  1A1H A;  3VHT B;  1WJP A;  2GHF A;  2EM0 A;  2YTD A;  2BB8 A;  2EMZ A;  2LO3 A;  4F2J C;  2EMC A;  1F2I G;  2EMW A;  2ELZ A;  2EQ1 A;  2VRD A;  2EOM A;  1KJK A;  1G2F C;  2I13 A;  1X3C A;  2EMK A;  1TN9 A;  1G2D C;  2LV2 A;  1RMD A;  2WCC 3;  2YRK A;  2WBU A;  2EM7 A;  2YRH A;  2EQ3 A;  2ELY A;  4R2S A;  2JP9 A;  2EOO A;  1BB8 A;  2ENH A;  3MHS C;  2EOY A;  1NCS A;  2YTF A;  4R2D A;  1AAY A;  2EMH A;  1JK1 A;  2EPU A;  2EMY A;  2LCE A;  1A1G A;  3EPH A;  2EML A;  2EOR A;  2YRM A;  4WSG A;  1UN6 B;  2CT1 A;  1A1K A;  2MKD A;  4R2Q A;  2EE8 A;  1Z1B A;  1YSA C;  1X6F A;  2EL6 A;  2ENA A;  4IS1 C;  2YSP A;  2ENC A;  2WBT A;  2EPP A;  2EMF A;  2E72 A;  2EN8 A;  2WBS A;  2DMI A;  1ZU1 A;  2YTE A;  4F6M A;  1B69 A;  1X6E A;  4R2C A;  2EOS A;  1UBD C;  2DLK A;  1LLM C;  2EM9 A;  5KL6 A;  1BBO A;  4R2P A;  1ZR9 A;  2J7J A;  4R2A A;  2EJ4 A;  4GZN C;  2D9H A;  2YTP A;  1DGC A;  5KL7 A;  2LT7 A;  2EMA A;  2MDG A;  2EOZ A;  5KL3 A;  2EMG A;  2LVH A;  2RPC A;  2EN4 A;  2EPA A;  2EM6 A;  1MEY C;  2YTI A;  2YU5 A;  2JPA A; 
#chains in the Genus database with same CATH topology
 2EPC A;  2GPI A;  2YSO A;  2EP3 A;  2YT4 A;  2ADR A;  2EN7 A;  5ADZ A;  1N33 E;  2UXB E;  1IMU A;  1WHN A;  3JAM C;  4DR4 E;  1X48 A;  2RS6 A;  4M30 A;  2UUA E;  2V85 A;  1XMO E;  3EPL A;  2LRS A;  5KL4 A;  2YU8 A;  2EMI A;  1GTK A;  1YUJ A;  2I9I A;  2B3T B;  2EN1 A;  1YUI A;  2DLQ A;  4YHH E;  2L3C A;  2RQL A;  2LMZ A;  2R76 A;  4WPY A;  2V87 A;  1MGT A;  2KON A;  1EH7 A;  4LF7 E;  4KWY A;  1X6H A;  2LTR A;  5DNY A;  3MHH C;  2RSI A;  5CFF E;  3IWC A;  2YTD A;  2EMC A;  2VRD A;  4NXN E;  4WXC A;  1TN9 A;  2YRK A;  2EM7 A;  4OOG C;  4GKJ E;  4DV6 E;  1T38 A;  3MHS C;  2YTF A;  2JVA A;  3KZY A;  4WSP A;  2M1S A;  2LCE A;  2UUC E;  3F6H A;  3C6K A;  2CT1 A;  4MLV A;  1EKZ A;  2ODR C;  2MKD A;  1HNZ E;  2LUP B;  1Z1B A;  3TQM A;  4IS1 C;  2ENC A;  2WBT A;  4L8N A;  1RC7 A;  1PKP A;  1YZ9 A;  2E72 A;  2V83 A;  2NA2 A;  4ZYE A;  4GKK E;  5A69 A;  2NUG A;  2FGG A;  1WRJ A;  4X62 E;  2UU9 E;  2M4I A;  2EOS A;  2HHH E;  1T4L B;  1KYQ A;  4X8W A;  4R2P A;  1PJS A;  3J81 C;  4WFT A;  1ZR9 A;  2J7J A;  4B3T E;  3VYX A;  2YTP A;  4DR2 E;  4X65 E;  2LT7 A;  4LFB E;  4DV4 E;  4JI1 E;  2EOZ A;  4O5G A;  2RPC A;  4TUG A;  4BC7 A;  3VK6 A;  2YTI A;  4DV5 E;  3L00 A;  3ADL A;  2EMX A;  2EPO A;  4LF8 E;  2EN6 A;  1T4N A;  1QNT A;  2JYA A;  1IQS A;  3T1H E;  4FK5 C;  2MC5 A;  1TF6 A;  2MC6 A;  2EM8 A;  1YFH A;  5T6J A;  4RHB B;  2V86 A;  3VYY A;  2FV4 B;  2EPZ A;  3BID A;  3QG5 C;  2EL5 A;  4F6N A;  1IBL E;  2ZM6 E;  4YY3 E;  2EPM X;  2CSH A;  2NUF A;  2LUQ A;  3UK3 C;  4JV5 E;  1T4O A;  2M9A A;  1J26 A;  2EM4 A;  4ZYH A;  4JI5 E;  2DSY A;  4DR3 E;  2JOX A;  4LF4 E;  5KL2 A;  3LLH A;  2YTO A;  1A1I A;  3C6M A;  5A6J A;  1YYW A;  2PRT A;  4KHP E;  2EOX A;  5IT9 C;  2DIX A;  2L2N A;  2EM5 A;  3J7Y p;  2YTQ A;  4DV2 E;  2EOE A;  5A6B A;  2EM0 A;  4F2J C;  3IWB A;  1DQ3 A;  2M7Q A;  3JTZ A;  2V8Q B;  1KJK A;  3HTX A;  4X66 E;  1X3C A;  2EMK A;  2LV2 A;  1RMD A;  2WCC 3;  2WBU A;  1SR9 A;  2JR1 A;  2L6M A;  4R2S A;  1BB8 A;  4R8O A;  4R2D A;  1AAY A;  2EMH A;  1JK1 A;  2VQE E;  2YRM A;  4NXM E;  1A1K A;  2EE8 A;  5A2Q C;  2G7H A;  4N4R B;  5AE1 A;  2EL6 A;  4I8O A;  1ZBQ A;  2V89 A;  2L3J A;  1EH6 A;  5AAS A;  2EWL A;  2WBS A;  2VQF E;  2DMI A;  3T1Y E;  1STU A;  4BS9 A;  1B69 A;  4R2C A;  4BCA A;  4B3M E;  3MSW A;  1LLM C;  4DV3 E;  3IWD A;  2DMY A;  4BHB A;  4X64 E;  2RTX A;  2F4V E;  4DKK A;  1XMQ E;  3HQ1 A;  5LL6 R;  1AH5 A;  5IWA E;  5KL3 A;  2LVH A;  2YPN A;  2EPA A;  2EM6 A;  1XNQ E;  1MEY C;  1WHQ A;  2YU5 A;  4BC9 A;  2JPA A;  1XNR E;  3ZOQ B;  2EOF A;  4X9J A;  2A25 A;  5IXM B;  4BBY A;  3J80 C;  3EPK A;  1O0W A;  1J5E E;  1HR0 E;  4AQY E;  2DGC A;  2EM3 A;  2YTJ A;  2EL4 A;  2ODR D;  2EPX A;  3EPJ A;  4O24 A;  5KL5 A;  2LJH A;  1JK2 A;  3K6Q A;  4ZYG A;  5A6B D;  3HXL A;  4LFA E;  5AC4 A;  2K4V A;  3AUZ A;  2YTG A;  1YYK A;  1EH8 A;  4WXD A;  4P78 A;  1ZBT A;  2E5L E;  4WX9 A;  2EOQ A;  4R2R A;  4DV7 E;  2MKN A;  1GQE A;  4IJD A;  4NHR A;  2EOJ A;  4LF9 E;  2H36 X;  2N3H A;  3THO B;  4DR5 E;  2JOB A;  1UIL A;  1IQO A;  2EPR A;  4OX9 E;  2L92 A;  2R1F A;  3EQ1 A;  4F9A B;  3H09 A;  2NAB A;  4DR6 E;  2N8X A;  2Q8U A;  3C4B A;  1GZ6 A;  2YTN A;  4L5N C;  4RH8 A;  4R2E A;  1A1H A;  3VHT B;  3FIG A;  2BB8 A;  2EMZ A;  2CPN A;  2HJJ A;  4F54 A;  2EMW A;  2ELZ A;  2EOM A;  2I13 A;  4WYQ B;  3OTO E;  1IBM E;  2EQ3 A;  4ZYD A;  2ELY A;  4DMI A;  3BF2 A;  4R03 A;  4GEQ B;  4HTG A;  4O43 A;  2EPU A;  1A1G A;  2UUB E;  4LF6 E;  5LLQ A;  2EML A;  4B3R E;  1UN6 B;  1I94 E;  3BGH A;  4R2Q A;  1YSA C;  1X6F A;  4DR1 E;  2ENA A;  2EPP A;  5TSE A;  5LMN E;  2EMF A;  5LMU E;  4P7D A;  2JY9 A;  4Q35 B;  4JI2 E;  2EN8 A;  2WZO A;  2YWQ A;  4JI4 E;  4F6M A;  1X6E A;  4KZS A;  5AC5 A;  1FJG E;  2EM9 A;  1HNX E;  3DF6 A;  3ADI A;  3HPS A;  2VE7 C;  2MDR A;  4R2A A;  2UXD E;  2EJ4 A;  2VF1 A;  2K7I A;  1DGC A;  4O4K A;  5KL7 A;  4M2Z A;  1FKA E;  3THN A;  2MDG A;  2B7T A;  2KOU A;  1SFE A;  3KWR A;  2N3G A;  5A6K A;  2LBS B;  2V88 A;  4JYA E;  1NEI A;  2F8B A;  2RSM A;  3M99 B;  1A1J A;  2EPK X;  2CTD A;  3J7A G;  1X49 A;  1N34 E;  1PDA A;  2FTX B;  1YYO A;  4LU9 A;  1TF3 A;  2EM2 A;  2JXP A;  1A1F A;  4LFC E;  4HEI A;  2BBG A;  3F6G A;  2IHR 1;  2EN3 A;  2EZ6 A;  2DRP A;  1BBG A;  4Q28 A;  1A1L A;  2LE2 A;  4LF5 E;  2JWO A;  4J8Z A;  4DV0 E;  4B3S E;  3P1X A;  2L2M A;  4F9C B;  1ZAA C;  2L2K B;  2EOI A;  1P47 A;  4JI7 E;  2EQ0 A;  2EN2 A;  1RQ0 A;  4BHC A;  1PJQ A;  1WXR A;  1N3G A;  1N32 E;  1X5W A;  3LML A;  2DB2 A;  4DV1 E;  4M9V C;  2HGH A;  3JU0 A;  2GLI A;  2EMB A;  5F3W A;  2EOH A;  1WJP A;  2GHF A;  2LTS A;  2LO3 A;  4DUY E;  3ADG A;  5A6A A;  1F2I G;  2EQ1 A;  1G2F C;  5IV8 B;  1G2D C;  2YRH A;  1T39 A;  2JP9 A;  2EOO A;  2ENH A;  1PJT A;  4DR7 E;  2EOY A;  3OML A;  3KZZ A;  1NCS A;  4JI6 E;  2HC5 A;  1QU6 A;  2EMY A;  2B9D A;  4LTY A;  3EPH A;  3C4T A;  1UHZ A;  2EOR A;  2L8T A;  4WSG A;  5AE3 A;  2EPN A;  2LJU A;  3DJW A;  4M0V A;  1L4S A;  2NUE A;  2EPL X;  2L33 A;  1HNW E;  2YSP A;  3BBG A;  3AV0 A;  4JI8 E;  1IBK E;  1DI2 A;  3ECR A;  4JI0 E;  4F9B B;  4K0K E;  4NZV A;  1N36 E;  1X47 A;  1ZU1 A;  2YTE A;  1UBD C;  2DLK A;  5KL6 A;  1BBO A;  2YZT A;  3ADJ A;  5AE2 A;  2B7V A;  5BR8 E;  2UXC E;  2KHX A;  4GZN C;  2D9H A;  4JI3 E;  2EMA A;  2E1M A;  2EMG A;  2RS7 A;  2EN4 A;  4DUZ E;  4BMJ A;  3HPZ A;  3RMP A;  5FLX C;  1YPN A;  4TUI A;  4MLQ A; 
#chains in the Genus database with same CATH homology
 2EMX A;  2EPC A;  3M99 B;  2YSO A;  2EOF A;  4X9J A;  2A25 A;  2EP3 A;  1A1J A;  2EN6 A;  2CTD A;  2ADR A;  2EN7 A;  3EPK A;  4FK5 C;  2DGC A;  1TF3 A;  2EM2 A;  1TF6 A;  1A1F A;  2EM8 A;  2EM3 A;  2EN3 A;  2YTJ A;  2EL4 A;  2DRP A;  2EPX A;  3EPJ A;  1A1L A;  2EPZ A;  5KL5 A;  1JK2 A;  3EPL A;  2EL5 A;  4F6N A;  5KL4 A;  2YTG A;  2YU8 A;  2EMI A;  1ZAA C;  2EOI A;  2CSH A;  1P47 A;  2EQ0 A;  3UK3 C;  4R2R A;  2EOQ A;  1YUJ A;  2EN1 A;  1YUI A;  2MKN A;  2EN2 A;  2DLQ A;  4IJD A;  2EOJ A;  2M9A A;  2EM4 A;  5KL2 A;  2EPR A;  2R1F A;  2YTO A;  1A1I A;  2PRT A;  1X5W A;  2EOX A;  2NAB A;  1X6H A;  4M9V C;  3MHH C;  2RSI A;  2HGH A;  2EM5 A;  2YTQ A;  2YTN A;  2GLI A;  2EOE A;  2EMB A;  2EOH A;  4R2E A;  1A1H A;  3VHT B;  1WJP A;  2GHF A;  2EM0 A;  2YTD A;  2BB8 A;  2EMZ A;  2LO3 A;  4F2J C;  2EMC A;  1F2I G;  2EMW A;  2ELZ A;  2EQ1 A;  2VRD A;  2EOM A;  1KJK A;  1G2F C;  2I13 A;  1X3C A;  2EMK A;  1TN9 A;  1G2D C;  2LV2 A;  1RMD A;  2WCC 3;  2YRK A;  2WBU A;  2EM7 A;  2YRH A;  2EQ3 A;  2ELY A;  4R2S A;  2JP9 A;  2EOO A;  1BB8 A;  2ENH A;  3MHS C;  2EOY A;  1NCS A;  2YTF A;  4R2D A;  1AAY A;  2EMH A;  1JK1 A;  2EPU A;  2EMY A;  2LCE A;  1A1G A;  3EPH A;  2EML A;  2EOR A;  2YRM A;  4WSG A;  1UN6 B;  2CT1 A;  1A1K A;  2MKD A;  4R2Q A;  2EE8 A;  1Z1B A;  1YSA C;  1X6F A;  2EL6 A;  2ENA A;  4IS1 C;  2YSP A;  2ENC A;  2WBT A;  2EPP A;  2EMF A;  2E72 A;  2EN8 A;  2WBS A;  2DMI A;  1ZU1 A;  2YTE A;  4F6M A;  1B69 A;  1X6E A;  4R2C A;  2EOS A;  1UBD C;  2DLK A;  1LLM C;  2EM9 A;  5KL6 A;  1BBO A;  4R2P A;  1ZR9 A;  2J7J A;  4R2A A;  2EJ4 A;  4GZN C;  2D9H A;  2YTP A;  1DGC A;  5KL7 A;  2LT7 A;  2EMA A;  2MDG A;  2EOZ A;  5KL3 A;  2EMG A;  2LVH A;  2RPC A;  2EN4 A;  2EPA A;  2EM6 A;  1MEY C;  2YTI A;  2YU5 A;  2JPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...