2EMWA

Solution structure of the c2h2 type zinc finger (region 301-331) of human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
GSSGSSGEKPYGCNECGKDFSSKSYLIVHQRIHTGEKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 301-331) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emwA01
2EMXA 2EOFA 3VHTB 1A1KA 2YTGA 3EPJA 2GHFA 2NABA 4F2JC 2YTJA 4R2PA 2RSIA 2EPPA 2YSPA 1TF6A 1A1LA 4F6MA 2ENAA 1B69A 2R1FA 2EOOA 2EMCA 2DGCA 2EL6A 2EN1A 2YTDA 2YRHA 1UBDC 2RPCA 1YUIA 2ADRA 5KL6A 2LT7A 2EN7A 4R2SA 2EM5A 2EL4A 5KL2A 3MHHC 3MHSC 2YTIA 1JK1A 1TN9A 2EP3A 3UK3C 1Z1BA 2MDGA 5KL7A 2CT1A 4R2CA 1ZU1A 1WJPA 4WSGA 2EOXA 2YTOA 2EN6A 2EOMA 4GZNC 2EMFA 1YUJA 2M9AA 1ZR9A 2YTEA 4M9VC 1MEYC 5KL4A 2EM6A 2I13A 2EQ1A 1KJKA 2DMIA 4R2AA 2EMIA 2ENCA 3EPHA 4R2DA 1A1HA 2EOQA 4R2QA 2YTNA 2EN2A 1LLMC 2EMBA 2EMWA 2LCEA 2JPAA 2EPRA 2YRKA 1A1FA 1X6EA 2EOZA 4R2RA 2EOIA 2D9HA 2EE8A 2EPZA 1F2IG 2E72A 2EMLA 1TF3A 2EM8A 2GLIA 2EOHA 2EOJA 2YTFA 2MKDA 3EPLA 2YSOA 2EN8A 2LV2A 4R2EA 2EQ0A 1G2DC 1JK2A 1X6FA 2EQ3A 1A1JA 2YTPA 2JP9A 4F6NA 1A1GA 2HGHA 2WBUA 1DGCA 2EMYA 2EPCA 1BBOA 2LVHA 1BB8A 1ZAAC 2YTQA 2ELYA 2EOYA 2EPAA 2VRDA 2DRPA 2EMZA 2EOSA 4IS1C 2EMHA 1YSAC 2A25A 2EPUA 3EPKA 2EL5A 2LO3A 2YU8A 2EORA 4IJDA 4X9JA 1NCSA 2WBSA 1UN6B 4FK5C 2ENHA 2CSHA 2EMGA 2EN4A 1X3CA 2BB8A 2EM4A 3M99B 2ELZA 2WCC3 2MKNA 1X6HA 2EM9A 2EM7A 2EMAA 1AAYA 2EJ4A 2PRTA 2EM3A 2WBTA 2DLQA 1X5WA 2EN3A 5KL3A 1P47A 2CTDA 1RMDA 2EPXA 2EM0A 2EMKA 2EOEA 1A1IA 5KL5A 2DLKA 2J7JA 2YRMA 1G2FC 2EM2A 2YU5A
chains in the Genus database with same CATH superfamily
2YZTA 3H09A 4DMIA 4DR6E 3VHTB 3RMPA 4F2JC 2V87A 4X64E 2LE2A 1XMQE 1A1LA 2V86A 4LTYA 4F6MA 2ENAA 1B69A 2Q8UA 1YYWA 2EMCA 5ADZA 2E5LE 3BIDA 2EN1A 1UBDC 3HTXA 5A6BD 2ADRA 5KL6A 4M0VA 4R2SA 2EL4A 1O0WA 2FGGA 5KL2A 3MHHC 1RQ0A 2YTIA 5AC5A 2EP3A 4F9CB 5KL7A 2LUQA 1ZU1A 5CFFE 4O4KA 2YTOA 2EOMA 3THOB 2VF1A 4GZNC 1YUJA 1GQEA 2UUCE 4DV6E 2MC6A 5IWAE 2VQFE 2YTEA 2LTRA 4NXME 5KL4A 3VYYA 4JI1E 1KJKA 2L2NA 2HHHE 3EPHA 4DV0E 2EOQA 3EQ1A 4P78A 4B3TE 4I8OA 3ADGA 2EPRA 2V89A 2EOIA 1IBLE 2UU9E 2EE8A 3C4BA 1TF3A 2EOJA 1XNQE 3THNA 2YTFA 2MKDA 4DKKA 3EPLA 2LBSB 4Q35B 1G2DC 4JI4E 1WHNA 2WBUA 1BBGA 1SFEA 3J81C 4LFCE 2JR1A 1ZAAC 2YTQA 2HC5A 2DRPA 2EMHA 5AE2A 4DR1E 2A25A 1EH7A 4BHCA 1FKAE 4NHRA 4X9JA 2NUEA 2L3JA 1UN6B 1ZBTA 4AQYE 2E1MA 2M7QA 1IQOA 3OTOE 1N32E 1X6HA 2EM9A 2ODRC 2EMAA 1YFHA 2L6MA 4F54A 2FTXB 1P47A 4LF6E 2UXBE 2EMKA 3FIGA 4N4RB 2JOBA 1XMOE 4JI8E 4DR2E 2J7JA 1STUA 2L2KB 4YY3E 2LJHA 4DV4E 1HNZE 4OX9E 3IWDA 4LF5E 3C6KA 2EOFA 1A1KA 2N8XA 2YTGA 3EPJA 2NABA 3DJWA 4L5NC 2YTJA 4ZYEA 4R2PA 1PJTA 2DIXA 2LRSA 2YSPA 4ZYDA 1J26A 2LTSA 3L00A 4KHPE 2K4VA 2CPNA 2M1SA 2DGCA 2EL6A 4WXCA 3T1YE 1I94E 3MHSC 3UK3C 4JI6E 4J8ZA 1WHQA 3F6HA 4NZVA 3ZOQB 1NEIA 1WJPA 4WSGA 2VE7C 4X65E 2M9AA 1ZR9A 4O24A 4OOGC 2LMZA 2L2MA 1MEYC 3C6MA 2EM6A 4WPYA 1N36E 2I13A 4KZSA 2EMIA 4BMJA 1T39A 2B7TA 2YTNA 3OMLA 2EZ6A 2F8BA 1A1FA 4B3RE 2EOZA 2EPNA 4R2RA 1IBME 2EPZA 2E72A 2EM8A 2EOHA 3JU0A 3LMLA 4BC9A 2YSOA 2V85A 1T4LB 1PKPA 5AE1A 2EN8A 2LV2A 2EQ0A 1JK2A 1A1JA 2JP9A 4F6NA 3ADLA 1YYOA 2EPCA 3ECRA 1MGTA 2M4IA 1BB8A 2L92A 2I9IA 2NA2A 2VRDA 3VK6A 4JI2E 4M2ZA 2EOSA 2KOUA 4JI0E 2EPUA 2UUBE 1X48A 2EL5A 4GKKE 2B9DA 2JVAA 4ZYGA 4MLQA 4FK5C 2CSHA 4WFTA 2EMGA 5AASA 3BBGA 5IT9C 1QNTA 2BB8A 2RQLA 1HR0E 2EPMX 4DV2E 3T1HE 3J80C 2ELZA 4WSPA 4DUYE 4L8NA 1AAYA 2PRTA 2HJJA 4BC7A 2EM0A 2EPXA 1A1IA 2KONA 2DLKA 3IWBA 2YRMA 2B3TB 2YU5A 4GEQB 4NXNE 2ODRD 3TQMA 5AE3A 2EPPA 4JI5E 2EPLX 2K7IA 1UILA 1SR9A 4TUGA 2R1FA 2EOOA 2NUGA 3HPZA 1YYKA 1GTKA 2RPCA 1YUIA 2DB2A 4LF7E 2LT7A 2EM5A 2UUAE 1HNWE 2F4VE 2RTXA 4DR4E 2YT4A 2ZM6E 4P7DA 2MDGA 1T4OA 4B3ME 3HQ1A 1EKZA 5LMNE 2EN6A 4LF4E 2EMFA 4RH8A 5LLQA 2JXPA 2IHR1 5FLXC 4DUZE 2B7VA 2JOXA 2KHXA 4M9VC 2EQ1A 5AC4A 4R2AA 4LF8E 5LMUE 2VQEE 1A1HA 4BHBA 4LF9E 4R2QA 3BGHA 2FV4B 1LLMC 2EMBA 2EMWA 2LCEA 3K6QA 2JPAA 5T6JA 2RSMA 1X6EA 1UHZA 2D9HA 4DR5E 1IMUA 2EMLA 2GLIA 4LFBE 2DMYA 2V88A 1PDAA 4R2EA 2YTPA 4X66E 2EMYA 4HEIA 1BBOA 1PJSA 1PJQA 2LVHA 1GZ6A 5LL6R 2EOYA 2EPAA 5TSEA 5IXMB 1DQ3A 4IS1C 1YSAC 5A6BA 4ZYHA 1IBKE 3EPKA 2LO3A 4DV3E 4K0KE 5A69A 2YU8A 2BBGA 2EORA 3AUZA 5A6JA 3KZZA 2ENHA 2UXDE 1EH6A 3ADJA 3M99B 2MKNA 2JY9A 2L33A 3MSWA 2N3GA 4WYQB 2DLQA 3KZYA 3J7AG 1HNXE 1RMDA 2EOEA 1RC7A 5KL5A 4B3SE 4DV1E 2EM2A 4O5GA 3KWRA 5BR8E 4GKJE 2EMXA 3P1XA 3ADIA 2GHFA 4DR7E 2RSIA 2NUFA 3VYXA 4X62E 3JTZA 1WRJA 1TF6A 4X8WA 1IQSA 2N3HA 2YTDA 2YRHA 4BCAA 4YHHE 1T4NA 2EN7A 4WX9A 1X47A 2JWOA 1JK1A 1TN9A 1Z1BA 4JV5E 2CT1A 4R2CA 2L3CA 2EOXA 4JYAE 4JI3E 1N33E 5A2QC 5F3WA 2YPNA 2GPIA 4F9BB 5A6AA 1YZ9A 2YWQA 5A6KA 2DMIA 3HPSA 4KWYA 3AV0A 2ENCA 2JYAA 4MLVA 4BBYA 2LUPB 4R2DA 2EPKX 4LFAE 2L8TA 3F6GA 1X49A 2EN2A 2V83A 1AH5A 2R76A 1EH8A 2YRKA 1ZBQA 2LJUA 2V8QB 1L4SA 1F2IG 3IWCA 4HTGA 2MDRA 2EPOA 1KYQA 2WZOA 3HXLA 4R8OA 2MC5A 1X6FA 2EQ3A 1A1GA 1QU6A 2HGHA 2RS7A 1DGCA 1FJGE 3QG5C 4Q28A 2ELYA 4F9AB 2EMZA 4JI7E 1DI2A 4TUIA 1N3GA 4LU9A 4M30A 5IV8B 4BS9A 2H36X 4R03A 4IJDA 1T38A 1NCSA 2WBSA 3J7Yp 4DV5E 2G7HA 2EN4A 4DV7E 4WXDA 4DR3E 1X3CA 2DSYA 2EM4A 3DF6A 2WCC3 1YPNA 4RHBB 2EM7A 2EJ4A 2RS6A 2EM3A 2WBTA 1X5WA 2EN3A 3BF2A 5KL3A 2CTDA 1J5EE 2UXCE 3C4TA 4O43A 3JAMC 1WXRA 1XNRE 1N34E 2EWLA 1G2FC 3LLHA 5DNYA
chains in the Genus database with same CATH topology
2EMXA 2EOFA 3VHTB 1A1KA 2YTGA 3EPJA 2GHFA 2NABA 4F2JC 2YTJA 4R2PA 2RSIA 2EPPA 2YSPA 1TF6A 1A1LA 4F6MA 2ENAA 1B69A 2R1FA 2EOOA 2EMCA 2DGCA 2EL6A 2EN1A 2YTDA 2YRHA 1UBDC 2RPCA 1YUIA 2ADRA 5KL6A 2LT7A 2EN7A 4R2SA 2EM5A 2EL4A 5KL2A 3MHHC 3MHSC 2YTIA 1JK1A 1TN9A 2EP3A 3UK3C 1Z1BA 2MDGA 5KL7A 2CT1A 4R2CA 1ZU1A 1WJPA 4WSGA 2EOXA 2YTOA 2EN6A 2EOMA 4GZNC 2EMFA 1YUJA 2M9AA 1ZR9A 2YTEA 4M9VC 1MEYC 5KL4A 2EM6A 2I13A 2EQ1A 1KJKA 2DMIA 4R2AA 2EMIA 2ENCA 3EPHA 4R2DA 1A1HA 2EOQA 4R2QA 2YTNA 2EN2A 1LLMC 2EMBA 2EMWA 2LCEA 2JPAA 2EPRA 2YRKA 1A1FA 1X6EA 2EOZA 4R2RA 2EOIA 2D9HA 2EE8A 2EPZA 1F2IG 2E72A 2EMLA 1TF3A 2EM8A 2GLIA 2EOHA 2EOJA 2YTFA 2MKDA 3EPLA 2YSOA 2EN8A 2LV2A 4R2EA 2EQ0A 1G2DC 1JK2A 1X6FA 2EQ3A 1A1JA 2YTPA 2JP9A 4F6NA 1A1GA 2HGHA 2WBUA 1DGCA 2EMYA 2EPCA 1BBOA 2LVHA 1BB8A 1ZAAC 2YTQA 2ELYA 2EOYA 2EPAA 2VRDA 2DRPA 2EMZA 2EOSA 4IS1C 2EMHA 1YSAC 2A25A 2EPUA 3EPKA 2EL5A 2LO3A 2YU8A 2EORA 4IJDA 4X9JA 1NCSA 2WBSA 1UN6B 4FK5C 2ENHA 2CSHA 2EMGA 2EN4A 1X3CA 2BB8A 2EM4A 3M99B 2ELZA 2WCC3 2MKNA 1X6HA 2EM9A 2EM7A 2EMAA 1AAYA 2EJ4A 2PRTA 2EM3A 2WBTA 2DLQA 1X5WA 2EN3A 5KL3A 1P47A 2CTDA 1RMDA 2EPXA 2EM0A 2EMKA 2EOEA 1A1IA 5KL5A 2DLKA 2J7JA 2YRMA 1G2FC 2EM2A 2YU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMX A;  2EOF A;  3VHT B;  1A1K A;  2YTG A;  3EPJ A;  2GHF A;  2NAB A;  4F2J C;  2YTJ A;  4R2P A;  2RSI A;  2EPP A;  2YSP A;  1TF6 A;  1A1L A;  4F6M A;  2ENA A;  1B69 A;  2R1F A;  2EOO A;  2EMC A;  2DGC A;  2EL6 A;  2EN1 A;  2YTD A;  2YRH A;  1UBD C;  2RPC A;  1YUI A;  2ADR A;  5KL6 A;  2LT7 A;  2EN7 A;  4R2S A;  2EM5 A;  2EL4 A;  5KL2 A;  3MHH C;  3MHS C;  2YTI A;  1JK1 A;  1TN9 A;  2EP3 A;  3UK3 C;  1Z1B A;  2MDG A;  5KL7 A;  2CT1 A;  4R2C A;  1ZU1 A;  1WJP A;  4WSG A;  2EOX A;  2YTO A;  2EN6 A;  2EOM A;  4GZN C;  2EMF A;  1YUJ A;  2M9A A;  1ZR9 A;  2YTE A;  4M9V C;  1MEY C;  5KL4 A;  2EM6 A;  2I13 A;  2EQ1 A;  1KJK A;  2DMI A;  4R2A A;  2EMI A;  2ENC A;  3EPH A;  4R2D A;  1A1H A;  2EOQ A;  4R2Q A;  2YTN A;  2EN2 A;  1LLM C;  2EMB A;  2EMW A;  2LCE A;  2JPA A;  2EPR A;  2YRK A;  1A1F A;  1X6E A;  2EOZ A;  4R2R A;  2EOI A;  2D9H A;  2EE8 A;  2EPZ A;  1F2I G;  2E72 A;  2EML A;  1TF3 A;  2EM8 A;  2GLI A;  2EOH A;  2EOJ A;  2YTF A;  2MKD A;  3EPL A;  2YSO A;  2EN8 A;  2LV2 A;  4R2E A;  2EQ0 A;  1G2D C;  1JK2 A;  1X6F A;  2EQ3 A;  1A1J A;  2YTP A;  2JP9 A;  4F6N A;  1A1G A;  2HGH A;  2WBU A;  1DGC A;  2EMY A;  2EPC A;  1BBO A;  2LVH A;  1BB8 A;  1ZAA C;  2YTQ A;  2ELY A;  2EOY A;  2EPA A;  2VRD A;  2DRP A;  2EMZ A;  2EOS A;  4IS1 C;  2EMH A;  1YSA C;  2A25 A;  2EPU A;  3EPK A;  2EL5 A;  2LO3 A;  2YU8 A;  2EOR A;  4IJD A;  4X9J A;  1NCS A;  2WBS A;  1UN6 B;  4FK5 C;  2ENH A;  2CSH A;  2EMG A;  2EN4 A;  1X3C A;  2BB8 A;  2EM4 A;  3M99 B;  2ELZ A;  2WCC 3;  2MKN A;  1X6H A;  2EM9 A;  2EM7 A;  2EMA A;  1AAY A;  2EJ4 A;  2PRT A;  2EM3 A;  2WBT A;  2DLQ A;  1X5W A;  2EN3 A;  5KL3 A;  1P47 A;  2CTD A;  1RMD A;  2EPX A;  2EM0 A;  2EMK A;  2EOE A;  1A1I A;  5KL5 A;  2DLK A;  2J7J A;  2YRM A;  1G2F C;  2EM2 A;  2YU5 A; 
#chains in the Genus database with same CATH topology
 2YZT A;  3H09 A;  4DMI A;  4DR6 E;  3VHT B;  3RMP A;  4F2J C;  2V87 A;  4X64 E;  2LE2 A;  1XMQ E;  1A1L A;  2V86 A;  4LTY A;  4F6M A;  2ENA A;  1B69 A;  2Q8U A;  1YYW A;  2EMC A;  5ADZ A;  2E5L E;  3BID A;  2EN1 A;  1UBD C;  3HTX A;  5A6B D;  2ADR A;  5KL6 A;  4M0V A;  4R2S A;  2EL4 A;  1O0W A;  2FGG A;  5KL2 A;  3MHH C;  1RQ0 A;  2YTI A;  5AC5 A;  2EP3 A;  4F9C B;  5KL7 A;  2LUQ A;  1ZU1 A;  5CFF E;  4O4K A;  2YTO A;  2EOM A;  3THO B;  2VF1 A;  4GZN C;  1YUJ A;  1GQE A;  2UUC E;  4DV6 E;  2MC6 A;  5IWA E;  2VQF E;  2YTE A;  2LTR A;  4NXM E;  5KL4 A;  3VYY A;  4JI1 E;  1KJK A;  2L2N A;  2HHH E;  3EPH A;  4DV0 E;  2EOQ A;  3EQ1 A;  4P78 A;  4B3T E;  4I8O A;  3ADG A;  2EPR A;  2V89 A;  2EOI A;  1IBL E;  2UU9 E;  2EE8 A;  3C4B A;  1TF3 A;  2EOJ A;  1XNQ E;  3THN A;  2YTF A;  2MKD A;  4DKK A;  3EPL A;  2LBS B;  4Q35 B;  1G2D C;  4JI4 E;  1WHN A;  2WBU A;  1BBG A;  1SFE A;  3J81 C;  4LFC E;  2JR1 A;  1ZAA C;  2YTQ A;  2HC5 A;  2DRP A;  2EMH A;  5AE2 A;  4DR1 E;  2A25 A;  1EH7 A;  4BHC A;  1FKA E;  4NHR A;  4X9J A;  2NUE A;  2L3J A;  1UN6 B;  1ZBT A;  4AQY E;  2E1M A;  2M7Q A;  1IQO A;  3OTO E;  1N32 E;  1X6H A;  2EM9 A;  2ODR C;  2EMA A;  1YFH A;  2L6M A;  4F54 A;  2FTX B;  1P47 A;  4LF6 E;  2UXB E;  2EMK A;  3FIG A;  4N4R B;  2JOB A;  1XMO E;  4JI8 E;  4DR2 E;  2J7J A;  1STU A;  2L2K B;  4YY3 E;  2LJH A;  4DV4 E;  1HNZ E;  4OX9 E;  3IWD A;  4LF5 E;  3C6K A;  2EOF A;  1A1K A;  2N8X A;  2YTG A;  3EPJ A;  2NAB A;  3DJW A;  4L5N C;  2YTJ A;  4ZYE A;  4R2P A;  1PJT A;  2DIX A;  2LRS A;  2YSP A;  4ZYD A;  1J26 A;  2LTS A;  3L00 A;  4KHP E;  2K4V A;  2CPN A;  2M1S A;  2DGC A;  2EL6 A;  4WXC A;  3T1Y E;  1I94 E;  3MHS C;  3UK3 C;  4JI6 E;  4J8Z A;  1WHQ A;  3F6H A;  4NZV A;  3ZOQ B;  1NEI A;  1WJP A;  4WSG A;  2VE7 C;  4X65 E;  2M9A A;  1ZR9 A;  4O24 A;  4OOG C;  2LMZ A;  2L2M A;  1MEY C;  3C6M A;  2EM6 A;  4WPY A;  1N36 E;  2I13 A;  4KZS A;  2EMI A;  4BMJ A;  1T39 A;  2B7T A;  2YTN A;  3OML A;  2EZ6 A;  2F8B A;  1A1F A;  4B3R E;  2EOZ A;  2EPN A;  4R2R A;  1IBM E;  2EPZ A;  2E72 A;  2EM8 A;  2EOH A;  3JU0 A;  3LML A;  4BC9 A;  2YSO A;  2V85 A;  1T4L B;  1PKP A;  5AE1 A;  2EN8 A;  2LV2 A;  2EQ0 A;  1JK2 A;  1A1J A;  2JP9 A;  4F6N A;  3ADL A;  1YYO A;  2EPC A;  3ECR A;  1MGT A;  2M4I A;  1BB8 A;  2L92 A;  2I9I A;  2NA2 A;  2VRD A;  3VK6 A;  4JI2 E;  4M2Z A;  2EOS A;  2KOU A;  4JI0 E;  2EPU A;  2UUB E;  1X48 A;  2EL5 A;  4GKK E;  2B9D A;  2JVA A;  4ZYG A;  4MLQ A;  4FK5 C;  2CSH A;  4WFT A;  2EMG A;  5AAS A;  3BBG A;  5IT9 C;  1QNT A;  2BB8 A;  2RQL A;  1HR0 E;  2EPM X;  4DV2 E;  3T1H E;  3J80 C;  2ELZ A;  4WSP A;  4DUY E;  4L8N A;  1AAY A;  2PRT A;  2HJJ A;  4BC7 A;  2EM0 A;  2EPX A;  1A1I A;  2KON A;  2DLK A;  3IWB A;  2YRM A;  2B3T B;  2YU5 A;  4GEQ B;  4NXN E;  2ODR D;  3TQM A;  5AE3 A;  2EPP A;  4JI5 E;  2EPL X;  2K7I A;  1UIL A;  1SR9 A;  4TUG A;  2R1F A;  2EOO A;  2NUG A;  3HPZ A;  1YYK A;  1GTK A;  2RPC A;  1YUI A;  2DB2 A;  4LF7 E;  2LT7 A;  2EM5 A;  2UUA E;  1HNW E;  2F4V E;  2RTX A;  4DR4 E;  2YT4 A;  2ZM6 E;  4P7D A;  2MDG A;  1T4O A;  4B3M E;  3HQ1 A;  1EKZ A;  5LMN E;  2EN6 A;  4LF4 E;  2EMF A;  4RH8 A;  5LLQ A;  2JXP A;  2IHR 1;  5FLX C;  4DUZ E;  2B7V A;  2JOX A;  2KHX A;  4M9V C;  2EQ1 A;  5AC4 A;  4R2A A;  4LF8 E;  5LMU E;  2VQE E;  1A1H A;  4BHB A;  4LF9 E;  4R2Q A;  3BGH A;  2FV4 B;  1LLM C;  2EMB A;  2EMW A;  2LCE A;  3K6Q A;  2JPA A;  5T6J A;  2RSM A;  1X6E A;  1UHZ A;  2D9H A;  4DR5 E;  1IMU A;  2EML A;  2GLI A;  4LFB E;  2DMY A;  2V88 A;  1PDA A;  4R2E A;  2YTP A;  4X66 E;  2EMY A;  4HEI A;  1BBO A;  1PJS A;  1PJQ A;  2LVH A;  1GZ6 A;  5LL6 R;  2EOY A;  2EPA A;  5TSE A;  5IXM B;  1DQ3 A;  4IS1 C;  1YSA C;  5A6B A;  4ZYH A;  1IBK E;  3EPK A;  2LO3 A;  4DV3 E;  4K0K E;  5A69 A;  2YU8 A;  2BBG A;  2EOR A;  3AUZ A;  5A6J A;  3KZZ A;  2ENH A;  2UXD E;  1EH6 A;  3ADJ A;  3M99 B;  2MKN A;  2JY9 A;  2L33 A;  3MSW A;  2N3G A;  4WYQ B;  2DLQ A;  3KZY A;  3J7A G;  1HNX E;  1RMD A;  2EOE A;  1RC7 A;  5KL5 A;  4B3S E;  4DV1 E;  2EM2 A;  4O5G A;  3KWR A;  5BR8 E;  4GKJ E;  2EMX A;  3P1X A;  3ADI A;  2GHF A;  4DR7 E;  2RSI A;  2NUF A;  3VYX A;  4X62 E;  3JTZ A;  1WRJ A;  1TF6 A;  4X8W A;  1IQS A;  2N3H A;  2YTD A;  2YRH A;  4BCA A;  4YHH E;  1T4N A;  2EN7 A;  4WX9 A;  1X47 A;  2JWO A;  1JK1 A;  1TN9 A;  1Z1B A;  4JV5 E;  2CT1 A;  4R2C A;  2L3C A;  2EOX A;  4JYA E;  4JI3 E;  1N33 E;  5A2Q C;  5F3W A;  2YPN A;  2GPI A;  4F9B B;  5A6A A;  1YZ9 A;  2YWQ A;  5A6K A;  2DMI A;  3HPS A;  4KWY A;  3AV0 A;  2ENC A;  2JYA A;  4MLV A;  4BBY A;  2LUP B;  4R2D A;  2EPK X;  4LFA E;  2L8T A;  3F6G A;  1X49 A;  2EN2 A;  2V83 A;  1AH5 A;  2R76 A;  1EH8 A;  2YRK A;  1ZBQ A;  2LJU A;  2V8Q B;  1L4S A;  1F2I G;  3IWC A;  4HTG A;  2MDR A;  2EPO A;  1KYQ A;  2WZO A;  3HXL A;  4R8O A;  2MC5 A;  1X6F A;  2EQ3 A;  1A1G A;  1QU6 A;  2HGH A;  2RS7 A;  1DGC A;  1FJG E;  3QG5 C;  4Q28 A;  2ELY A;  4F9A B;  2EMZ A;  4JI7 E;  1DI2 A;  4TUI A;  1N3G A;  4LU9 A;  4M30 A;  5IV8 B;  4BS9 A;  2H36 X;  4R03 A;  4IJD A;  1T38 A;  1NCS A;  2WBS A;  3J7Y p;  4DV5 E;  2G7H A;  2EN4 A;  4DV7 E;  4WXD A;  4DR3 E;  1X3C A;  2DSY A;  2EM4 A;  3DF6 A;  2WCC 3;  1YPN A;  4RHB B;  2EM7 A;  2EJ4 A;  2RS6 A;  2EM3 A;  2WBT A;  1X5W A;  2EN3 A;  3BF2 A;  5KL3 A;  2CTD A;  1J5E E;  2UXC E;  3C4T A;  4O43 A;  3JAM C;  1WXR A;  1XNR E;  1N34 E;  2EWL A;  1G2F C;  3LLH A;  5DNY A; 
#chains in the Genus database with same CATH homology
 2EMX A;  2EOF A;  3VHT B;  1A1K A;  2YTG A;  3EPJ A;  2GHF A;  2NAB A;  4F2J C;  2YTJ A;  4R2P A;  2RSI A;  2EPP A;  2YSP A;  1TF6 A;  1A1L A;  4F6M A;  2ENA A;  1B69 A;  2R1F A;  2EOO A;  2EMC A;  2DGC A;  2EL6 A;  2EN1 A;  2YTD A;  2YRH A;  1UBD C;  2RPC A;  1YUI A;  2ADR A;  5KL6 A;  2LT7 A;  2EN7 A;  4R2S A;  2EM5 A;  2EL4 A;  5KL2 A;  3MHH C;  3MHS C;  2YTI A;  1JK1 A;  1TN9 A;  2EP3 A;  3UK3 C;  1Z1B A;  2MDG A;  5KL7 A;  2CT1 A;  4R2C A;  1ZU1 A;  1WJP A;  4WSG A;  2EOX A;  2YTO A;  2EN6 A;  2EOM A;  4GZN C;  2EMF A;  1YUJ A;  2M9A A;  1ZR9 A;  2YTE A;  4M9V C;  1MEY C;  5KL4 A;  2EM6 A;  2I13 A;  2EQ1 A;  1KJK A;  2DMI A;  4R2A A;  2EMI A;  2ENC A;  3EPH A;  4R2D A;  1A1H A;  2EOQ A;  4R2Q A;  2YTN A;  2EN2 A;  1LLM C;  2EMB A;  2EMW A;  2LCE A;  2JPA A;  2EPR A;  2YRK A;  1A1F A;  1X6E A;  2EOZ A;  4R2R A;  2EOI A;  2D9H A;  2EE8 A;  2EPZ A;  1F2I G;  2E72 A;  2EML A;  1TF3 A;  2EM8 A;  2GLI A;  2EOH A;  2EOJ A;  2YTF A;  2MKD A;  3EPL A;  2YSO A;  2EN8 A;  2LV2 A;  4R2E A;  2EQ0 A;  1G2D C;  1JK2 A;  1X6F A;  2EQ3 A;  1A1J A;  2YTP A;  2JP9 A;  4F6N A;  1A1G A;  2HGH A;  2WBU A;  1DGC A;  2EMY A;  2EPC A;  1BBO A;  2LVH A;  1BB8 A;  1ZAA C;  2YTQ A;  2ELY A;  2EOY A;  2EPA A;  2VRD A;  2DRP A;  2EMZ A;  2EOS A;  4IS1 C;  2EMH A;  1YSA C;  2A25 A;  2EPU A;  3EPK A;  2EL5 A;  2LO3 A;  2YU8 A;  2EOR A;  4IJD A;  4X9J A;  1NCS A;  2WBS A;  1UN6 B;  4FK5 C;  2ENH A;  2CSH A;  2EMG A;  2EN4 A;  1X3C A;  2BB8 A;  2EM4 A;  3M99 B;  2ELZ A;  2WCC 3;  2MKN A;  1X6H A;  2EM9 A;  2EM7 A;  2EMA A;  1AAY A;  2EJ4 A;  2PRT A;  2EM3 A;  2WBT A;  2DLQ A;  1X5W A;  2EN3 A;  5KL3 A;  1P47 A;  2CTD A;  1RMD A;  2EPX A;  2EM0 A;  2EMK A;  2EOE A;  1A1I A;  5KL5 A;  2DLK A;  2J7J A;  2YRM A;  1G2F C;  2EM2 A;  2YU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...