2EMWA

Solution structure of the c2h2 type zinc finger (region 301-331) of human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
GSSGSSGEKPYGCNECGKDFSSKSYLIVHQRIHTGEKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 301-331) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 268
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2emwA01
4R2PA 1BB8A 1YSAC 2VRDA 2EM0A 4X9JA 2YTJA 2DGCA 2EORA 2BB8A 2EMWA 1MEYC 5KL5A 1B69A 2EPAA 2RSIA 2YRHA 2EL5A 2YTPA 2EMZA 1KJKA 2CTDA 2EPZA 2EMLA 1X6HA 2EE8A 2RPCA 1G2DC 2EMXA 1X5WA 2EOEA 2EPXA 2YSOA 4R2SA 2MKNA 2ENCA 2YTEA 1P47A 2EPRA 2LV2A 2YU5A 4M9VC 5KL4A 2EOFA 2ELYA 2EN7A 1A1HA 2EN3A 2YTIA 1LLMC 1F2IG 2M9AA 2CT1A 2ENHA 2YTGA 2HGHA 2EM4A 1RMDA 1A1JA 2YTFA 2R1FA 3EPLA 1YUIA 1JK2A 1WJPA 2EMBA 2EM5A 3EPKA 2EOSA 3VHTB 1TF6A 2EMGA 2EJ4A 2EQ1A 2DMIA 2LVHA 4GZNC 2EOIA 2EM6A 2YTQA 4IJDA 2YSPA 2DLKA 2WBSA 2CSHA 2EMHA 1X3CA 2LCEA 2EPCA 3EPJA 1ZR9A 1X6EA 2EMYA 1X6FA 2EN6A 2MDGA 2WCC3 1G2FC 2LO3A 3EPHA 2ADRA 2WBTA 2DLQA 2D9HA 2EMKA 2EN8A 1TF3A 1ZAAC 1UBDC 2I13A 2MKDA 5KL6A 1A1FA 2EOJA 2ENAA 2EPUA 4R2QA 4IS1C 2NABA 2EN1A 2EQ0A 3M99B 4FK5C 4R2RA 2YTNA 1AAYA 1JK1A 2JPAA 3MHHC 2EOXA 2EN2A 3MHSC 2YRMA 2YU8A 5KL2A 2LT7A 2EQ3A 1UN6B 2EOZA 2EP3A 4R2EA 2EOHA 2EM9A 2EM2A 2ELZA 2EMFA 2GLIA 2EMIA 2JP9A 2WBUA 1BBOA 2EPPA 2EM3A 1A1KA 5KL7A 2DRPA 2EM8A 2YTOA 1TN9A 1A1LA 1A1GA 2EOYA 2PRTA 2EL4A 4R2AA 2YRKA 2EOQA 2EM7A 1A1IA 1DGCA 2J7JA 2EOMA 1NCSA 2GHFA 2EL6A 4R2DA 2YTDA 5KL3A 2A25A 4WSGA 4F6NA 2EMCA 1YUJA 2EOOA 3UK3C 4F6MA 1Z1BA 4F2JC 2EMAA 4R2CA 2EN4A 1ZU1A 2E72A
chains in the Genus database with same CATH superfamily
4R2PA 5A6KA 1IQSA 2DGCA 2EMWA 3IWBA 5AE1A 1MEYC 2NUEA 4X64E 4LFCE 2ODRC 1N33E 4R03A 4F9AB 1T38A 1G2DC 4NXME 2L2MA 4B3SE 2ENCA 1P47A 4O5GA 4WFTA 4M9VC 4BBYA 4J8ZA 5DNYA 2FTXB 1SFEA 1A1HA 4MLVA 2DSYA 2CT1A 2YTGA 2JR1A 3DJWA 5IT9C 2R1FA 3EPLA 3C6KA 4O43A 4DKKA 4P7DA 2JVAA 1HNWE 2N3GA 4LU9A 1XNRE 5A6JA 4WXCA 1RQ0A 4X62E 2EM6A 1X49A 2I9IA 2RS7A 4KHPE 4BCAA 2UU9E 4LF9E 2ZM6E 3OTOE 2WCC3 4DV3E 1N34E 2M1SA 2LO3A 3EPHA 2V87A 1EH7A 2EN8A 4DMIA 3JTZA 4BC7A 1YFHA 4X66E 2EPUA 4R2QA 3OMLA 2E1MA 4DR7E 2KHXA 2MDRA 2NABA 1PJTA 5AE3A 2UUCE 4R2RA 2LE2A 4DUZE 3HXLA 5FLXC 2B7VA 2JPAA 4GKKE 4F54A 2EOXA 1YYKA 2YRMA 1UN6B 2UUBE 4JI0E 3JAMC 2EM9A 3VYYA 1ZBQA 3LLHA 4DV7E 4JI2E 4WXDA 3T1YE 1BBOA 2UUAE 4KWYA 5KL7A 2GPIA 3J80C 2DRPA 2YTOA 1A1LA 1A1GA 4DV6E 3P1XA 2EM7A 5LMUE 2H36X 4R2DA 2EL6A 2KOUA 2YT4A 2LJUA 2EOOA 2JY9A 4F2JC 2LUPB 2JOBA 3BF2A 2EN4A 2B7TA 2E72A 3HQ1A 3ADJA 1XNQE 4JV5E 1FKAE 2YTJA 2EPOA 4DV2E 2L33A 2K4VA 3KZYA 1J5EE 2YTPA 2VQEE 2EPZA 2EMLA 1GZ6A 1X6HA 3MSWA 2V83A 2EPXA 2EOEA 4R2SA 1BBGA 3EQ1A 1HR0E 2LV2A 4DR1E 2EOFA 1T4OA 4JI4E 3VK6A 2LMZA 2LJHA 4DR5E 2EN7A 2CPNA 2RTXA 1X48A 2DIXA 1LLMC 4ZYEA 4K0KE 2V85A 2YZTA 2HGHA 4RH8A 1IBME 4M0VA 1QU6A 3C4TA 4BHBA 3AUZA 1WJPA 5IV8B 2E5LE 4JI7E 2EJ4A 2EQ1A 2DMIA 2DMYA 3H09A 4JI8E 4GZNC 2EOIA 5AASA 2VF1A 2CSHA 4L5NC 3ECRA 1WHNA 4NHRA 4OOGC 1G2FC 2MDGA 4TUIA 2MC6A 2WBTA 4LF7E 2EMKA 2F4VE 4ZYHA 2L6MA 5T6JA 2L2NA 2LUQA 2MKDA 3TQMA 5KL6A 1A1FA 1UBDC 2EN1A 3C4BA 5AE2A 2M7QA 4F9BB 3MHSC 2LT7A 2R76A 2EQ3A 3BGHA 4BC9A 3THNA 1HNXE 4O24A 2EOHA 1N36E 2EM2A 2BBGA 3J81C 2EMFA 1RC7A 2NA2A 2NUFA 1SR9A 5LLQA 2WBUA 2EPPA 3KWRA 4KZSA 3THOB 2FV4B 2EM8A 5F3WA 2ODRD 1T4LB 4OX9E 2RQLA 2UXBE 2PRTA 4N4RB 5AC4A 2YRKA 3HTXA 4M2ZA 2WZOA 2HHHE 2YTDA 3DF6A 5KL3A 2A25A 1WHQA 5TSEA 4RHBB 5CFFE 2YTNA 3MHHC 4F9CB 1N3GA 3F6HA 2VRDA 4NZVA 3BBGA 1UHZA 1PJSA 1B69A 2EPAA 2RSIA 2YRHA 2HC5A 3FIGA 2EMZA 1KJKA 2CTDA 2V89A 2RPCA 2EMXA 1X5WA 4WX9A 2YSOA 2YTEA 1NEIA 5BR8E 4LFBE 2EWLA 5AC5A 1FJGE 2YTIA 2HJJA 4DR2E 4LF8E 1PDAA 2NUGA 5A2QC 2DB2A 4LF6E 4DV5E 4WYQB 2EM4A 1ZBTA 2L3CA 1A1JA 1KYQA 4JI1E 4DR4E 4YY3E 1YUIA 1JK2A 2F8BA 4DR6E 2EM5A 1IBLE 1PKPA 2L92A 4JYAE 3K6QA 1AH5A 2YTQA 3ADGA 4LF4E 2M4IA 2DLKA 3JU0A 2WBSA 2EMHA 4ZYDA 1X3CA 4LFAE 2EPCA 3EPJA 2JWOA 2EMYA 1X6FA 4DUYE 4JI5E 2G7HA 2LBSB 2ADRA 1DI2A 2DLQA 2D9HA 2EZ6A 3J7AG 4B3ME 2I13A 4R8OA 1STUA 2YPNA 3HPZA 4DV1E 4B3TE 2V88A 2EQ0A 1EH6A 4FK5C 2MC5A 5ADZA 2EN2A 4I8OA 5KL2A 2IHR1 2N8XA 2EP3A 4BS9A 2L3JA 2EMIA 3LMLA 2B9DA 4Q35B 4X8WA 4P78A 4JI3E 3RMPA 1L4SA 4HTGA 5A69A 4M30A 1I94E 1TN9A 2LTRA 3C6MA 4R2AA 3ADLA 3AV0A 1IMUA 2VQFE 1A1IA 1QNTA 2EOMA 2J7JA 1NCSA 3KZZA 4WSGA 2EMCA 2L8TA 2JYAA 1PJQA 3UK3C 4F6MA 1J26A 2EMAA 1ZU1A 5A6BD 1BB8A 1YSAC 2EM0A 4X9JA 4BMJA 2EORA 2BB8A 3BIDA 1MGTA 5KL5A 2EL5A 2RSMA 4HEIA 2EE8A 1IBKE 2MKNA 2EPRA 2YU5A 2V86A 4ZYGA 5KL4A 5A6BA 2ELYA 2EPLX 2RS6A 4BHCA 1WRJA 4WSPA 2EN3A 1F2IG 2M9AA 4LF5E 2ENHA 1HNZE 2YWQA 1RMDA 2YTFA 5IWAE 1GTKA 4YHHE 1DQ3A 3ADIA 3J7Yp 4O4KA 2EMBA 1YYWA 2LRSA 3EPKA 2EPNA 1X47A 2EOSA 3VHTB 1TF6A 2EMGA 2LVHA 4NXNE 4IJDA 2YSPA 4B3RE 2B3TB 3F6GA 5LL6R 1UILA 2LCEA 1YPNA 5A6AA 2LTSA 1IQOA 2Q8UA 2N3HA 1ZR9A 1X6EA 4TUGA 2EN6A 4L8NA 3VYXA 5IXMB 3T1HE 1O0WA 1TF3A 1ZAAC 3QG5C 3L00A 4DV0E 1WXRA 4JI6E 2EOJA 2ENAA 4IS1C 3M99B 4X65E 4WPYA 2K7IA 4DR3E 1AAYA 1GQEA 1JK1A 2FGGA 2UXDE 2YU8A 2VE7C 2EOZA 4R2EA 3IWCA 1N32E 2L2KB 2ELZA 2JXPA 2GLIA 2JP9A 3HPSA 4GEQB 3ZOQB 2EM3A 1XMQE 1A1KA 1T39A 4AQYE 4MLQA 4Q28A 2EPKX 1EKZA 1YZ9A 1EH8A 4GKJE 2EOYA 5LMNE 4DV4E 2EL4A 2V8QB 2EOQA 1DGCA 2UXCE 1XMOE 2GHFA 2KONA 4F6NA 1YUJA 2EPMX 2JOXA 1Z1BA 4LTYA 1T4NA 4R2CA 3IWDA 1YYOA
chains in the Genus database with same CATH topology
4R2PA 1BB8A 1YSAC 2VRDA 2EM0A 4X9JA 2YTJA 2DGCA 2EORA 2BB8A 2EMWA 1MEYC 5KL5A 1B69A 2EPAA 2RSIA 2YRHA 2EL5A 2YTPA 2EMZA 1KJKA 2CTDA 2EPZA 2EMLA 1X6HA 2EE8A 2RPCA 1G2DC 2EMXA 1X5WA 2EOEA 2EPXA 2YSOA 4R2SA 2MKNA 2ENCA 2YTEA 1P47A 2EPRA 2LV2A 2YU5A 4M9VC 5KL4A 2EOFA 2ELYA 2EN7A 1A1HA 2EN3A 2YTIA 1LLMC 1F2IG 2M9AA 2CT1A 2ENHA 2YTGA 2HGHA 2EM4A 1RMDA 1A1JA 2YTFA 2R1FA 3EPLA 1YUIA 1JK2A 1WJPA 2EMBA 2EM5A 3EPKA 2EOSA 3VHTB 1TF6A 2EMGA 2EJ4A 2EQ1A 2DMIA 2LVHA 4GZNC 2EOIA 2EM6A 2YTQA 4IJDA 2YSPA 2DLKA 2WBSA 2CSHA 2EMHA 1X3CA 2LCEA 2EPCA 3EPJA 1ZR9A 1X6EA 2EMYA 1X6FA 2EN6A 2MDGA 2WCC3 1G2FC 2LO3A 3EPHA 2ADRA 2WBTA 2DLQA 2D9HA 2EMKA 2EN8A 1TF3A 1ZAAC 1UBDC 2I13A 2MKDA 5KL6A 1A1FA 2EOJA 2ENAA 2EPUA 4R2QA 4IS1C 2NABA 2EN1A 2EQ0A 3M99B 4FK5C 4R2RA 2YTNA 1AAYA 1JK1A 2JPAA 3MHHC 2EOXA 2EN2A 3MHSC 2YRMA 2YU8A 5KL2A 2LT7A 2EQ3A 1UN6B 2EOZA 2EP3A 4R2EA 2EOHA 2EM9A 2EM2A 2ELZA 2EMFA 2GLIA 2EMIA 2JP9A 2WBUA 1BBOA 2EPPA 2EM3A 1A1KA 5KL7A 2DRPA 2EM8A 2YTOA 1TN9A 1A1LA 1A1GA 2EOYA 2PRTA 2EL4A 4R2AA 2YRKA 2EOQA 2EM7A 1A1IA 1DGCA 2J7JA 2EOMA 1NCSA 2GHFA 2EL6A 4R2DA 2YTDA 5KL3A 2A25A 4WSGA 4F6NA 2EMCA 1YUJA 2EOOA 3UK3C 4F6MA 1Z1BA 4F2JC 2EMAA 4R2CA 2EN4A 1ZU1A 2E72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2P A;  1BB8 A;  1YSA C;  2VRD A;  2EM0 A;  4X9J A;  2YTJ A;  2DGC A;  2EOR A;  2BB8 A;  2EMW A;  1MEY C;  5KL5 A;  1B69 A;  2EPA A;  2RSI A;  2YRH A;  2EL5 A;  2YTP A;  2EMZ A;  1KJK A;  2CTD A;  2EPZ A;  2EML A;  1X6H A;  2EE8 A;  2RPC A;  1G2D C;  2EMX A;  1X5W A;  2EOE A;  2EPX A;  2YSO A;  4R2S A;  2MKN A;  2ENC A;  2YTE A;  1P47 A;  2EPR A;  2LV2 A;  2YU5 A;  4M9V C;  5KL4 A;  2EOF A;  2ELY A;  2EN7 A;  1A1H A;  2EN3 A;  2YTI A;  1LLM C;  1F2I G;  2M9A A;  2CT1 A;  2ENH A;  2YTG A;  2HGH A;  2EM4 A;  1RMD A;  1A1J A;  2YTF A;  2R1F A;  3EPL A;  1YUI A;  1JK2 A;  1WJP A;  2EMB A;  2EM5 A;  3EPK A;  2EOS A;  3VHT B;  1TF6 A;  2EMG A;  2EJ4 A;  2EQ1 A;  2DMI A;  2LVH A;  4GZN C;  2EOI A;  2EM6 A;  2YTQ A;  4IJD A;  2YSP A;  2DLK A;  2WBS A;  2CSH A;  2EMH A;  1X3C A;  2LCE A;  2EPC A;  3EPJ A;  1ZR9 A;  1X6E A;  2EMY A;  1X6F A;  2EN6 A;  2MDG A;  2WCC 3;  1G2F C;  2LO3 A;  3EPH A;  2ADR A;  2WBT A;  2DLQ A;  2D9H A;  2EMK A;  2EN8 A;  1TF3 A;  1ZAA C;  1UBD C;  2I13 A;  2MKD A;  5KL6 A;  1A1F A;  2EOJ A;  2ENA A;  2EPU A;  4R2Q A;  4IS1 C;  2NAB A;  2EN1 A;  2EQ0 A;  3M99 B;  4FK5 C;  4R2R A;  2YTN A;  1AAY A;  1JK1 A;  2JPA A;  3MHH C;  2EOX A;  2EN2 A;  3MHS C;  2YRM A;  2YU8 A;  5KL2 A;  2LT7 A;  2EQ3 A;  1UN6 B;  2EOZ A;  2EP3 A;  4R2E A;  2EOH A;  2EM9 A;  2EM2 A;  2ELZ A;  2EMF A;  2GLI A;  2EMI A;  2JP9 A;  2WBU A;  1BBO A;  2EPP A;  2EM3 A;  1A1K A;  5KL7 A;  2DRP A;  2EM8 A;  2YTO A;  1TN9 A;  1A1L A;  1A1G A;  2EOY A;  2PRT A;  2EL4 A;  4R2A A;  2YRK A;  2EOQ A;  2EM7 A;  1A1I A;  1DGC A;  2J7J A;  2EOM A;  1NCS A;  2GHF A;  2EL6 A;  4R2D A;  2YTD A;  5KL3 A;  2A25 A;  4WSG A;  4F6N A;  2EMC A;  1YUJ A;  2EOO A;  3UK3 C;  4F6M A;  1Z1B A;  4F2J C;  2EMA A;  4R2C A;  2EN4 A;  1ZU1 A;  2E72 A; 
#chains in the Genus database with same CATH topology
 4R2P A;  5A6K A;  1IQS A;  2DGC A;  2EMW A;  3IWB A;  5AE1 A;  1MEY C;  2NUE A;  4X64 E;  4LFC E;  2ODR C;  1N33 E;  4R03 A;  4F9A B;  1T38 A;  1G2D C;  4NXM E;  2L2M A;  4B3S E;  2ENC A;  1P47 A;  4O5G A;  4WFT A;  4M9V C;  4BBY A;  4J8Z A;  5DNY A;  2FTX B;  1SFE A;  1A1H A;  4MLV A;  2DSY A;  2CT1 A;  2YTG A;  2JR1 A;  3DJW A;  5IT9 C;  2R1F A;  3EPL A;  3C6K A;  4O43 A;  4DKK A;  4P7D A;  2JVA A;  1HNW E;  2N3G A;  4LU9 A;  1XNR E;  5A6J A;  4WXC A;  1RQ0 A;  4X62 E;  2EM6 A;  1X49 A;  2I9I A;  2RS7 A;  4KHP E;  4BCA A;  2UU9 E;  4LF9 E;  2ZM6 E;  3OTO E;  2WCC 3;  4DV3 E;  1N34 E;  2M1S A;  2LO3 A;  3EPH A;  2V87 A;  1EH7 A;  2EN8 A;  4DMI A;  3JTZ A;  4BC7 A;  1YFH A;  4X66 E;  2EPU A;  4R2Q A;  3OML A;  2E1M A;  4DR7 E;  2KHX A;  2MDR A;  2NAB A;  1PJT A;  5AE3 A;  2UUC E;  4R2R A;  2LE2 A;  4DUZ E;  3HXL A;  5FLX C;  2B7V A;  2JPA A;  4GKK E;  4F54 A;  2EOX A;  1YYK A;  2YRM A;  1UN6 B;  2UUB E;  4JI0 E;  3JAM C;  2EM9 A;  3VYY A;  1ZBQ A;  3LLH A;  4DV7 E;  4JI2 E;  4WXD A;  3T1Y E;  1BBO A;  2UUA E;  4KWY A;  5KL7 A;  2GPI A;  3J80 C;  2DRP A;  2YTO A;  1A1L A;  1A1G A;  4DV6 E;  3P1X A;  2EM7 A;  5LMU E;  2H36 X;  4R2D A;  2EL6 A;  2KOU A;  2YT4 A;  2LJU A;  2EOO A;  2JY9 A;  4F2J C;  2LUP B;  2JOB A;  3BF2 A;  2EN4 A;  2B7T A;  2E72 A;  3HQ1 A;  3ADJ A;  1XNQ E;  4JV5 E;  1FKA E;  2YTJ A;  2EPO A;  4DV2 E;  2L33 A;  2K4V A;  3KZY A;  1J5E E;  2YTP A;  2VQE E;  2EPZ A;  2EML A;  1GZ6 A;  1X6H A;  3MSW A;  2V83 A;  2EPX A;  2EOE A;  4R2S A;  1BBG A;  3EQ1 A;  1HR0 E;  2LV2 A;  4DR1 E;  2EOF A;  1T4O A;  4JI4 E;  3VK6 A;  2LMZ A;  2LJH A;  4DR5 E;  2EN7 A;  2CPN A;  2RTX A;  1X48 A;  2DIX A;  1LLM C;  4ZYE A;  4K0K E;  2V85 A;  2YZT A;  2HGH A;  4RH8 A;  1IBM E;  4M0V A;  1QU6 A;  3C4T A;  4BHB A;  3AUZ A;  1WJP A;  5IV8 B;  2E5L E;  4JI7 E;  2EJ4 A;  2EQ1 A;  2DMI A;  2DMY A;  3H09 A;  4JI8 E;  4GZN C;  2EOI A;  5AAS A;  2VF1 A;  2CSH A;  4L5N C;  3ECR A;  1WHN A;  4NHR A;  4OOG C;  1G2F C;  2MDG A;  4TUI A;  2MC6 A;  2WBT A;  4LF7 E;  2EMK A;  2F4V E;  4ZYH A;  2L6M A;  5T6J A;  2L2N A;  2LUQ A;  2MKD A;  3TQM A;  5KL6 A;  1A1F A;  1UBD C;  2EN1 A;  3C4B A;  5AE2 A;  2M7Q A;  4F9B B;  3MHS C;  2LT7 A;  2R76 A;  2EQ3 A;  3BGH A;  4BC9 A;  3THN A;  1HNX E;  4O24 A;  2EOH A;  1N36 E;  2EM2 A;  2BBG A;  3J81 C;  2EMF A;  1RC7 A;  2NA2 A;  2NUF A;  1SR9 A;  5LLQ A;  2WBU A;  2EPP A;  3KWR A;  4KZS A;  3THO B;  2FV4 B;  2EM8 A;  5F3W A;  2ODR D;  1T4L B;  4OX9 E;  2RQL A;  2UXB E;  2PRT A;  4N4R B;  5AC4 A;  2YRK A;  3HTX A;  4M2Z A;  2WZO A;  2HHH E;  2YTD A;  3DF6 A;  5KL3 A;  2A25 A;  1WHQ A;  5TSE A;  4RHB B;  5CFF E;  2YTN A;  3MHH C;  4F9C B;  1N3G A;  3F6H A;  2VRD A;  4NZV A;  3BBG A;  1UHZ A;  1PJS A;  1B69 A;  2EPA A;  2RSI A;  2YRH A;  2HC5 A;  3FIG A;  2EMZ A;  1KJK A;  2CTD A;  2V89 A;  2RPC A;  2EMX A;  1X5W A;  4WX9 A;  2YSO A;  2YTE A;  1NEI A;  5BR8 E;  4LFB E;  2EWL A;  5AC5 A;  1FJG E;  2YTI A;  2HJJ A;  4DR2 E;  4LF8 E;  1PDA A;  2NUG A;  5A2Q C;  2DB2 A;  4LF6 E;  4DV5 E;  4WYQ B;  2EM4 A;  1ZBT A;  2L3C A;  1A1J A;  1KYQ A;  4JI1 E;  4DR4 E;  4YY3 E;  1YUI A;  1JK2 A;  2F8B A;  4DR6 E;  2EM5 A;  1IBL E;  1PKP A;  2L92 A;  4JYA E;  3K6Q A;  1AH5 A;  2YTQ A;  3ADG A;  4LF4 E;  2M4I A;  2DLK A;  3JU0 A;  2WBS A;  2EMH A;  4ZYD A;  1X3C A;  4LFA E;  2EPC A;  3EPJ A;  2JWO A;  2EMY A;  1X6F A;  4DUY E;  4JI5 E;  2G7H A;  2LBS B;  2ADR A;  1DI2 A;  2DLQ A;  2D9H A;  2EZ6 A;  3J7A G;  4B3M E;  2I13 A;  4R8O A;  1STU A;  2YPN A;  3HPZ A;  4DV1 E;  4B3T E;  2V88 A;  2EQ0 A;  1EH6 A;  4FK5 C;  2MC5 A;  5ADZ A;  2EN2 A;  4I8O A;  5KL2 A;  2IHR 1;  2N8X A;  2EP3 A;  4BS9 A;  2L3J A;  2EMI A;  3LML A;  2B9D A;  4Q35 B;  4X8W A;  4P78 A;  4JI3 E;  3RMP A;  1L4S A;  4HTG A;  5A69 A;  4M30 A;  1I94 E;  1TN9 A;  2LTR A;  3C6M A;  4R2A A;  3ADL A;  3AV0 A;  1IMU A;  2VQF E;  1A1I A;  1QNT A;  2EOM A;  2J7J A;  1NCS A;  3KZZ A;  4WSG A;  2EMC A;  2L8T A;  2JYA A;  1PJQ A;  3UK3 C;  4F6M A;  1J26 A;  2EMA A;  1ZU1 A;  5A6B D;  1BB8 A;  1YSA C;  2EM0 A;  4X9J A;  4BMJ A;  2EOR A;  2BB8 A;  3BID A;  1MGT A;  5KL5 A;  2EL5 A;  2RSM A;  4HEI A;  2EE8 A;  1IBK E;  2MKN A;  2EPR A;  2YU5 A;  2V86 A;  4ZYG A;  5KL4 A;  5A6B A;  2ELY A;  2EPL X;  2RS6 A;  4BHC A;  1WRJ A;  4WSP A;  2EN3 A;  1F2I G;  2M9A A;  4LF5 E;  2ENH A;  1HNZ E;  2YWQ A;  1RMD A;  2YTF A;  5IWA E;  1GTK A;  4YHH E;  1DQ3 A;  3ADI A;  3J7Y p;  4O4K A;  2EMB A;  1YYW A;  2LRS A;  3EPK A;  2EPN A;  1X47 A;  2EOS A;  3VHT B;  1TF6 A;  2EMG A;  2LVH A;  4NXN E;  4IJD A;  2YSP A;  4B3R E;  2B3T B;  3F6G A;  5LL6 R;  1UIL A;  2LCE A;  1YPN A;  5A6A A;  2LTS A;  1IQO A;  2Q8U A;  2N3H A;  1ZR9 A;  1X6E A;  4TUG A;  2EN6 A;  4L8N A;  3VYX A;  5IXM B;  3T1H E;  1O0W A;  1TF3 A;  1ZAA C;  3QG5 C;  3L00 A;  4DV0 E;  1WXR A;  4JI6 E;  2EOJ A;  2ENA A;  4IS1 C;  3M99 B;  4X65 E;  4WPY A;  2K7I A;  4DR3 E;  1AAY A;  1GQE A;  1JK1 A;  2FGG A;  2UXD E;  2YU8 A;  2VE7 C;  2EOZ A;  4R2E A;  3IWC A;  1N32 E;  2L2K B;  2ELZ A;  2JXP A;  2GLI A;  2JP9 A;  3HPS A;  4GEQ B;  3ZOQ B;  2EM3 A;  1XMQ E;  1A1K A;  1T39 A;  4AQY E;  4MLQ A;  4Q28 A;  2EPK X;  1EKZ A;  1YZ9 A;  1EH8 A;  4GKJ E;  2EOY A;  5LMN E;  4DV4 E;  2EL4 A;  2V8Q B;  2EOQ A;  1DGC A;  2UXC E;  1XMO E;  2GHF A;  2KON A;  4F6N A;  1YUJ A;  2EPM X;  2JOX A;  1Z1B A;  4LTY A;  1T4N A;  4R2C A;  3IWD A;  1YYO A; 
#chains in the Genus database with same CATH homology
 4R2P A;  1BB8 A;  1YSA C;  2VRD A;  2EM0 A;  4X9J A;  2YTJ A;  2DGC A;  2EOR A;  2BB8 A;  2EMW A;  1MEY C;  5KL5 A;  1B69 A;  2EPA A;  2RSI A;  2YRH A;  2EL5 A;  2YTP A;  2EMZ A;  1KJK A;  2CTD A;  2EPZ A;  2EML A;  1X6H A;  2EE8 A;  2RPC A;  1G2D C;  2EMX A;  1X5W A;  2EOE A;  2EPX A;  2YSO A;  4R2S A;  2MKN A;  2ENC A;  2YTE A;  1P47 A;  2EPR A;  2LV2 A;  2YU5 A;  4M9V C;  5KL4 A;  2EOF A;  2ELY A;  2EN7 A;  1A1H A;  2EN3 A;  2YTI A;  1LLM C;  1F2I G;  2M9A A;  2CT1 A;  2ENH A;  2YTG A;  2HGH A;  2EM4 A;  1RMD A;  1A1J A;  2YTF A;  2R1F A;  3EPL A;  1YUI A;  1JK2 A;  1WJP A;  2EMB A;  2EM5 A;  3EPK A;  2EOS A;  3VHT B;  1TF6 A;  2EMG A;  2EJ4 A;  2EQ1 A;  2DMI A;  2LVH A;  4GZN C;  2EOI A;  2EM6 A;  2YTQ A;  4IJD A;  2YSP A;  2DLK A;  2WBS A;  2CSH A;  2EMH A;  1X3C A;  2LCE A;  2EPC A;  3EPJ A;  1ZR9 A;  1X6E A;  2EMY A;  1X6F A;  2EN6 A;  2MDG A;  2WCC 3;  1G2F C;  2LO3 A;  3EPH A;  2ADR A;  2WBT A;  2DLQ A;  2D9H A;  2EMK A;  2EN8 A;  1TF3 A;  1ZAA C;  1UBD C;  2I13 A;  2MKD A;  5KL6 A;  1A1F A;  2EOJ A;  2ENA A;  2EPU A;  4R2Q A;  4IS1 C;  2NAB A;  2EN1 A;  2EQ0 A;  3M99 B;  4FK5 C;  4R2R A;  2YTN A;  1AAY A;  1JK1 A;  2JPA A;  3MHH C;  2EOX A;  2EN2 A;  3MHS C;  2YRM A;  2YU8 A;  5KL2 A;  2LT7 A;  2EQ3 A;  1UN6 B;  2EOZ A;  2EP3 A;  4R2E A;  2EOH A;  2EM9 A;  2EM2 A;  2ELZ A;  2EMF A;  2GLI A;  2EMI A;  2JP9 A;  2WBU A;  1BBO A;  2EPP A;  2EM3 A;  1A1K A;  5KL7 A;  2DRP A;  2EM8 A;  2YTO A;  1TN9 A;  1A1L A;  1A1G A;  2EOY A;  2PRT A;  2EL4 A;  4R2A A;  2YRK A;  2EOQ A;  2EM7 A;  1A1I A;  1DGC A;  2J7J A;  2EOM A;  1NCS A;  2GHF A;  2EL6 A;  4R2D A;  2YTD A;  5KL3 A;  2A25 A;  4WSG A;  4F6N A;  2EMC A;  1YUJ A;  2EOO A;  3UK3 C;  4F6M A;  1Z1B A;  4F2J C;  2EMA A;  4R2C A;  2EN4 A;  1ZU1 A;  2E72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...