2EN3A

Solution structure of the c2h2 type zinc finger (region 796-828) of human zinc finger protein 95 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPFQCKECGMNFSWSCSLFKHLRSHERTDPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 95 homolog
publication title Solution structure of the C2H2 type zinc finger (region 796-828) of human Zinc finger protein 95 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en3A01
2EOIA 2JPAA 2NABA 2YTDA 4X9JA 2EOXA 4R2QA 4R2RA 1Z1BA 1WJPA 2EPPA 1KJKA 2EPZA 2EE8A 2EM0A 3EPKA 2LVHA 2EL4A 2YTIA 2EMIA 2EORA 2BB8A 2CTDA 2ENCA 2R1FA 2M9AA 2EM9A 1UBDC 2EOFA 2LO3A 2LCEA 1X6EA 1TF6A 1LLMC 4R2EA 3M99B 2LV2A 4M9VC 1ZAAC 2ELZA 4R2PA 1DGCA 2YRKA 2YTOA 5KL5A 2EL6A 2EPUA 2EPRA 2MKDA 2DLKA 1YSAC 1A1GA 2MKNA 2DLQA 2EN8A 2EOSA 2EJ4A 1YUIA 1X6FA 2EOOA 2EOYA 3EPJA 1X3CA 2EOMA 1A1FA 2EL5A 5KL4A 4F6NA 2WBTA 1RMDA 4R2DA 2EMBA 4R2CA 1UN6B 2EMHA 5KL2A 2EN7A 1AAYA 1BBOA 2EN1A 2DMIA 2EPCA 3EPHA 4R2SA 2ADRA 2EM6A 2EMZA 2EPAA 1A1IA 1A1JA 2EN4A 2ENHA 2YTPA 2WBUA 2DRPA 2GHFA 2YTQA 2EMKA 2VRDA 2EMFA 2CSHA 2EM2A 1P47A 2YSOA 2YRHA 1X6HA 2EMLA 1G2DC 4F6MA 4GZNC 2MDGA 4WSGA 1G2FC 2EPXA 1ZR9A 1BB8A 2EOJA 2EM8A 5KL6A 5KL3A 2WCC3 2EMCA 2EMYA 1TN9A 5KL7A 3EPLA 2EM5A 1A1LA 2EOQA 1YUJA 1X5WA 1ZU1A 2EOEA 4F2JC 2RSIA 1TF3A 2EOHA 2EMXA 2YTEA 2EQ0A 2YU8A 1MEYC 2YU5A 2EOZA 2EP3A 1B69A 2EMAA 2I13A 3VHTB 2A25A 2LT7A 2EN2A 2EN3A 2EMWA 2EQ1A 4FK5C 2CT1A 1JK2A 2EM4A 2EN6A 4IJDA 2YTNA 2EQ3A 1A1KA 2EM7A 2YSPA 2PRTA 3MHHC 2YTJA 1F2IG 2D9HA 2HGHA 2YRMA 2RPCA 2EM3A 2GLIA 1A1HA 2EMGA 2WBSA 3UK3C 4R2AA 4IS1C 2ENAA 2YTFA 2J7JA 1JK1A 2DGCA 2JP9A 2ELYA 2E72A 3MHSC 1NCSA 2YTGA
chains in the Genus database with same CATH superfamily
4J8ZA 2NABA 4X9JA 3HQ1A 4BMJA 2RS7A 2EPNA 2EM0A 5AASA 2YT4A 4I8OA 5BR8E 2EPOA 2BB8A 2R1FA 5LMUE 2EM9A 1UBDC 3L00A 2NUFA 4DKKA 4R2EA 3M99B 2L8TA 2HHHE 2ELZA 3LMLA 2EPUA 5AC4A 5A6AA 1T4LB 1IQOA 2Q8UA 4BC9A 1A1GA 2LBSB 2NUGA 4DUYE 4JYAE 1YFHA 3BBGA 4DUZE 3MSWA 4P7DA 1X47A 2M4IA 4WXDA 4R2DA 2B7VA 2LMZA 5IWAE 2EN7A 2HJJA 2LUQA 3FIGA 3ADJA 3EPHA 1KYQA 2ADRA 3J7Yp 2EPAA 4JI6E 1J5EE 2L2MA 2JXPA 4B3ME 1PJSA 2N3GA 5A2QC 4DV0E 4LF5E 2MC6A 2EM2A 4DV2E 2YSOA 2EMLA 4M30A 2YZTA 4GZNC 2EPXA 1EH7A 4X62E 2EMCA 2G7HA 1RQ0A 2DMYA 4JI3E 5A6JA 2RQLA 1A1LA 4BC7A 4DR7E 4WXCA 1X5WA 3T1HE 1O0WA 4WPYA 2NA2A 4DV3E 2EPMX 3BF2A 1TF3A 5T6JA 2EQ0A 1MEYC 4YY3E 2F8BA 5IT9C 3IWBA 2EP3A 1T4NA 2NUEA 1GQEA 2YWQA 2I13A 4FK5C 2EN6A 1QNTA 2LJUA 2HC5A 1YPNA 2YSPA 1IBKE 2HGHA 2KHXA 2RPCA 3LLHA 4DV7E 2N8XA 2V89A 4NXME 2WBSA 2J7JA 4WYQB 2DGCA 2GPIA 1IBLE 3EQ1A 4B3TE 1WJPA 1SFEA 2EPZA 2EE8A 5LMNE 3EPKA 2LVHA 2E1MA 2N3HA 3THOB 2EL4A 2EMIA 2EORA 4JI1E 1QU6A 4DR5E 4RH8A 2LCEA 2IHR1 2JVAA 1LLMC 3F6HA 2LV2A 4DR4E 1BBGA 4F54A 2B7TA 2YRKA 4O4KA 5KL5A 2EL6A 2MKDA 4ZYEA 3KZZA 4N4RB 2VF1A 4BBYA 2EJ4A 4LF6E 2JR1A 2EOYA 3EPJA 4AQYE 3VK6A 2JY9A 1PJTA 4WX9A 2L92A 2F4VE 2V87A 2UXCE 4F6NA 1HNXE 2L6MA 4R2CA 2VE7C 4GEQB 2L3CA 2L33A 2UUAE 2EPCA 4L8NA 2EM6A 5TSEA 4O24A 2ENHA 2DRPA 3C4TA 4MLQA 2EMFA 5AE1A 2CSHA 3HTXA 5ADZA 1X6HA 1X48A 1G2FC 1ZR9A 1MGTA 2EOJA 3ECRA 2MDRA 2M7QA 5KL3A 1T38A 3C6MA 2RTXA 1ZBQA 1T39A 2DSYA 5AE3A 5KL7A 3EPLA 2DB2A 2EOQA 5IV8B 1DI2A 4KZSA 4ZYDA 3ADLA 1ZU1A 1FJGE 4DR1E 1YZ9A 1PDAA 4DR3E 2CPNA 2EOHA 2ODRD 2YU8A 1B69A 4MLVA 2A25A 2LT7A 2EN3A 2EMWA 2EQ1A 1JK2A 5IXMB 1XNQE 4TUIA 4HEIA 1A1KA 4LTYA 2PRTA 1J26A 1PJQA 2I9IA 2YRMA 4GKKE 1HNWE 1YYKA 4Q35B 3IWCA 2ZM6E 2FGGA 2UXDE 2JP9A 3QG5C 2E72A 2JOBA 3P1XA 1UHZA 4JI7E 4NXNE 2JPAA 2YTDA 2RS6A 3J81C 3VYYA 2EPLX 2B9DA 4R2QA 4LFAE 1Z1BA 2EPPA 1KJKA 3AUZA 4X8WA 4LF8E 2JYAA 2CTDA 2EOFA 1TF6A 5LLQA 4B3RE 1ZAAC 2LUPB 5F3WA 3OMLA 2EPRA 1XMQE 2MKNA 2DLQA 5A6KA 4X66E 1AH5A 3IWDA 1GZ6A 4M0VA 1X6FA 2EOOA 4OX9E 1X3CA 1A1FA 1ZBTA 2BBGA 4R03A 1YYOA 4LF7E 2EWLA 4DV6E 2WBTA 1XNRE 4M2ZA 1N3GA 3C4BA 1BBOA 2EN1A 2DMIA 4JI8E 2LTSA 4R2SA 2VQEE 2YTPA 5A6BD 2GHFA 4L5NC 1IBME 1STUA 2V83A 2VRDA 4BHBA 5AE2A 4R8OA 4DR2E 1N36E 1P47A 1HNZE 1WXRA 2UUBE 4F6MA 4F9CB 4WSGA 2EM8A 2YPNA 4HTGA 3T1YE 2WCC3 1WHQA 3HXLA 2LJHA 4BS9A 1YUJA 3KZYA 3AV0A 2EOEA 4F2JC 4DR6E 2ODRC 2RSIA 4F9BB 2EMXA 2YTEA 4JV5E 2LE2A 1EH8A 2WZOA 3VHTB 1GTKA 2EN2A 4X64E 3JU0A 2EM4A 3TQMA 4BHCA 5A6BA 1IQSA 2EQ3A 2H36X 4KWYA 1RC7A 3BGHA 1NEIA 4F9AB 3MHHC 2YTJA 2D9HA 2EM3A 2GLIA 2EMGA 3UK3C 4JI4E 2K4VA 3THNA 3ADIA 1JK1A 2ELYA 1SR9A 4Q28A 1YYWA 1NCSA 2EOIA 4BCAA 2KONA 2B3TB 3JTZA 2EOXA 4R2RA 4DV4E 5FLXC 3VYXA 1HR0E 2YTIA 3BIDA 2ENCA 2JWOA 3ADGA 4KHPE 2M9AA 4DMIA 1IMUA 2LO3A 1X6EA 3F6GA 2DIXA 1WRJA 1T4OA 4M9VC 4R2PA 1I94E 1DGCA 2YTOA 1EH6A 1EKZA 2DLKA 1YSAC 2E5LE 4LF9E 2V88A 3HPSA 2EN8A 2EOSA 1YUIA 2L3JA 2UU9E 2LTRA 2EOMA 2MC5A 1PKPA 2EL5A 5KL4A 4LF4E 2FV4B 5DNYA 3J80C 4JI5E 1RMDA 2R76A 1X49A 2EMBA 4K0KE 1UILA 3DF6A 4P78A 1UN6B 2EMHA 4RHBB 5KL2A 1AAYA 4OOGC 4ZYGA 4B3SE 3JAMC 2K7IA 2EMZA 2UUCE 3J7AG 1A1IA 1A1JA 2EN4A 5A69A 2WBUA 2KOUA 2YTQA 2EMKA 5AC5A 5LL6R 2M1SA 4TUGA 3OTOE 2UXBE 1G2DC 2YRHA 4DV5E 2MDGA 2V86A 3C6KA 4LFBE 4O5GA 1BB8A 5KL6A 2L2KB 2EMYA 3DJWA 1TN9A 1WHNA 2EPKX 3HPZA 2EM5A 4NZVA 5CFFE 3KWRA 2L2NA 2V85A 4JI0E 4NHRA 2VQFE 2YU5A 2EOZA 3H09A 2EZ6A 2EMAA 2LRSA 3RMPA 4LU9A 4O43A 2CT1A 4X65E 1N32E 1L4SA 1DQ3A 4WFTA 4DV1E 4IJDA 2YTNA 1XMOE 4WSPA 4YHHE 2V8QB 4LFCE 3K6QA 2JOXA 2EM7A 1F2IG 2FTXB 3ZOQB 1A1HA 2RSMA 4JI2E 4R2AA 4IS1C 2ENAA 2YTFA 1N34E 4GKJE 1FKAE 1N33E 3MHSC 4ZYHA 2YTGA
chains in the Genus database with same CATH topology
2EOIA 2JPAA 2NABA 2YTDA 4X9JA 2EOXA 4R2QA 4R2RA 1Z1BA 1WJPA 2EPPA 1KJKA 2EPZA 2EE8A 2EM0A 3EPKA 2LVHA 2EL4A 2YTIA 2EMIA 2EORA 2BB8A 2CTDA 2ENCA 2R1FA 2M9AA 2EM9A 1UBDC 2EOFA 2LO3A 2LCEA 1X6EA 1TF6A 1LLMC 4R2EA 3M99B 2LV2A 4M9VC 1ZAAC 2ELZA 4R2PA 1DGCA 2YRKA 2YTOA 5KL5A 2EL6A 2EPUA 2EPRA 2MKDA 2DLKA 1YSAC 1A1GA 2MKNA 2DLQA 2EN8A 2EOSA 2EJ4A 1YUIA 1X6FA 2EOOA 2EOYA 3EPJA 1X3CA 2EOMA 1A1FA 2EL5A 5KL4A 4F6NA 2WBTA 1RMDA 4R2DA 2EMBA 4R2CA 1UN6B 2EMHA 5KL2A 2EN7A 1AAYA 1BBOA 2EN1A 2DMIA 2EPCA 3EPHA 4R2SA 2ADRA 2EM6A 2EMZA 2EPAA 1A1IA 1A1JA 2EN4A 2ENHA 2YTPA 2WBUA 2DRPA 2GHFA 2YTQA 2EMKA 2VRDA 2EMFA 2CSHA 2EM2A 1P47A 2YSOA 2YRHA 1X6HA 2EMLA 1G2DC 4F6MA 4GZNC 2MDGA 4WSGA 1G2FC 2EPXA 1ZR9A 1BB8A 2EOJA 2EM8A 5KL6A 5KL3A 2WCC3 2EMCA 2EMYA 1TN9A 5KL7A 3EPLA 2EM5A 1A1LA 2EOQA 1YUJA 1X5WA 1ZU1A 2EOEA 4F2JC 2RSIA 1TF3A 2EOHA 2EMXA 2YTEA 2EQ0A 2YU8A 1MEYC 2YU5A 2EOZA 2EP3A 1B69A 2EMAA 2I13A 3VHTB 2A25A 2LT7A 2EN2A 2EN3A 2EMWA 2EQ1A 4FK5C 2CT1A 1JK2A 2EM4A 2EN6A 4IJDA 2YTNA 2EQ3A 1A1KA 2EM7A 2YSPA 2PRTA 3MHHC 2YTJA 1F2IG 2D9HA 2HGHA 2YRMA 2RPCA 2EM3A 2GLIA 1A1HA 2EMGA 2WBSA 3UK3C 4R2AA 4IS1C 2ENAA 2YTFA 2J7JA 1JK1A 2DGCA 2JP9A 2ELYA 2E72A 3MHSC 1NCSA 2YTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOI A;  2JPA A;  2NAB A;  2YTD A;  4X9J A;  2EOX A;  4R2Q A;  4R2R A;  1Z1B A;  1WJP A;  2EPP A;  1KJK A;  2EPZ A;  2EE8 A;  2EM0 A;  3EPK A;  2LVH A;  2EL4 A;  2YTI A;  2EMI A;  2EOR A;  2BB8 A;  2CTD A;  2ENC A;  2R1F A;  2M9A A;  2EM9 A;  1UBD C;  2EOF A;  2LO3 A;  2LCE A;  1X6E A;  1TF6 A;  1LLM C;  4R2E A;  3M99 B;  2LV2 A;  4M9V C;  1ZAA C;  2ELZ A;  4R2P A;  1DGC A;  2YRK A;  2YTO A;  5KL5 A;  2EL6 A;  2EPU A;  2EPR A;  2MKD A;  2DLK A;  1YSA C;  1A1G A;  2MKN A;  2DLQ A;  2EN8 A;  2EOS A;  2EJ4 A;  1YUI A;  1X6F A;  2EOO A;  2EOY A;  3EPJ A;  1X3C A;  2EOM A;  1A1F A;  2EL5 A;  5KL4 A;  4F6N A;  2WBT A;  1RMD A;  4R2D A;  2EMB A;  4R2C A;  1UN6 B;  2EMH A;  5KL2 A;  2EN7 A;  1AAY A;  1BBO A;  2EN1 A;  2DMI A;  2EPC A;  3EPH A;  4R2S A;  2ADR A;  2EM6 A;  2EMZ A;  2EPA A;  1A1I A;  1A1J A;  2EN4 A;  2ENH A;  2YTP A;  2WBU A;  2DRP A;  2GHF A;  2YTQ A;  2EMK A;  2VRD A;  2EMF A;  2CSH A;  2EM2 A;  1P47 A;  2YSO A;  2YRH A;  1X6H A;  2EML A;  1G2D C;  4F6M A;  4GZN C;  2MDG A;  4WSG A;  1G2F C;  2EPX A;  1ZR9 A;  1BB8 A;  2EOJ A;  2EM8 A;  5KL6 A;  5KL3 A;  2WCC 3;  2EMC A;  2EMY A;  1TN9 A;  5KL7 A;  3EPL A;  2EM5 A;  1A1L A;  2EOQ A;  1YUJ A;  1X5W A;  1ZU1 A;  2EOE A;  4F2J C;  2RSI A;  1TF3 A;  2EOH A;  2EMX A;  2YTE A;  2EQ0 A;  2YU8 A;  1MEY C;  2YU5 A;  2EOZ A;  2EP3 A;  1B69 A;  2EMA A;  2I13 A;  3VHT B;  2A25 A;  2LT7 A;  2EN2 A;  2EN3 A;  2EMW A;  2EQ1 A;  4FK5 C;  2CT1 A;  1JK2 A;  2EM4 A;  2EN6 A;  4IJD A;  2YTN A;  2EQ3 A;  1A1K A;  2EM7 A;  2YSP A;  2PRT A;  3MHH C;  2YTJ A;  1F2I G;  2D9H A;  2HGH A;  2YRM A;  2RPC A;  2EM3 A;  2GLI A;  1A1H A;  2EMG A;  2WBS A;  3UK3 C;  4R2A A;  4IS1 C;  2ENA A;  2YTF A;  2J7J A;  1JK1 A;  2DGC A;  2JP9 A;  2ELY A;  2E72 A;  3MHS C;  1NCS A;  2YTG A; 
#chains in the Genus database with same CATH topology
 4J8Z A;  2NAB A;  4X9J A;  3HQ1 A;  4BMJ A;  2RS7 A;  2EPN A;  2EM0 A;  5AAS A;  2YT4 A;  4I8O A;  5BR8 E;  2EPO A;  2BB8 A;  2R1F A;  5LMU E;  2EM9 A;  1UBD C;  3L00 A;  2NUF A;  4DKK A;  4R2E A;  3M99 B;  2L8T A;  2HHH E;  2ELZ A;  3LML A;  2EPU A;  5AC4 A;  5A6A A;  1T4L B;  1IQO A;  2Q8U A;  4BC9 A;  1A1G A;  2LBS B;  2NUG A;  4DUY E;  4JYA E;  1YFH A;  3BBG A;  4DUZ E;  3MSW A;  4P7D A;  1X47 A;  2M4I A;  4WXD A;  4R2D A;  2B7V A;  2LMZ A;  5IWA E;  2EN7 A;  2HJJ A;  2LUQ A;  3FIG A;  3ADJ A;  3EPH A;  1KYQ A;  2ADR A;  3J7Y p;  2EPA A;  4JI6 E;  1J5E E;  2L2M A;  2JXP A;  4B3M E;  1PJS A;  2N3G A;  5A2Q C;  4DV0 E;  4LF5 E;  2MC6 A;  2EM2 A;  4DV2 E;  2YSO A;  2EML A;  4M30 A;  2YZT A;  4GZN C;  2EPX A;  1EH7 A;  4X62 E;  2EMC A;  2G7H A;  1RQ0 A;  2DMY A;  4JI3 E;  5A6J A;  2RQL A;  1A1L A;  4BC7 A;  4DR7 E;  4WXC A;  1X5W A;  3T1H E;  1O0W A;  4WPY A;  2NA2 A;  4DV3 E;  2EPM X;  3BF2 A;  1TF3 A;  5T6J A;  2EQ0 A;  1MEY C;  4YY3 E;  2F8B A;  5IT9 C;  3IWB A;  2EP3 A;  1T4N A;  2NUE A;  1GQE A;  2YWQ A;  2I13 A;  4FK5 C;  2EN6 A;  1QNT A;  2LJU A;  2HC5 A;  1YPN A;  2YSP A;  1IBK E;  2HGH A;  2KHX A;  2RPC A;  3LLH A;  4DV7 E;  2N8X A;  2V89 A;  4NXM E;  2WBS A;  2J7J A;  4WYQ B;  2DGC A;  2GPI A;  1IBL E;  3EQ1 A;  4B3T E;  1WJP A;  1SFE A;  2EPZ A;  2EE8 A;  5LMN E;  3EPK A;  2LVH A;  2E1M A;  2N3H A;  3THO B;  2EL4 A;  2EMI A;  2EOR A;  4JI1 E;  1QU6 A;  4DR5 E;  4RH8 A;  2LCE A;  2IHR 1;  2JVA A;  1LLM C;  3F6H A;  2LV2 A;  4DR4 E;  1BBG A;  4F54 A;  2B7T A;  2YRK A;  4O4K A;  5KL5 A;  2EL6 A;  2MKD A;  4ZYE A;  3KZZ A;  4N4R B;  2VF1 A;  4BBY A;  2EJ4 A;  4LF6 E;  2JR1 A;  2EOY A;  3EPJ A;  4AQY E;  3VK6 A;  2JY9 A;  1PJT A;  4WX9 A;  2L92 A;  2F4V E;  2V87 A;  2UXC E;  4F6N A;  1HNX E;  2L6M A;  4R2C A;  2VE7 C;  4GEQ B;  2L3C A;  2L33 A;  2UUA E;  2EPC A;  4L8N A;  2EM6 A;  5TSE A;  4O24 A;  2ENH A;  2DRP A;  3C4T A;  4MLQ A;  2EMF A;  5AE1 A;  2CSH A;  3HTX A;  5ADZ A;  1X6H A;  1X48 A;  1G2F C;  1ZR9 A;  1MGT A;  2EOJ A;  3ECR A;  2MDR A;  2M7Q A;  5KL3 A;  1T38 A;  3C6M A;  2RTX A;  1ZBQ A;  1T39 A;  2DSY A;  5AE3 A;  5KL7 A;  3EPL A;  2DB2 A;  2EOQ A;  5IV8 B;  1DI2 A;  4KZS A;  4ZYD A;  3ADL A;  1ZU1 A;  1FJG E;  4DR1 E;  1YZ9 A;  1PDA A;  4DR3 E;  2CPN A;  2EOH A;  2ODR D;  2YU8 A;  1B69 A;  4MLV A;  2A25 A;  2LT7 A;  2EN3 A;  2EMW A;  2EQ1 A;  1JK2 A;  5IXM B;  1XNQ E;  4TUI A;  4HEI A;  1A1K A;  4LTY A;  2PRT A;  1J26 A;  1PJQ A;  2I9I A;  2YRM A;  4GKK E;  1HNW E;  1YYK A;  4Q35 B;  3IWC A;  2ZM6 E;  2FGG A;  2UXD E;  2JP9 A;  3QG5 C;  2E72 A;  2JOB A;  3P1X A;  1UHZ A;  4JI7 E;  4NXN E;  2JPA A;  2YTD A;  2RS6 A;  3J81 C;  3VYY A;  2EPL X;  2B9D A;  4R2Q A;  4LFA E;  1Z1B A;  2EPP A;  1KJK A;  3AUZ A;  4X8W A;  4LF8 E;  2JYA A;  2CTD A;  2EOF A;  1TF6 A;  5LLQ A;  4B3R E;  1ZAA C;  2LUP B;  5F3W A;  3OML A;  2EPR A;  1XMQ E;  2MKN A;  2DLQ A;  5A6K A;  4X66 E;  1AH5 A;  3IWD A;  1GZ6 A;  4M0V A;  1X6F A;  2EOO A;  4OX9 E;  1X3C A;  1A1F A;  1ZBT A;  2BBG A;  4R03 A;  1YYO A;  4LF7 E;  2EWL A;  4DV6 E;  2WBT A;  1XNR E;  4M2Z A;  1N3G A;  3C4B A;  1BBO A;  2EN1 A;  2DMI A;  4JI8 E;  2LTS A;  4R2S A;  2VQE E;  2YTP A;  5A6B D;  2GHF A;  4L5N C;  1IBM E;  1STU A;  2V83 A;  2VRD A;  4BHB A;  5AE2 A;  4R8O A;  4DR2 E;  1N36 E;  1P47 A;  1HNZ E;  1WXR A;  2UUB E;  4F6M A;  4F9C B;  4WSG A;  2EM8 A;  2YPN A;  4HTG A;  3T1Y E;  2WCC 3;  1WHQ A;  3HXL A;  2LJH A;  4BS9 A;  1YUJ A;  3KZY A;  3AV0 A;  2EOE A;  4F2J C;  4DR6 E;  2ODR C;  2RSI A;  4F9B B;  2EMX A;  2YTE A;  4JV5 E;  2LE2 A;  1EH8 A;  2WZO A;  3VHT B;  1GTK A;  2EN2 A;  4X64 E;  3JU0 A;  2EM4 A;  3TQM A;  4BHC A;  5A6B A;  1IQS A;  2EQ3 A;  2H36 X;  4KWY A;  1RC7 A;  3BGH A;  1NEI A;  4F9A B;  3MHH C;  2YTJ A;  2D9H A;  2EM3 A;  2GLI A;  2EMG A;  3UK3 C;  4JI4 E;  2K4V A;  3THN A;  3ADI A;  1JK1 A;  2ELY A;  1SR9 A;  4Q28 A;  1YYW A;  1NCS A;  2EOI A;  4BCA A;  2KON A;  2B3T B;  3JTZ A;  2EOX A;  4R2R A;  4DV4 E;  5FLX C;  3VYX A;  1HR0 E;  2YTI A;  3BID A;  2ENC A;  2JWO A;  3ADG A;  4KHP E;  2M9A A;  4DMI A;  1IMU A;  2LO3 A;  1X6E A;  3F6G A;  2DIX A;  1WRJ A;  1T4O A;  4M9V C;  4R2P A;  1I94 E;  1DGC A;  2YTO A;  1EH6 A;  1EKZ A;  2DLK A;  1YSA C;  2E5L E;  4LF9 E;  2V88 A;  3HPS A;  2EN8 A;  2EOS A;  1YUI A;  2L3J A;  2UU9 E;  2LTR A;  2EOM A;  2MC5 A;  1PKP A;  2EL5 A;  5KL4 A;  4LF4 E;  2FV4 B;  5DNY A;  3J80 C;  4JI5 E;  1RMD A;  2R76 A;  1X49 A;  2EMB A;  4K0K E;  1UIL A;  3DF6 A;  4P78 A;  1UN6 B;  2EMH A;  4RHB B;  5KL2 A;  1AAY A;  4OOG C;  4ZYG A;  4B3S E;  3JAM C;  2K7I A;  2EMZ A;  2UUC E;  3J7A G;  1A1I A;  1A1J A;  2EN4 A;  5A69 A;  2WBU A;  2KOU A;  2YTQ A;  2EMK A;  5AC5 A;  5LL6 R;  2M1S A;  4TUG A;  3OTO E;  2UXB E;  1G2D C;  2YRH A;  4DV5 E;  2MDG A;  2V86 A;  3C6K A;  4LFB E;  4O5G A;  1BB8 A;  5KL6 A;  2L2K B;  2EMY A;  3DJW A;  1TN9 A;  1WHN A;  2EPK X;  3HPZ A;  2EM5 A;  4NZV A;  5CFF E;  3KWR A;  2L2N A;  2V85 A;  4JI0 E;  4NHR A;  2VQF E;  2YU5 A;  2EOZ A;  3H09 A;  2EZ6 A;  2EMA A;  2LRS A;  3RMP A;  4LU9 A;  4O43 A;  2CT1 A;  4X65 E;  1N32 E;  1L4S A;  1DQ3 A;  4WFT A;  4DV1 E;  4IJD A;  2YTN A;  1XMO E;  4WSP A;  4YHH E;  2V8Q B;  4LFC E;  3K6Q A;  2JOX A;  2EM7 A;  1F2I G;  2FTX B;  3ZOQ B;  1A1H A;  2RSM A;  4JI2 E;  4R2A A;  4IS1 C;  2ENA A;  2YTF A;  1N34 E;  4GKJ E;  1FKA E;  1N33 E;  3MHS C;  4ZYH A;  2YTG A; 
#chains in the Genus database with same CATH homology
 2EOI A;  2JPA A;  2NAB A;  2YTD A;  4X9J A;  2EOX A;  4R2Q A;  4R2R A;  1Z1B A;  1WJP A;  2EPP A;  1KJK A;  2EPZ A;  2EE8 A;  2EM0 A;  3EPK A;  2LVH A;  2EL4 A;  2YTI A;  2EMI A;  2EOR A;  2BB8 A;  2CTD A;  2ENC A;  2R1F A;  2M9A A;  2EM9 A;  1UBD C;  2EOF A;  2LO3 A;  2LCE A;  1X6E A;  1TF6 A;  1LLM C;  4R2E A;  3M99 B;  2LV2 A;  4M9V C;  1ZAA C;  2ELZ A;  4R2P A;  1DGC A;  2YRK A;  2YTO A;  5KL5 A;  2EL6 A;  2EPU A;  2EPR A;  2MKD A;  2DLK A;  1YSA C;  1A1G A;  2MKN A;  2DLQ A;  2EN8 A;  2EOS A;  2EJ4 A;  1YUI A;  1X6F A;  2EOO A;  2EOY A;  3EPJ A;  1X3C A;  2EOM A;  1A1F A;  2EL5 A;  5KL4 A;  4F6N A;  2WBT A;  1RMD A;  4R2D A;  2EMB A;  4R2C A;  1UN6 B;  2EMH A;  5KL2 A;  2EN7 A;  1AAY A;  1BBO A;  2EN1 A;  2DMI A;  2EPC A;  3EPH A;  4R2S A;  2ADR A;  2EM6 A;  2EMZ A;  2EPA A;  1A1I A;  1A1J A;  2EN4 A;  2ENH A;  2YTP A;  2WBU A;  2DRP A;  2GHF A;  2YTQ A;  2EMK A;  2VRD A;  2EMF A;  2CSH A;  2EM2 A;  1P47 A;  2YSO A;  2YRH A;  1X6H A;  2EML A;  1G2D C;  4F6M A;  4GZN C;  2MDG A;  4WSG A;  1G2F C;  2EPX A;  1ZR9 A;  1BB8 A;  2EOJ A;  2EM8 A;  5KL6 A;  5KL3 A;  2WCC 3;  2EMC A;  2EMY A;  1TN9 A;  5KL7 A;  3EPL A;  2EM5 A;  1A1L A;  2EOQ A;  1YUJ A;  1X5W A;  1ZU1 A;  2EOE A;  4F2J C;  2RSI A;  1TF3 A;  2EOH A;  2EMX A;  2YTE A;  2EQ0 A;  2YU8 A;  1MEY C;  2YU5 A;  2EOZ A;  2EP3 A;  1B69 A;  2EMA A;  2I13 A;  3VHT B;  2A25 A;  2LT7 A;  2EN2 A;  2EN3 A;  2EMW A;  2EQ1 A;  4FK5 C;  2CT1 A;  1JK2 A;  2EM4 A;  2EN6 A;  4IJD A;  2YTN A;  2EQ3 A;  1A1K A;  2EM7 A;  2YSP A;  2PRT A;  3MHH C;  2YTJ A;  1F2I G;  2D9H A;  2HGH A;  2YRM A;  2RPC A;  2EM3 A;  2GLI A;  1A1H A;  2EMG A;  2WBS A;  3UK3 C;  4R2A A;  4IS1 C;  2ENA A;  2YTF A;  2J7J A;  1JK1 A;  2DGC A;  2JP9 A;  2ELY A;  2E72 A;  3MHS C;  1NCS A;  2YTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...