2EN3A

Solution structure of the c2h2 type zinc finger (region 796-828) of human zinc finger protein 95 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGEKPFQCKECGMNFSWSCSLFKHLRSHERTDPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 95 homolog
publication title Solution structure of the C2H2 type zinc finger (region 796-828) of human Zinc finger protein 95 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en3A01
2WBUA 2EMZA 1Z1BA 2EJ4A 1UBDC 4R2DA 2DMIA 1KJKA 2MKNA 2DLQA 2LO3A 2M9AA 2YTFA 2ADRA 2EMHA 2EOSA 2LVHA 2YTEA 2EN7A 1ZR9A 3EPKA 4F6MA 2DRPA 1X6FA 2RPCA 2EOHA 2ELZA 1A1FA 2DLKA 2EM3A 1A1GA 2WBSA 4R2AA 2EOOA 1TN9A 5KL7A 2EM9A 5KL6A 2EOYA 5KL5A 2EM2A 2EN8A 4F6NA 1RMDA 1DGCA 2YU8A 5KL3A 2EMWA 3EPHA 2EPCA 1X6HA 2EORA 3M99B 2BB8A 2EN1A 2J7JA 2YSOA 2EMLA 3MHSC 1A1KA 2EM4A 2EQ0A 2EPXA 2HGHA 2VRDA 1A1JA 4WSGA 5KL2A 1BB8A 2ENHA 2EN3A 2LT7A 2EPZA 2NABA 2YSPA 3MHHC 1YUIA 2EMYA 2EN6A 1A1LA 3EPLA 2EOIA 2E72A 2PRTA 1JK1A 2WBTA 2EN2A 1G2DC 4R2EA 4IS1C 2YTIA 2DGCA 2EP3A 2EMAA 1TF3A 2YTOA 2EQ3A 5KL4A 2EMXA 4X9JA 2EMBA 2EL6A 2D9HA 2YRMA 4R2QA 1UN6B 1WJPA 2EM6A 1AAYA 2EOMA 2ENCA 2JP9A 1YUJA 2EMIA 1JK2A 1MEYC 2YRHA 4R2PA 2EM5A 4R2CA 4GZNC 2EL5A 2GLIA 1YSAC 4M9VC 2MKDA 2EOEA 2EPAA 1X3CA 2CT1A 1A1IA 2EQ1A 3EPJA 2YTNA 1F2IG 2EM8A 2EL4A 2LCEA 2YRKA 2ENAA 2JPAA 1A1HA 3UK3C 2CTDA 2EOJA 2R1FA 4F2JC 2I13A 2YTJA 4R2RA 2RSIA 2YTPA 2EMCA 2GHFA 2EPUA 3VHTB 1BBOA 2EE8A 1NCSA 2EN4A 2EMGA 2EM0A 2CSHA 2EPPA 2YTDA 2YTQA 4FK5C 1X5WA 2A25A 1ZU1A 1G2FC 2YU5A 2EM7A 1B69A 2LV2A 2EOZA 2EOQA 1TF6A 2EMKA 2EOXA 2MDGA 1X6EA 1ZAAC 2EMFA 1P47A 4R2SA 2YTGA 4IJDA 2EOFA 1LLMC 2EPRA 2WCC3 2ELYA
chains in the Genus database with same CATH superfamily
3THOB 3JAMC 4MLQA 4F9CB 1Z1BA 4JI6E 1UBDC 3JU0A 4BCAA 3HQ1A 3J81C 3KZYA 1EH6A 2DIXA 3MSWA 4DR5E 2ADRA 1YYOA 2EMHA 2DMYA 1ZR9A 4JI7E 4F6MA 4LF7E 1RQ0A 4BC7A 2EM3A 1A1GA 2LMZA 2EOOA 5KL7A 2YWQA 5KL5A 2EM2A 4F6NA 4LF8E 1J26A 4DV3E 2EMWA 3EPHA 1X6HA 3M99B 2BB8A 2EN1A 4O43A 2EMLA 2MC5A 4LU9A 1GQEA 3F6HA 1WRJA 2M7QA 4TUGA 2JWOA 2YZTA 4N4RB 2YSPA 1GTKA 1YUIA 1IQOA 1JK1A 4DV4E 2DGCA 2UU9E 2EMAA 1TF3A 3BGHA 3J7Yp 4DUZE 2EMXA 1T4OA 4X66E 4X9JA 2EMBA 2EL6A 2YRMA 4R2QA 4DMIA 1IQSA 2ENCA 4ZYDA 1MGTA 1N36E 2RS7A 4JI2E 4R2CA 1IBME 3J7AG 4O4KA 1YYWA 1YSAC 2IHR1 4ZYEA 2JOXA 3BF2A 1X3CA 2N3GA 1A1IA 5AE3A 3EPJA 4M2ZA 1XNRE 3HPSA 3DJWA 1A1HA 2ODRD 2K4VA 2L6MA 2HHHE 4R2RA 2RSIA 2EMCA 2L2MA 4GKKE 1IBKE 5A6AA 4NHRA 1RC7A 3VHTB 1UILA 4X62E 1BBOA 4R8OA 2LRSA 2YTDA 2KHXA 2M1SA 1N32E 2YU5A 2EOZA 2EOQA 1ZAAC 2EMFA 5LL6R 3AV0A 2EPRA 2ZM6E 4DR7E 2EJ4A 5LLQA 4X8WA 3HPZA 5IWAE 3RMPA 2R76A 2ODRC 1L4SA 2EOSA 3C6KA 4BS9A 2LBSB 4DV2E 2GPIA 2EOHA 4JI0E 2LJHA 1STUA 3VYXA 2WBSA 4R2AA 1TN9A 4BHCA 2UUCE 4BBYA 3EQ1A 2LTRA 1HNXE 4ZYGA 1DGCA 2KOUA 2VE7C 5KL3A 5TSEA 3KWRA 5LMUE 2V88A 4JV5E 2EORA 2RTXA 3VYYA 4X64E 4ZYHA 4DR2E 3ADGA 2EPXA 2HGHA 2VRDA 4WSGA 4MLVA 2ENHA 2EPZA 2EN6A 3EPLA 2I9IA 4OX9E 2E72A 5A6JA 4Q28A 3LLHA 2WBTA 4NXNE 2EPNA 4B3SE 1G2DC 1NEIA 2VF1A 2YTIA 2JY9A 2EP3A 4WXDA 5A6BD 5KL4A 5ADZA 1PJTA 1I94E 2RQLA 1UHZA 1YZ9A 2JP9A 1YUJA 2EMIA 1JK2A 4R2PA 4DV5E 4GZNC 4YY3E 2HC5A 1DI2A 4M9VC 2EOEA 2NUGA 1F2IG 4KZSA 2L3JA 2EPOA 3F6GA 4J8ZA 1QNTA 3HTXA 2R1FA 1FKAE 2I13A 4NZVA 4RHBB 4DV7E 3QG5C 4M0VA 1GZ6A 1SFEA 4X65E 2EPUA 2NUEA 2M4IA 2FV4B 2EE8A 1NCSA 2EN4A 1EKZA 2YTQA 2CSHA 3TQMA 4LF9E 4LFCE 5BR8E 2MDGA 2LJUA 2JR1A 2E1MA 4DR1E 2YTGA 3J80C 2WCC3 1EH7A 3BBGA 2WBUA 4WSPA 2L2KB 2EMZA 3ADJA 3L00A 4B3RE 3FIGA 2F4VE 2EZ6A 2DMIA 5AC4A 1KJKA 2MKNA 3OMLA 2LO3A 2M9AA 1X47A 4F54A 5IV8B 2E5LE 5AE2A 3EPKA 1ZBTA 4P78A 1A1FA 4GKJE 2WZOA 2DLKA 4JI1E 5A6BA 2HJJA 3VK6A 2NA2A 2EM9A 2UUAE 1ZBQA 2BBGA 5A6KA 1YPNA 4DUYE 2JYAA 4TUIA 2N8XA 5AE1A 2L8TA 1PJQA 1IMUA 4LFAE 2B7TA 3BIDA 1A1KA 2YSOA 2VQFE 2EM4A 1X48A 1A1JA 1BB8A 2LT7A 5A69A 2JOBA 2F8BA 1WHQA 2EMYA 1A1LA 2RS6A 2EOIA 4KWYA 2V89A 2PRTA 2YPNA 4K0KE 3C4BA 2EN2A 2V83A 2MC6A 4IS1C 5IT9C 2LUPB 4DR6E 1XMOE 2UXDE 3T1HE 5T6JA 1SR9A 2YTOA 2EQ3A 2V86A 3IWCA 5AASA 2LUQA 1UN6B 2EWLA 5CFFE 1N34E 1KYQA 2FTXB 2V8QB 1N3GA 4WPYA 2H36X 5AC5A 1MEYC 4WXCA 1T4LB 4Q35B 2EM5A 3ADLA 4DR4E 2EL5A 2JVAA 5LMNE 4O24A 1YFHA 1EH8A 2UUBE 2EPMX 4M30A 2MKDA 4GEQB 1HR0E 1J5EE 2EL4A 3LMLA 2YRKA 2ENAA 2JPAA 3UK3C 2CTDA 4F2JC 2B3TB 4L8NA 2L3CA 4BHBA 2L2NA 1N33E 4LFBE 2GHFA 2LE2A 2EMGA 2EM0A 1WXRA 3C4TA 2DB2A 1ZU1A 2Q8UA 1HNWE 2EM7A 4F9AB 5A2QC 1PKPA 4LF5E 1TF6A 2EOXA 1X6EA 1P47A 4IJDA 2EOFA 1LLMC 5DNYA 4DKKA 3AUZA 4LF4E 1AH5A 4R2DA 2DLQA 2YTFA 3JTZA 1XNQE 2LVHA 2YTEA 2EN7A 1T39A 2DRPA 1X6FA 5IXMB 2RPCA 2ELZA 4F9BB 2N3HA 2NUFA 4JI5E 2DSYA 5KL6A 2EOYA 4BC9A 1WHNA 2EN8A 2V87A 1RMDA 2YU8A 3DF6A 4JI4E 4HEIA 3IWBA 2EPCA 3THNA 4B3ME 2J7JA 3MHSC 1PJSA 2EQ0A 2L92A 1HNZE 1FJGE 4L5NC 3P1XA 4JI3E 1PDAA 5KL2A 1T4NA 2EPLX 2G7HA 2EN3A 4RH8A 4WX9A 4KHPE 2NABA 3ZOQB 3MHHC 2FGGA 2B7VA 1XMQE 2RSMA 1X49A 4R2EA 4LF6E 4WYQB 2KONA 4WFTA 4B3TE 4DV1E 3IWDA 2K7IA 4BMJA 2D9HA 2VQEE 1WJPA 2EM6A 4YHHE 5F3WA 1IBLE 4DV6E 1AAYA 2EOMA 2UXCE 3KZZA 2V85A 2YRHA 3T1YE 3OTOE 5FLXC 2GLIA 4OOGC 3K6QA 2EPAA 2CT1A 2EQ1A 3C6MA 1BBGA 2YTNA 2EM8A 3HXLA 2LCEA 3ECRA 2EPKX 1O0WA 4NXME 4AQYE 2EOJA 4LTYA 4O5GA 2JXPA 2YTJA 2YTPA 2B9DA 1T38A 1QU6A 4HTGA 2CPNA 4P7DA 4DR3E 2LTSA 3H09A 1YYKA 2L33A 4I8OA 2YT4A 1DQ3A 4DV0E 4FK5C 2EPPA 2MDRA 4JI8E 1X5WA 2A25A 1G2FC 2UXBE 1B69A 2LV2A 2EMKA 4R03A 4R2SA 4JYAE 3ADIA 2ELYA
chains in the Genus database with same CATH topology
2WBUA 2EMZA 1Z1BA 2EJ4A 1UBDC 4R2DA 2DMIA 1KJKA 2MKNA 2DLQA 2LO3A 2M9AA 2YTFA 2ADRA 2EMHA 2EOSA 2LVHA 2YTEA 2EN7A 1ZR9A 3EPKA 4F6MA 2DRPA 1X6FA 2RPCA 2EOHA 2ELZA 1A1FA 2DLKA 2EM3A 1A1GA 2WBSA 4R2AA 2EOOA 1TN9A 5KL7A 2EM9A 5KL6A 2EOYA 5KL5A 2EM2A 2EN8A 4F6NA 1RMDA 1DGCA 2YU8A 5KL3A 2EMWA 3EPHA 2EPCA 1X6HA 2EORA 3M99B 2BB8A 2EN1A 2J7JA 2YSOA 2EMLA 3MHSC 1A1KA 2EM4A 2EQ0A 2EPXA 2HGHA 2VRDA 1A1JA 4WSGA 5KL2A 1BB8A 2ENHA 2EN3A 2LT7A 2EPZA 2NABA 2YSPA 3MHHC 1YUIA 2EMYA 2EN6A 1A1LA 3EPLA 2EOIA 2E72A 2PRTA 1JK1A 2WBTA 2EN2A 1G2DC 4R2EA 4IS1C 2YTIA 2DGCA 2EP3A 2EMAA 1TF3A 2YTOA 2EQ3A 5KL4A 2EMXA 4X9JA 2EMBA 2EL6A 2D9HA 2YRMA 4R2QA 1UN6B 1WJPA 2EM6A 1AAYA 2EOMA 2ENCA 2JP9A 1YUJA 2EMIA 1JK2A 1MEYC 2YRHA 4R2PA 2EM5A 4R2CA 4GZNC 2EL5A 2GLIA 1YSAC 4M9VC 2MKDA 2EOEA 2EPAA 1X3CA 2CT1A 1A1IA 2EQ1A 3EPJA 2YTNA 1F2IG 2EM8A 2EL4A 2LCEA 2YRKA 2ENAA 2JPAA 1A1HA 3UK3C 2CTDA 2EOJA 2R1FA 4F2JC 2I13A 2YTJA 4R2RA 2RSIA 2YTPA 2EMCA 2GHFA 2EPUA 3VHTB 1BBOA 2EE8A 1NCSA 2EN4A 2EMGA 2EM0A 2CSHA 2EPPA 2YTDA 2YTQA 4FK5C 1X5WA 2A25A 1ZU1A 1G2FC 2YU5A 2EM7A 1B69A 2LV2A 2EOZA 2EOQA 1TF6A 2EMKA 2EOXA 2MDGA 1X6EA 1ZAAC 2EMFA 1P47A 4R2SA 2YTGA 4IJDA 2EOFA 1LLMC 2EPRA 2WCC3 2ELYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBU A;  2EMZ A;  1Z1B A;  2EJ4 A;  1UBD C;  4R2D A;  2DMI A;  1KJK A;  2MKN A;  2DLQ A;  2LO3 A;  2M9A A;  2YTF A;  2ADR A;  2EMH A;  2EOS A;  2LVH A;  2YTE A;  2EN7 A;  1ZR9 A;  3EPK A;  4F6M A;  2DRP A;  1X6F A;  2RPC A;  2EOH A;  2ELZ A;  1A1F A;  2DLK A;  2EM3 A;  1A1G A;  2WBS A;  4R2A A;  2EOO A;  1TN9 A;  5KL7 A;  2EM9 A;  5KL6 A;  2EOY A;  5KL5 A;  2EM2 A;  2EN8 A;  4F6N A;  1RMD A;  1DGC A;  2YU8 A;  5KL3 A;  2EMW A;  3EPH A;  2EPC A;  1X6H A;  2EOR A;  3M99 B;  2BB8 A;  2EN1 A;  2J7J A;  2YSO A;  2EML A;  3MHS C;  1A1K A;  2EM4 A;  2EQ0 A;  2EPX A;  2HGH A;  2VRD A;  1A1J A;  4WSG A;  5KL2 A;  1BB8 A;  2ENH A;  2EN3 A;  2LT7 A;  2EPZ A;  2NAB A;  2YSP A;  3MHH C;  1YUI A;  2EMY A;  2EN6 A;  1A1L A;  3EPL A;  2EOI A;  2E72 A;  2PRT A;  1JK1 A;  2WBT A;  2EN2 A;  1G2D C;  4R2E A;  4IS1 C;  2YTI A;  2DGC A;  2EP3 A;  2EMA A;  1TF3 A;  2YTO A;  2EQ3 A;  5KL4 A;  2EMX A;  4X9J A;  2EMB A;  2EL6 A;  2D9H A;  2YRM A;  4R2Q A;  1UN6 B;  1WJP A;  2EM6 A;  1AAY A;  2EOM A;  2ENC A;  2JP9 A;  1YUJ A;  2EMI A;  1JK2 A;  1MEY C;  2YRH A;  4R2P A;  2EM5 A;  4R2C A;  4GZN C;  2EL5 A;  2GLI A;  1YSA C;  4M9V C;  2MKD A;  2EOE A;  2EPA A;  1X3C A;  2CT1 A;  1A1I A;  2EQ1 A;  3EPJ A;  2YTN A;  1F2I G;  2EM8 A;  2EL4 A;  2LCE A;  2YRK A;  2ENA A;  2JPA A;  1A1H A;  3UK3 C;  2CTD A;  2EOJ A;  2R1F A;  4F2J C;  2I13 A;  2YTJ A;  4R2R A;  2RSI A;  2YTP A;  2EMC A;  2GHF A;  2EPU A;  3VHT B;  1BBO A;  2EE8 A;  1NCS A;  2EN4 A;  2EMG A;  2EM0 A;  2CSH A;  2EPP A;  2YTD A;  2YTQ A;  4FK5 C;  1X5W A;  2A25 A;  1ZU1 A;  1G2F C;  2YU5 A;  2EM7 A;  1B69 A;  2LV2 A;  2EOZ A;  2EOQ A;  1TF6 A;  2EMK A;  2EOX A;  2MDG A;  1X6E A;  1ZAA C;  2EMF A;  1P47 A;  4R2S A;  2YTG A;  4IJD A;  2EOF A;  1LLM C;  2EPR A;  2WCC 3;  2ELY A; 
#chains in the Genus database with same CATH topology
 3THO B;  3JAM C;  4MLQ A;  4F9C B;  1Z1B A;  4JI6 E;  1UBD C;  3JU0 A;  4BCA A;  3HQ1 A;  3J81 C;  3KZY A;  1EH6 A;  2DIX A;  3MSW A;  4DR5 E;  2ADR A;  1YYO A;  2EMH A;  2DMY A;  1ZR9 A;  4JI7 E;  4F6M A;  4LF7 E;  1RQ0 A;  4BC7 A;  2EM3 A;  1A1G A;  2LMZ A;  2EOO A;  5KL7 A;  2YWQ A;  5KL5 A;  2EM2 A;  4F6N A;  4LF8 E;  1J26 A;  4DV3 E;  2EMW A;  3EPH A;  1X6H A;  3M99 B;  2BB8 A;  2EN1 A;  4O43 A;  2EML A;  2MC5 A;  4LU9 A;  1GQE A;  3F6H A;  1WRJ A;  2M7Q A;  4TUG A;  2JWO A;  2YZT A;  4N4R B;  2YSP A;  1GTK A;  1YUI A;  1IQO A;  1JK1 A;  4DV4 E;  2DGC A;  2UU9 E;  2EMA A;  1TF3 A;  3BGH A;  3J7Y p;  4DUZ E;  2EMX A;  1T4O A;  4X66 E;  4X9J A;  2EMB A;  2EL6 A;  2YRM A;  4R2Q A;  4DMI A;  1IQS A;  2ENC A;  4ZYD A;  1MGT A;  1N36 E;  2RS7 A;  4JI2 E;  4R2C A;  1IBM E;  3J7A G;  4O4K A;  1YYW A;  1YSA C;  2IHR 1;  4ZYE A;  2JOX A;  3BF2 A;  1X3C A;  2N3G A;  1A1I A;  5AE3 A;  3EPJ A;  4M2Z A;  1XNR E;  3HPS A;  3DJW A;  1A1H A;  2ODR D;  2K4V A;  2L6M A;  2HHH E;  4R2R A;  2RSI A;  2EMC A;  2L2M A;  4GKK E;  1IBK E;  5A6A A;  4NHR A;  1RC7 A;  3VHT B;  1UIL A;  4X62 E;  1BBO A;  4R8O A;  2LRS A;  2YTD A;  2KHX A;  2M1S A;  1N32 E;  2YU5 A;  2EOZ A;  2EOQ A;  1ZAA C;  2EMF A;  5LL6 R;  3AV0 A;  2EPR A;  2ZM6 E;  4DR7 E;  2EJ4 A;  5LLQ A;  4X8W A;  3HPZ A;  5IWA E;  3RMP A;  2R76 A;  2ODR C;  1L4S A;  2EOS A;  3C6K A;  4BS9 A;  2LBS B;  4DV2 E;  2GPI A;  2EOH A;  4JI0 E;  2LJH A;  1STU A;  3VYX A;  2WBS A;  4R2A A;  1TN9 A;  4BHC A;  2UUC E;  4BBY A;  3EQ1 A;  2LTR A;  1HNX E;  4ZYG A;  1DGC A;  2KOU A;  2VE7 C;  5KL3 A;  5TSE A;  3KWR A;  5LMU E;  2V88 A;  4JV5 E;  2EOR A;  2RTX A;  3VYY A;  4X64 E;  4ZYH A;  4DR2 E;  3ADG A;  2EPX A;  2HGH A;  2VRD A;  4WSG A;  4MLV A;  2ENH A;  2EPZ A;  2EN6 A;  3EPL A;  2I9I A;  4OX9 E;  2E72 A;  5A6J A;  4Q28 A;  3LLH A;  2WBT A;  4NXN E;  2EPN A;  4B3S E;  1G2D C;  1NEI A;  2VF1 A;  2YTI A;  2JY9 A;  2EP3 A;  4WXD A;  5A6B D;  5KL4 A;  5ADZ A;  1PJT A;  1I94 E;  2RQL A;  1UHZ A;  1YZ9 A;  2JP9 A;  1YUJ A;  2EMI A;  1JK2 A;  4R2P A;  4DV5 E;  4GZN C;  4YY3 E;  2HC5 A;  1DI2 A;  4M9V C;  2EOE A;  2NUG A;  1F2I G;  4KZS A;  2L3J A;  2EPO A;  3F6G A;  4J8Z A;  1QNT A;  3HTX A;  2R1F A;  1FKA E;  2I13 A;  4NZV A;  4RHB B;  4DV7 E;  3QG5 C;  4M0V A;  1GZ6 A;  1SFE A;  4X65 E;  2EPU A;  2NUE A;  2M4I A;  2FV4 B;  2EE8 A;  1NCS A;  2EN4 A;  1EKZ A;  2YTQ A;  2CSH A;  3TQM A;  4LF9 E;  4LFC E;  5BR8 E;  2MDG A;  2LJU A;  2JR1 A;  2E1M A;  4DR1 E;  2YTG A;  3J80 C;  2WCC 3;  1EH7 A;  3BBG A;  2WBU A;  4WSP A;  2L2K B;  2EMZ A;  3ADJ A;  3L00 A;  4B3R E;  3FIG A;  2F4V E;  2EZ6 A;  2DMI A;  5AC4 A;  1KJK A;  2MKN A;  3OML A;  2LO3 A;  2M9A A;  1X47 A;  4F54 A;  5IV8 B;  2E5L E;  5AE2 A;  3EPK A;  1ZBT A;  4P78 A;  1A1F A;  4GKJ E;  2WZO A;  2DLK A;  4JI1 E;  5A6B A;  2HJJ A;  3VK6 A;  2NA2 A;  2EM9 A;  2UUA E;  1ZBQ A;  2BBG A;  5A6K A;  1YPN A;  4DUY E;  2JYA A;  4TUI A;  2N8X A;  5AE1 A;  2L8T A;  1PJQ A;  1IMU A;  4LFA E;  2B7T A;  3BID A;  1A1K A;  2YSO A;  2VQF E;  2EM4 A;  1X48 A;  1A1J A;  1BB8 A;  2LT7 A;  5A69 A;  2JOB A;  2F8B A;  1WHQ A;  2EMY A;  1A1L A;  2RS6 A;  2EOI A;  4KWY A;  2V89 A;  2PRT A;  2YPN A;  4K0K E;  3C4B A;  2EN2 A;  2V83 A;  2MC6 A;  4IS1 C;  5IT9 C;  2LUP B;  4DR6 E;  1XMO E;  2UXD E;  3T1H E;  5T6J A;  1SR9 A;  2YTO A;  2EQ3 A;  2V86 A;  3IWC A;  5AAS A;  2LUQ A;  1UN6 B;  2EWL A;  5CFF E;  1N34 E;  1KYQ A;  2FTX B;  2V8Q B;  1N3G A;  4WPY A;  2H36 X;  5AC5 A;  1MEY C;  4WXC A;  1T4L B;  4Q35 B;  2EM5 A;  3ADL A;  4DR4 E;  2EL5 A;  2JVA A;  5LMN E;  4O24 A;  1YFH A;  1EH8 A;  2UUB E;  2EPM X;  4M30 A;  2MKD A;  4GEQ B;  1HR0 E;  1J5E E;  2EL4 A;  3LML A;  2YRK A;  2ENA A;  2JPA A;  3UK3 C;  2CTD A;  4F2J C;  2B3T B;  4L8N A;  2L3C A;  4BHB A;  2L2N A;  1N33 E;  4LFB E;  2GHF A;  2LE2 A;  2EMG A;  2EM0 A;  1WXR A;  3C4T A;  2DB2 A;  1ZU1 A;  2Q8U A;  1HNW E;  2EM7 A;  4F9A B;  5A2Q C;  1PKP A;  4LF5 E;  1TF6 A;  2EOX A;  1X6E A;  1P47 A;  4IJD A;  2EOF A;  1LLM C;  5DNY A;  4DKK A;  3AUZ A;  4LF4 E;  1AH5 A;  4R2D A;  2DLQ A;  2YTF A;  3JTZ A;  1XNQ E;  2LVH A;  2YTE A;  2EN7 A;  1T39 A;  2DRP A;  1X6F A;  5IXM B;  2RPC A;  2ELZ A;  4F9B B;  2N3H A;  2NUF A;  4JI5 E;  2DSY A;  5KL6 A;  2EOY A;  4BC9 A;  1WHN A;  2EN8 A;  2V87 A;  1RMD A;  2YU8 A;  3DF6 A;  4JI4 E;  4HEI A;  3IWB A;  2EPC A;  3THN A;  4B3M E;  2J7J A;  3MHS C;  1PJS A;  2EQ0 A;  2L92 A;  1HNZ E;  1FJG E;  4L5N C;  3P1X A;  4JI3 E;  1PDA A;  5KL2 A;  1T4N A;  2EPL X;  2G7H A;  2EN3 A;  4RH8 A;  4WX9 A;  4KHP E;  2NAB A;  3ZOQ B;  3MHH C;  2FGG A;  2B7V A;  1XMQ E;  2RSM A;  1X49 A;  4R2E A;  4LF6 E;  4WYQ B;  2KON A;  4WFT A;  4B3T E;  4DV1 E;  3IWD A;  2K7I A;  4BMJ A;  2D9H A;  2VQE E;  1WJP A;  2EM6 A;  4YHH E;  5F3W A;  1IBL E;  4DV6 E;  1AAY A;  2EOM A;  2UXC E;  3KZZ A;  2V85 A;  2YRH A;  3T1Y E;  3OTO E;  5FLX C;  2GLI A;  4OOG C;  3K6Q A;  2EPA A;  2CT1 A;  2EQ1 A;  3C6M A;  1BBG A;  2YTN A;  2EM8 A;  3HXL A;  2LCE A;  3ECR A;  2EPK X;  1O0W A;  4NXM E;  4AQY E;  2EOJ A;  4LTY A;  4O5G A;  2JXP A;  2YTJ A;  2YTP A;  2B9D A;  1T38 A;  1QU6 A;  4HTG A;  2CPN A;  4P7D A;  4DR3 E;  2LTS A;  3H09 A;  1YYK A;  2L33 A;  4I8O A;  2YT4 A;  1DQ3 A;  4DV0 E;  4FK5 C;  2EPP A;  2MDR A;  4JI8 E;  1X5W A;  2A25 A;  1G2F C;  2UXB E;  1B69 A;  2LV2 A;  2EMK A;  4R03 A;  4R2S A;  4JYA E;  3ADI A;  2ELY A; 
#chains in the Genus database with same CATH homology
 2WBU A;  2EMZ A;  1Z1B A;  2EJ4 A;  1UBD C;  4R2D A;  2DMI A;  1KJK A;  2MKN A;  2DLQ A;  2LO3 A;  2M9A A;  2YTF A;  2ADR A;  2EMH A;  2EOS A;  2LVH A;  2YTE A;  2EN7 A;  1ZR9 A;  3EPK A;  4F6M A;  2DRP A;  1X6F A;  2RPC A;  2EOH A;  2ELZ A;  1A1F A;  2DLK A;  2EM3 A;  1A1G A;  2WBS A;  4R2A A;  2EOO A;  1TN9 A;  5KL7 A;  2EM9 A;  5KL6 A;  2EOY A;  5KL5 A;  2EM2 A;  2EN8 A;  4F6N A;  1RMD A;  1DGC A;  2YU8 A;  5KL3 A;  2EMW A;  3EPH A;  2EPC A;  1X6H A;  2EOR A;  3M99 B;  2BB8 A;  2EN1 A;  2J7J A;  2YSO A;  2EML A;  3MHS C;  1A1K A;  2EM4 A;  2EQ0 A;  2EPX A;  2HGH A;  2VRD A;  1A1J A;  4WSG A;  5KL2 A;  1BB8 A;  2ENH A;  2EN3 A;  2LT7 A;  2EPZ A;  2NAB A;  2YSP A;  3MHH C;  1YUI A;  2EMY A;  2EN6 A;  1A1L A;  3EPL A;  2EOI A;  2E72 A;  2PRT A;  1JK1 A;  2WBT A;  2EN2 A;  1G2D C;  4R2E A;  4IS1 C;  2YTI A;  2DGC A;  2EP3 A;  2EMA A;  1TF3 A;  2YTO A;  2EQ3 A;  5KL4 A;  2EMX A;  4X9J A;  2EMB A;  2EL6 A;  2D9H A;  2YRM A;  4R2Q A;  1UN6 B;  1WJP A;  2EM6 A;  1AAY A;  2EOM A;  2ENC A;  2JP9 A;  1YUJ A;  2EMI A;  1JK2 A;  1MEY C;  2YRH A;  4R2P A;  2EM5 A;  4R2C A;  4GZN C;  2EL5 A;  2GLI A;  1YSA C;  4M9V C;  2MKD A;  2EOE A;  2EPA A;  1X3C A;  2CT1 A;  1A1I A;  2EQ1 A;  3EPJ A;  2YTN A;  1F2I G;  2EM8 A;  2EL4 A;  2LCE A;  2YRK A;  2ENA A;  2JPA A;  1A1H A;  3UK3 C;  2CTD A;  2EOJ A;  2R1F A;  4F2J C;  2I13 A;  2YTJ A;  4R2R A;  2RSI A;  2YTP A;  2EMC A;  2GHF A;  2EPU A;  3VHT B;  1BBO A;  2EE8 A;  1NCS A;  2EN4 A;  2EMG A;  2EM0 A;  2CSH A;  2EPP A;  2YTD A;  2YTQ A;  4FK5 C;  1X5W A;  2A25 A;  1ZU1 A;  1G2F C;  2YU5 A;  2EM7 A;  1B69 A;  2LV2 A;  2EOZ A;  2EOQ A;  1TF6 A;  2EMK A;  2EOX A;  2MDG A;  1X6E A;  1ZAA C;  2EMF A;  1P47 A;  4R2S A;  2YTG A;  4IJD A;  2EOF A;  1LLM C;  2EPR A;  2WCC 3;  2ELY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...