2EN3A

Solution structure of the c2h2 type zinc finger (region 796-828) of human zinc finger protein 95 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
GSSGSSGTGEKPFQCKECGMNFSWSCSLFKHLRSHERTDPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 796-828) of human Zinc finger protein 95 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 95 homolog
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en3A01
2EPXA 4R2RA 1G2FC 2EORA 2A25A 2EM8A 1AAYA 2EM5A 4WSGA 2EM0A 2DMIA 1X5WA 2EM2A 1TF3A 1A1FA 2MKDA 2BB8A 2ENHA 2ELYA 2LV2A 2EMGA 2YRKA 1X6HA 2DRPA 1YUIA 3UK3C 2R1FA 2EMCA 2MDGA 4R2CA 2EOFA 4R2SA 4IS1C 1JK2A 2YRMA 2YU5A 1YUJA 2EPAA 2EN3A 1ZAAC 4R2QA 2EMIA 2EOOA 4F6NA 4R2PA 2EOIA 5KL4A 2EE8A 2EN7A 2EN1A 2EMLA 2DLQA 1TF6A 2YRHA 2YTJA 2EMFA 5KL5A 1A1JA 2EPUA 2GLIA 1ZU1A 2EM7A 3VHTB 2YSOA 1Z1BA 2EM3A 2EN2A 1MEYC 2EMAA 2EOZA 2CT1A 2M9AA 2WBTA 2PRTA 2EP3A 1UBDC 2ENAA 2D9HA 2LCEA 3EPLA 2EN8A 2EOYA 2GHFA 1RMDA 2EM9A 2EOQA 1B69A 3MHSC 2LVHA 2EL6A 2EOJA 2YTFA 4R2EA 4GZNC 4FK5C 1NCSA 2JPAA 2J7JA 2EOXA 1A1IA 2EQ1A 2EMWA 2EM6A 1YSAC 1BB8A 4M9VC 3EPHA 5KL6A 4F6MA 1ZR9A 2ADRA 2WBUA 2YTIA 2EMBA 2EL5A 2E72A 2EOSA 5KL3A 2EPCA 2CTDA 2EMZA 2RPCA 1G2DC 2EOEA 2EPRA 2EOHA 4F2JC 2RSIA 3EPJA 5KL7A 4R2DA 1DGCA 2ELZA 2EMXA 1X3CA 2YTPA 1TN9A 2EQ3A 2LO3A 2ENCA 2EPZA 1P47A 2MKNA 4R2AA 1A1KA 2WBSA 1X6FA 1JK1A 2EMYA 2EL4A 2YTDA 4IJDA 1UN6B 1BBOA 2YTNA 1KJKA 2YSPA 2NABA 2EM4A 1A1LA 2HGHA 3M99B 2EMHA 1LLMC 2VRDA 2EJ4A 2EMKA 1X6EA 2WCC3 2EN6A 2EQ0A 2DGCA 3MHHC 1WJPA 1F2IG 1A1HA 2YTQA 4X9JA 2DLKA 2LT7A 2EN4A 2JP9A 2YTGA 5KL2A 3EPKA 2EOMA 2YU8A 1A1GA 2I13A 2YTEA 2EPPA 2CSHA 2YTOA
chains in the Genus database with same CATH superfamily
2EPXA 3HTXA 4JI3E 2B9DA 1YYWA 3C6MA 3DF6A 2EM8A 2JXPA 4F9BB 3JTZA 2EM0A 2L8TA 1T38A 4LF4E 1ZBTA 1SFEA 2ELYA 2EWLA 2M7QA 2NA2A 2KOUA 1J26A 2EZ6A 1JK2A 1SR9A 2EOOA 3IWCA 4JI4E 2LE2A 1HR0E 5AE2A 4OX9E 2DLQA 2FGGA 3IWBA 3F6GA 2EPUA 2GLIA 1ZU1A 2V85A 3VHTB 2I9IA 3FIGA 2GPIA 2ODRC 2YSOA 1MGTA 2VF1A 1YYOA 5FLXC 1WRJA 3J80C 1YFHA 2WBTA 1N34E 1T4NA 5AC5A 2EP3A 2H36X 2B7VA 2GHFA 4RH8A 1B69A 4BHCA 3MHSC 2LVHA 1XNRE 2EOJA 1RQ0A 1EKZA 1KYQA 4ZYDA 5LLQA 4NXNE 2HJJA 4MLVA 1WXRA 2J7JA 4JI2E 2EOXA 3BBGA 1YSAC 3EPHA 4F6MA 4WYQB 5IWAE 4DV1E 1IBKE 2WBUA 2RTXA 2EPMX 2YTIA 4LF6E 1DQ3A 1X47A 2EPCA 2CTDA 2LRSA 3J81C 2EMZA 2RPCA 2EOEA 2RS6A 1DGCA 2ELZA 1X3CA 1X49A 1N36E 1I94E 2MDRA 4DR6E 4LTYA 2MKNA 4LFAE 1JK1A 2YTDA 2UXCE 4HTGA 4RHBB 4LF8E 2EMHA 5A6BA 2EQ0A 3HQ1A 3ADLA 1UILA 1F2IG 4JI0E 4HEIA 4F9CB 3EQ1A 1HNZE 1IMUA 2KONA 3J7AG 2YTEA 2JOBA 4ZYHA 4Q35B 4AQYE 2N3HA 2L2MA 3ADJA 2A25A 3DJWA 2LTSA 3C4BA 2DMIA 2JR1A 2EMGA 1X6HA 4NZVA 2VQEE 2EMCA 2MDGA 2LUPB 4DKKA 5DNYA 1IBLE 2YU5A 1YUJA 2EPAA 1GTKA 2EN3A 4DR1E 4F6NA 4LFBE 2EN1A 2UUBE 4R8OA 2EMLA 4F54A 4M2ZA 3H09A 2YRHA 2DB2A 2ZM6E 2YT4A 3L00A 2LJHA 4J8ZA 2LUQA 2EPLX 4DR5E 4DV2E 3ECRA 2EN2A 3T1YE 2EMAA 2L3JA 2M9AA 1FKAE 1UBDC 1GQEA 2ENAA 2K4VA 2BBGA 3LLHA 2M1SA 4GZNC 4FK5C 2JPAA 4KHPE 5F3WA 3OTOE 2Q8UA 2E5LE 4DUYE 3VYYA 1BB8A 3THOB 1FJGE 2B3TB 3KZYA 2MC6A 2EMBA 2EL5A 2E72A 2V89A 1G2DC 2EPNA 4JI7E 2V88A 3EPJA 4R2DA 1BBGA 4ZYGA 4X64E 1TN9A 4O24A 3JU0A 1STUA 2EPZA 5A6AA 3MSWA 1PKPA 2L2KB 2EL4A 1QU6A 1UN6B 4JV5E 2FV4B 1KJKA 2YSPA 2LMZA 1A1LA 4LF7E 2R76A 3M99B 3IWDA 4X66E 2EJ4A 4DV0E 4DR2E 4DV6E 2EMKA 2WCC3 2EN6A 1X48A 2YZTA 4NHRA 2DIXA 2DGCA 3HPSA 2NUEA 2LT7A 3EPKA 2EOMA 2L2NA 2EPKX 2MC5A 4GKKE 4KZSA 2V8QB 4WSPA 3ZOQB 2CPNA 4R2RA 2L3CA 1N3GA 2LBSB 4BC9A 4MLQA 1QNTA 2EORA 3KWRA 4B3TE 4L8NA 4Q28A 2EM5A 1YZ9A 2VE7C 1X5WA 2EM2A 4DMIA 1TF3A 2M4IA 2BB8A 1YPNA 2JWOA 1GZ6A 2LV2A 3ADIA 5IXMB 3UK3C 2R1FA 2EOFA 1PJSA 4IS1C 1ZAAC 4R2QA 4R2PA 2EOIA 5KL4A 2IHR1 2EN7A 1EH8A 1TF6A 5KL5A 2YTJA 2EMFA 5A69A 4BC7A 4LFCE 2V86A 2EM7A 5T6JA 1MEYC 4X65E 4X8WA 3LMLA 4O5GA 2E1MA 3EPLA 2KHXA 4BS9A 4N4RB 1RMDA 2EM9A 2EOQA 1AH5A 3AUZA 4JYAE 3OMLA 5CFFE 2UU9E 1NCSA 4M30A 2LJUA 3BGHA 4DR4E 2EMWA 1T4LB 1ZR9A 2ADRA 1IQSA 2N3GA 2EOSA 5KL3A 4JI6E 2HC5A 2RS7A 2EPRA 2EOHA 2RSMA 2RSIA 2UUCE 2UUAE 5KL7A 4DV7E 1T4OA 4BCAA 4BMJA 2B7TA 4TUIA 5LMUE 2EQ3A 1HNXE 4JI5E 5AE3A 1DI2A 1P47A 5TSEA 4R2AA 3C6KA 4O43A 1X6FA 2WBSA 2V87A 1NEIA 1BBOA 5LL6R 2NABA 1LLMC 2VRDA 2DMYA 3F6HA 4GEQB 2G7HA 1X6EA 4B3SE 4WFTA 2YPNA 2NUGA 3HPZA 3MHHC 5BR8E 4WPYA 2L6MA 4X62E 2EN4A 3HXLA 3P1XA 3RMPA 1PDAA 2VQFE 2YU8A 1A1GA 3ADGA 2EPPA 2CSHA 4DV4E 1G2FC 3C4TA 4LF5E 1XMOE 1AAYA 4I8OA 4WSGA 4OOGC 1EH6A 2JY9A 5AASA 2F4VE 1A1FA 2MKDA 2ENHA 5IV8B 2YRKA 2DRPA 2YWQA 3AV0A 1YUIA 4R2CA 4R2SA 2YRMA 1WHQA 1T39A 2EMIA 3BIDA 5A6KA 4JI1E 2K7IA 2EE8A 1N33E 2ODRD 4WXCA 1YYKA 2L92A 4F9AB 1A1JA 4TUGA 3VK6A 2F8BA 4R03A 4BHBA 2LTRA 1UHZA 1Z1BA 4LU9A 2UXBE 2EPOA 2EM3A 2EOZA 1N32E 4L5NC 2CT1A 4O4KA 3THNA 2PRTA 1EH7A 1ZBQA 4KWYA 4JI8E 3VYXA 2D9HA 2LCEA 4YY3E 2EN8A 2EOYA 2N8XA 4DR7E 2EL6A 4WXDA 2YTFA 4R2EA 5AE1A 5LMNE 4DUZE 1XMQE 4P78A 1HNWE 1WHNA 1J5EE 1A1IA 2EQ1A 2EM6A 5A6BD 4M9VC 2DSYA 5KL6A 4YHHE 2FTXB 3K6QA 2JVAA 4F2JC 5A2QC 2L33A 1PJTA 3QG5C 4B3ME 5AC4A 4DV5E 4BBYA 2EMXA 2V83A 2YTPA 2LO3A 4DV3E 2ENCA 2HHHE 2NUFA 3T1HE 2JOXA 1A1KA 1RC7A 4ZYEA 2EMYA 4NXME 4IJDA 2YTNA 4B3RE 4GKJE 5ADZA 2EM4A 2JYAA 4DR3E 2HGHA 4P7DA 3J7Yp 4LF9E 1XNQE 3JAMC 2UXDE 1O0WA 3KZZA 1WJPA 1PJQA 2YTQA 1A1HA 4X9JA 2DLKA 4WX9A 2JP9A 2YTGA 5KL2A 2WZOA 2RQLA 1IBME 1IQOA 2I13A 1L4SA 4M0VA 3TQMA 5IT9C 5A6JA 3BF2A 4K0KE 2YTOA
chains in the Genus database with same CATH topology
2EPXA 4R2RA 1G2FC 2EORA 2A25A 2EM8A 1AAYA 2EM5A 4WSGA 2EM0A 2DMIA 1X5WA 2EM2A 1TF3A 1A1FA 2MKDA 2BB8A 2ENHA 2ELYA 2LV2A 2EMGA 2YRKA 1X6HA 2DRPA 1YUIA 3UK3C 2R1FA 2EMCA 2MDGA 4R2CA 2EOFA 4R2SA 4IS1C 1JK2A 2YRMA 2YU5A 1YUJA 2EPAA 2EN3A 1ZAAC 4R2QA 2EMIA 2EOOA 4F6NA 4R2PA 2EOIA 5KL4A 2EE8A 2EN7A 2EN1A 2EMLA 2DLQA 1TF6A 2YRHA 2YTJA 2EMFA 5KL5A 1A1JA 2EPUA 2GLIA 1ZU1A 2EM7A 3VHTB 2YSOA 1Z1BA 2EM3A 2EN2A 1MEYC 2EMAA 2EOZA 2CT1A 2M9AA 2WBTA 2PRTA 2EP3A 1UBDC 2ENAA 2D9HA 2LCEA 3EPLA 2EN8A 2EOYA 2GHFA 1RMDA 2EM9A 2EOQA 1B69A 3MHSC 2LVHA 2EL6A 2EOJA 2YTFA 4R2EA 4GZNC 4FK5C 1NCSA 2JPAA 2J7JA 2EOXA 1A1IA 2EQ1A 2EMWA 2EM6A 1YSAC 1BB8A 4M9VC 3EPHA 5KL6A 4F6MA 1ZR9A 2ADRA 2WBUA 2YTIA 2EMBA 2EL5A 2E72A 2EOSA 5KL3A 2EPCA 2CTDA 2EMZA 2RPCA 1G2DC 2EOEA 2EPRA 2EOHA 4F2JC 2RSIA 3EPJA 5KL7A 4R2DA 1DGCA 2ELZA 2EMXA 1X3CA 2YTPA 1TN9A 2EQ3A 2LO3A 2ENCA 2EPZA 1P47A 2MKNA 4R2AA 1A1KA 2WBSA 1X6FA 1JK1A 2EMYA 2EL4A 2YTDA 4IJDA 1UN6B 1BBOA 2YTNA 1KJKA 2YSPA 2NABA 2EM4A 1A1LA 2HGHA 3M99B 2EMHA 1LLMC 2VRDA 2EJ4A 2EMKA 1X6EA 2WCC3 2EN6A 2EQ0A 2DGCA 3MHHC 1WJPA 1F2IG 1A1HA 2YTQA 4X9JA 2DLKA 2LT7A 2EN4A 2JP9A 2YTGA 5KL2A 3EPKA 2EOMA 2YU8A 1A1GA 2I13A 2YTEA 2EPPA 2CSHA 2YTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPX A;  4R2R A;  1G2F C;  2EOR A;  2A25 A;  2EM8 A;  1AAY A;  2EM5 A;  4WSG A;  2EM0 A;  2DMI A;  1X5W A;  2EM2 A;  1TF3 A;  1A1F A;  2MKD A;  2BB8 A;  2ENH A;  2ELY A;  2LV2 A;  2EMG A;  2YRK A;  1X6H A;  2DRP A;  1YUI A;  3UK3 C;  2R1F A;  2EMC A;  2MDG A;  4R2C A;  2EOF A;  4R2S A;  4IS1 C;  1JK2 A;  2YRM A;  2YU5 A;  1YUJ A;  2EPA A;  2EN3 A;  1ZAA C;  4R2Q A;  2EMI A;  2EOO A;  4F6N A;  4R2P A;  2EOI A;  5KL4 A;  2EE8 A;  2EN7 A;  2EN1 A;  2EML A;  2DLQ A;  1TF6 A;  2YRH A;  2YTJ A;  2EMF A;  5KL5 A;  1A1J A;  2EPU A;  2GLI A;  1ZU1 A;  2EM7 A;  3VHT B;  2YSO A;  1Z1B A;  2EM3 A;  2EN2 A;  1MEY C;  2EMA A;  2EOZ A;  2CT1 A;  2M9A A;  2WBT A;  2PRT A;  2EP3 A;  1UBD C;  2ENA A;  2D9H A;  2LCE A;  3EPL A;  2EN8 A;  2EOY A;  2GHF A;  1RMD A;  2EM9 A;  2EOQ A;  1B69 A;  3MHS C;  2LVH A;  2EL6 A;  2EOJ A;  2YTF A;  4R2E A;  4GZN C;  4FK5 C;  1NCS A;  2JPA A;  2J7J A;  2EOX A;  1A1I A;  2EQ1 A;  2EMW A;  2EM6 A;  1YSA C;  1BB8 A;  4M9V C;  3EPH A;  5KL6 A;  4F6M A;  1ZR9 A;  2ADR A;  2WBU A;  2YTI A;  2EMB A;  2EL5 A;  2E72 A;  2EOS A;  5KL3 A;  2EPC A;  2CTD A;  2EMZ A;  2RPC A;  1G2D C;  2EOE A;  2EPR A;  2EOH A;  4F2J C;  2RSI A;  3EPJ A;  5KL7 A;  4R2D A;  1DGC A;  2ELZ A;  2EMX A;  1X3C A;  2YTP A;  1TN9 A;  2EQ3 A;  2LO3 A;  2ENC A;  2EPZ A;  1P47 A;  2MKN A;  4R2A A;  1A1K A;  2WBS A;  1X6F A;  1JK1 A;  2EMY A;  2EL4 A;  2YTD A;  4IJD A;  1UN6 B;  1BBO A;  2YTN A;  1KJK A;  2YSP A;  2NAB A;  2EM4 A;  1A1L A;  2HGH A;  3M99 B;  2EMH A;  1LLM C;  2VRD A;  2EJ4 A;  2EMK A;  1X6E A;  2WCC 3;  2EN6 A;  2EQ0 A;  2DGC A;  3MHH C;  1WJP A;  1F2I G;  1A1H A;  2YTQ A;  4X9J A;  2DLK A;  2LT7 A;  2EN4 A;  2JP9 A;  2YTG A;  5KL2 A;  3EPK A;  2EOM A;  2YU8 A;  1A1G A;  2I13 A;  2YTE A;  2EPP A;  2CSH A;  2YTO A; 
#chains in the Genus database with same CATH topology
 2EPX A;  3HTX A;  4JI3 E;  2B9D A;  1YYW A;  3C6M A;  3DF6 A;  2EM8 A;  2JXP A;  4F9B B;  3JTZ A;  2EM0 A;  2L8T A;  1T38 A;  4LF4 E;  1ZBT A;  1SFE A;  2ELY A;  2EWL A;  2M7Q A;  2NA2 A;  2KOU A;  1J26 A;  2EZ6 A;  1JK2 A;  1SR9 A;  2EOO A;  3IWC A;  4JI4 E;  2LE2 A;  1HR0 E;  5AE2 A;  4OX9 E;  2DLQ A;  2FGG A;  3IWB A;  3F6G A;  2EPU A;  2GLI A;  1ZU1 A;  2V85 A;  3VHT B;  2I9I A;  3FIG A;  2GPI A;  2ODR C;  2YSO A;  1MGT A;  2VF1 A;  1YYO A;  5FLX C;  1WRJ A;  3J80 C;  1YFH A;  2WBT A;  1N34 E;  1T4N A;  5AC5 A;  2EP3 A;  2H36 X;  2B7V A;  2GHF A;  4RH8 A;  1B69 A;  4BHC A;  3MHS C;  2LVH A;  1XNR E;  2EOJ A;  1RQ0 A;  1EKZ A;  1KYQ A;  4ZYD A;  5LLQ A;  4NXN E;  2HJJ A;  4MLV A;  1WXR A;  2J7J A;  4JI2 E;  2EOX A;  3BBG A;  1YSA C;  3EPH A;  4F6M A;  4WYQ B;  5IWA E;  4DV1 E;  1IBK E;  2WBU A;  2RTX A;  2EPM X;  2YTI A;  4LF6 E;  1DQ3 A;  1X47 A;  2EPC A;  2CTD A;  2LRS A;  3J81 C;  2EMZ A;  2RPC A;  2EOE A;  2RS6 A;  1DGC A;  2ELZ A;  1X3C A;  1X49 A;  1N36 E;  1I94 E;  2MDR A;  4DR6 E;  4LTY A;  2MKN A;  4LFA E;  1JK1 A;  2YTD A;  2UXC E;  4HTG A;  4RHB B;  4LF8 E;  2EMH A;  5A6B A;  2EQ0 A;  3HQ1 A;  3ADL A;  1UIL A;  1F2I G;  4JI0 E;  4HEI A;  4F9C B;  3EQ1 A;  1HNZ E;  1IMU A;  2KON A;  3J7A G;  2YTE A;  2JOB A;  4ZYH A;  4Q35 B;  4AQY E;  2N3H A;  2L2M A;  3ADJ A;  2A25 A;  3DJW A;  2LTS A;  3C4B A;  2DMI A;  2JR1 A;  2EMG A;  1X6H A;  4NZV A;  2VQE E;  2EMC A;  2MDG A;  2LUP B;  4DKK A;  5DNY A;  1IBL E;  2YU5 A;  1YUJ A;  2EPA A;  1GTK A;  2EN3 A;  4DR1 E;  4F6N A;  4LFB E;  2EN1 A;  2UUB E;  4R8O A;  2EML A;  4F54 A;  4M2Z A;  3H09 A;  2YRH A;  2DB2 A;  2ZM6 E;  2YT4 A;  3L00 A;  2LJH A;  4J8Z A;  2LUQ A;  2EPL X;  4DR5 E;  4DV2 E;  3ECR A;  2EN2 A;  3T1Y E;  2EMA A;  2L3J A;  2M9A A;  1FKA E;  1UBD C;  1GQE A;  2ENA A;  2K4V A;  2BBG A;  3LLH A;  2M1S A;  4GZN C;  4FK5 C;  2JPA A;  4KHP E;  5F3W A;  3OTO E;  2Q8U A;  2E5L E;  4DUY E;  3VYY A;  1BB8 A;  3THO B;  1FJG E;  2B3T B;  3KZY A;  2MC6 A;  2EMB A;  2EL5 A;  2E72 A;  2V89 A;  1G2D C;  2EPN A;  4JI7 E;  2V88 A;  3EPJ A;  4R2D A;  1BBG A;  4ZYG A;  4X64 E;  1TN9 A;  4O24 A;  3JU0 A;  1STU A;  2EPZ A;  5A6A A;  3MSW A;  1PKP A;  2L2K B;  2EL4 A;  1QU6 A;  1UN6 B;  4JV5 E;  2FV4 B;  1KJK A;  2YSP A;  2LMZ A;  1A1L A;  4LF7 E;  2R76 A;  3M99 B;  3IWD A;  4X66 E;  2EJ4 A;  4DV0 E;  4DR2 E;  4DV6 E;  2EMK A;  2WCC 3;  2EN6 A;  1X48 A;  2YZT A;  4NHR A;  2DIX A;  2DGC A;  3HPS A;  2NUE A;  2LT7 A;  3EPK A;  2EOM A;  2L2N A;  2EPK X;  2MC5 A;  4GKK E;  4KZS A;  2V8Q B;  4WSP A;  3ZOQ B;  2CPN A;  4R2R A;  2L3C A;  1N3G A;  2LBS B;  4BC9 A;  4MLQ A;  1QNT A;  2EOR A;  3KWR A;  4B3T E;  4L8N A;  4Q28 A;  2EM5 A;  1YZ9 A;  2VE7 C;  1X5W A;  2EM2 A;  4DMI A;  1TF3 A;  2M4I A;  2BB8 A;  1YPN A;  2JWO A;  1GZ6 A;  2LV2 A;  3ADI A;  5IXM B;  3UK3 C;  2R1F A;  2EOF A;  1PJS A;  4IS1 C;  1ZAA C;  4R2Q A;  4R2P A;  2EOI A;  5KL4 A;  2IHR 1;  2EN7 A;  1EH8 A;  1TF6 A;  5KL5 A;  2YTJ A;  2EMF A;  5A69 A;  4BC7 A;  4LFC E;  2V86 A;  2EM7 A;  5T6J A;  1MEY C;  4X65 E;  4X8W A;  3LML A;  4O5G A;  2E1M A;  3EPL A;  2KHX A;  4BS9 A;  4N4R B;  1RMD A;  2EM9 A;  2EOQ A;  1AH5 A;  3AUZ A;  4JYA E;  3OML A;  5CFF E;  2UU9 E;  1NCS A;  4M30 A;  2LJU A;  3BGH A;  4DR4 E;  2EMW A;  1T4L B;  1ZR9 A;  2ADR A;  1IQS A;  2N3G A;  2EOS A;  5KL3 A;  4JI6 E;  2HC5 A;  2RS7 A;  2EPR A;  2EOH A;  2RSM A;  2RSI A;  2UUC E;  2UUA E;  5KL7 A;  4DV7 E;  1T4O A;  4BCA A;  4BMJ A;  2B7T A;  4TUI A;  5LMU E;  2EQ3 A;  1HNX E;  4JI5 E;  5AE3 A;  1DI2 A;  1P47 A;  5TSE A;  4R2A A;  3C6K A;  4O43 A;  1X6F A;  2WBS A;  2V87 A;  1NEI A;  1BBO A;  5LL6 R;  2NAB A;  1LLM C;  2VRD A;  2DMY A;  3F6H A;  4GEQ B;  2G7H A;  1X6E A;  4B3S E;  4WFT A;  2YPN A;  2NUG A;  3HPZ A;  3MHH C;  5BR8 E;  4WPY A;  2L6M A;  4X62 E;  2EN4 A;  3HXL A;  3P1X A;  3RMP A;  1PDA A;  2VQF E;  2YU8 A;  1A1G A;  3ADG A;  2EPP A;  2CSH A;  4DV4 E;  1G2F C;  3C4T A;  4LF5 E;  1XMO E;  1AAY A;  4I8O A;  4WSG A;  4OOG C;  1EH6 A;  2JY9 A;  5AAS A;  2F4V E;  1A1F A;  2MKD A;  2ENH A;  5IV8 B;  2YRK A;  2DRP A;  2YWQ A;  3AV0 A;  1YUI A;  4R2C A;  4R2S A;  2YRM A;  1WHQ A;  1T39 A;  2EMI A;  3BID A;  5A6K A;  4JI1 E;  2K7I A;  2EE8 A;  1N33 E;  2ODR D;  4WXC A;  1YYK A;  2L92 A;  4F9A B;  1A1J A;  4TUG A;  3VK6 A;  2F8B A;  4R03 A;  4BHB A;  2LTR A;  1UHZ A;  1Z1B A;  4LU9 A;  2UXB E;  2EPO A;  2EM3 A;  2EOZ A;  1N32 E;  4L5N C;  2CT1 A;  4O4K A;  3THN A;  2PRT A;  1EH7 A;  1ZBQ A;  4KWY A;  4JI8 E;  3VYX A;  2D9H A;  2LCE A;  4YY3 E;  2EN8 A;  2EOY A;  2N8X A;  4DR7 E;  2EL6 A;  4WXD A;  2YTF A;  4R2E A;  5AE1 A;  5LMN E;  4DUZ E;  1XMQ E;  4P78 A;  1HNW E;  1WHN A;  1J5E E;  1A1I A;  2EQ1 A;  2EM6 A;  5A6B D;  4M9V C;  2DSY A;  5KL6 A;  4YHH E;  2FTX B;  3K6Q A;  2JVA A;  4F2J C;  5A2Q C;  2L33 A;  1PJT A;  3QG5 C;  4B3M E;  5AC4 A;  4DV5 E;  4BBY A;  2EMX A;  2V83 A;  2YTP A;  2LO3 A;  4DV3 E;  2ENC A;  2HHH E;  2NUF A;  3T1H E;  2JOX A;  1A1K A;  1RC7 A;  4ZYE A;  2EMY A;  4NXM E;  4IJD A;  2YTN A;  4B3R E;  4GKJ E;  5ADZ A;  2EM4 A;  2JYA A;  4DR3 E;  2HGH A;  4P7D A;  3J7Y p;  4LF9 E;  1XNQ E;  3JAM C;  2UXD E;  1O0W A;  3KZZ A;  1WJP A;  1PJQ A;  2YTQ A;  1A1H A;  4X9J A;  2DLK A;  4WX9 A;  2JP9 A;  2YTG A;  5KL2 A;  2WZO A;  2RQL A;  1IBM E;  1IQO A;  2I13 A;  1L4S A;  4M0V A;  3TQM A;  5IT9 C;  5A6J A;  3BF2 A;  4K0K E;  2YTO A; 
#chains in the Genus database with same CATH homology
 2EPX A;  4R2R A;  1G2F C;  2EOR A;  2A25 A;  2EM8 A;  1AAY A;  2EM5 A;  4WSG A;  2EM0 A;  2DMI A;  1X5W A;  2EM2 A;  1TF3 A;  1A1F A;  2MKD A;  2BB8 A;  2ENH A;  2ELY A;  2LV2 A;  2EMG A;  2YRK A;  1X6H A;  2DRP A;  1YUI A;  3UK3 C;  2R1F A;  2EMC A;  2MDG A;  4R2C A;  2EOF A;  4R2S A;  4IS1 C;  1JK2 A;  2YRM A;  2YU5 A;  1YUJ A;  2EPA A;  2EN3 A;  1ZAA C;  4R2Q A;  2EMI A;  2EOO A;  4F6N A;  4R2P A;  2EOI A;  5KL4 A;  2EE8 A;  2EN7 A;  2EN1 A;  2EML A;  2DLQ A;  1TF6 A;  2YRH A;  2YTJ A;  2EMF A;  5KL5 A;  1A1J A;  2EPU A;  2GLI A;  1ZU1 A;  2EM7 A;  3VHT B;  2YSO A;  1Z1B A;  2EM3 A;  2EN2 A;  1MEY C;  2EMA A;  2EOZ A;  2CT1 A;  2M9A A;  2WBT A;  2PRT A;  2EP3 A;  1UBD C;  2ENA A;  2D9H A;  2LCE A;  3EPL A;  2EN8 A;  2EOY A;  2GHF A;  1RMD A;  2EM9 A;  2EOQ A;  1B69 A;  3MHS C;  2LVH A;  2EL6 A;  2EOJ A;  2YTF A;  4R2E A;  4GZN C;  4FK5 C;  1NCS A;  2JPA A;  2J7J A;  2EOX A;  1A1I A;  2EQ1 A;  2EMW A;  2EM6 A;  1YSA C;  1BB8 A;  4M9V C;  3EPH A;  5KL6 A;  4F6M A;  1ZR9 A;  2ADR A;  2WBU A;  2YTI A;  2EMB A;  2EL5 A;  2E72 A;  2EOS A;  5KL3 A;  2EPC A;  2CTD A;  2EMZ A;  2RPC A;  1G2D C;  2EOE A;  2EPR A;  2EOH A;  4F2J C;  2RSI A;  3EPJ A;  5KL7 A;  4R2D A;  1DGC A;  2ELZ A;  2EMX A;  1X3C A;  2YTP A;  1TN9 A;  2EQ3 A;  2LO3 A;  2ENC A;  2EPZ A;  1P47 A;  2MKN A;  4R2A A;  1A1K A;  2WBS A;  1X6F A;  1JK1 A;  2EMY A;  2EL4 A;  2YTD A;  4IJD A;  1UN6 B;  1BBO A;  2YTN A;  1KJK A;  2YSP A;  2NAB A;  2EM4 A;  1A1L A;  2HGH A;  3M99 B;  2EMH A;  1LLM C;  2VRD A;  2EJ4 A;  2EMK A;  1X6E A;  2WCC 3;  2EN6 A;  2EQ0 A;  2DGC A;  3MHH C;  1WJP A;  1F2I G;  1A1H A;  2YTQ A;  4X9J A;  2DLK A;  2LT7 A;  2EN4 A;  2JP9 A;  2YTG A;  5KL2 A;  3EPK A;  2EOM A;  2YU8 A;  1A1G A;  2I13 A;  2YTE A;  2EPP A;  2CSH A;  2YTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...