2EN3A

Solution structure of the c2h2 type zinc finger (region 796-828) of human zinc finger protein 95 homolog
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
b'GSSGSSGTGEKPFQCKECGMNFSWSCSLFKHLRSHERTDPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 95 homolog
publication title Solution structure of the C2H2 type zinc finger (region 796-828) of human Zinc finger protein 95 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2en3A01
4R2RA 2WCC3 3MHHC 1DGCA 2CSHA 2ELYA 1JK2A 2EN6A 2EOZA 2CT1A 2EMCA 2WBUA 2A25A 2EPAA 1A1HA 1ZAAC 2EOYA 2YTQA 2MKNA 2EOSA 2YRHA 2WBTA 2DLQA 4IJDA 2LV2A 4R2EA 2RSIA 2LT7A 4GZNC 2D9HA 2YTNA 2ELZA 2YTPA 2EN4A 1G2DC 1YSAC 2E72A 2EMHA 2EQ1A 2YTEA 2EMBA 2EPPA 2EM5A 1TF3A 2CTDA 1AAYA 5KL2A 2LCEA 5KL4A 2EN8A 4R2DA 1A1LA 2EPCA 2EMZA 2YTFA 4F6NA 2YRMA 1YUJA 2YSOA 4IS1C 2YSPA 2MDGA 1ZR9A 1X6HA 2EL6A 2M9AA 2EMAA 2EOQA 5KL6A 2EM4A 2EOXA 1Z1BA 2DLKA 2ENCA 2EPUA 2RPCA 1YUIA 4X9JA 1G2FC 2PRTA 2YTGA 2EM6A 1LLMC 1A1KA 1A1IA 2ENHA 2EOEA 3MHSC 3VHTB 2DMIA 2EMIA 2EOOA 5KL7A 2ADRA 4FK5C 2EM2A 2YU8A 4R2QA 2EOIA 1MEYC 2ENAA 2EN1A 2LVHA 2YTOA 2J7JA 2EPXA 2EMLA 2EOHA 1UBDC 1BBOA 3EPKA 2JP9A 2YTJA 1F2IG 1A1JA 3UK3C 2EPZA 2NABA 1BB8A 2EM3A 2HGHA 2EMWA 1A1FA 2BB8A 2EMYA 2WBSA 2EL5A 2JPAA 1TF6A 5KL3A 2LO3A 3EPHA 2EOJA 1TN9A 2GHFA 2GLIA 1KJKA 3M99B 1X6EA 2EP3A 2EL4A 2EN2A 2EM7A 2EMKA 2EOFA 2EQ0A 2EM0A 1ZU1A 2EN3A 2EN7A 3EPLA 2YTDA 1P47A 2EMFA 4F2JC 1A1GA 1X5WA 2YU5A 4R2PA 4R2CA 2I13A 2EMGA 2EORA 1B69A 4R2SA 1UN6B 1X6FA 2EMXA 4WSGA 2R1FA 4R2AA 2EM8A 3EPJA 2EJ4A 2EQ3A 1RMDA 1X3CA 2VRDA 2YRKA 5KL5A 1JK1A 2MKDA 2YTIA 2DRPA 4F6MA 2DGCA 2EPRA 4M9VC 2EOMA 2EM9A 1NCSA 2EE8A 1WJPA
chains in the Genus database with same CATH superfamily
4R2RA 2WCC3 1N3GA 3C6MA 2FV4B 2CSHA 4NXME 4ZYDA 2WBUA 2A25A 1A1HA 4MLVA 4LF7E 1T39A 5A2QC 4DR3E 2MKNA 3HPSA 1XMOE 4RH8A 4NXNE 2LTSA 4JI0E 2N3GA 4IJDA 2DSYA 1FJGE 3T1YE 4J8ZA 1G2DC 2L3JA 4JI7E 2EQ1A 2VQEE 2EM5A 2LJUA 3J81C 1X49A 2CTDA 3BBGA 4LFBE 2EN8A 1DQ3A 4X65E 1A1LA 4WPYA 3ADGA 2YSOA 4DR1E 4LF5E 1ZR9A 3TQMA 2IHR1 1IMUA 1N36E 5KL6A 1Z1BA 1G2FC 2VQFE 2YTGA 2UUCE 2LUQA 4DV6E 1A1IA 1DI2A 2UUBE 3VHTB 4F9BB 1PKPA 5DNYA 5KL7A 2EM2A 2RS7A 1MEYC 2NA2A 2ENAA 2EN1A 1UBDC 2EMLA 2EPNA 2YTJA 1F2IG 4GKJE 1XNRE 2NABA 4L8NA 3C4TA 1A1FA 2HJJA 1J26A 2WBSA 2EL5A 2JPAA 3MSWA 1T38A 1TF6A 3EPHA 1WHNA 3RMPA 3OTOE 2GLIA 1SR9A 2E1MA 1YZ9A 2BBGA 2EL4A 4JI5E 2EMKA 1O0WA 4JYAE 2EOFA 4YHHE 2EM0A 1ZU1A 4F54A 3EPLA 2E5LE 2LTRA 2YTDA 1X48A 2FTXB 4DR2E 1A1GA 5A6BD 1B69A 4R2SA 4WXCA 4DV3E 2EMXA 4WSGA 1AH5A 5LL6R 2L3CA 1IBLE 2ODRD 4JI3E 5KL5A 2LUPB 2MKDA 2YTIA 2DRPA 2EPRA 4DV2E 2L2NA 2EOMA 3C6KA 1UILA 4JI4E 4M9VC 4WYQB 2DB2A 2EE8A 2B3TB 1WJPA 2JOBA 3VYXA 1WXRA 3LMLA 1HR0E 1JK2A 3JTZA 2EMCA 2YWQA 1IQSA 2EPAA 2EOYA 1J5EE 1MGTA 2UXDE 1GTKA 2DLQA 4X64E 2HC5A 2HHHE 2B9DA 2JWOA 4BCAA 2G7HA 3IWBA 3BGHA 2L8TA 2ELZA 2YTPA 2EN4A 4MLQA 5IXMB 4TUIA 1ZBTA 5BR8E 2YTEA 4DV7E 2EPPA 4LF4E 2V88A 4OX9E 5KL2A 2K7IA 4R2DA 3FIGA 3L00A 2YRMA 3LLHA 3JU0A 2CPNA 1X6HA 2EL6A 4X62E 2M9AA 1N33E 2F8BA 2L2MA 2UU9E 4X8WA 2EM4A 4DR4E 4NHRA 2M1SA 2ENCA 2EPUA 2RPCA 4I8OA 2JYAA 4Q28A 2PRTA 2JR1A 1LLMC 4LF8E 2MDRA 2EZ6A 1A1KA 2ENHA 2NUGA 2EOEA 2EMIA 3K6QA 2LBSB 1WRJA 2YU8A 4R2QA 2EOIA 2YTOA 2J7JA 4LFAE 4DR7E 1BBOA 3EPKA 3P1XA 2UXCE 2EPZA 3BIDA 2B7TA 1BB8A 1N34E 4JI1E 2HGHA 3IWCA 2EMYA 2L92A 2L2KB 1ZBQA 1BBGA 4R8OA 1PJTA 1T4NA 2I9IA 1X6EA 1KYQA 4WFTA 1X47A 2M4IA 5AC5A 1IQOA 3KWRA 3HXLA 2EN3A 1STUA 2V86A 3THNA 4DV4E 4M0VA 1P47A 4F2JC 1X5WA 2EORA 4LTYA 4P7DA 4DV1E 4HEIA 1UHZA 2ZM6E 4R2AA 4F9AB 2EM8A 4DMIA 4M30A 1RMDA 2B7VA 2FGGA 4KWYA 4WSPA 2MC5A 4LFCE 4F6MA 4KHPE 1HNXE 2LMZA 1QU6A 5ADZA 4LF9E 3OMLA 3IWDA 1QNTA 3MHHC 4YY3E 1EKZA 1DGCA 2EOZA 2CT1A 4N4RB 4X66E 1ZAAC 1IBME 5AE3A 2YT4A 2EOSA 4JI6E 4ZYGA 2WBTA 3HTXA 1RC7A 2LV2A 5A6AA 4DUZE 4JV5E 4R2EA 2YPNA 5FLXC 5A6BA 3HQ1A 4F9CB 4GZNC 2M7QA 2YTNA 2E72A 1YPNA 2EMBA 1FKAE 1HNWE 4BS9A 2LCEA 5KL4A 2F4VE 1XMQE 2KHXA 2EMZA 4F6NA 5IV8B 1YUJA 4IS1C 4DKKA 2YSPA 4ZYHA 2Q8UA 2EMAA 2WZOA 4GKKE 4O5GA 1YUIA 2R76A 3ADLA 2VF1A 2N8XA 4JI8E 4BC7A 2DMIA 1T4LB 4TUGA 3KZZA 1PJQA 4JI2E 4DR6E 5IWAE 4LF6E 4BHBA 3JAMC 2LVHA 2EPXA 3AV0A 4O4KA 1A1JA 4GEQB 3UK3C 1EH8A 2RTXA 4R03A 2BB8A 2JY9A 3T1HE 2EOJA 1TN9A 2N3HA 2GHFA 1EH6A 5AE1A 1KJKA 3M99B 2EP3A 2EN2A 5IT9C 1T4OA 3BF2A 5AE2A 2KOUA 4OOGC 2EMFA 4R2PA 2DIXA 4R2CA 5LLQA 2L33A 5AASA 2K4VA 2R1FA 2V83A 3EPJA 3H09A 2EJ4A 2EQ3A 3EQ1A 4B3SE 3J7AG 4BMJA 2VRDA 2YRKA 1IBKE 5A6JA 2V85A 4DV5E 2KONA 2RQLA 2JXPA 2EM9A 3ADIA 2V87A 4B3RE 2RS6A 1I94E 1YYWA 2ELYA 2DMYA 2EN6A 2H36X 2V89A 4B3TE 1RQ0A 2YTQA 3THOB 2YRHA 2MC6A 4B3ME 2EPLX 3QG5C 5T6JA 2GPIA 2JVAA 2RSIA 2LT7A 2D9HA 5A6KA 4LU9A 4RHBB 5AC4A 4BBYA 3J80C 3F6HA 1YSAC 2EMHA 4K0KE 1TF3A 4KZSA 5TSEA 1AAYA 1YFHA 1PJSA 1N32E 1GZ6A 2EPCA 3ZOQB 1GQEA 2YTFA 2MDGA 4DV0E 5LMUE 1EH7A 2EOQA 2ODRC 4O24A 2VE7C 4M2ZA 2EOXA 2DLKA 2EPMX 5A69A 4X9JA 2JOXA 2L6MA 1L4SA 2EM6A 4HTGA 4L5NC 4WX9A 1HNZE 3MHSC 5F3WA 2EOOA 3VYYA 2ADRA 4FK5C 2EPKX 3HPZA 3DJWA 2EOHA 2LJHA 2LRSA 2JP9A 4ZYEA 2EWLA 4P78A 2UXBE 1YYOA 4O43A 2EM3A 3ECRA 2EMWA 2EPOA 1XNQE 3C4BA 3DF6A 5KL3A 2LO3A 1WHQA 2NUFA 2UUAE 1PDAA 2RSMA 2EM7A 3ADJA 3VK6A 2EQ0A 4BC9A 2EN7A 2YZTA 2LE2A 2NUEA 3J7Yp 3KZYA 4BHCA 2YU5A 2I13A 1NEIA 2EMGA 1UN6B 1X6FA 1SFEA 1YYKA 4Q35B 3F6GA 4DUYE 5LMNE 1X3CA 2V8QB 1JK1A 3AUZA 2DGCA 4AQYE 1NCSA 4NZVA 4WXDA 4DR5E 5CFFE
chains in the Genus database with same CATH topology
4R2RA 2WCC3 3MHHC 1DGCA 2CSHA 2ELYA 1JK2A 2EN6A 2EOZA 2CT1A 2EMCA 2WBUA 2A25A 2EPAA 1A1HA 1ZAAC 2EOYA 2YTQA 2MKNA 2EOSA 2YRHA 2WBTA 2DLQA 4IJDA 2LV2A 4R2EA 2RSIA 2LT7A 4GZNC 2D9HA 2YTNA 2ELZA 2YTPA 2EN4A 1G2DC 1YSAC 2E72A 2EMHA 2EQ1A 2YTEA 2EMBA 2EPPA 2EM5A 1TF3A 2CTDA 1AAYA 5KL2A 2LCEA 5KL4A 2EN8A 4R2DA 1A1LA 2EPCA 2EMZA 2YTFA 4F6NA 2YRMA 1YUJA 2YSOA 4IS1C 2YSPA 2MDGA 1ZR9A 1X6HA 2EL6A 2M9AA 2EMAA 2EOQA 5KL6A 2EM4A 2EOXA 1Z1BA 2DLKA 2ENCA 2EPUA 2RPCA 1YUIA 4X9JA 1G2FC 2PRTA 2YTGA 2EM6A 1LLMC 1A1KA 1A1IA 2ENHA 2EOEA 3MHSC 3VHTB 2DMIA 2EMIA 2EOOA 5KL7A 2ADRA 4FK5C 2EM2A 2YU8A 4R2QA 2EOIA 1MEYC 2ENAA 2EN1A 2LVHA 2YTOA 2J7JA 2EPXA 2EMLA 2EOHA 1UBDC 1BBOA 3EPKA 2JP9A 2YTJA 1F2IG 1A1JA 3UK3C 2EPZA 2NABA 1BB8A 2EM3A 2HGHA 2EMWA 1A1FA 2BB8A 2EMYA 2WBSA 2EL5A 2JPAA 1TF6A 5KL3A 2LO3A 3EPHA 2EOJA 1TN9A 2GHFA 2GLIA 1KJKA 3M99B 1X6EA 2EP3A 2EL4A 2EN2A 2EM7A 2EMKA 2EOFA 2EQ0A 2EM0A 1ZU1A 2EN3A 2EN7A 3EPLA 2YTDA 1P47A 2EMFA 4F2JC 1A1GA 1X5WA 2YU5A 4R2PA 4R2CA 2I13A 2EMGA 2EORA 1B69A 4R2SA 1UN6B 1X6FA 2EMXA 4WSGA 2R1FA 4R2AA 2EM8A 3EPJA 2EJ4A 2EQ3A 1RMDA 1X3CA 2VRDA 2YRKA 5KL5A 1JK1A 2MKDA 2YTIA 2DRPA 4F6MA 2DGCA 2EPRA 4M9VC 2EOMA 2EM9A 1NCSA 2EE8A 1WJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2R A;  2WCC 3;  3MHH C;  1DGC A;  2CSH A;  2ELY A;  1JK2 A;  2EN6 A;  2EOZ A;  2CT1 A;  2EMC A;  2WBU A;  2A25 A;  2EPA A;  1A1H A;  1ZAA C;  2EOY A;  2YTQ A;  2MKN A;  2EOS A;  2YRH A;  2WBT A;  2DLQ A;  4IJD A;  2LV2 A;  4R2E A;  2RSI A;  2LT7 A;  4GZN C;  2D9H A;  2YTN A;  2ELZ A;  2YTP A;  2EN4 A;  1G2D C;  1YSA C;  2E72 A;  2EMH A;  2EQ1 A;  2YTE A;  2EMB A;  2EPP A;  2EM5 A;  1TF3 A;  2CTD A;  1AAY A;  5KL2 A;  2LCE A;  5KL4 A;  2EN8 A;  4R2D A;  1A1L A;  2EPC A;  2EMZ A;  2YTF A;  4F6N A;  2YRM A;  1YUJ A;  2YSO A;  4IS1 C;  2YSP A;  2MDG A;  1ZR9 A;  1X6H A;  2EL6 A;  2M9A A;  2EMA A;  2EOQ A;  5KL6 A;  2EM4 A;  2EOX A;  1Z1B A;  2DLK A;  2ENC A;  2EPU A;  2RPC A;  1YUI A;  4X9J A;  1G2F C;  2PRT A;  2YTG A;  2EM6 A;  1LLM C;  1A1K A;  1A1I A;  2ENH A;  2EOE A;  3MHS C;  3VHT B;  2DMI A;  2EMI A;  2EOO A;  5KL7 A;  2ADR A;  4FK5 C;  2EM2 A;  2YU8 A;  4R2Q A;  2EOI A;  1MEY C;  2ENA A;  2EN1 A;  2LVH A;  2YTO A;  2J7J A;  2EPX A;  2EML A;  2EOH A;  1UBD C;  1BBO A;  3EPK A;  2JP9 A;  2YTJ A;  1F2I G;  1A1J A;  3UK3 C;  2EPZ A;  2NAB A;  1BB8 A;  2EM3 A;  2HGH A;  2EMW A;  1A1F A;  2BB8 A;  2EMY A;  2WBS A;  2EL5 A;  2JPA A;  1TF6 A;  5KL3 A;  2LO3 A;  3EPH A;  2EOJ A;  1TN9 A;  2GHF A;  2GLI A;  1KJK A;  3M99 B;  1X6E A;  2EP3 A;  2EL4 A;  2EN2 A;  2EM7 A;  2EMK A;  2EOF A;  2EQ0 A;  2EM0 A;  1ZU1 A;  2EN3 A;  2EN7 A;  3EPL A;  2YTD A;  1P47 A;  2EMF A;  4F2J C;  1A1G A;  1X5W A;  2YU5 A;  4R2P A;  4R2C A;  2I13 A;  2EMG A;  2EOR A;  1B69 A;  4R2S A;  1UN6 B;  1X6F A;  2EMX A;  4WSG A;  2R1F A;  4R2A A;  2EM8 A;  3EPJ A;  2EJ4 A;  2EQ3 A;  1RMD A;  1X3C A;  2VRD A;  2YRK A;  5KL5 A;  1JK1 A;  2MKD A;  2YTI A;  2DRP A;  4F6M A;  2DGC A;  2EPR A;  4M9V C;  2EOM A;  2EM9 A;  1NCS A;  2EE8 A;  1WJP A; 
#chains in the Genus database with same CATH topology
 4R2R A;  2WCC 3;  1N3G A;  3C6M A;  2FV4 B;  2CSH A;  4NXM E;  4ZYD A;  2WBU A;  2A25 A;  1A1H A;  4MLV A;  4LF7 E;  1T39 A;  5A2Q C;  4DR3 E;  2MKN A;  3HPS A;  1XMO E;  4RH8 A;  4NXN E;  2LTS A;  4JI0 E;  2N3G A;  4IJD A;  2DSY A;  1FJG E;  3T1Y E;  4J8Z A;  1G2D C;  2L3J A;  4JI7 E;  2EQ1 A;  2VQE E;  2EM5 A;  2LJU A;  3J81 C;  1X49 A;  2CTD A;  3BBG A;  4LFB E;  2EN8 A;  1DQ3 A;  4X65 E;  1A1L A;  4WPY A;  3ADG A;  2YSO A;  4DR1 E;  4LF5 E;  1ZR9 A;  3TQM A;  2IHR 1;  1IMU A;  1N36 E;  5KL6 A;  1Z1B A;  1G2F C;  2VQF E;  2YTG A;  2UUC E;  2LUQ A;  4DV6 E;  1A1I A;  1DI2 A;  2UUB E;  3VHT B;  4F9B B;  1PKP A;  5DNY A;  5KL7 A;  2EM2 A;  2RS7 A;  1MEY C;  2NA2 A;  2ENA A;  2EN1 A;  1UBD C;  2EML A;  2EPN A;  2YTJ A;  1F2I G;  4GKJ E;  1XNR E;  2NAB A;  4L8N A;  3C4T A;  1A1F A;  2HJJ A;  1J26 A;  2WBS A;  2EL5 A;  2JPA A;  3MSW A;  1T38 A;  1TF6 A;  3EPH A;  1WHN A;  3RMP A;  3OTO E;  2GLI A;  1SR9 A;  2E1M A;  1YZ9 A;  2BBG A;  2EL4 A;  4JI5 E;  2EMK A;  1O0W A;  4JYA E;  2EOF A;  4YHH E;  2EM0 A;  1ZU1 A;  4F54 A;  3EPL A;  2E5L E;  2LTR A;  2YTD A;  1X48 A;  2FTX B;  4DR2 E;  1A1G A;  5A6B D;  1B69 A;  4R2S A;  4WXC A;  4DV3 E;  2EMX A;  4WSG A;  1AH5 A;  5LL6 R;  2L3C A;  1IBL E;  2ODR D;  4JI3 E;  5KL5 A;  2LUP B;  2MKD A;  2YTI A;  2DRP A;  2EPR A;  4DV2 E;  2L2N A;  2EOM A;  3C6K A;  1UIL A;  4JI4 E;  4M9V C;  4WYQ B;  2DB2 A;  2EE8 A;  2B3T B;  1WJP A;  2JOB A;  3VYX A;  1WXR A;  3LML A;  1HR0 E;  1JK2 A;  3JTZ A;  2EMC A;  2YWQ A;  1IQS A;  2EPA A;  2EOY A;  1J5E E;  1MGT A;  2UXD E;  1GTK A;  2DLQ A;  4X64 E;  2HC5 A;  2HHH E;  2B9D A;  2JWO A;  4BCA A;  2G7H A;  3IWB A;  3BGH A;  2L8T A;  2ELZ A;  2YTP A;  2EN4 A;  4MLQ A;  5IXM B;  4TUI A;  1ZBT A;  5BR8 E;  2YTE A;  4DV7 E;  2EPP A;  4LF4 E;  2V88 A;  4OX9 E;  5KL2 A;  2K7I A;  4R2D A;  3FIG A;  3L00 A;  2YRM A;  3LLH A;  3JU0 A;  2CPN A;  1X6H A;  2EL6 A;  4X62 E;  2M9A A;  1N33 E;  2F8B A;  2L2M A;  2UU9 E;  4X8W A;  2EM4 A;  4DR4 E;  4NHR A;  2M1S A;  2ENC A;  2EPU A;  2RPC A;  4I8O A;  2JYA A;  4Q28 A;  2PRT A;  2JR1 A;  1LLM C;  4LF8 E;  2MDR A;  2EZ6 A;  1A1K A;  2ENH A;  2NUG A;  2EOE A;  2EMI A;  3K6Q A;  2LBS B;  1WRJ A;  2YU8 A;  4R2Q A;  2EOI A;  2YTO A;  2J7J A;  4LFA E;  4DR7 E;  1BBO A;  3EPK A;  3P1X A;  2UXC E;  2EPZ A;  3BID A;  2B7T A;  1BB8 A;  1N34 E;  4JI1 E;  2HGH A;  3IWC A;  2EMY A;  2L92 A;  2L2K B;  1ZBQ A;  1BBG A;  4R8O A;  1PJT A;  1T4N A;  2I9I A;  1X6E A;  1KYQ A;  4WFT A;  1X47 A;  2M4I A;  5AC5 A;  1IQO A;  3KWR A;  3HXL A;  2EN3 A;  1STU A;  2V86 A;  3THN A;  4DV4 E;  4M0V A;  1P47 A;  4F2J C;  1X5W A;  2EOR A;  4LTY A;  4P7D A;  4DV1 E;  4HEI A;  1UHZ A;  2ZM6 E;  4R2A A;  4F9A B;  2EM8 A;  4DMI A;  4M30 A;  1RMD A;  2B7V A;  2FGG A;  4KWY A;  4WSP A;  2MC5 A;  4LFC E;  4F6M A;  4KHP E;  1HNX E;  2LMZ A;  1QU6 A;  5ADZ A;  4LF9 E;  3OML A;  3IWD A;  1QNT A;  3MHH C;  4YY3 E;  1EKZ A;  1DGC A;  2EOZ A;  2CT1 A;  4N4R B;  4X66 E;  1ZAA C;  1IBM E;  5AE3 A;  2YT4 A;  2EOS A;  4JI6 E;  4ZYG A;  2WBT A;  3HTX A;  1RC7 A;  2LV2 A;  5A6A A;  4DUZ E;  4JV5 E;  4R2E A;  2YPN A;  5FLX C;  5A6B A;  3HQ1 A;  4F9C B;  4GZN C;  2M7Q A;  2YTN A;  2E72 A;  1YPN A;  2EMB A;  1FKA E;  1HNW E;  4BS9 A;  2LCE A;  5KL4 A;  2F4V E;  1XMQ E;  2KHX A;  2EMZ A;  4F6N A;  5IV8 B;  1YUJ A;  4IS1 C;  4DKK A;  2YSP A;  4ZYH A;  2Q8U A;  2EMA A;  2WZO A;  4GKK E;  4O5G A;  1YUI A;  2R76 A;  3ADL A;  2VF1 A;  2N8X A;  4JI8 E;  4BC7 A;  2DMI A;  1T4L B;  4TUG A;  3KZZ A;  1PJQ A;  4JI2 E;  4DR6 E;  5IWA E;  4LF6 E;  4BHB A;  3JAM C;  2LVH A;  2EPX A;  3AV0 A;  4O4K A;  1A1J A;  4GEQ B;  3UK3 C;  1EH8 A;  2RTX A;  4R03 A;  2BB8 A;  2JY9 A;  3T1H E;  2EOJ A;  1TN9 A;  2N3H A;  2GHF A;  1EH6 A;  5AE1 A;  1KJK A;  3M99 B;  2EP3 A;  2EN2 A;  5IT9 C;  1T4O A;  3BF2 A;  5AE2 A;  2KOU A;  4OOG C;  2EMF A;  4R2P A;  2DIX A;  4R2C A;  5LLQ A;  2L33 A;  5AAS A;  2K4V A;  2R1F A;  2V83 A;  3EPJ A;  3H09 A;  2EJ4 A;  2EQ3 A;  3EQ1 A;  4B3S E;  3J7A G;  4BMJ A;  2VRD A;  2YRK A;  1IBK E;  5A6J A;  2V85 A;  4DV5 E;  2KON A;  2RQL A;  2JXP A;  2EM9 A;  3ADI A;  2V87 A;  4B3R E;  2RS6 A;  1I94 E;  1YYW A;  2ELY A;  2DMY A;  2EN6 A;  2H36 X;  2V89 A;  4B3T E;  1RQ0 A;  2YTQ A;  3THO B;  2YRH A;  2MC6 A;  4B3M E;  2EPL X;  3QG5 C;  5T6J A;  2GPI A;  2JVA A;  2RSI A;  2LT7 A;  2D9H A;  5A6K A;  4LU9 A;  4RHB B;  5AC4 A;  4BBY A;  3J80 C;  3F6H A;  1YSA C;  2EMH A;  4K0K E;  1TF3 A;  4KZS A;  5TSE A;  1AAY A;  1YFH A;  1PJS A;  1N32 E;  1GZ6 A;  2EPC A;  3ZOQ B;  1GQE A;  2YTF A;  2MDG A;  4DV0 E;  5LMU E;  1EH7 A;  2EOQ A;  2ODR C;  4O24 A;  2VE7 C;  4M2Z A;  2EOX A;  2DLK A;  2EPM X;  5A69 A;  4X9J A;  2JOX A;  2L6M A;  1L4S A;  2EM6 A;  4HTG A;  4L5N C;  4WX9 A;  1HNZ E;  3MHS C;  5F3W A;  2EOO A;  3VYY A;  2ADR A;  4FK5 C;  2EPK X;  3HPZ A;  3DJW A;  2EOH A;  2LJH A;  2LRS A;  2JP9 A;  4ZYE A;  2EWL A;  4P78 A;  2UXB E;  1YYO A;  4O43 A;  2EM3 A;  3ECR A;  2EMW A;  2EPO A;  1XNQ E;  3C4B A;  3DF6 A;  5KL3 A;  2LO3 A;  1WHQ A;  2NUF A;  2UUA E;  1PDA A;  2RSM A;  2EM7 A;  3ADJ A;  3VK6 A;  2EQ0 A;  4BC9 A;  2EN7 A;  2YZT A;  2LE2 A;  2NUE A;  3J7Y p;  3KZY A;  4BHC A;  2YU5 A;  2I13 A;  1NEI A;  2EMG A;  1UN6 B;  1X6F A;  1SFE A;  1YYK A;  4Q35 B;  3F6G A;  4DUY E;  5LMN E;  1X3C A;  2V8Q B;  1JK1 A;  3AUZ A;  2DGC A;  4AQY E;  1NCS A;  4NZV A;  4WXD A;  4DR5 E;  5CFF E; 
#chains in the Genus database with same CATH homology
 4R2R A;  2WCC 3;  3MHH C;  1DGC A;  2CSH A;  2ELY A;  1JK2 A;  2EN6 A;  2EOZ A;  2CT1 A;  2EMC A;  2WBU A;  2A25 A;  2EPA A;  1A1H A;  1ZAA C;  2EOY A;  2YTQ A;  2MKN A;  2EOS A;  2YRH A;  2WBT A;  2DLQ A;  4IJD A;  2LV2 A;  4R2E A;  2RSI A;  2LT7 A;  4GZN C;  2D9H A;  2YTN A;  2ELZ A;  2YTP A;  2EN4 A;  1G2D C;  1YSA C;  2E72 A;  2EMH A;  2EQ1 A;  2YTE A;  2EMB A;  2EPP A;  2EM5 A;  1TF3 A;  2CTD A;  1AAY A;  5KL2 A;  2LCE A;  5KL4 A;  2EN8 A;  4R2D A;  1A1L A;  2EPC A;  2EMZ A;  2YTF A;  4F6N A;  2YRM A;  1YUJ A;  2YSO A;  4IS1 C;  2YSP A;  2MDG A;  1ZR9 A;  1X6H A;  2EL6 A;  2M9A A;  2EMA A;  2EOQ A;  5KL6 A;  2EM4 A;  2EOX A;  1Z1B A;  2DLK A;  2ENC A;  2EPU A;  2RPC A;  1YUI A;  4X9J A;  1G2F C;  2PRT A;  2YTG A;  2EM6 A;  1LLM C;  1A1K A;  1A1I A;  2ENH A;  2EOE A;  3MHS C;  3VHT B;  2DMI A;  2EMI A;  2EOO A;  5KL7 A;  2ADR A;  4FK5 C;  2EM2 A;  2YU8 A;  4R2Q A;  2EOI A;  1MEY C;  2ENA A;  2EN1 A;  2LVH A;  2YTO A;  2J7J A;  2EPX A;  2EML A;  2EOH A;  1UBD C;  1BBO A;  3EPK A;  2JP9 A;  2YTJ A;  1F2I G;  1A1J A;  3UK3 C;  2EPZ A;  2NAB A;  1BB8 A;  2EM3 A;  2HGH A;  2EMW A;  1A1F A;  2BB8 A;  2EMY A;  2WBS A;  2EL5 A;  2JPA A;  1TF6 A;  5KL3 A;  2LO3 A;  3EPH A;  2EOJ A;  1TN9 A;  2GHF A;  2GLI A;  1KJK A;  3M99 B;  1X6E A;  2EP3 A;  2EL4 A;  2EN2 A;  2EM7 A;  2EMK A;  2EOF A;  2EQ0 A;  2EM0 A;  1ZU1 A;  2EN3 A;  2EN7 A;  3EPL A;  2YTD A;  1P47 A;  2EMF A;  4F2J C;  1A1G A;  1X5W A;  2YU5 A;  4R2P A;  4R2C A;  2I13 A;  2EMG A;  2EOR A;  1B69 A;  4R2S A;  1UN6 B;  1X6F A;  2EMX A;  4WSG A;  2R1F A;  4R2A A;  2EM8 A;  3EPJ A;  2EJ4 A;  2EQ3 A;  1RMD A;  1X3C A;  2VRD A;  2YRK A;  5KL5 A;  1JK1 A;  2MKD A;  2YTI A;  2DRP A;  4F6M A;  2DGC A;  2EPR A;  4M9V C;  2EOM A;  2EM9 A;  1NCS A;  2EE8 A;  1WJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...