2ENSA

Solution structure of the third ig-like domain from human advanced glycosylation end product-specific receptor
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
96
structure length
96
Chain Sequence
GSSGSSGLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Advanced glycosylation end product-specific receptor
publication title Solution structure of the third ig-like domain from human Advanced glycosylation end product-specific receptor
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ensA01
3UBXA 3SGDI 3R1GH 4LLDA 4OGYL 4QOKD 3BMWA 3GSXA 3FAXA 3UTPE 1I1YA 4NGHH 3B8SA 3QUML 4U1IA 3W5NA 1JI1A 4Z7WE 3X12A 3QWRA 2N7BA 4TSBH 2NLJB 3BD3A 3SGKC 4WW2A 3DROA 4OF0A 3MV8B 2UUDK 1I9RL 4K23L 1DVFC 5K59F 4YBLB 2FL5A 5IMKA 4NO0A 3RWCA 3VFRB 2LAGB 4MZ3A 5EH1A 4TTDC 4ACPA 4POZD 3U4BH 3UTSE 3WUWA 1S5IL 2Z35A 5JLZA 1Q9KA 3J8F7 5DQDH 2FJFB 4U6TA 4EZMA 2FEDD 1FZJB 2X9XA 1VADA 5L9DL 4Z7UE 2J4WH 4HFWB 4ONHA 2HLAA 1BJ1H 3ES6B 4ZS7L 2DL9A 4JPWL 2ZPKL 3IETA 2WINA 5IBTH 2DD8H 5JO5A 2DTSA 3EDJA 1WBXB 4GOSA 5EOCJ 5IB4B 4D0BA 1U93A 3OXSB 1V7MH 1Q9OA 3WN5B 2E7HA 5DQJA 4F8QA 3KPPA 2Q87A 3V6OC 4PGDA 2APWA 2F19H 1JL8A 3DIFB 1C5DA 2CUIA 3MLUL 4PLJC 3RVUD 1ZSDA 5F7NC 3MZTA 1VB9A 3UJJL 3O8XC 1N7MH 5FO9B 1CLZL 1UYWL 3MBED 3S37L 5IESL 1NGZB 4OQ1A 4HWZB 4YK4B 5D72L 1WZ1L 2DTMH 3HR5A 4Z95H 4N0UA 1WF5A 3WKNA 5HI4C 1KF9B 2GITA 3TT3L 1W0VA 4NNPH 4RGNE 1HOCB 2B4CH 1ERNA 3UTZA 4NC1E 5FGSA 5J13C 3N50A 5ERWB 3P0VH 5CMAB 5MENE 4Z8FL 2NQCA 3MLWH 1GGUA 3OKOB 1EK3A 4OLUL 3QDGB 1AGFB 1NEUA 3D2UB 2FD6L 4U0RC 4XVTH 5EU5B 3QCUH 3GSRB 4I2XE 2ZKHL 4ENEC 5HYJE 3QG6B 3L3OB 4S1RH 3OPZL 3VWKB 5EZOH 4KV5E 4LVNB 3F7RA 3WFCL 1MHCA 1N2RB 3G6AB 3QFJE 4P2QA 4R9HA 4DZBA 5L6YH 2BCKB 3RFZC 1BJ8A 4LQ1A 1GZPB 3MOAH 5F8QC 4WFED 5MERB 1JWMB 3NIGF 5C0DB 1FNAA 4XGZA 5CIPB 3DWTA 3SDDC 1QG3A 4M7LL 4A2LA 3QZWA 3ME0A 3SDXE 4X80H 4JDZA 1LE5B 4I48A 4F58L 4JDTH 4ZMAT 4LQFL 3MROA 3JWDH 3ARGA 1NC2D 4DFHA 4UZGA 4OCWL 2XTJB 1ZWIA 4UIKL 4PJ9B 4HF5H 5JW3H 1JGUL 1JIBA 3MYJB 4DKEH 1LQSR 2XKSA 2FX7H 1LDPH 3IDIA 3QUKA 2DLFH 5DMGC 5DD3H 1QNZL 4MQXC 5GRUH 2F8OA 1H15B 4JFXB 4UNTA 5J4MA 1ZLSH 4JGMA 5FGBC 2JF1A 4I9WE 3PWUB 4C56E 1UWGH 2HFFB 5I16A 4R2GB 3MRHB 1A02N 4F80A 1PY4A 1RHHA 1NLBL 5DT1H 2UVFA 4HQQH 1J1XH 2D9CA 4Y1AB 4OCXH 2F5BL 4YWGL 4F7CA 3MLVL 3S7GA 1IGCH 3QUYA 1T66C 3MXVH 1T1YA 3BP7A 3QXAA 3OJVC 4KZDL 4LDLB 4M8QB 4MHHI 1DL7H 4NIKB 3FOLA 4ZOAA 5FV2A 4HGKC 5DK3A 2MJWA 2IJ0C 1JHKL 3K4ZA 5DQ9B 5MEQB 2ADIB 3LD8C 3TIEA 4X99A 1T5WB 5EU4A 5D6CA 1BQUA 1HHHB 1T1WA 5EORL 5CJ8A 4ZAKB 2JK5B 2B1AL 1CI5A 3VFGL 5IMOA 2XZCH 4ZUWB 2IPUG 3FB6B 5D93B 1G7PB 3EOAB 3QDMA 4HZAA 3SKMA 4KUCD 4POZC 1NPUA 3BT2H 5B3JF 4G8FB 3BDBA 1KPVB 4QHLA 2V5TA 2FEDC 2OQJA 4QYOA 3DVIA 3G5ZA 3P40A 4X9BA 1OQXA 3BKCH 4NQVB 1IGIL 1F3JB 3WKMH 1UFUA 5I71B 1IAIM 5J11C 5D7IB 2PTUA 1T1XB 5T1LD 1N5YL 1AR2A 3LEYH 4PJ7A 1YNKH 2R0KH 5E0QA 3BKJH 3B2UC 4EUPA 1P5UA 5FKAB 2M2DA 3MRLB 2YD1A 2XWTA 4FTVD 1I7UB 3BI9X 4UTAL 3EBAA 1J88A 4P5TD 3BRGC 1FJ1A 2ICEB 3QRGL 4GKOA 1JPTH 5JNYB 3BYTA 5DEGA 2I60L 1BAFL 4DZ8B 1GC1L 2Q7YB 4P9MH 3BMVA 3U46B 2NNAA 4DN4H 1IKNA 3ZDXE 4CN6A 5I30H 3GMLB 3OMZA 1MCKA 2YBRA 2DQCL 4EBQH 3GBML 5HJ3A 1T0MB 2D9QB 5HYQA 4BZ1H 1KPRA 2WV3A 4QHMA 3FN9A 5DHVB 5FK9A 4K3JH 3QRFM 4X9HA 4ZO9A 4HWEH 5GGQH 4WU7A 3GSOA 4Y4FD 4URTB 5DRXB 2QSTA 1U8MB 1NAKL 3K2MC 1TJHL 3LQAL 3I9GH 2BVPB 5BJTA 4R3SA 4JN1L 3C60D 3P9MB 1K9TA 3ECBA 5E9DA 3VFMB 3VH8G 2E6QA 4L9LC 2F54E 1RZKH 3DXAB 1N8ZB 2HJLA 4P2YA 4PRPB 4BUHA 3TC9A 2BVOA 5E2WH 2B20A 1X5AA 1T83C 5IM7A 4GAJL 4BA8A 1HZHL 4Y16D 5AUMB 8CGTA 1F6AB 1E6JL 5DJDB 3OAZK 4LLYA 1OW0C 5ANME 3SKJH 1FAIH 1SM3H 4N0RA 4QY8B 4EVNA 5IMMA 1MFEH 1C5CL 5DA4A 4AY0A 4AEHL 4LHUD 4LRNL 2ESVA 3D0LB 3BKYL 4QRTB 3WUZA 4WV1C 1KNOA 1QSFA 1U8OB 1RK0A 3L5XH 1MLBB 1CLYL 3MRRB 4K3DL 5M95B 4PREA 5JPMB 1Q9LB 1HSBB 4ETYA 1Q1JL 3GMQA 5IG7A 5A3IC 5DUMH 4UT7H 4JRXA 4QXTA 4MQ7A 2BY0A 3DX7B 4XXCA 3LB6C 3CAFA 5HDQL 2CLZB 3PGCB 3TYFB 4M93B 2P48B 1HI6B 4P99A 5JA8B 5BRZA 5CWSB 4UBDC 3REVB 4WEMB 4FQ2H 2HJKA 4ESKA 4Z5RB 1KLUB 1S9XA 4LSQL 1FYTE 3IDNA 4X6DF 4P3CH 3ULUL 4U7MA 1HN1A 5CJQH 3RUGF 1MEXL 4TTGA 2NY4D 1BGXL 1UT9A 1MNUL 5LG1A 2DQTH 4J6RL 5CP7B 4D2NA 3HMXH 4WO4C 5EO9A 1IM3B 3RAJL 4BQ8A 3VFVA 4ZUVA 5ESQA 3LRSB 4QRRB 1A2YB 1M6OA 5I0DA 1X5GA 4Q9CA 3SKOB 4KDTC 4AIZA 3MUHL 4K7PH 3D9AH 1NCAH 4HC1L 3RRQA 3IXAB 5J6HA 1DBBL 4AG4H 1JV5A 2YUWA 5GGUA 3QHFH 2F5AH 5DA0B 3LKNA 3SCMA 4XNYH 4UUJA 2YEZB 1WGOA 1IKFH 1YN7B 3CFKA 3KLDA 3OG4B 1MFCH 1H8SA 1RZIB 4E41E 4AT6B 1KELL 1E4XL 5IIEA 9CGTA 3PL6B 3K4AA 5D5ME 3TIDB 4MDJB 4XC1H 4LSSL 1ZS8B 3L3GA 5BW7C 3X3GH 5F9JB 5EWIL 4JG0L 5J3HD 5T1DL 4GG6E 3NMEA 3NTCL 1OD7A 5IEHB 3CU1A 4PJBA 5KSBB 1FBIL 1UB6B 15C8L 4Y19D 2P8MB 3D3VB 1UKQA 5I1EH 4X0KA 3T4YB 4GBXD 3ARBD 4PD4K 1A6TA 1W0WA 3T0EB 3WS6C 5HGAA 3RZCA 3V7MA 4QHNA 4D94A 4OM1H 2MQ3A 1AFVH 3I75B 4NKDB 1PZUB 2HVJB 4JRYB 5C1MB 4X6CE 5F6HI 5C0FB 3CFDB 4JN2A 4RDQF 1KENL 2ICWA 2A6DB 3DSFL 1I8KA 1QFWL 3U79A 4BH7A 2YPLE 5GGVH 3S6CA 2XQYK 2Y5TA 4KZEL 1CXFA 3GGWB 4ZFZA 4OZIA 3O2DH 5GZNC 4XBGA 5GIRA 3R1GL 3UZQA 4JJ5B 5C08A 1P7QB 3KPSA 4XMPH 1UENA 1J7VR 4NGHL 1FO0H 2QL1A 1PD6A 3OGCB 4G3YH 3IDUA 7FABL 1IGMH 2OTWA 4UDTA 2WBJB 1YEFH 4L3EA 3U6RA 3L3HB 1HEZB 3QIUB 3FT4B 5EU3A 3T09A 3VXOA 1S7VA 3WO3B 3TBSB 1FZOA 2FIRT 3I6GA 3DVGA 1IC7H 4DW2H 3O3UN 3QIWD 3U4BL 2UVEA 1CBVH 1CXEA 3FQRA 1I8LA 2GTWA 5IFJA 2EE9A 3CX5K 2FIKB 4XX1G 4YIQB 2X4QA 1CICD 2J4WL 3Q48A 3SDCD 4M1CC 4Z7VB 4Y16C 4HUKB 4Z7UF 4PJXE 1B6UA 4F9LA 3MSPA 2V2XA 1HKLH 1DQJA 1S7SA 5IBTL 1M4KA 2DD8L 4NHUA 4NPYA 4KQ4L 1H3WM 2FYYB 4YO0B 1V7ML 4P4RA 3N1MC 4U1MA 2KQNA 4YDIL 1C08A 5HPOA 1X6LA 2FBJH 4FABH 5CZKA 5ID1B 1KXQE 3PIQB 5T3XH 2HH0L 3QNYB 4IIQC 5A16B 2AAVA 1IJ9A 2F19L 5IMLA 1MF2H 3VXSA 5HGBA 4H25A 3QNXA 2BY3A 1RURH 1F3RB 4TUOA 5F97E 2FB4H 5CAYB 3VA2C 1N7ML 4R4FH 5E03A 4JAMB 5EBGA 1MCWM 1PVHA 1T2QH 4OFKA 1S78D 4GLRH 2DTML 1U42A 1VFOA 2YMXH 4Z95L 3JTTB 3MV9A 3VFSA 4GAYA 5MEPB 1ZLVK 4W6XB 4NNPL 5E8PA 2B4CL 3RY4A 1IAIH 2QQLH 4K71C 1CDGA 2VLRD 4M7LT 4UNVA 2NY4C 3P0VL 3E6FA 3FO9A 3MLWL 3JV4B 4Q6YA 1NBVH 5D70H 3L95B 4LSVH 2LFGA 4RMQA 4WFHD 3TZVA 2K7PA 4XVTL 3QCUL 2YD2A 5EBMA 5D1XD 4FFZH 1ZT7A 4S1RL 4BKLA 3FOMB 5A2FA 5DLMH 2DN7A 5EZOL 2E6PA 3V6OE 4PJDB 1YEDB 4KV5F 1S3KH 5L6YL 4BZYA 5TFSH 5IB1B 4ZG1A 3MOAL 2X4TB 3WFHA 4PY8J 1WZLA 1P7KA 5GS0H 1ZHBB 4FFVC 4KROB 3DV6A 2IANE 1NSNH 5E95B 4X80L 1U8HB 4LSTH 4F7MA 3H6JA 1KLFA 3R0MA 4JDTL 4Z78A 3SDXF 5J6GA 2IG2H 1DUYB 5IEKA 4Q2ZB 2ADGB 3JWDL 1DN0A 2FH6A 3BXNA 2GSIA 3KDMB 2ZOLB 5FDWB 3ZT5A 3MJ6A 1ES0B 5L8LB 1OAUH 5JW3L 2VLJA 1OOAA 4G80B 2FX7L 1ED3B 2DLFL 1QLRB 4NQSA 3PABB 5DD3L 3FO2B 3ARFD 2AXHA 5CIPH 2VUOA 4QRUB 3C5SA 1ZLSL 5D1ZD 5KZCD 3O3EB 4PBWD 1AQKH 2GJ6B 4PB0L 3I02A 2ZCKH 5E4IA 4GBXC 3P4MB 5DD0H 3ARBC 1UWGL 2C3VB 5TGBB 1DANT 5DT1L 1LDSA 5EBLB 4HQQL 1J1XL 4LOUD 4IRJD 3SKUD 4OCXL 1CVRA 2AVGA 4RMTA 1IGCL 4OF7A 3QEHB 3KPRA 3KGRA 3ES6A 2EDKA 2WWKO 1OT1A 4AEFA 2QSVA 3DX6A 4Z77B 1ZT1A 4NUGH 1DL7L 4DGYL 2HKFH 5F7WC 4BFEA 5GSRB 4Y4HC 5JTWA 1NCBH 4WCYH 2R1WB 1CFSB 5DHYA 4LNRB 2XN9E 3SJVD 2FWOA 4R7DA 3WIHH 2A2QT 4KKAC 3GBLA 3R8QA 1HH9A 2BOCA 4KMQA 3TVMA 5FO9A 1K8IA 4Z7OE 3UBXG 5L7XL 3VXTB 4HWZA 3VFPA 1CDIA 1UWXK 2IWGA 3BT2L 1QRKA 3KG5A 5CHNA 5F7KC 4F37K 2B7DT 5EOTB 1JYXA 5C0AB 2QBWA 3QBTB 1HOCA 2Q76B 1LK3L 3BKCL 5C2UB 1VCAA 3WKML 5CMAA 4ZYKA 2LABA 1MCPH 5CP3H 3LEYL 1YNKL 5ACMA 3GSRA 2NY0B 2R0KL 3BKJL 4FNLH 4H26B 1SHMA 3QG6A 3CVIH 3L3OA 3FTGA 2ZOKA 3NGBC 3LVEA 1Y6KR 2EDNA 3FQTB 4QOKE 2XIDA 2IPKB 1JRHH 2OTUB 1MRCH 3G6AA 1HILB 4APQD 5H35B 3HUJB 4HIEB 3F7YA 4P46A 1OP3K 1JWMA 1XCTA 1F2QA 1JPTL 5CIPA 4G9FD 3VFNA 5I6XC 1UXWB 4GAGH 3NCCB 1LE5A 3K74B 1FN4B 1EVTC 3MLSH 2Z8WC 4P9ML 5EFIB 2F15A 2QADC 4DN4L 3HCVA 3H0TA 5I30L 4CUCA 4PJCB 5AWNH 2M1KA 3ZDXF 4PJ9A 4EBQL 4BZ1L 1R5WB 2PETA 3NIFE 3VDCA 4K3JL 1AXTH 4M5YH 4R4NC 1P5VA 4HWEL 5GGQL 3K81A 5GZOD 5CSBA 4X6FB 1H15A 3QAZC 3W9EB 4MX7A 3I9GL 3EAKA 2X4UB 1CD8A 5C0RH 3B3IB 2G75A 2Y7QB 4LLVB 1BQLL 1RZKL 5D1XC 4V2BA 4ELKB 3ROOA 3LKSB 1CGWA 2HFFA 1TQCB 3MRHA 4LVEA 3W0WA 5E2WL 4J3OC 1TZIA 1WK0A 5FUOL 2R4SH 5EO1B 1X5JA 3FAWA 1UM5H 2LTQC 1S9VB 4L4VD 5DHVH 3VXUD 5FYLH 3RIFK 3ZDZE 4R97B 4B53A 4I8DA 1WAAA 1T5XB 3CCHA 4KKNA 4YHNB 2JJTA 3SKJL 2F9BT 1FAIL 1SM3L 2E27L 4MAYD 1MFEL 3K3QA 4DVRH 1E4JA 1TJIH 4TQEH 3E2HB 3F6LA 1IM9B 1JF1B 4GW4B 1CGYA 4XH2B 2QHLA 5FO7A 2VLKB 2YRPA 4NQDB 1HXMA 3BWUC 1FSKB 5I1JH 1RMFH 1ULVA 5GRWA 5DUML 3QZWG 4UT7L 3H9HA 4S1SH 3MMEB 5KS9E 2FGZA 4U1NA 2R2HB 1FL3B 5FM8A 3ARFC 2I24N 3RIAK 2JK5A 1QZ1A 4U1SB 1D6EB 1DZBA 2NY2C 3CH1B 3BE1H 2DQIL 4HH8A 2NY6B 3BP4B 4FQ2L 3EOAA 1JP5A 4PBXA 4NO0D 5LVEA 2EEDA 3CUPB 1WWBX 4NOFA 2AJUH 4LOUC 2FLBT 1CR9L 3QXUA 4P3CL 4DJMA 1QLEH 5CJQL 4NQVA 1C1EL 1DN2A 1F3JA 2VABB 4P2OC 2DQTL 4XVJH 1P53A 5D7IA 5EUOE 2D7MA 3HMXL 1WWCA 4G6FB 3CZFB 3ZSSA 4DOHE 3OJDA 4P49A 2PO6A 3WYRA 4HIXH 1MCOH 2C3XA 3TJHD 3BP6B 1CFNB 3DTXA 2JELH 4PJIB 5C2BH 5EZIH 1ZMYA 3CC5B 3C6SB 5HVHC 2D7TH 5FKAA 4U1LB 4ELME 3MRLA 4JRWA 4K7PL 5BS0A 3IF1A 1NCAL 3OR7B 1I7UA 4Z76B 1K2DB 4GRMA 4AG4L 3BOVA 2WQRA 3QHFL 2F5AL 2ICEA 1U92B 3OB8A 4ODUB 4XNYL 5JNYA 5EZLA 4L4TA 1IKFL 4DCQA 5ALBL 1F90H 5J9PB 4DZ8A 4M02A 5ITFA 4RZCB 1OTTC 2OX5A 5SX4H 3OX8B 3U46A 1GL4B 1MFCL 2OLDA 3MA7B 5E7FA 3U4EA 3H42H 2NR6C 1TTFA 3MCLH 1BX2B 3GMLA 4XC1L 3AS1A 4JFPA 5D5MF 5KAQF 1T0MA 3X3GL 5DRZB 1KUMA 2UWEE 1A6ZB 1OAYL 1DDHB 2LU7A 1EEUA 1RJYA 4GG6F 2E7BA 3DJ9A 5F89B 5E6IB 3RL1A 2NMSA 5FAAA 3VI4E 3AM8A 4Q7DA 5IB2B 4NRZA 5I1EL 4QRPA 5DEZA 1MQ8A 3VXRB 1TXKA 3VFMA 4NFBA 4NZUH 1N8ZA 2IH1B 2Z93B 3K2UH 4PRPA 3HE7B 2V5RA 1M05A 4OM1L 4R8WH 3HLAA 2NCMA 1DQMH 1KCLA 5FA4B 1WTGT 1VFAB 2DQJL 4HGWB 1TCRB 1AFVL 1ETZB 4P2QD 5AUMA 3R4DA 1F6AA 4IBLT 4KDWA 1XF2A 2IMNA 5DJDA 3PDDA 4JPVH 4X6CF 3GJFB 3LQAC 1A6AB 3ULVH 4MJIB 1J8KA 4CADB 4U3HA 4XPFH 1WCQA 4MCYB 5GGVL 4JFDB 3D0LA 3T1WA 3O2DL 1F02I 1FV1A 5CJXA 4FN0A 1MLBA 3QCVH 3OKEA 1UADC 3ARGD 2VIRA 4MXQC 2ZUWA 4XMPL 3JWOH 5JPMA 2GFBB 4JZNB 2WZPD 2CQVA 1FO0L 1YMMB 4EN3B 3C9NB 3S8WA 1RHFA 1YEFL 4ETQB 1W8OA 5TE4H 5GZOC 4HLJA 2X44D 5GRXG 1MPAH 1HI6A 1N0XH 1E4WH 3AU1B 3N9GH 1IC7L 2ADJB 4DW2L 1X5YA 5FYKH 2DMCA 1F11B 4NJ9H 4R4BB 1KLUA 4FS0A 5CD5D 4Y0GA 4L5FH 5F3BA 4XAWH 1NFIB 3DO7B 2XA8H 2OP4H 2EIZB 4OZGE 3BFOA 2HT4C 5AAMA 1ZA6B 5HSFA 5CP7A 2WP3T 1IM3A 1R5VA 1HKLL 4PJXF 3QUYD 1E6OH 5HHNB 1FZKB 3LRSA 1N0LA 4OD3H 1VA9A 3DYPA 3MNZA 1U3HA 4FABL 2FBJL 1P1ZB 3MLYH 4PRDB 5T3XL 3UEZA 3ULUC 5FA3A 1JNNH 1J12A 1NAMH 4PGEA 5DD6B 1MF2L 4GO6B 5J1SC 3DVFA 5MEOB 2H1PH 4R7NA 4P23B 3E3QE 4PYHA 1RURL 2PTTB 2FB4L 4HG4K 4IJ3C 4R4FL 3KXFE 3RGVC 1T2QL 4MNQB 4AT6A 3MGTB 2YMXL 4P2RB 4X4XB 4L3CA 3T04D 4TUJA 1KCSH 3P77B 3QDMD 4DAGH 5I1KL 5KSAC 5F9JA 2G5BB 2NXYC 5D2LE 1ROWA 2VWEC 3GEWB 1IAIL 1EO5A 2BDNH 2QQLL 5D2NE 4PRAA 4WEBH 1Z6JT 1UH2A 1KV3A 2RJMA 4JLRB 2HRLA 5E6YA 2OI9C 1U36A 2NYYD 5D70L 1T22B 2VISB 3D3VA 4LSVL 1BJ1J 4OGZA 3VFOA 1F4HA 2XXMB 1I1AA 4RCAA 4FFZL 4OD2B 1U2HA 1JYNA 1QRNA 1DBKH 5DLML 3T0EA 3D18B 3T8XB 2J3SA 5CEYA 3HZVB 1S3KL 5C8JB 3V5HB 5TFSL 4OZHE 2AJ3A 4N8VB 3IJYB 2ZUTA 2MHAA 5GS0L 4NKDA 3DX9B 1UCBH 3CPLB 2N56A 4KDVA 1NSNL 3CFDA 4LSTL 3T0AA 1XR9B 1KJVA 1AY1H 5FCSH 4YFEA 2A6DA 2IG2L 3I6KB 2HG5B 4JZJC 2NX5B 4R0LC 4P5MA 2J5LC 1P7QA 4WFGD 1Z9MA 3C8KA 4WVRA 1OAUL 4E42A 4XCNB 3BH8B 3H7BB 3OGCA 1NL0H 1SYSA 3DRQA 1JK8B 1KBGH 3NFNB 3QEUB 3L3HA 1HEZA 3QIUA 4CNIA 1FC2D 3FT4A 1LNUB 3KYNB 4N5UA 4RRPA 3AAZB 4R96B 3P73B 4Z7NE 1AQKL 2DM3A 3V5DB 1F45A 2ZCKL 3WXWH 5DD0L 4B41A 5GS3A 4NQTA 3V6FA 5E9DD 4NBZB 5EULV 4JREB 3F65A 1DQQA 1IZKA 1ADQA 2EH7H 3VI3E 2FIKA 1ORSB 4OLEA 5F96H 3SO3C 3MRPB 5HDOA 2F53A 1C12A 5AYUH 4Z7VA 1NC4B 2APFA 2ORBH 2YD8A 3S5LB 1MCCA 3SPVB 1VESA 5AYQA 1FNLA 1KB9J 2W65B 5IJVB 2NY1D 4NUGL 1SJXA 4NNXB 4YO0A 1OTSD 2HKFL 1VACB 32C2A 3SDAB 5TDNA 5I18H 2ESVD 4WCYL 2J8UA 4TVPD 2BMKB 2XI9A 3ZKNC 5ID1A 1DE4A 1QSFD 1RFDH 1XF5B 2BZDA 4XNZC 4YDVA 5A16A 4W4OC 4ERSH 2BRRL 4YGAB 2VL4A 5BVJB 2V17H 3NCMA 1QBAA 5JOPD 3WIHL 5F44A 4OCLC 2Z8VC 4Y19E 4M6AA 4JDVB 4JRXD 1MHPH 3OTTA 4AK1A 5C0JA 5JW4Q 1DJSA 1EHAA 3F6IA 3S4SG 3BIKA 4ZPTB 5DD1H 5TQ2L 1QO3A 5I15H 2JIXB 3WJLA 3NA9H 5BRZD 4Z7OF 1GHFH 5L2KE 5DVMA 5DGRA 4S11A 2YPVL 3HI6H 3Q5OA 3E0GA 3C5ZC 4BSWB 4F37F 2J88H 3FCTB 1CL7I 4HZLB 4BK4A 5ITBH 3EZJB 3JV4A 3CD4A 1DLHB 1MCPL 3L95A 4D3CH 2IPTL 3VDAA 1MVUB 2CIIA 1R3JA 3CVIL 4MDIB 1WIUA 3FOMA 4KVNH 4MD5B 2VDLH 1XGRA 3D5OF 1JRHL 5CBEB 3NFSH 1MRCL 5MI0B 5JA9A 2HT2D 1PG7W 3CDYA 1NQBA 5DR5L 1YEDA 1IGTB 1KB5B 3DX8A 2FDBP 4YLQT 2BY1A 1S7RB 3ZE2E 1XGTB 4R90H 4PJ8B 4PB9L 5F7YC 2B4CC 3IYLW 1ZHBA 2KZ1B 2UYLA 2E7LA 2A73B 4I3RL 1XGPA 1A14H 4MVBD 2YD9A 3SCMD 4PRBA 1I1RA 1R3LB 1WBZA 3MLSL 3WV0A 1LO5B 5GRJL 1KT2B 4RIRB 4NFDA 1VFUA 4JKLA 4M9PA 4JPIA 4WUKH 3KDMA 2ZOLA 1JNLH 5AWNL 1BLNB 5FDWA 3A6CH 4XNQA 3RBSA 4JO1H 4HS8H 2A83B 1A6VH 1OY3B 3KVQA 4M5YL 1AXTL 2BFVH 2DJUA 1ED3A 3NIFF 1EMTH 1QLRA 3FONB 4E5XA 3FO2A 5JR1H 4JFEB 4JY6B 2NYYC 5L0QB 4LKCB 5E5MA 2X4PB 3O3EA 5C0RL 3M07A 2GJ6A 3VW3H 1BFVL 3PWPD 3P4MA 3JWDC 2A38A 2DYPB 3P9LB 1HHKB 4WEUD 4P3DB 5TGBA 1LO2L 1LHZA 5EBLA 2VDRH 2VN7A 1WV7T 2X1PA 4I3SH 5IV2B 3O3AB 4CVZB 1BQSA 1P4LB 1AGEA 3MOQA 1UM5L 3WHE0 2DWEB 3QEHA 2EYSA 4GW5B 3WDJA 5FYLL 2R4RH 4Z77A 3ZDZF 3ARDC 3PNWB 1WFOA 4N0FB 4MNGE 1D9KB 4DVRL 3DARA 1TJIL 4TQEL 2DQUH 1OAQH 5CZXC 5GSRA 3IDYC 5H37G 2R1WA 5T5NG 4LKXA 4DK6A 4PRIB 5C08D 3KPSD 2DIAA 3MCKA 1TQBB 5IHBA 4S1SL 2R1YB 2FO1A 3L7FA 3ZE1E 4WFHE 1YUHA 2AEIT 4U4BA 1AHWA 3ALPA 4L3ED 2QKIB 5KS9F 4G7YL 1HHIA 1YPZE 3BE1L 3VGFA 2B0SL 5HHPA 3RIAF 4H1LB 5E56A 1DCLA 3WD5H 2XACC 5EOTA 5C0AA 5HHOB 4NM8H 1QLEL 3DOSA 2Q76A 4CW1B 1T0NA 1CYGA 3EYOB 4XVJL 3TA3A 1KIQA 2OS7A 3OB0K 5EUOF 3QDHA 4HIXL 1SJEB 3BQUB 2JELL 5C2BL 4R26H 1Y6MR 4IRSA 2D7TL 4LFHG 3CFCH 2HWZH 4F2MB 1T89A 3FQTA 5IJKA 1LEKB 2OTUA 3EYVB 3HPJB 3GMRB 4ELMF 2WQ8A 1A7BA 1FLTX 1HILA 5EIIB 5F9WB 5KANI 3MGAA 4RWYH 4OF5A 1F90L 5D7LE 2VZ3A 3VXSD 4YHIA 5I73C 1FN4A 4XXCC 3T0DA 5EFIA 2R8SH 4X98B 3FQUB 4LARL 3H42L 1IAKB 1WZKA 3IU4H 4YHYC 3MCLL 5JORB 1FFPB 4PJCA 4YNYB 2AW2A 5C07A 1JF5A 1CZ8H 2H6PB 5DTFB 3MV9D 1FE8H 3D25B 1U8IB 2GK0B 1FIGL 4OFVA 3O6MH 4XI5D 4F7TB 1UGNA 4X6FA 1LK2A 3MLZH 3STZB 1L0XA 3LS4H 3VI4F 1GGBH 4PUBH 2X4UA 4MD4B 5EUKB 1U3JA 4LLVA 3RWJA 3TZVD 3V0WH 1LP9E 3LKSA 5IQ7H 1A0QH 3MNVA 1HHJB 4OZ4A 5E1HB 2NXZB 5FYLE 4R8WL 2A77H 3SJVE 4AH2B 3PWLB 4Z9KB 2OZ4A 5CS7A 2OJZH 3O9WB 1G7LA 4U3XA 3IJSB 1OP5K 1S9VA 2NY5H 4NZJA 1MSPA 4MJ6B 1YMHA 4JEGB 5FCUH 1U8JB 2Z92A 1XIWC 4MVBC 4NM4L 3ULVL 3IDMB 3HN3A 1NGQH 1EJ6A 2BSSA 4XPFL 1OTUC 1EGJA 3DURB 1RZKC 1S7XB 3RHWK 4KUCF 3QCVL 1A1MB 4GW4A 4I4WA 1N3NA 4OKDA 2HJFB 3BO8B 3CSBA 3JWOL 4XH2A 4HPOH 2N4IA 2VLKA 4NQDA 3RUGB 3KHQA 3K1DA 4K07A 1A7OH 4U1GC 5DJ0A 1OHQA 2XWBB 5TE4L 3MMEA 2VLJD 2NZ9D 1MPAL 3ARUA 4EXPX 4U1SA 1N0XL 2YC1A 1E4WL 3CH1A 3JTSB 4WWID 5JW5B 3UX9B 5FYKL 3BEVA 4NJ9L 2OSLA 3U9PH 3CXHJ 4HJGB 4JQXC 1FNFA 3CUPA 2HRPL 2O5YH 4LPUA 1KPUB 3STBA 4QF1A 4L5FL 2QR0A 2XA8L 2XKNB 2OP4L 4FQIH 4TSCL 3RZCC 2EYTA 1MCIA 4G9FE 5A40E 5TDOB 4GQ9H 3UO1H 4RAHA 4OZGF 3VGAB 3EUUA 1YC7A 3CZFA 3OZ9H 1H0DB 3FRPA 3KPRD 1FCCA 3O2VH 1CFNA 4OLWH 3L3DB 4OD3L 3CC5A 5CZVH 5INCB 2X05A 3T3ME 1KIPA 4U1LA 5TDPA 1ZEAH 1M7IB 1I7RB 3MLYL 2DQDH 3WS3B 1DBAL 1M71B 1JNNL 1NAML 4FFYH 4YDLC 1U92A 5L2JB 3H8NA 3VXQB 4YFDB 1A9EB 5KVFH 1NFDB 4LIQH 2H1PL 4FA8A 3FKUS 4MZ2A 1RIHL 2DJSA 3L5WB 2BNRB 1MCNA 3F5WA 3B6SB 5BO1L 3MA7A 3TVMD 5GS1A 2YXFA 1S7TB 2PCPA 1CT8A 4X4MA 4DAGL 4RFEA 1ZVSB 1KYOK 1NCNA 4L4VE 2BDNL 4ONFH 3VXUE 1DDHA 3CGTA 4WEBL 5F89A 2CMRH 4NN6B 5IB2A 2P42B 4N5EC 2BK8A 4PJHA 1FFOB 3DO3A 4F9LC 2AXFB 5DJAB 5E8EA 4KTYA 2IH1A 4NQEE 2UZXB 2Z93A 3FB5B 1DBKL 5GGSB 4QO1A 1KN4H 1JPGB 3TN0C 1RZJH 4KAQH 3Q6GH 4OUUB 3ULVE 4H0HB 1VFAA 2CSPA 1TCRA 4HGWA 3KYOA 4Z7WB 1HYSD 1D5BB 5BMFL 1UCBL 4P46D 3QI9A 5C09E 3SE3A 2VXVH 1AY1L 3GJFA 1A6AA 5E8OB 2EYRB 4CADA 5IGXH 4MCYA 4F33A 1BVLA 2F8XC 1MLCB 4KFZC 1WTLA 1UWEH 4HWBA 2XY1A 4UAOC 3UTSB 2GFBA 4JZNA 4L9DA 5GRYA 4ZFFB 2R2CA 1NBZA 1YMMA 1R6VA 4PJ9D 1NL0L 1WBYB 3LN5A 4EN3A 1EHXA 1KBGL 3HZMB 4XI5C 5FYKE 1MHHB 4J4PA 3D85A 4HIHB 3BAEH 3AU1A 2EEAA 4F3FA 2W59A 3OR6B 1W8NA 2DLEA 2ADJA 3WXWL 4Z7NF 2AK4A 5DJ6A 3GK8H 4GS7C 3T77A 1P69B 5DYOA 1RZ7H 1IILE 5DJ8B 3MRJB 4NRXB 2EH7L 2EIZA 3SY0B 4JFOB 5F96L 3W0WD 5GJTH 3VI3F 1YEEH 5AYUL 3V4PH 2ORBL 3JUZA 1VGKB 4Y5VB 3QJHA 4QRQB 2ZG1A 1Q9WB 3FRUA 3UBXI 5HHNA 1FZKA 3O6FB 4YXLH 3T2PA 3QWOB 1UJ3A 3K0WA 4N1HB 4CN4A 3DMMC 2Z31B 2A0LC 4FQLH 5D71H 5HVGB 4N0UE 3FQWB 2DAVA 1RFDL 3GIVA 4PRDA 4ODTH 4ERSL 4OT1H 1VSCA 2W0LA 5DD6A 2BC4A 4FQCH 3ALWA 4I0PB 4Y2OA 1MHPL 1JTOA 3VH8B 1SEQH 5DD1L 4I2XB 4MNQA 4YBLC 5HYJB 5I15L 4HIJB 3RPKA 3NA9L 4P2RA 3SGKA 2YOCA 1GHFL 4WGWB 1ZANH 2P24A 3EGSB 3QFJB 1S9YB 1ZV5A 5GGRY 2J88L 2VXTH 1QSEA 1F4WH 1MFBH 4QXUH 4YPJA 2YS4A 5ITBL 3SDXB 1T22A 2VISA 1QR1B 2PO6D 2FNBA 4Z0BH 1I4FA 5L8KB 3QUXB 4KVNL 4G8IB 1GOHA 3C8HA 2VDLL 3T8XA 4P4KD 3NFSL 1B0GA 5FYKU 3HG1A 2FJGB 3HZVA 1CLOL 5C8JA 2AABH 5BS0D 3FZUD 3WN5C 4R90L 5K9QI 3IJYA 3EYUH 3ZE2F 3DX9A 1YY8A 5IQ9B 1A14L 4X5XB 2MCPH 1WWWX 5EO0A 3D6GA 4HEME 1XR9A 3AVEA 5F7LB 5IOPB 4L4TD 1DSFH 1KEGH 1F2XK 2HG5A 3I6KA 2ILLA 4YC2B 2PYEA 4GH7B 5IVZB 3V5KB 3VMOA 3VDBA 1NGWB 4YUEH 4WUKL 4C56B 1JNLL 1IARB 3A6CL 5IT2H 2C1PA 2MQ0A 4JO1L 1A6VL 4YK4C 3D39A 3BH8A 4XCNA 1NKRA 1QSVA 1ZKAA 1FFNB 3O8XA 1JZ8A 4G43B 2BFVL 1JK8A 3WNOA 2EDLA 1CE6A 4XB8A 4PJAA 3QEUA 5I1LB 2VQ1A 5JR1L 1LNUA 3KYNA 4YHPA 1M1SA 3AAZA 5CEZD 4R96A 1H5BB 3P73A 4LSRH 3W9DB 4KWUA 3R06B 5EOQH 4QRPD 4KJWC 4F57H 1WEJH 3G5YB 2FH8A 2VDRL 4I3SL 4PRPD 3VWKC 4QXGL 3QDJA 4LVNC 4PJ5A 1CE1H 4OCMC 1QPXA 4TVPL 4UQ3A 3TM6A 3OAYK 1J8HA 1JN6B 2C1OB 5F7FA 2VYRE 4U33A 3ZL4H 3S5LA 4LBEA 3RPIB 3SPVA 5ETUB 5TF0A 2R4RL 4RA3A 3BVNB 1HK6A 4LLUB 5F7EH 1G6RB 2RQ8A 4NNXA 3IFOA 1VACA 3SDAA 1OAQL 3QDME 5FHBH 3V79C 2VR5A 1X9QA 3PHOB 1XF5A 5DC9B 4RQQA 1QFHA 2XTJC 5I1CH 3S9DB 5BVJA 2Z4QB 4PJ9C 2E9WA 2GHWB 1PX4A 4D0CB 2AGJL 1GYAA 3U9UB 4KXZI 1EZVY 3V4VH 4AMKH 5M7QA 1FORH 3VD7A 5F88B 3ZE1F 2IALB 3LKPB 4PJ7E 1Q38A 4ZPTA 1XF3B 4L8BB 4O00A 1A1OA 2MOVA 1YPZF 5DC0A 4M8VA 4GJTB 3CLEH 2P8PB 3X11A 3WD5L 4HBCL 4NM8L 4R2GC 4BSWA 5FGBA 3HZKB 2J8HA 1R5IB 3AXLA 3FCTA 3NH7H 4UI2A 4I3GA 4HZLA 4IOFD 2C7UB 2AEPL 1I9EA 5HBBA 1ZAGA 2V9RA 1MVUA 4R26L 4MJ5A 4MDIA 4S2SA 4WTZA 3CFCL 2HWZL 2JJTC 1GGCH 1VPOH 2ATKA 2XFXB 1KB5A 2GSGA 3G5XB 1U3HD 1ACZA 1GVIA 3KLAB 5B8CB 1NBYB 4JGUA 1R3HA 5C0EA 2BJML 2IFFH 4KRMB 5MHSD 5CSZA 4RWYL 1VEPA 4GXUN 4LCCB 4EEEA 3L6FB 4NZTH 1T80A 3CLFH 4BQ6A 2R8SL 4ZAKC 4HPYH 3IU4L 5E9DE 4HHAB 2F54B 4H88H 1BLNA 5DFVC 3MRBB 1CZ8L 2LVCA 5D93C 4Y5XB 4Q6IB 1FE8L 2Q8AH 4WW1B 3IXTB 4LPVA 3O6ML 4ZFOA 3FONA 3MV7A 3RWGA 3CXDH 4HWNA 1AXIB 3MLZL 4XPAL 5C9JB 3LS4L 1GGBL 2X4PA 3GMOB 4PUBL 5I71C 5ANMB 4HT1H 3U82B 1ZT4B 4XMLL 3MRQB 4KRPB 4J8RB 3JV5A 4HS3B 3D3VD 3V0WL 3P9LA 2ESVE 5IQ7L 1A0QL 3DYOA 2HFGH 4TVPE 4PJEF 1I1AD 1LP9F 1GGTA 4XPTH 1QRND 4TPRL 2E3VA 1JGDA 4IM8A 3T0ED 2A77L 3O3AA 2OMBA 1J87A 2VRAA 5IFAH 1Z9LA 2OM5A 1CLCA 2EKJA 5FV1L 1BIIB 2DWEA 2NY5L 4E0RB 3SE9H 4JRXE 1OGTB 1PYWA 1MFNA 3V9FA 5FCUL 2AJXH 1NGQL 4N0FA 4M1DH 5BRZE 3PQYA 3QR2A 3MO1A 4RMUA 1KC5L 1FL5B 4MD0A 2RFXB 2P47B 3BPCB 2CUHA 2CDFB 2YSSB 3VFUB 3ZKMD 2LQRA 1MJUH 4HPOL 1FYTB 1P7QD 3KYKH 1A7OL 3FFDA 2P44B 3PWVB 1J0IA 2R1YA 4G42A 1GZQB 4U1JB 3KPMB 4PGBB 4HKXB 3ZYIA 4K2UH 3QIUD 2R23A 3PJSA 4H1LA 4RFNB 1D5ZB 3U9PL 1H3VA 1RJLB 3O6LH 3EOYG 5BXFB 1MCFA 1I3VA 2Y07H 4KJQD 3TBTB 5IVXB 1EJOH 1F4YH 4OSUH 2CK2A 4FQIL 3VGDA 4CW1A 2FGWL 2W1NA 1KN2H 3UO1L 5MEOA 3L3KA 3MRIA 3TLRA 3LN4A 2PW1B 5LKNA 1EIBA 2F53D 1RK1B 4JY4B 3OZ9L 5I66A 4XVSH 2CIKB 2DQHL 3O2VL 4PP2B 2Q7NA 1SJEA 4P0DA 1ACYL 3BQUA 4P57A 4OLWL 4QT5B 1T83A 4XMKH 5CZVL 4LSPH 3CFJB 4E41B 1DUZA 1ZEAL 4RFOH 5D5MB 3T3MF 3V6BR 2VNCA 3G5VB 2XICA 4PTUB 3L9RB 1OW0A 5CJXC 2DQDL 4N90D 1FVEB 5EIIA 1AXSA 2XZQL 4GG6B 4X6EA 1J1PL 4BJLA 2AEQH 3DUSB 4LIQL 1EEYB 3EO0B 3O2WH 3IFNH 4PJBE 3SGDH 3VA6A 5KSUB 4LP4A 3PWPE 5FKPB 4X98A 3FB8B 1IAKA 3GSUA 4M93C 2CKBA 5JORA 5FUCC 1FFPA 2P5WA 2AK1L 2RB8A 4KHXH 4YNYA 3QT2A 1A9BB 1XMWA 3QO1B 4RGOH 5DTFA 3HZYA 3D25A 1YY9D 3UDWA 2GK0A 2N7AA 4ONFL 4I18B 4KKCC 3TNNB 1ZTXH 1XGQA 1P2CA 3TP4A 3P9WB 4X6CB 1LVEA 3STZA 3EO1B 5E4EB 1B0RA 3V95A 2YPLB 1YEIH 2PXYB 2GY7B 4MSWA 3VRIB 4PLOB 4FQXB 4WO4A 1RZJL 1B4JH 5C08E 4M48H 5T1MB 4KAQL 4AH2A 3Q6GL 1FIEA 3PWLA 3TBWA 3O9WA 4LK4A 5I74B 4WWKD 4YDJB 1FNEA 4TOYH 2W60A 1U8JA 4KDTA 4PRHE 4OTXH 2VXVL 3KLHD 4KROD 4WW2F 1E0OB 3IRPX 5JPNB 3IDMA 3AREB 3BDXA 1EH9A 4G8EB 4HUVB 4M6NH 5ISZA 2DLIA 1UWEL 1S7XA 1UH4A 2IQ9H 2EE2A 3BO8A 3PL6C 3I3BA 2CDEB 1F5WA 2FLRT 1QEWB 2JJVA 5DUBA 3PP4H 4HUXB 4PJXB 5JIIA 4Y88A 4XC3H 5BW7A 1BVKB 5TQ0H 2G2RA 2UUDH 5KVGH 3MFFB 1G9NH 3IVKA 2FZ3A 3BIBX 1QOKA 4HJGA 2CLVB 5I1AB 2GJ6D 1KPUA 1RZ7L 5E5RB 2XKNA 3JWOC 3RTQC 3T0EC 3VG0H 3LS5H 3PV6B 4JFFA 3F7VA 5GJTL 5LCVH 1YEEL 2N1KA 5AG8A 2WIIA 4KMTH 4MS8D 3WS6A 1A7QL 1E4KC 4X7TA 4PTTB 3F62A 4YXLL 1SVCP 2DQGH 3FT2A 1KCRL 2QSCL 1RUAH 3ARVA 2VITB 3X13A 3QHTC 4WI8A 1NMBH 3C5JA 1AGBB 1CU4H 3BRDA 5D71L 5GGRA 3ZKMC 3VGBA 2KZWA 1N59A 4YR6B 4ODTL 3Q6FA 4YHKH 3RX5A 5HY9B 4U6HB 2I9TA 4LL9A 3VXQA 3IGAB 1F6LL 1NFDA 2GUOA 3A6BL 4FQCL 2WBJC 3L5WA 1CS6A 4XXDA 5AD0A 3MRNB 3LKOB 3ZHLA 3QIUC 1SEQL 2FO4B 2GJJA 3VRJA 1S7TA 4RA0C 3CH8A 5ID0A 3ZDYE 4PJFE 4ZUUA 3WCYA 2VXTL 5C0AD 3E6HA 3MR9B 4EOWL 1SY6A 3H7LA 1MFBL 1MWAL 2H2SD 3HAEB 4QXUL 1FVDB 2ZUQC 25C8H 1IQDB 3KPQB 1Q8MA 1FFOA 3TA3D 1I85C 1EEQA 5DS8A 2AXFA 3KPOB 4OAWB 4Z0BL 3I3EA 4NSKB 5KG9A 3L3JB 3Q2CA 4KK9D 4QHUA 1E28B 4IRSD 1RVFH 4MB3A 4M6OH 5DVLA 1HQRA 4J3XA 4Z7WA 2W9LA 2VLJE 1D5BA 4BQ9A 1N64H 1QSZA 4UINH 1NEZB 1RIUH 2MCPL 3BJ91 5CILH 5A1AA 2KUTA 4JVPA 3QPQC 5E8OA 1DSFL 2EICA 2EYRA 1AIFB 2WUCH 5CKAA 1KEGL 4I1NB 1ZGLB 1QLFA 3WHE1 1MLCA 2ZUSA 4YUEL 4HXAH 2DI7A 2EH8L 1K4DA 3UTSA 5IT2L 4HK0B 3HC0B 5F70A 1P4IH 5C07D 1G0XA 3LZFH 4YPGA 1YY9C 3HE6B 5GXBB 2VXQL 3R8BB 3B83A 3NAAH 3GRWH 3UYOD 1MHHA 3KPRE 4L1HA 1BZ7B 1U8NB 4JZOB 2DMBA 4P9HH 3WLWC 2H8PB 1CN4A 1HSAB 4LSRL 1BBJB 1CDUA 4L8CA 1V5JA 3ZKSD 1S5IH 1PEWA 3MRGB 5EOQL 1ZOXA 3B9KD 3ARTA 3NOIA 5EPMB 3GO1L 2ZSWB 4F57L 1H3UA 1WEJL 1W72A 2DLTA 5DURB 3IU3B 5L9DH 4NRXA 2JCCA 4BFGA 2XNAB 1D6VH 2R2BB 1CE1L 2XN9B 2UZIL 1CQYA 1T3FA 5GGTH 3W2DH 4X4ZA 3ZL4L 2GTZB 4QRQA 4J3TA 4MNHB 1BM3H 1Q9WA 2P5EB 3KLHC 1NGYB 4KROC 3O6FA 2E7LC 5F7EL 2VAAA 1EAPB 1BIHA 2Z31A 4LRIC 4LPWA 4O2FB 2LAAA 3NCYP 4KKLC 4QTIL 3TYGL 3T65A 1C8PA 2PUQT 4NKMB 2CLRB 1AKJB 5I1CL 4HKBB 3FQNB 2VLKD 4NQDD 5IBUB 5F93C 3DV4B 3QXVA 3V4VL 4AMKL 5IR1A 2G9HB 1FORL 4I0PA 1UYWH 2DF3A 1X7QB 1OB1B 4JE4B 1WZ1H 3VH8A 4I2XA 2ZZUT 4PJ7F 5HTSA 1G6RH 3KWWB 5AG9A 3CLEL 2ADFH 3OHXB 4QOKB 5IK3A 3DGGA 1P4BH 2EC9T 4K7PX 2IGFH 1J0ZA 3RVXD 2ZCLH 1I3RB 3NH7L 5DDHB 1LGVA 3LRHA 2J8OA 3UJIH 4IS6B 5IHLB 3QUMA 5DI8B 3BGMB 4G8IA 4YAQB 1GGCL 2V5MA 4UT6H 4NT6B 5E2TH 5F7DB 1VPOL 1ZHNB 2LE9A 2FR4B 2FJGA 5HPMA 1ZHKA 3TF7C 4M7LH 3QJFA 4OCYL 2IFFL 4BFIB 4Q9BA 5CUSH 3KPNB 2VDOH 1UC6A 4X5XA 4Y4HA 5HXMA 4NZTL 4NBYB 5H2BA 5BQ7A 3ET9F 3CLFL 5IOPA 3QQ3B 3BPLB 3DSNA 4OQTH 5SX5K 2QQNL 4HPYL 3TH4T 3MV01 3RNQB 4C56A 3DECA 5CEZL 1Z9SA 1X5XA 2X40A 3ARRA 1ITCA 2BNQE 3U7YH 3N85L 4HX1A 5JDSB 3W0WE 1TVHB 3OKDB 3A67L 4ZUSB 1FFNA 2Q8AL 2E9IA 3AFLA 3GM0A 1QHPA 1EBPA 2H2SC 4LHQB 3BUYB 4MMXC 1NLDL 3MBEB 4HT1L 5JOFA 3F58H 5I8OH 3F12B 4J2XA 4L8DB 1NLBH 3R06A 1FH5H 5HI5D 2HFGL 2NY0C 5TJWK 3G5YA 2D0HA 4W6WB 4XPTL 1DFBH 4YWGH 3MLVH 1ZGLM 2EZ0D 4JANA 1NUGA 3QXDB 2O5ZH 1T89C 5IFAL 2V2WA 3HNSH 3EW3B 3VXNB 2E8ZA 3SE9L 1JN6A 2C1OA 4DQOH 4NQCA 3RPIA 3U2SB 4G7VH 2R29L 2AJXL 1RD6A 5KS9B 4OGAC 1UJTA 3QI9D 4M1DL 2VE6B 5E8DH 3RWFB 4ZDHB 1JHKH 3OAZH 1AO7A 2X1QA 3SDYH 5L88H 3MBXL 3N1PC 4HV8A 2V5YA 4S1DD 4YHOH 2NY3D 1MJUL 3HNVL 3PHOA 3HRZA 4N8VG 2BNUB 2L7UA 3RY6A 3KYKL 3T1FB 5JW4R 3BEWA 2EKSB 1YMMD 1UEYA 5EA0H 2B1AH 3LRGA 4EN3D 5D7IE 5EUOB 3DPBA 2Y23A 4FQ1H 5F88A 4K2UL 3DUUB 5JW4N 1JGEB 3LKPA 4J4PD 3D85D 1NC2B 1RJZB 1B3JA 4D0DA 3O6LL 2P8PA 1EHLH 5BZDA 4PR5A 4WFFD 1RUML 5BS0E 1HHGB 2AK4D 2Y07L 4PIRF 1EJOL 1F4YL 4OSUL 1TQCC 4ZS6D 1IC5H 3HZKA 1KN2L 3L3IB 5FFLA 4ISVB 3OKMA 1NCTA 2YD5A 4Q9QL 5IROC 4DFIA 2C7UA 4L4TE 3UXFA 2DBJA 3OGOE 1UM6H 1JWSA 4BYHA 2KQMA 4R97C 1YNTB 4LSPL 3GSWA 4NP4H 1IGJB 1PLGH 4RFOL 5KVEH 3QQ4B 1A3QA 4LVOB 2PYFB 2XFXA 3BX7C 2D2OA 3EHBD 3EOBB 2V7HB 3E2HC 2QQQA 3EYQD 3LSOB 5B8CA 4HXBH 2DOCA 2UWEB 3T2QA 4LDOB 3JSSA 2AEQL 5C0BE 1EFXB 1FSKC 3O2WL 5DK2A 3DVNA 5CEZE 4GMTH 5J89A 3L6FA 3B9VA 4FQQB 3PUCA 3H9SA 1EA9C 4PJBF 1WT5A 1JZ7A 4QRPE 4ODXA 2DQCH 3MRCB 2ITCB 2K1MA 2GW5A 4MXWL 4KHXL 4MNQD 3CFBA 3JV6B 2R2EB 2YD3A 3MRBA 4HMCA 2NY6C 4C57C 2P8LB 4Y5XA 4P2RD 4U1KA 4RGOL 4HCRH 4IOSD 3RDTB 1UG9A 4HUUB 5DK0A 2OL3B 3IXTA 3RVXC 4H0IA 2W0FB 5F72S 1DEEB 3EZ8A 4DUVA 3SBWC 2HT3C 1QSED 1V3KA 4C4KO 5C9JA 2X4RB 43C9B 2Q1EA 4TTDD 4MLIA 3MRQA 4KI5C 3LEXB 4HS3A 3WFDL 1YEIL 3TPUA 1WCBB 4OZFH 4Y4KB 2CRYA 4P2OA 5SWQB 4DGVH 4OZIF 1B4JL 5EIVA 4XZUA 1NCDH 35C8H 3HG1D 3GMMB 1BIIA 5HHME 1AD0B 1OGTA 4TOYL 5T1LB 1PQZB 1C5CH 2X1XR 3NVQA 4KY1H 3S4SB 4LCUA 1CDHA 3FT3B 3M17A 3V7AE 5LGKA 1V3MA 4WY7H 4M6NL 1FL5A 2RFXA 5FECB 3BPCA 2CDFA 2IQ9L 2PYED 3PP3K 2OK0H 4P5TB 2W0KA 4TUKH 3GMPB 5IWLC 3WO4B 1HH6A 4GXVH 5HDQH 4OZGB 1XCQB 1VERA 3D39D 1IEAB 4M43H 2R1XB 3G04B 2NY5C 3O8XD 3PP4L 3UMTA 3WIFA 4HKXA 5EZJA 1NUFA 4XC3L 3WE6B 5E6IC 5JQ6H 2WSKA 2AJVH 5KVGL 1G9NL 5EBWB 4X6DE 1S7UB 4IHOA 2ZCHH 5HI5C 4KJPC 2V9TA 1V7NH 3LPWA 2EZ0C 3TBTA 5IVXA 3VG0L 3LS5L 3HE7C 2XWJA 4J6RH 1IGFH 4IOIB 4IEFB 5MHSE 2JLLA 1AGDB 4Y4FB 1NCUA 3RAJH 3QDJD 2PW1A 4PY7A 2F74B 4PJ5D 4JY4A 4ENED 1J8HD 1RAMA 3C60B 3G9VA 4QT5A 2DQGL 4K9EC 4QEGA 5GS2D 3KXFB 3SE3C 1RUAL 1ONQB 1S7WB 4GXUM 1NMBL 4NN7B 1CU4L 2E9BA 4PTUA 3P4LA 2R0WH 3SDAD 1MCJA 1NDGB 4RWHA 2EDXA 4YHKL 5D2LB 5LGHH 1EUUA 1RV6X 5D2NB 2B5IB 1GSMA 1EEYA 1NMCB 3QH3A 4FQJH 4X5LA 4EN3C 3GHEL 3IJHB 1E4XH 3DYMA 4CN1A 4WI3A 3D3VE 3FB8A 1NDMB 4FHBD 4J4PC 4LHUB 3PDOA 1FZMB 5SWSE 5JIHA 4K7FB 4XCYA 1QRNE 2BVTA 3PWJB 2IADB 1C7TA 3RNKB 4JG0H 2X4NB 3T0EE 3DNKA 5T1DH 3ZTJH 2DQFA 4FXGA 3NTCH 3QO1A 1KJMB 4P3WA 5SX4I 5HYEA 4LAQH 1KJ2B 4ZS6C 4AEIH 1KG0A 4OZHB 3ZDYF 4PJFF 2BOBB 4N1CA 3MJ9H 4I18A 4NN5B 5H94B 3TNNA 1ZLVH 4O2CA 3HPLB 1IAMA 1RU9L 1BEYH 3EO1A 2X7LA 5ICYB 4M9OA 3L1OH 1CD0A 2YPLA 4ONOA 4O2EA 1FO0B 1A3LH 3QEQA 1SYVB 4PG9A 3VRIA 3SGJA 4FQXA 4ODWB 5T5FH 3THMH 1XGYH 2YA2A 1KTRL 3BHBB 1RVFL 4WHCA 5B38B 4M6OL 5T1MA 5INDA 3EHBC 4LSUH 2R15A 3EYQC 1I1FA 4MCZA 1N64L 4UINL 2FX8H 1RIUL 1JE6A 3MRFB 3BWAB 3DSFH 5DFTA 3HAEH 5CILL 5JPNA 1IEBB 2LV4A 3LQZA 1G84A 1JWUB 4KZEH 2E5EA 1GXEA 4P23C 3BGFB 3H9YA 4G8EA 3BGAA 5E6ZA 2P7TB 4HXAL 4NOBA 5SWZA 5HYFA 1K4CB 2VZSA 4NYLB 7FABH 1PZ5B 5BV7L 5F71A 1P4IL 2VXUH 1RZJC 1O7VA 3LZFL 5D7KD 1XGUB 3RGVA 1GOGA 2FSEB 2F53E 4RISH 3NAAL 3GRWL 1H3PH 2P49B 2XY2A 4HUXA 4Z7VE 1AH1A 4P9HL 1BVKA 3MV7D 5KSAA 4IDJH 1JNHB 2E8YA 4HC1A 3U0TB 3MFFA 3WLBB 5EU6A 2CLVA 2GT9B 1DEDA 1UQSB 3QQNA 3BYYA 3S97C 2MQCA 4N90E 2I07A 2J8UE 1IEHA 1PG7X 1D6VL 2M26A 3TFKC 5BCAA 4QCIB 5J1AB 3FJTA 5GGTL 3JV0A 4LF3B 3LY6A 2IF7A 3W2DL 3IS1X 1HDMA 4KQ4H 1BM3L 4Y19B 3B2UD 3RWEA 5JHDA 4FOMA 3TCXA 5IHZB 2J7LA 4YDIH 4FP8L 4K7PY 1TENA 4ZODA 3HB3C 3ISWA 1U8QB 4LLWB 1AGBA 3TESA 4P5KB 2O61B 3PQYD 3QQ9C 2HH0H 2YA1A 5L2KB 4D9QD 4QRSA 4YR6A 3Q1SH 5D6DC 2IBBA 1D5MB 1S7QB 4JZJA 3LHPL 1ZVHA 1EO7A 1WITA 3IGAA 1NCWH 1SJHA 1XZ0B 3HI1B 4R0LA 3BH9B 4YHMH 2B39A 1URLA 4X8JB 5K33A 1BECA 2Q86B 3LKOA 4K8RD 1CDCA 4KK6D 4D9RD 5EOCH 4EDXA 4N9GA 3QSKB 1G6RL 1HXYA 3KYMB 3WNLA 2AKRB 1FAKT 4JG1H 2ADFL 4WU5B 4C55A 1P4BL 3MJGX 4NKOB 3P4OB 4NQUA 2IGFL 4TSAH 3BN3B 4MQSB 1CD1B 2H26B 4JREC 1UWXH 5F1NB 3J7HA 1A8JH 1IC1A 1QFOA 3MR9A 2ZCLL 5FGRA 1X5IA 3QXWA 3PGDB 1FVDA 3LIZL 4AM0B 1IQDA 3KPQA 1OSPL 3BZFB 4PP1C 3UJIL 4OAWA 3N1QC 4M3KB 4NSKA 2NW3B 3L3JA 3BQUD 5ESVB 3OJ2C 4UT6L 1E28A 5E2TL 4ALAH 3RL2B 1Y0LB 4RGMB 1R3KB 3SDAC 3LDBB 3MJ8B 1ZVYA 5E94A 3W5MA 3TNMA 2YZ8A 3SDCB 4KUZH 4UTBL 4ZNEA 3N1FC 5CUSL 3SQBA 5C0NC 1VEOA 2VDOL 1OP3H 5GGVY 5DMKB 3O3DB 3UZVB 3CFEA 1AIFA 1TPXB 1U95B 1K85A 4OQTL 4W4OA 2OBGA 3DBXB 5IB3A 5KSVA 2ENYA 1KLGA 2FJHA 2YPKB 3B43A 4HK0A 5A3ID 3HC0A 3U7YL 2P5WD 1EO8H 2BSTA 4PLKD 3LB6D 4N0CC 4O5LH 1QA9B 3IFPB 4KGJA 4XB7A 5HYSB 4U6VH 5IVNA 5F1IA 4M03A 1JYWA 4Y2DB 4JFHD 4UBDD 3MOBH 3UPRA 4PB0H 4DGIL 3WXVH 4C83B 1HSAA 1S9KC 1LD9B 5I76B 3IDXL 3F58L 3C5ZA 1WAAF 3GM8A 2AJSH 5I8OL 4OD1H 5DVNA 1I75A 2EDQA 3QISA 4MNGB 1D7FA 1FH5L 4XBEL 3OKKB 2ZSWA 3IU3A 1DFBL 1AD9B 4HKZA 2O5ZL 1AGCB 1ITBB 3VD4A 5MI0C 2PR4L 3HNSL 4WO4D 2XN9A 1B9ZA 4TVSa 4RDQG 4DQOL 4YXHH 5I1DB 3DETC 5D4QA 1SEBB 2AQ2A 3O9WD 4G7VL 4PJ8C 2H32H 2P5EA 4X5WB 5DMJB 2FHFA 3JBG7 4DGYH 5IUSA 4U6XA 1VGEL 1Y6NR 1EAPA 1YPZB 5E8DL 4YFLI 4G9DB 2IBZY 5EU7C 4M00A 4O2FA 4ZUTA 1MELA 3SDYL 5IHUL 5L88L 3GJEB 4CU8A 4YHOL 2NTFA 3G08A 5ISZD 4PV9B 2CLRA 1AKJA 4WUUE 3P11H 3QA3A 3FQNA 3MRMB 2J6EH 4HK3N 1ZGLP 1LEIA 1XEDA 1RZGB 5EA0L 2G9HA 2X70A 4FQ1L 1IAOB 4GRLB 5L7XH 1FFRA 1KXTB 1OB1A 1X7QA 5A2JH 5D7IF 2EECA 2ARJQ 1MJJB 3X3FH 2CGRH 5L0QC 4AIXA 2R0ZH 4QTHB 4JFZH 1EHLL 3GI8H 3VXMB 2ZWLT 1RSFA 1LK3H 1A21A 5J1TC 1IC5L 2D3VA 4X4YB 1BPVA 12E8L 5DDHA 2WW8A 4M6MH 4JFFD 4JHZA 2DLGA 2UZYB 4JM4H 5FEBA 3VXPA 5D7LB 5D1ZB 1UM6L 5KZCB 2JB6B 4IS6A 1MFAL 2VDPH 5DI8A 4NP4L 3BGMA 1LEGA 1PLGL 5KVEL 4NT6A 4XP9H 5EC1A 1D9KC 1ZHNA 5IW1B 4IRJB 5C07E 2FR4A 5AEAA 5JIKA 8FABB 4JCMA 3K46A 3ARDA 3WFBH 1BZ9B 4HXBL 4HFUH 4U0QB 2WAHA 2I26N 4BFIA 5JZ7D 3SEPA 4JKKA 4G6AD 4GMTL 1TQBC 3QQ3A 1MRDH 2VERN 5GZND 3RBGA 4K8RC 4LEOB 1Q0XH 4KK6C 1A6UL 1T7XA 1XR8B 2ITDA 1LP9B 2C3HA 1A22B 3UTTE 1XF1A 2X2YA 1T6WA 1G7JA 4HS6B 1TVHA 3D0VB 4HCRL 2I27N 4ZUSA 1WSST 1DQTA 3PHQB 4RAVB 4D9LH 3KYAA 4OIIH 1PEZA 1U8PA 3VG9B 4NRYB 5JMOC 1BQLH 1TTUA 1CD9B 3MXWH 2FATH 4FG6C 3B4NA 3MFGB 1BD2E 3WDIA 3BQUC 3QB7C 3O45A 3GB7B 5FXCH 3NZ8B 4DGVL 5T3ZD 2VKWA 4MHHG 2WP3O 4G6KH 2MTPA 4M1CD 3P4NB 1NCDL 35C8L 4PJGA 4CVXB 1YJDH 4JVUA 1OPGH 3VXNA 5FF6A 3STLB 2OL3H 3U2SA 2E27H 1AP2A 3BN9D 5F9WC 2CR3A 4KY1L 4A6YB 4OGXH 1YDPB 4GKNA 3RWFA 4WY7L 3VGEA 1KJ3H 4OIAA 3H3BC 1A64A 3RI5K 2OK0L 4MGXA 5I75B 5FOBA 2EC8A 4APQB 3U0PA 3UTSD 4TUKL 4PLKC 4GXVL 4LCIH 4M43L 3UDWC 3P0YH 1H8NA 1E27B 2DQIH 1H8OA 5JQ6L 1JGEA 1INQB 3QULB 2AJVL 1RJZA 3AB0B 2ZCHL 5ECJE 1CR9H 4J1UB 4XP6H 4PYGA 1V7NL 1HHGA 1C1EH 3MRDA 1UVQA 1IGFL 2NXZC 4JKMA 3L3IA 5FYJD 2OR8A 3O9WC 2NZIA 5E8NB 4G8GE 4AYFA 1JHLH 2EDWA 6FABH 1YNTA 1SBSH 3O6FD 4KRLB 2KL6A 4F7EA 4MB4A 4JO2H 3QQ4A 4HKJA 4FZ8L 4OUOA 2PYFA 2Z31D 2R0WL 3RJDA 2FEEI 1XIWA 3M1BB 1P84J 4FFVD 2V7HA 3LSOA 4EKXA 1FVCB 4GUPB 5LGHL 3QP3A 1A1NB 4WTWA 2UWEA 5ALBH 4L4VB 1JFQL 3VXUB 1EFXA 2EDDA 3O41A 4LDEB 4NFCA 3UC0H 3NABH 4DKFH 4FQJL 4FQQA 1OSZA 3MUGA 4MAYB 4PJHE 4I0PD 5T1KB 2WNGA 4NQEB 2XA3A 5J12B 2IH3B 1OAYH 4WI2A 3TJEL 4KQ3H 3WNPA 2JTDA 1Z0NA 4B50A 3RDTA 4HUUA 4LAQL 4ZXBC 4AEIL 5C3LD 1I1YB 1FGNH 3MJ9L 1H3TA 2W0FA 3S88H 1DEEA 3X12B 1VEMA 4JQXA 5DZNA 1MAMH 4WW2B 2X4RA 1BEYL 5C09B 1BMGA 3VGAC 4NO3B 4V1DE 3RTQB 3LEXA 4AQ1B 3L1OL 1I9JH 1J11A 1TCMA 4MA8H 4NO0B 1A3LL 3RWCB 1YN6B 4Y4KA 1I7TA 5T5FL 3THML 5IFHH 1XGYL 5SWQA 2DQJH 1QYGL 3NN8A 2Z35B 4OFYA 5JLZB 1Q9KB 4LSUL 2YN5A 2WBKA 3TBVA 3VGGA 1KJ2H 5D96B 5CLWA 2FX8L 5JZ7C 2O93L 4ONHB 4G6AC 1RUKH 2HLAB 3CSPA 3BP5A 5A2LH 3S4SA 3QG7L 4Y4HD 1JF6A 2X4SA 2VN4A 5FECA 2EEBA 1A7RH 2AK4E 4D0BB 4YJZL 3LOWA 3SHSA 1ZA3B 4I9WD 4JCLA 5JW4M 4LLMB 4C56D 1HCVA 5B3NA 2WM0A 3HMXA 2VXUL 3BKMH 3G6JA 4OBSA 4CVWA 3GMPA 3FFCA 4KKAD 4WI7A 1XCQA 2VJXA 2VXSH 4PGDB 4RISL 1H3PL 1R0AL 3G04A 1OAXH 2E7CA 3S36L 1C5DB 1MH5B 4Z7VF 3WE6A 1MIEL 4IDJL 4NN6C 1JBJA 4C4KT 3AY4A 5EBWA 3VWJB 4JFQB 1S7UA 7CGTA 4HUWB 3QXTA 1NAMB 1CL7H 2ZUQB 3HR5B 4N0UB 2J8UF 2OR9H 4IOIA 1RIVL 2IEPA 2GITB 5FOJA 1LO4H 1AGDA 3UTZB 4OFPA 1G7QB 3BN9C 3C60A 3TN0A 4NQCD 4EI6A 2NW2B 3KXFA 1MREH 2AP2A 5JHLH 5D7SL 3GSNL 4PS4H 1MAKA 3MGOB 4QHKJ 3RA7H 1AO7D 5A2IH 3IKCB 1MHCB 3Q1SL 5D2LA 3S3PA 2EDJA 5D2NA 4MA1B 1QSEE 1NCWL 3GZKA 1F97A 1RZ8B 4OKVA 5E2UH 4YHML 2QADD 4XGZB 4XNXH 3V8OA 5CINL 1PKQA 2H9GB 2VMFA 4JDZB 4I48B 5EOCL 2SEBB 3BDYL 2ZUVA 5DF0A 4K7FA 3MROB 4HUNB 4CMHB 3CDGB 5I1KH 1JMZA 3PWJA 2IADA 3ARGB 4JG1L 2J1KA 3VFTB 4FXKB 1MFDH 4I0KA 4R4ND 5TF1H 3HG1E 2VL5A 4O58H 4TSAL 4XCCH 1UEMA 1XF4B 2RGSA 4OZHA 2BOBA 5H94A 1P6FA 1U8KA 3EDEA 4XT1C 2BXYA 2VZUA 4JB9H 4U7SA 2PW2A 1B4RA 1TETH 3IDIB 3QUKB 3O2DA 3ESVF 1MCDA 1A4JA 2BSED 4O9HH 4Y5VC 5ICYA 2DB8A 1FO0A 3ZMRA 2PYEE 1SYVA 4UIMB 3WNKA 1OGAA 3O6FC 5HI3D 3LAFA 4ODWA 1G6VK 4ALAL 3BHBA 3ZT7A 2Z31C 5I16B 4M7KH 1EEZB 2VUYA 3D39E 4YFLF 4KUZL 3V0VA 4YBQC 3DMMA 2YK1L 4X7DC 1GOFA 4PJAE 3TWCL 1TZGH 4RGNC 3MTRA 3QUYB 1J5OH 4NC1C 4EIZC 1GAFH 2GAZB 3ALXA 3BP7B 4F7TA 4CDGC 2ZSVB 2AJYL 4I0PC 5KAQG 3I6LD 3GSQB 3H9SD 4EXKA 2P7TA 2ICES 3FOLB 2CH8A 4IRZH 4NYLA 1T7YA 2BHYA 3NCJH 3ROLB 1PZ5A 2NLJA 1EO8L 1IQWH 1WIOA 4UNUA 1PSKH 4MAUH 3MV8A 4O5LL 3QDJE 2BP3A 4JHWH 3BZ4B 4PJ5E 4U6VL 5IBLD 4YDKL 1J8HE 2NY2D 3RZWA 3KPTA 3TIEB 1JTPA 4X99B 3VFRA 4OZFG 3HMWH 3MOBL 5I8KL 3S3JA 3WXVL 1JNHA 1T1WB 3U0TA 3WLBA 2AJSL 4OD1L 4ZFGH 2FJFA 2GT9A 1FZJA 5JOEA 3KLSA 3QDMB 3QUXC 3SKMB 4PGCB 2YR3A 4HFWA 4RSVA 4P2OD 4LCWE 2V7NB 2OQJB 4QYOB 4LP5A 4YXHL 4TNWK 2Q6WB 1WBXA 4NQXB 5IB4A 2W9EH 4W81A 3CU7A 3OXSA 4P9HC 3ABZA 5BOPA 2RCSL 1PGRB 2MNUA 3WN5A 1EX0A 2XQYG 3TO4B 1U8QA 4LLWA 4P5KA 4EUPB 2O61A 1TVDA 4YC2C 1BF8A 2BERA 5L2KA 3HS0B 1L0YA 2BRRH 2IQAB 4C54A 1WFNA 2CD0A 3P2TA 5D8JH 5MP6H 2X9YA 3DIFA 3P11L 3CMOH 4LPYA 1D5MA 2J6EL 2CUMA 4OV6F 3HI1A 1OTTD 2ZG2A 3MCG1 3BH9A 1FJ1B 3R0NA 4X8JA 5E24E 1NGZA 5KVMC 2NR6D 2FBOJ 5TQ2H 5DVOA 3D87B 3I3DA 1BOYA 1CDBA 4ZQKB 5DRNB 3BUTA 4F7PB 3X3FL 2CGRL 2R0ZL 1JVKA 4X7FC 4EIGB 2NNAB 3KYMA 4KK5D 1H5BC 2AKRA 2P46B 2YPVH 4JFZL 4WU5A 1KGCD 1MRFH 3GI8L 2X42A 2YBRB 5ERWA 3MRKB 5HJ3B 1I3GH 5F1NA 1KPRB 3OKOA 4QHMB 3QDGA 3E8UH 1AGFA 3D2UA 4M6ML 2IPTH 4AM0A 5EU5A 4JM4L 3GSOB 3ILPB 3CVHH 3VWKA 1MY7A 5I1IH 2HMIC 2AV7B 4C58B 2VDPL 1N2RA 4GMSL 4BSVB 5DR5H 3OB0H 3ECBB 5E9DB 4M5ZL 2BCKA 4YX2H 4XP9L 2COQA 3RWDB 2GQHA 1GZPA 4PB9H 4PJCF 5MERA 2DDQL 5C0DA 3MJ8A 3WFBL 3OKNB 4I3RH 4HFUL 3SDCA 3INUL 1FDLL 5LJYH 3RY6C 3MV7E 5GRJH 5DJZB 1MRDL 3O3DA 1NANI 2NY1B 4BQBA 4LLYB 3ZTJG 1Q0XL 3BZDA 4KRNA 4MXQD 3FO0H 1NH6A 4B7LA 4ZTPH 4EVNB 5IMMB 2WLYA 3DBXA 1B6DA 2AERT 3QCTH 4XNMB 1QBMH 2ESVB 4OBRA 3MYJA 1KNOB 4MA7L 3FQXB 3GKZA 3PXJA 3W11C 4NWUL 5DZOA 1WICA 1IT9H 3IFPA 4JFXA 4D9LL 2JE8A 4H5SB 4OIIL 4JRXB 4Y2DA 4QXTB 4MQ7B 4TNVK 4Y5YB 5I2IB 3PWUA 1BFVH 1ZLUK 2EO1A 3MXWL 2FECI 2FATL 4C83A 5I76A 3DHMA 1LO2H 5BRZB 3PQYE 1RZFH 3OKKA 3ARYA 5HI3C 4Y1AA 4D9QE 3ARZA 2HA1A 2YPLD 4K55A 3WIHA 3QEQD 2HT4D 4G6KL 1X5LA 4FQXD 4JM2B 4QNPE 2VQTA 3K4DA 3IDNB 3HAEG 1YJDL 2ERJB 1OPGL 2YZ1A 2OL3L 1ZXQA 1EBAA 1FNGB 1PKOA 5B8CC 1JTTA 3B9AA 4M8QA 4D9RE 1FGVH 2NTSP 5EO9B 1OP5H 1A7NL 3D1MC 4OGXL 4LCCC 4ZOBA 2Q20A 1DLFL 5DEFB 5ESQB 1KJ3L 4ODHH 1PJ9A 5DQ9A 1PG7H 1M6OB 4XPHL 3GJEA 1WT5C 3UPAA 5MEQA 5I17B 3ULUD 2ADIA 2WUBH 5SWZD 4PV9A 4AIZB 2YD4A 1T5WA 3RI5F 5CP3A 3MRMA 2VOTA 5J6HB 1FNSL 3QWRD 1NEZG 1HHHA 4Y5XC 2VO5A 1JV5B 4LCIL 4ZAKA 2H45A 5GGUB 5IBLC 4Q6IC 4G7YH 3LKNB 3SCMB 3RGVD 1KCUH 3P0YL 1WUNT 4ZUWA 2VH5H 2B0SH 4GRLA 3CFKB 3FB6A 3MLRH 1G7PA 2L7JA 4HJ0C 3T2OA 5E1AB 4YEEA 4A6YH 1BF2A 1MJJA 4G8FA 2JB5H 1KPVA 5KSAD 2C4FU 2NXYD 4ODSH 4WFEE 2BVQB 4XP6L 4KRPC 5EU6D 3VXMA 4S0TD 1KTDB 4OM0H 3NPSB 4POUB 4XVUD 2W38A 1T1XA 4PD4J 3IT8D 3N0PB 1QACA 1CFBA 3WBDA 3HC4L 1CGTA 1G7HB 5D7LA 4PJBB 2W07A 1JHLL 3PWPB 1HYRC 6FABL 5JHDD 1SBSL 4X0KB 5B4MD 4JO2L 2P5WE 4POYA 4M7ZB 4OFDA 2ZJSH 1MUJB 3UC0L 4JFHE 1JGVH 2Q7YA 3ELAT 3NABL 4DKFL 3I2CH 1QFUH 4LARH 5E5UB 3KJ4B 4LEOA 2IAMB 4JN2B 4TRPH 2V5SA 3S98A 2EO9A 2ICWB 4PJHF 1I8KB 1XR8A 4NDMB 1C5BH 1LP9A 4KK5C 2Y5TB 2HLFC 1QPPA 5DHVA 4RFNC 4XBGB 4HS6A 3EO9H 1FIGH 4FXLA 4KQ3L 1ORQB 5C08B 4RX4A 5DRXA 2X6MA 3FN3A 5IBUG 1U8MA 3PHQA 4RAVA 1FGNL 3S88L 2BVPA 4FFWC 2OTWB 3P9MA 1MAML 2Y6SD 1GC1C 4NRYA 3U6RB 4PRHB 3T0XA 3DXAA 1CFQB 3CX5J 1S7VB 3U48A 1I9JL 4MA8L 1QQDB 1FZOB 3I6GB 3ULSB 1KIRB 5ISZE 1V3LA 5IFHL 1P9MC 5JUEL 3B9EA 3AS3A 5FDYA 3P4NA 2LU3A 4AL8L 5C71A 5FUZH 2GTWB 5IFJB 3QUZB 3STLA 1KJ2L 5EDXA 4NM4H 5C3TA 4QY8A 3KR3L 2MFNA 1RUKL 3LV3B 1OWRM 3FN0H 4QRTA 4YH6A 2V2XB 1ZE3C 1U8OA 1YDPA 3MRRA 4NPYB 3ZKND 1Q9LA 4K3GA 1HSBA 1A7RL 4Z6AT 5HD8D 5DJ2B 3RWIB 4P4RB 3KS0J 1W2KT 3RU8H 1C08B 3BKML 4I5BB 3DX7A 1L6XA 2CLZA 3PGCA 4JFFE 5D7JB 2L4OA 2VXSL 3O4LB 3TYFA 3REWB 3OF6A 3BJLA 5LQBH 1OAXL 5CWSA 5IMLB 5HGBB 4H25B 4I18C 3REVA 3QNXB 1INQA 3QULA 4Q0XH 3JVGC 4Z5RA 4FTVE 4TUOB 2HRPH 1L7IH 1LO0H 5E4EC 2YWZA 3MUY1 1MJ7H 1WVZA 4J1UA 3C5ZD 4TSCH 4J3SA 3P30L 5HHVL 1YA5A 1CL7L 4KKBC 2PXYC 2WIMA 3SGJC 3B2VL 4FQXC 3VD9A 2OR9L 2BXZA 1LO4L 1ND0B 1NFDE 2XN9D 1A2YA 4QRRA 1CF8H 1FG2B 5E8NA 5I74C 4XP4H 3SKOA 2P5ED 3TZVB 1MREL 3AREC 3IXAA 1CG9B 5CJBA 4BKLB 1DBAH 5JHLL 1KEMH 4PS4L 3RA7L 4DVBB 1RUPH 1V3JA 3M1BA 4I77H 4FQHB 4UV7H 1FVCA 1T21B 1YN7A 2P4AB 2YEZA 4PJFB 1FQ9C 1AKJD 1RIHH 3VXUA 2AI0H 5E2UL 5BO1H 1RZIA 4XNXL 4LCYB 3MLPA 4YZFE 3PL6A 3TIDA 4ONGH 4MDJA 3ZT6A 1ZS8A 4MYWB 5T1KA 1P84K 3RVWC 5IEKB 4EI5B 4NQEA 5T3ZE 1DN0B 4Q74A 3BXNB 2GSIB 1MFDL 1YEHH 2IH3A 1FFQA 5TF1L 4XVUC 5IEHA 4O58L 4XCCL 4KVCH 2CRMA 3MPCA 5KSBA 5E00B 1UB6A 4JB9L 2VLJB 2P8MA 1TETL 4NQSB 3T4YA 5C09A 3KAAA 2C4FT 4NO3A 1B88A 3L5JA 3MUZ1 3O81A 2MPAL 4O9HL 2YRLA 4OI8A 3RTQA 3MREB 3ILQD 2IPUK 1KOAA 3C5SB 1YN6A 4KTEH 5B4MC 1GGIH 3UZEA 3I02B 2PKDA 1JCKA 1E4KA 4M7KL 4X6BB 2VKXA 3I75A 1H9VA 5BMFH 2HVJA 2AXJA 4JRYA 4KH2A 4O51B 5C0FA 3ARDD 3AUVA 1TZGL 3KPRB 1S9WB 4OLVH 4OLXH 4PJAF 1J5OL 2X4OB 1GAFL 4GRWE 3GGWA 5CZXD 1IGYB 3DX6B 4JJ5A 1ZT1B 2CXKA 5GSVB 4YHLL 2MMXA 3C08L 1ZA3A 4KXZH 4GT7A 4IRZL 4LLMA 3NCJL 2WBJA 1EXUB 1S5HB 1IQWL 5FYJE 1PSKL 4MAUL 5DHYB 4M61B 2JCCE 1GGYA 4JHWL 4OLZH 1TLKA 1JI2A 2FWOB 5J0BA 4R7DB 2D7NA 3DUHA 3TBSA 1AI1H 1MH5A 2Y6SC 3GHBH 3HMWL 4U1HB 5D1QB 3O6KH 1HH9B 2R39A 2BOCB 3TVMB 3VWJA 4JFQA 4ZFGL 2EIBA 4LGPB 2OTPA 1K8IB 4HUWA 1NAMA 2W0PA 3LCYA 2D31B 3CNKA 4YIQA 3VFPB 2VZOA 1J9CT 1YZZA 4JPKL 5CHNB 3UAJD 4JHBA 1I85A 2ZG3A 1D5IL 3LPGA 4RAUB 1G7QA 1WQVT 2W9EL 4ZYKB 2FYYA 3OAYH 1GIGH 4TNWF 2NW2A 2Y06H 4OCRH 4IMKA 1F3DH 3O3BB 3FTGB 2ZOKB 3PIQA 3QNYA 4HSQA 5HD8C 3MGOA 1MWAB 5CGMA 3RKDD 5DD5H 3IKCA 5D8JL 5MP6L 1I3UA 1D5XB 3CMOL 1YEJH 3GSVB 1N26A 4LLQB 4NHCH 2EE3A 3F7YB 4P46B 3GIZH 1RZ8A 2CRZA 4Q9RH 1XCTB 3HE6C 4JAMA 2OMNA 1MIMH 3VFNB 4NCC1 2H9GA 5C0CB 2RIKA 2A1WL 4QWWC 2SEBA 4OF3A 4XPBL 3JTTA 4NKQB 3PXHA 3CDGA 5MEPA 3VFTA 1MRFL 3HCVB 3H0TB 4FXKA 3CK0L 4EUPH 4XWGH 2VTFA 1I3GL 3K7UA 1XF4A 2QLVB 1MAJA 1CXHA 3E8UL 1B2WH 3IKKA 3G6DH 4JFYB 1UM4H 4PV8B 2YD7A 4MLSA 3NZHH 3CVHL 1QD0A 4L3AA 4MX7B 5I1IL 2OXHA 5FYJU 4RBPK 4PJDA 1T7WA 4UIMA 2G75B 4K3HA 1CLOH 4YX2L 5IW3A 3ROOB 5IB1A 2Y4SA 2X4TA 2BNQB 1EEZA 3W0WB 1G9MH 3ORJA 1TZIB 1XIWD 1U8HA 1JHTB 3LEVH 4LRIA 5K93A 2ZP0T 4F9PC 1DUYA 4Q2ZA 2ADGA 1OTUD 1EFXD 2EXYC 3BESR 2GAZA 2KBGA 2ZSVA 3CCHB 1EUTA 3FO0L 3GSQA 5SV4A 1ES0A 4ZTPL 3QCTL 5DWUH 1QBML 3NCEB 4G80A 3ROLA 4QXWA 3PABA 1SQ2N 1IT9L 2HFEB 5FO7B 3PWNB 4JHAL 1X3DA 1HXMB 1WFUA 2D7PA 3BZ4A 4BQCA 4N8CH 4QHKI 4QRUA 3RDTD 2WLZA 4NQCE 3H9HB 3RX8A 4LHUG 2KDGA 3G9AB 4U1NB 5IKCB 1I8MB 4TNVF 1UZ8B 2C3VA 2EE6A 3ILQC 4JVWA 1BFSA 1HWHB 1RZFL 3SGEI 1AO7E 4JO3L 4QXGH 3RZCD 1LE9B 4PGCA 4Y4KD 2GKIA 5I8EB 4TVPH 3CSGA 4CJ1A 4DK3A 2V7NA 1T1ZB 5ADOH 4IMLB 4QNPF 4OFYD 1VFMA 2X41A 2Q6WA 1EDQA 5I19L 4NQXA 4F8TA 1FGVL 2EDHA 4N1EA 3OJDB 2PO6B 3LH2H 5GRVL 3HTLX 3TO4A 1HINH 4ODHL 3DTXB 1PG7L 1CFSA 5B38G 4P4KB 3BPLC 4LNRA 1CCZA 4KMLB 2VLRE 3HS0A 2WUBL 2IQAA 3CMGA 4O4YH 5BS0B 3AS2A 3IF1B 2AGJH 3SQOH 2DM7A 2EDTA 4GRMB 3ZTNH 2KKQA 4PY8I 3FFCD 4X83A 1KCUL 3U4AA 3W81A 2VH5L 5EZLB 4L4TB 3RVUC 3TO2B 3VXTA 3MLRL 4DCQB 3NIDF 2IC2A 2X10A 4ZQKA 2APXA 5DRNA 5ITFB 4F7PA 3CJJA 4A6YL 1IFHH 2ZNWA 2JB5L 3MODH 4JR9H 4HBCH 4TYUA 3U4EB 3MBEC 4ODSL 2OCFD 5DSCB 3AC0A 4OM0L 4JFPB 1KIUA 3LQMA 5JMRA 3MRKA 3UAJC 2A6KB 2AEPH 4N5ED 4B5EA 1QVOB 2ATPB 1JYVA 1L0QA 5C0BB 1RJYB 4H26A 3RL1B 1U91B 3ILPA 1J18A 3I6LE 3H9SE 4NRZB 2AV7A 2IPKA 4KK8D 4P59L 1N6QH 3TN0D 4QRPB 4BSVA 1F42A 5LXGL 3WJJC 4OJFH 3KXFD 5H35A 3HUJA 4HIEA 2CO6B 3RWDA 3PGFH 1REIA 1MCRA 3RKDC 2YKLH 1M05B 1XFPA 2BJMH 4NO2B 5F8RC 1UXWA 3OKNA 4XX1E 2ZJSL 2FHCA 3HLAB 2UV3A 1C16B 3TEUA 2C3WA 5HVWA 1JGVL 2APBA 4LGSB 5C0GB 3I2CL 2D0GA 1QFUL 1XF2B 4W6YB 5DJZA 4TRPL 3P3YA 3QYCA 1C5BL 4XNMA 1R5WA 1G1CA 4NZRH 5ACZB 1FV1B 3FQXA 1CIDA 2XQBH 1BJMA 3EO9L 5DO2D 3OKEB 2VIRB 2X5PA 2VDQL 1JUFB 3W9EA 4XPAH 1CXKA 4M7JH 5HHMB 4H5SA 4Y5YA 5I2IA 3B3IA 5J06A 2Y7QA 4XMLH 1X5ZA 4PJEE 1ZLWK 4ELKA 4ZSOB 2DL2A 2QJDA 4TPRH 5IROA 1OGAD 5EO1A 4JM2A 3EOTH 5FUZL 5F3BB 4LVOC 4XCEB 3OBAA 1MI5B 5GRVK 1NGPH 1T5XA 2G60L 1FNGA 4YHNA 3VRLE 3VMNA 1KULA 3DMMD 3FN0L 3CDCA 2OYPA 4OIBA 1KC5H 3EYFB 2PF6A 1L9MA 2A0LD 1R5VB 1IM9A 1JF1A 4ZOCA 5DEFA 4WNQB 1KGCE 4X6DB 2XZAH 5I17A