2ENSA

Solution structure of the third ig-like domain from human advanced glycosylation end product-specific receptor
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
96
structure length
96
Chain Sequence
GSSGSSGLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Advanced glycosylation end product-specific receptor
publication title Solution structure of the third ig-like domain from human Advanced glycosylation end product-specific receptor
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ensA01
4LCWD 1MPAL 4OUUA 5FYKH 3WIHH 3QXDB 2JJVA 4HMDA 3DRQA 1U8NB 3IJHB 4NFCA 2HVJB 5D1ZA 1EA9C 1E27B 1HEZA 2DQHH 4FXKA 2GJZB 1QG3A 1J0HA 2VDNL 4CVWA 1UM5L 3CCHB 1FBIH 1U8KB 2DOCA 4XH2A 5J57B 2DM3A 3CVIH 3BKML 4KU1A 5DEZA 2E9WA 3TM6A 4ZFGH 3FQXA 1GYAA 4D9RD 4U6YA 1AHWA 2DQTH 5CEXA 8FABB 5IB5A 2WANA 2NY4B 4KMTH 5D6CB 2GKIA 1P53A 4JLRB 1BBDL 1NMBL 4KHXH 2C4FU 3CZFB 4Y4HB 4QRTB 4X9HA 4UQ3B 3U0TA 3ARZA 5FEBA 5F44A 3I6LE 3KLAA 2DLIA 3TYFB 4HLZG 1MWAB 1X5FA 4K71B 1EHLL 3W9DB 1QSEB 4WY7L 5IVZB 4NUJA 2EXYC 4LCWA 3U7YL 2Y06H 3IJSA 1A3LH 2C3HA 25C8L 4M93C 5EU5A 3ESVF 1EHNA 4E42B 5JORB 2DJSA 1EGJH 2BXZA 4H88H 2F9BT 4HV8A 3KPMB 4R90L 3FQTB 3MJGX 2Q8AH 5H35A 4XVJH 2C1OB 3PNWB 5HHOB 5CSZB 1SJEA 5CIPA 1JYWA 5FO9B 3QH3B 4GRWB 1NGYA 3G6DL 3TIDA 5ICZB 3SE3C 3LIZL 5GZNC 3Q3GA 2RB8A 4PJDE 3MR9B 2F53A 3NCJH 1A7QH 1J0ZA 1DVFA 4JREC 3QNXA 4LL9A 5F96L 1F11B 1ZT7B 4PJHB 1TETL 5TF0A 4KXZI 1FVDA 1X5JA 1LNUA 3P4MA 1TCRA 3V6BR 1FE8L 4F37K 3JWOL 4YIQA 5EZJA 1CS6A 3P0VL 5F21B 2X42A 4Y5YC 4LLYA 4MD4A 3MCKB 4OGXL 1KJMB 2ENYA 4QWWC 4XVUD 4XBGA 2O5ZH 5GJSL 1Q9KB 2GSGA 2VN4A 5AYUH 4OD2A 5SWZE 4EVNA 1IZJA 2XTJD 1FL3A 5J12B 5HY9A 1J12A 1AQKH 5DRZB 3KDMA 1A1MB 3DXAE 1AJ7L 2HTLD 3QA3A 3PP3K 3PJSA 4JO1H 5TF1L 1OGAE 1T5WA 1A4JA 5GRUL 3RWGB 1T83A 5DHYB 4JFXB 5IFHL 2HKHL 1RK0B 1ZMYA 5IQ9A 2JELL 3L3KB 1JRHL 1SYVB 5EO1B 4HGWA 2YRLA 1U8OB 1VEOA 4MCZB 4Y4FD 5CINL 1G7MB 2Z31D 4HS6B 1IM3A 1CD1A 4QY8A 4NJAH 2NX5E 5LAXB 3G6JF 2A6KB 3OJDB 4NQUA 2DMCA 3ZDZF 1KLGA 4MA3B 4OZGE 4X80L 1FIGL 1S9WA 1H3PL 3PF2A 3UJIH 3WLWD 5GGTA 5DTFB 1JHTA 2AQ3A 4Y8DC 4NUGL 1FZMA 4UV7H 3TIEA 5E00A 3VFVB 4AEIH 5DQ9B 3BKJL 2YEZB 1JF5A 3DX7A 2ZSVA 3UZQA 4R8WH 3CXHK 4YHML 4UBDD 3O6FA 1YEJH 4HIIA 5D72L 3RUGA 2X4PB 1T1YA 1JHLL 3FONB 4OZFA 5LJYH 3BKCH 3IT8D 4P4RB 3KLDA 5GRJH 4HDIA 2ATPB 3QO0A 3VMNA 3ZKQD 3GHBL 2G9HB 3ZT6A 2FBJH 5FM5O 3RWJB 1JZ4A 2AV1A 1U8JB 3I6KB 3BW9B 2ED9A 5IWLA 1KPRA 2D7NA 3EFDH 3ZYZA 2BY0A 32C2B 1FDLH 1CVSC 1G6VK 2NW2A 1J1OL 3NCEB 2HMIC 4FN0A 1NJ9A 5DRXA 5JHLL 3QJFB 5FUOH 5C0BB 1CXLA 3HMXA 1KULA 5C0EB 1CTOA 1I3RA 4BSJA 3O2DL 5GRXG 4OF6A 2VLLB 2IBBA 2V5SA 5ELIA 3HLAB 3QT2A 3O4LD 1A6AA 3VXOA 4P5MA 2CLZA 2HRPL 4O9HH 4Z0BL 3OZ9H 1XGTA 3L1OL 3JWDH 4XP1L 1K4CA 2FD6L 1BAFH 4M7LL 1YEKL 1JYXA 4K23L 1MCKA 3RTQB 4YXLH 2BMKB 3HNTL 3K8KA 4XP5L 3K2UL 2J2ZA 4M6OH 4PG9B 1XF4A 5IT2L 3PGFH 3W11C 4AG4L 5DFTA 1CIDA 3C6LB 4PJCB 2VXQH 4DOHE 2W9LA 4YC2C 1KTLB 2FGWL 4MQSB 4UQ2B 5D7SL 2P46B 4PRHE 3W5NA 4S1RH 2UZIL 5KSAB 1J11A 4X7SL 5GGRY 5DMKB 4PJDA 3DXAD 5GS1A 2JCCE 4LRIC 3EYVB 3HN3A 7FABH 1F45A 3WFCH 5TH2B 4CU6A 2YC1A 2IAMC 1KXTB 1UCBH 3MOAL 4NFBA 3OR7A 3G6AA 3DSNA 3HPJA 5E4EB 2E7CA 4ZPTB 3JWDC 5F3HB 3NAAL 1AE6H 4FFVC 4P57A 1JGUL 3DMMD 3MODL 1NCWL 5CP3A 4ZAKB 3WIFA 3QEHB 5MHSD 2B5IB 4Q9RH 4M4PA 4D0DA 4LCIL 4G6JH 3ZL4H 4ODTH 4PGJA 1ZS8A 2DWEA 2NCMA 2E27H 4MCYA 5K59E 5A2KH 3NGBC 3BP6B 2NX5D 1G6RB 4EI5D 5DEGA 5SWZA 3VI3F 4P23A 4ODXA 4AT6B 1T21B 5A2FA 4HHAB 4X5WA 1N6QH 2DWDA 4DVBA 2DLEA 3L5HA 3LD8B 4IOFD 5HGAB 1SJHA 5DO2D 3DXAA 3TP4A 2OJEA 1LE9A 4PREB 4JR9H 1NEZB 1PVHA 4OF0A 4MX7B 4QXUH 4H20L 1OGAA 4OZFG 5J7CC 4FFYH 3ARBB 2WAHA 3DO7B 5C0DB 4N8CH 3P4OB 3MUY1 5EBMA 3TPUB 4LF3B 4X8JB 5JIKA 4P46C 1WV7T 4JM4L 1WT5A 5KVEH 2OTUB 3H9ZA 1TENA 4YDKL 5IOPA 4OCXH 3SBWA 4HUXA 5L6YL 3P11L 4D3CL 3CVHA 2NX5A 3W0WB 2HA1A 4JRXB 2PXYD 3MRCA 3HZVB 4EDWL 3B5GA 5HGHA 4J1UB 2L4OA 4OZGA 1UEYA 2OLDA 2ADFH 2F15A 4NQVB 1CFQB 3I75A 4M1DH 3PWLA 1H8OA 2X4QA 4J4PC 5BW7A 2UY7A 3A6OA 2Y7QA 2H26B 4Z76B 4LCUA 2MCPL 3UBXA 4UUJB 5E95B 2XXCB 4PB0H 1TITA 3CFCL 3PHQA 5E2VL 2EKSB 5MP6L 1W0WB 4NZJA 4GRWH 4OSUH 4YFLI 2EDFA 4GQ9L 1VADA 4ZO7A 5F9DC 3X17A 3MA9L 4RIRB 2NY4C 3M17A 1D3CA 4LSTL 3OHXB 5C7XH 4X4YA 1D9KA 1I8LC 2YD3A 3MNWA 1WAAE 4X7TA 2GSIA 4PJXF 1DBJH 1HQRB 3CDCA 5TFSH 5AZEH 1UXWA 3QWRD 4K71C 3HI1A 1Z9LA 4GAJL 4Y2OA 1QSZA 1MRCL 1AP2B 4OQ1A 3D87B 3FL7A 2ICEA 1O7VA 2A6JA 1KB9K 4JFOA 4ODWB 2AJZB 5IVNA 4MJ4A 2VH5H 5ITBL 2RFXB 3DHMA 4KJWC 1CFSB 3GJEB 3UTOA 4I48A 4ODSL 1WIOA 1A3QA 3QEUA 4Q97A 4KJYA 2XA8L 4DGVL 1OHQA 3IAGC 3MLYH 3O9WA 4MA7L 3TBVA 5DSCA 2KDGA 1S7TB 2CKBL 3S9DB 5C0GB 2DL2A 3QCVH 5D7IF 4JZJB 5F1IA 5IV2A 3O11B 4MJID 5ABDE 4M6AA 2VZ1A 5DRNB 4OFDA 3S88L 4PJAE 1IJ9A 1NCCL 1F90H 4LP4A 4P2QD 1FAIL 2ESVE 1YMHA 2ZUUA 4M48H 1MCDA 4RFEA 5IIEB 1CE1H 3ECBB 4PRHA 5DHVA 4TSAL 2BNQE 3BDBA 4XP9H 4E5XB 2WIIA 5DJDA 2JCCA 4GUPA 1IC5H 3SDAA 4OCSL 4I13B 1DJSA 2EIBA 2VRAA 1YZZA 4WEBH 3T09A 3SE9L 1JN6A 1UM6L 1MAML 4YK4C 3C60A 5F7KC 3CAFA 3X11A 4MDJB 1SM3L 2AABL 1EUUA 4PUBL 3R1GH 1L9NA 3LRSB 4XB8A 2AEQH 4LMQI 1GJIA 1MQ8A 2EIDA 2OQJB 3MLPA 1KJ2A 5J12C 3P77A 1GOFA 1TVBB 2W59A 1OAZL 5SWQA 1DFBL 1BM3L 3O3BA 1UB5A 4ZUTA 4OIBA 5IW6B 2NY6C 4IM8A 3WNPA 5CS7A 3TYGL 3U9PH 2P8PB 1VFBA 3F7YA 4JDZB 1N5YH 1FSKB 3D39E 1LK2B 4NDMB 3GFUA 5J11C 4ZS7H 2D0FA 5HTSA 2DQIL 1CDYA 5CJBA 4Z8FH 3OAUH 2C4FT 4WW1A 3B9AA 3DUSB 2DYPD 5IMMB 3UBXG 2Q7YB 1IL1B 5HHXL 4ZFZA 4GAGL 3ULUL 4U3CA 2OZ4L 3RI5K 4QHUB 4LARH 1S9XA 2Y1VA 2VO5A 1TCMA 2V9RA 4ACPA 4NQDE 1B0WA 3H42H 4K9EL 1KIQB 2VR5A 2GK2A 3MV11 1K3IA 4M7KL 4DCQA 2C7UB 5GRZA 2GK0A 4W4OC 5SWSD 4BKLA 3H9HA 3QIUB 5BOZG 1I9JL 2MQ3A 1S7UB 3QUKA 3V0VB 2EDWA 3VE0A 5DQJB 4WI3A 4BQBA 4WI9A 4RX4D 3GRWA 1S8DA 1VSCA 1A6ZA 4QRSA 1F2QA 4MB3A 1Y18B 4PJFF 2XPGB 1M4KA 4HUVA 4PJEF 3CIQA 5FB8A 2DKSA 3HUJF 1G9MH 3S34H 2CK0H 5C3LD 1KGCE 2X9WA 2Y23A 2R1YA 5DF0A 1NANH 3WSQH 3MJ9L 2VDOH 3UDWA 1G7LB 5HPOA 2OJZH 1AGEA 1YMMB 3ZDXE 2EDRA 4TPRH 4UT9H 1IGYB 5GSRA 4TOYH 3P2TA 6FABL 2R23B 2IFFL 2VXUH 4GSDH 2ESVD 1N26A 1FYTE 1YN6A 5L0QB 3RBSA 2JTDA 1KEGL 1RHHB 1WAAA 4PGBB 4LIQH 2XI9A 1MJ7L 1N3NA 5DLMH 4I3RH 2GCYA 3QPXH 5DMYA 2ATKA 1JVKA 2BNQD 4KGJA 2Z8WC 1V3KA 3BSZH 4XBPB 4LKCA 4Y89A 5FYJE 1G9MC 1F2XK 3EO1B 3RTQC 5FHBH 4O02H 1QR1B 1V3JA 3WHE1 2P8MB 3C6LC 1D5IH 1B0RB 3UPAA 1BQHB 3NZHH 1G6RH 1YNTA 1VB9A 1CXHA 4MJ5B 1WIPA 3W39A 4DVRH 1RZJH 5EUKA 1T1ZB 3KPTA 5KSAC 1H8NA 2Q3AA 2DDQH 4PJAA 3VXNB 4LASL 4FMFA 2DBLL 4NQEB 1QBLH 1YECL 2ESVA 2V2TB 3D39D 4P59L 1UFUA 4JGJA 3R06A 4RISH 3VXMB 3H7LA 1T7XA 5E4EC 2NR6C 4NQTA 4ODVH 5J9PA 4KVCL 2K9UA 1MH5A 2BNQA 4AENA 4MAYC 3VWKB 2ZUYA 1OARH 3QNYB 4ZAKC 3ULVE 1UT9A 3X3GL 1INEL 3PGCA 1D6EA 1F8TH 5AUMA 3I50L 2EICA 3MRMA 4NQDD 3KS0J 5SV4A 5I76B 5IHZB 1RZJC 1LEGB 5C9JB 3MRKA 2R2BB 3WIIH 3REVA 3LD8C 3BH8B 5F9OH 3IKCA 3T1FA 1IM9B 5ILTL 3LPGA 2VLRD 3KPOA 4TVPE 5T3XE 4WFHD 4YDJA 3D39A 4G6FD 3N50A 3ARBC 4YFLF 5EOTA 5DMIL 2CUMA 2CGRH 1IQDA 2ED8A 4HC1H 5DURD 3ZTNL 2DQGH 1TQCB 4OCRL 4NHUB 4PV8A 1CL7L 1U8QB 5ESQA 1NAML 2FYYB 3UROR 2V5MA 4PRIB 4G6KL 5ID1A 1WSST 3HC4H 3OV6A 3RA7H 2V17H 2DLGA 5EO9B 2Y9RT 1XGUA 1KTRL 1YUHB 5I9QB 2CIIB 3QUYD 3DV4B 3WKMH 5HGBA 4MZ2A 4IRSD 4NO2B 1GXEA 1ZA3B 4RBPH 3TJHC 1MJUL 2BCKB 1NH6A 4LNVA 5TPWL 4HWEH 1ZVSB 1J1XH 1T0NA 1PZ5A 1R3JB 2Y6SC 2EE9A 1ZHLA 3VD9A 3JWNC 3KWWB 5AD0A 3CPLB 4LLVB 4APQB 2X4SA 2Y4SA 1TIUA 1C12B 1UCTA 4GO6B 2FHFA 4YBQC 1KNOB 2ZCLH 1ZLUK 1AR1D 3GDBA 3ETBF 2X89A 3UO1H 2LAAA 4I5BB 2ZUTA 4HULB 3B3IB 4NJ9H 2JIXA 3OJ2C 4IRSA 1T22B 5BS0E 5JO5A 5I1CL 3WXVH 3HR5B 2EE6A 1KCLA 5TDOA 1LO5B 4LPUA 2PTTB 4YEFA 2CJUH 1I7UB 1BQSA 1FYTA 5GGVL 4NKMA 5EU3B 3AXLA 1BFVL 3EJYC 4POZD 1S9YB 2XYCA 4HJ0D 1NUDA 2IBZY 1K5NA 1CXFA 1IC4L 2DMKA 1CDIA 1MF2H 1P2CA 3MRDB 4LLWB 4OIIL 4XNUL 5H2BB 5K93A 1XCTA 3HR6A 3TFKC 3AU1A 4J6RL 4ZOAA 3ULVD 5I18L 4JZJC 5CEYA 5FDWB 4TUKH 2O5XH 5DJ2A 4JPVH 5J56B 2PO6B 5I1JL 3QIWB 4Z7UB 3ZTJH 3DI2B 3IB4A 4FQLH 4YDVA 1KYOJ 4MD5A 3CDGA 4CL7A 4KUCF 4QRRE 1CBVL 4A6YA 3OKMA 4DTGL 4PP2B 1RULH 3QAZC 3T77A 1VGKB 3BDYH 4TVPD 5T3XD 1A7NH 4AL8L 5E8PB 4JAMA 5JXED 5D70L 3SGDH 4MB5A 3FFCB 4ZUSA 1JGVL 5CEZD 1A6UL 1JZ5A 1JI2A 2R9HC 5BMFH 1IEHA 3UYRL 1MWAL 2KPNA 3RX7A 3AY4C 3D48R 4X98B 4XX1G 5IJKC 3VRIB 2AJVL 5IBUG 1Z9SA 1K8IB 4GBXD 1Y0LA 3GSNA 1J5OL 3UTTE 2B4CH 3QUMB 5TQ0L 4WUKH 4G7YH 5DJ6B 4RGND 4LSSL 1HINL 4FQXD 3ROLA 3SEPA 3MLWL 5T5FH 5FKAB 3GSRA 2IEPA 3SKJL 5JQHC 2Q6WA 5GHWH 4NHCH 3BXNA 5E8DL 4JCLA 5JXEA 1FYHB 1G9NH 3MLVL 2F5AL 5EC2A 2X6MA 2E6PA 2CH8A 3JV4A 5GRVL 4HFWB 2NLJB 1YEEL 4HXBL 5GGRA 4ENED 4LP5A 1D5ZB 1OTTD 3I6GB 5DZNA 1VACB 3MUGA 5IFAH 1BFOA 5KSBF 3VWJC 4X6CF 4S1DC 3HE7D 5FECB 1ZGLB 4CVXB 2NMSA 4C56B 1D5MB 5BS0D 2A6DB 4FQXA 3L7EA 2UWEE 4KZEL 3O3AB 1LGVA 1FNEB 3GMLA 4HXAH 1UM4L 2VOTA 5AAMA 4KJQC 5F7YC 1G9NC 5GGSY 3KPSD 1C08B 4QTHB 3UTPE 3G5XB 1CXKA 4XBEL 1FGVL 4NNYA 3V4UL 5CZVH 4ELKB 3DV6A 1WIUA 3SDCA 4GKNB 5EA0L 1HWGB 5FA4B 4AIOA 3MYJA 1LMKA 2NY0B 1TTFA 1MCJA 4PTUA 5T33H 3GEWB 1HQ4B 3QIBB 4TVSa 2A9MH 1GL4B 1P84J 3NIGE 2H6PB 1IT9L 5JTWA 3HPLB 4GAFB 2Q76A 3SCMB 1R3HB 5L0QC 5CJXA 1X5YA 1KIPB 2IBGA 2IPKA 2NY7L 4NZRL 5IM7A 1YNLL 4G6AD 5BS0A 3BDXA 4P3CL 1U92A 4QRRD 1HKFA 4MQXC 2WQRA 1DN2A 1UEMA 2B1HH 1U8LA 4ZS6C 5I1IH 3V8OA 1JK8A 4PJ9C 1EBAA 3O6ML 4EEEA 4U2ZA 4Z78A 5JDJA 1MHCA 4EQ2A 5KANI 2YRZA 1HHIA 2YRPA 1JPFB 2FATH 1XFPA 4JHWH 2XIDA 2J8UE 4YUEH 3QPQC 3A6CH 1FIEA 5HD8D 4UOW1 5D1QA 5DJ8B 1JPST 4HS3A 3MRHA 3P0YL 3MV9E 1JZ2A 1HI6B 4OTXH 3N06B 1UZ6F 4AIZA 3RVWD 4NM4H 4UINL 1B4RA 1KCRH 2G2RB 1DBBH 2ED7A 1X3DA 1QBBA 2YR3A 2A1WH 2XXMB 4NN7B 2Q87A 4NZTH 4QRRA 2MPAL 3DRTA 1QFUL 3VWKC 4LRNH 3SDDD 3M1BB 1CF8H 1WUNT 3ZKND 3S5LB 3KYNA 1ORSB 4PJ5E 4RSVA 4NP4H 3QFJB 5KVGH 4LCYB 2V9TA 5EIVA 4Q9CA 2R69L 1FLRH 1JGLH 4PRNB 1S5IL 5K9QG 2AK4D 1J0YA 1ZANL 4P5TA 2F19H 4XXCC 1YN7B 4WCYL 2FIRT 4Y5XB 4ZTOL 3MRFB 3AB0B 5DVMA 3QHZH 1NCBH 1LO2H 4XPAH 3GI9H 5LXGH 3P9MA 4M61B 3BP4B 1NBZA 4ONGH 3MLUH 3VI4E 3UJTH 5EU7C 3ET9F 4OUUB 3CX5J 2I9TA 3UTTA 4HX1A 4J3UA 4ETQA 1Z9OA 4XHJD 4PJ7F 3TBSA 1DQMH 3P9WB 3DRQB 4LEOA 2YS4A 1MIEH 5D1ZB 1HEZB 4FXKB 5J13B 1TQCC 4WTWA 1GOHA 4P2YA 5BZWA 5JW3H 4TSBL 1MFBH 1OD7A 5JNYA 2WMPA 1G1CA 4XH2B 3UTPD 4GXUN 1L6XA 3K4DA 1OM3H 3FRPG 3FQXB 4MXQC 4ZSOE 4YHYB 4U6YB 3QG6A 1KLUA 1AHWB 5IB5B 5CEXB 1RU9H 3QXVA 2ZKHL 3GBML 5GGVY 2VDML 5BO1H 1T03L 4X7FC 3KLAB 3IDXL 1Q38A 4NUJB 5CILH 4LCWB 3WO4B 4XCCL 3IJSB 2X1PA 2BVQA 4NQXA 5ENWA 5EU5B 4H8WL 4RGMB 4APQC 4WTZA 1KEMH 4EIZC 4DN4H 2UWEA 1DEDA 3LOWA 2ZCKH 5E8OA 4HV8B 5H35B 3V6ZB 4K7PX 4OZIF 2NXZD 4OCWL 1S7XA 1SJEB 5CIPB 3C5ZD 1NGYB 3RX8A 4NM8L 1E0OB 1QKZH 3BVNA 1QQDA 1ZT4A 2F53B 4FRWA 2QQNL 1P7HL 1JUFA 1DVFB 2BRRH 4IEFB 3QNXB 4ONFL 1DBKH 5DUMH 2ZUXA 1JNLL 2DQEH 1MCBA 1JNNH 1NKRA 1FVDB 4JFDE 1LNUB 1E28A 1LVEA 2YD2A 3P4MB 4HQQH 1WZ1L 3MV9D 2HFTA 1LO0H 4YIQB 2XA3A 3S4SG 3K74B 3Q2CA 2X4OA 1CLOH 1ZOXA 5GZOC 5I1AA 1YQVL 4LLYB 4MD4B 1RURH 4JQXA 4P49A 3TVMC 4KQ4H 4NBZB 4XBGB 3TCXA 4U7MA 4IBLT 1RUAH 5E1AA 2GSGB 3LDBB 3FQRA 4OD2B 4EVNB 2VDKL 2HVKB 5E4IA 1KV3A 2WWKT 1FL3B 4PJ5D 3C5ZA 4PRPA 3TA3D 5L8KB 1F6FB 2AJUL 3GMNA 3KDMB 4M4RA 3QIWC 3NACH 5EZIL 4Z5RA 1T6WA 3CDYA 3P4LA 1CWVA 1PQZA 3QA3B 2H2SC 2J8UA 3PJSB 1T5WB 1A4JB 1T6VN 1DUYA 3RPIA 5HI5D 1UWGL 3LEXA 1HNGA 3MV9A 5IQ9B 2DIJA 1YEHL 1XGQA 1F3RB 4RA3A 1L6ZA 2DLHA 5A3IC 1GPOL 1NLBL 3BMWA 5J1TC 1IM3B 1CD1B 3ARFD 4QY8B 2Q8BH 5CBEA 1KB5H 2PN5A 5JDSA 3IFLH 1G7PA 1MCQA 1KLGB 2PF6A 4U49A 2X40A 1N2RA 1S9WB 4PJ5A 3TWCH 4YX2H 4OD3H 2YD7A 3ZE2E 2MTPA 1JHTB 1FVCB 1IAIH 1FZMB 3CUPA 5D4QA 2LFGA 3TIEB 5D5MF 5E00B 2H3NA 1VERA 5T1MA 4IDJH 2A6IA 3DX7B 3UEZA 2ZSVB 3CFEB 2ADIA 1WFTA 1ZHNA 15C8L 1F4XL 3O6FB 4DKFL 4OCYH 4OLEA 4HIIB 4P99A 4X9FA 3RUGB 1T1YB 4OZFB 5I1EL 2HTKD 1PY9A 3S35L 2HRLA 3FZUC 4WTZG 4NNXA 3ZKXB 3RVXC 1F4AA 4M43L 4KPHH 4NGHH 4HDIB 2HT3C 3QO0B 5DD1H 3TV3H 3ULUE 5TDNA 1Q0XH 3L3GA 1DR9A 2AV1B 2XNAA 1KPRB 1P6FA 3ARFA 2NW2B 4YPGA 3CFDA 4LFHG 2RAMA 4MJ2A 4XAKD 3PL6D 4KI5F 2MOVA 1NJ9B 1NGQL 5DRXB 5L8LB 4X5XB 2EH8H 4BUHA 4Z7WF 4ZSOA 2HKFL 2Y25A 4LVNB 1I3RB 1AC6A 1U8PA 2WLZA 4MA1B 1CFBA 2JE8A 5I15H 3W9EA 4RA0C 1A5FL 1AI1H 4ORGB 3VXOB 4P5MB 1GIGH 1P4IH 2CLZB 3V4VH 4N90E 1XGTB 2P4AB 4K8RL 5I8CB 1RUQL 1K4CB 5F7DA 2QQKH 3DWTA 5GS3A 5EZLA 4FQCH 2B1AH 4ZTPL 2W07A 3X3FL 1XF4B 2NY0C 3FO0H 2KUTA 3HZYA 2VAJA 4XP4H 4KDTC 1DQDL 4L3CA 5BXFA 1NBQA 1G7IB 2AVGA 2M2DA 5BRZE 5K9JL 1T89C 2EDXA 3HNVH 4L29A 3K2MC 2EIZB 5F89A 3ZE1F 4UILL 4YHZH 3SCMC 3MACH 3BUYA 5DT1L 5GS1B 3O45A 5DA4A 3MREA 4PJBF 2V7NA 2YC1B 4WW2F 4NSKA 3G6AB 4JFDA 4TNWK 2HFEA 3HPJB 1FNSL 3CMOH 1E4WH 4EBQL 5C08D 1FGNH 3HFML 3F58H 2D7MA 4OF3A 4P57B 1SEBA 4CJ1A 2XRAH 5F6HI 1TJIH 3WIFB 3MRGA 4PLOB 4XVTL 4D0DB 1FNFA 4OGYH 1KF9B 4M6NL 1ZS8B 4HUKB 1MRDL 4MCYB 5KW9H 3UC0H 4PJIF 1DQJA 1YYLH 4ORZC 1T66D 3INUH 5ACLA 5DD5L 4FQ1L 3PP4H 3NZ8A 5DEGB 5SWZB 2D0GA 4P23B 2AJXH 2ZNXA 2CKBA 4ODXB 4X5WB 4QCIA 2DWDB 4DVBB 5JOPE 3L5IA 3TCLA 2B7DT 3UTSD 1SJHB 3DXAB 4JG1H 4FQPA 1NKOA 2OJEB 3RZCC 4ZFFA 5E6ID 2EH7H 5HBBA 1CLZH 4NN7C 1OGAB 4QO1A 2WLYA 4B53A 4W6XB 1T7YA 3V4PH 1RZ7L 1G0XA 1A7PL 2I5YL 4QNPF 4KZDL 2I26N 2X10A 3A67L 5EBMB 5I8KH 1S78D 3DMMB 2MSPA 4DN3L 3MLSL 2H41A 3QWQB 4KKCC 2BVOA 3AM8C 5IOPB 4YE4L 4OBSA 4XPHL 1V8HA 4Y5XC 3CVHB 2NX5B 3BWUC 3UP1A 5B3NA 4ZNCD 4ERSH 3MRCB 3S36H 2BNRE 5HGHB 2BJML 2XKNA 3NTCH 4OZGB 5D96B 5C0IA 5JZ7C 3HI6H 3I75B 3RIAF 3LZFL 1I4FA 1JPGA 3PWLB 2VAAA 3U79A 2X4QB 4FFWC 3FMGL 4M7JH 4Q6YA 2Y7QB 5D1ZC 3UBXB 5E6IA 3QWOA 2VDPH 5EC1A 4NWTH 4UT6H 4R4ND 1K6QL 3QCTL 4KK5D 5ALBL 1B2WH 3IDJA 3PHQB 2WV3A 1T20A 1HXYA 3RWDA 1CG9A 5EG6C 5IMKA 4YR6A 2UYLA 4LLMA 5DR5L 1MFEH 3TJEH 4BUGA 4HH9A 1RZKH 4YHYC 3BPLB 3KYOB 4PIRF 2OZ4A 2AS5M 1AHWC 2I25N 1QLFA 1Y6NR 2FX8L 3OTTA 3M17B 3NPSB 3HC3L 5DS8A 4X4YB 1D9KB 2VN7A 3I85A 3MNWB 3QULA 3NFNA 1EFQA 2GSIB 2F54E 2WWMD 5F71A 1G1YA 1UXWB 3FQUB 1RI8A 5DC9B 1IQWL 3WO4C 1SEQH 2ICEB 2A6JB 1RUKH 4JFOB 3WO3B 1ZLSH 4QXGL 3UMTA 1L0XA 2NZ9C 1BREA 2EYTA 2DIBA 1PGRB 4I48B 4C4KO 3RY5A 4KJYB 5SX4H 4JZNA 1Z3GH 2X70A 3O9WB 3TBVB 5DSCB 3LHPH 3I3BA 1U8HA 2ORBL 4JM2F 4Y1AE 1LDPH 1J8HD 5KJRH 1X5LA 4OLVH 5D7LD 5F1IB 4XWGH 5IV2B 3SKNA 4WI4A 2MQCA 5HHMD 1DVFC 4J23A 3L7FA 3IXAA 4D0CA 5C70A 4QRPD 2D7PA 4DOHB 4EOWL 5BRZA 2OR9L 4RFEB 2E6JA 4PRHB 5DHVB 5JOPD 2AQ1A 1C7TA 4G6MH 5E6ZA 5HHPB 4Y16D 2WIIB 5DJDB 3SY0A 5GGQH 2JCCB 2MWCA 4GUPB 1IKFH 3WEXA 3SDAB 3ILQC 1V7MH 4KXZH 3KPRE 1RFDL 4KVNH 5E2TH 3NIFF 1JN6B 3C60B 3X11B 1SBSH 2OK0L 2F58L 4YHPA 3V5HA 5J89A 3LDBC 3OAZK 1NC2A 3ARGD 2FH8A 1KJ2B 3P77B 2RCSL 3ARED 5SWQB 3O3BB 4ZUTB 1UB5B 2CMRH 4WUUD 1NMAL 3A6BH 5GS2D 1J1PL 5I16A 1IGFH 5CZXC 1AFVH 5GGTH 2CK2A 1VFBB 3F7YB 5CLWA 3FB6A 5I74B 2HLAA 2P5WE 2BNRD 3VXUE 1T83C 3IAPA 1JNHA 1NGPH 1Z0NA 1FORH 5GGSA 4WW1B 3CC5A 3NN8A 4YQXL 3N1MC 2R2EA 5A43C 4OZFH 4ZFZB 5JW4N 5B4MC 4WWKD 2AGJL 2IWGA 3P73A 3SKOA 3LB6D 4S1SH 2EIEA 2XZCL 3THMH 1QRKA 5HYJD 1TXKA 1S9XB 1J9CT 2XWBA 4U1NA 2MFNA 2XT1B 3PV6A 5IMOA 3ARGA 3NBNA 1F4WH 2JB5L 4N0YL 1ACYH 1DQTA 2QSCH 1EJ6A 4LQFL 5TE7H 4DCQB 3AREA 2PYEE 3DSFL 4H0HB 5E2WH 1KIUA 2P7TA 2GK0B 2HH0H 2EC9T 3T0XA 4BKLB 3H9HB 1ZA6A 3WFDH 3TO4A 4D0BA 3QUKB 2G5RA 4EN3D 4N68A 3VE0B 4ZQKA 2AI0H 1YYML 4FFZL 3ELAT 2BNRA 3SE4A 4JHZA 3O6FC 2Y72A 1S8DB 2DL9A 4JGUA 4QRSB 1FV1A 4Q6IC 4XP6L 4AQOA 3QUXA 5D7KE 3T65A 2A73A 1NCDH 5CMAA 4HUVB 5FB8B 3BPCA 3BP7A 1ZEAH 3HNSL 1LO3L 5GS0H 5J1AA 1S7QA 1RUML 2DS4A 5TE6L 2R1YB 5KTEL 2AXHA 5IWLC 3QXWA 3L3IA 4XPFL 3C2AH 4B7IA 5I75B 4PJHE 4KUCD 2GTWA 1AGEB 2R0ZH 5BJTA 3EO9H 5ID0B 1R24A 5GSRB 2CSPA 2XG4A 1C5BL 4LHQB 3T3ME 4HKJA 4JG0H 3V7AE 5SWSB 1YN6B 1P4BH 3VDBA 5FUZH 5KVMC 4IHOA 3EJZC 4BA8A 2XQBH 2F54A 1N3NB 2GCYB 3M8OH 2ATKB 4MS8D 4BJLA 1MSPA 4YHIA 4LKCB 1MFAL 4ZD3L 4M6MH 4JRYD 4QGTA 3KPRD 1M7IA 3Q6FA 3QUML 2OBGA 5CHNA 2C3WA 4U4BA 4XPGH 5LQBL 5HYSA 3B9DA 4WGWB 2R4RL 4JFHD 3VD4A 1YNTB 4OJFH 3W39B 2VDQL 2YN5A 4Y1AA 1FRGH 5FF6A 1FH5H 4GQPH 3RGVD 3F6LA 4O5LH 5ERWA 4QXTB 1WBZA 3G5YA 5GS1C 1IFHL 4PJAB 4X6DE 2ESVB 1BLNA 5FO8A 1MCHA 1O7SA 1EAJA 2BOCA 4O51A 2P5WD 5HHNA 4UU9A 2N56A 5F7FA 2IANE 4ZUVA 3GIZL 1ZLVK 4I2XE 4C58B 4WNQA 4XNZB 1MI5E 5J9PB 1MH5B 2BNQB 4AENB 4OZHE 3BZEA 2P8LA 4U0QB 5CCKH 5IESH 3I9GL 3UAJD 4QHMA 1AGBA 1NEUA 1U9KA 4DW2H 3KPRA 4R97B 3FQNA 5IB3A 3PGCB 1EERB 5AUMB 4ODUA 4P9ML 4TUOA 4NZUH 5D1XC 3MRMB 3BUTA 3CVHH 1CGTA 2OR7A 4P23C 3MRKB 1CQKA 3O0RL 4PP1D 5M94B 3C87A 2PYED 3REVB 3RGVA 1QHPA 4DKEH 3TZVC 1K9TA 1XGYL 1VEMA 1NC4D 3T1FB 5L7XL 1GZQA 5D71L 3HB3C 4OLUL 4YNYA 1E27A 4YDJB 3D39B 4QOKE 4X9GA 5IHLB 2Y07L 3S37H 1NCAH 3VXUA 2N7BA 5L9DL 3QDJD 4OGAD 2J8OA 5EOTB 1U3JA 1HILA 2RGSA 3TT3H 1IQDB 1CR9L 1EMTH 5E7FA 2OM5A 4OLYH 5JR1H 3H7BA 4PV8B 4R7DA 5D7KD 5ESQB 3V6OE 3BH9A 2NY5L 4I9WE 1TTGA 4KRMB 1XF1A 1CICA 1WT5C 2NXYC 4OKDA 5ID1B 1A6VL 2GAZA 5CGYD 4MNGB 1Q94A 1KN4L 4LGSB 5EU4A 3GK8L 3SBWC 1XGUB 3BESR 4MYWB 1PAMA 3SOBL 2APTA 3MCG1 4NQDB 4UDUA 4Y4HA 5HGBB 5IBUB 2D31A 1KB9J 4KTDL 4DZ8A 5F6HJ 3OB0H 5HI4D 1CD0A 2PYEA 4IOFC 1WLHA 4W68A 3MRJA 1NC4A 5BW7C 1KBGH 1T0NB 3MBED 3N9GH 4E42A 1PZ5B 4KMLB 4GJTB 1ZHLB 4JQIH 1Y6KR 4PYHA 1TJHH 5AD0B 4KK8D 1UA6H 4G6FB 2X4SB 5FV2A 1K8DA 4ZO8A 5DURB 5DQDL 2P42B 4OQTL 5I8OH 4DGIL 5HYSG 3WXWL 5FUCC 4UTAH 3NPSC 4R96A 1D9KC 1F11A 2HG5A 4XWOC 4M62H 5IKCA 1ZTXH 4PJHA 3RVUD 3QUYB 3E8UH 2DM7A 3MJ7A 2P5EE 5IK3A 3S98A 1VFUA 4IRSB 2IADA 5JO5B 1JMXA 3O41A 4N5EC 1X5AA 3U2SA 4Q0XL 1QSFE 5DHVH 5DUPH 1JBJA 2VE6A 4RAVA 4QTIH 1HHJA 3GHEL 3SJVE 3ZZ1A 2ADJA 2VNCA 5SX5H 1CCZA 1FYTB 2GITA 3AXLB 2ENSA 3VFSA 3V5DA 4CUCA 3O6KH 1K5NB 3BOVA 3O9WC 3OX8A 1P2CB 4U6XA 1YJDH 1XCTB 5I17A 1IGCL 3AU1B 1KJ2H 3PGDA 1RHFA 2MJWA 2QADB 5CEYB 1QPXA 5H94A 5DJ2B 1YEGH 2DQCH 3EYSH 3H3PH 1E6OH 4MD5B 4GXUM 3QQ3B 3CDGB 3K4AA 4LPXA 3TH2T 4ZPVA 4Y0GA 2FECI 4LSQL 4A6YB 3OKMB 3NABL 4OM1L 1Q72H 3B9VA 4X6DA 1U8OA 5FA3A 3KXFE 2ZUWA 3SDAC 3T77B 4RWYH 2Y36H 2G60L 4I3SL 4ZUSB 1FFRA 3C60C 1JYVA 2IANA 5D5ME 4I2XA 4MXVF 3RQ3A 3C5JA 1MI5A 2O61A 1YJDC 3BGFC 3OJDA 1OSZA 4XCFL 5FYLH 4OZHA 2BVEA 2JK5A 3F62A 3TO2A 3F7RA 1DEEB 3L3JA 1VPOL 5LWYH 1RIHL 4OM0L 2W92A 3EKCA 4IRJD 4F15C 2NY1C 2R8SL 4YWGH 3N85L 4OFYD 1Y0LB 3GSNB 2YWYA 3DX9A 1IZKA 3L9RA 3ROLB 1LP9F 3BWAA 1NANI 4WI5A 4GRMA 5DJZA 4DAGH 4L8SA 5KVFL 5T3ZD 4GLRI 1RMFL 4GXVH 2Q6WB 1V7NL 3BIAX 1AO7E 3WFHA 1NFDF 4HK0A 3BXNB 3VXPA 3GI8L 4QOKA 2MHAA 1IGIL 1QO3A 3V0WL 1YEDA 3BW9A 3U7WL 32C2A 5IBTL 5EC2B 3K8LA 2VXVH 4P0DA 3CFKA 4WFFD 3JV4B 2APBA 4V1DE 5CD3A 3NFSH 1Z2KA 3V6OA 4DEPC 4OV6F 4WV1A 1JE6A 2QHRL 5GSVA 3HMWL 3K8MA 5LVEA 1CDGA 5D8JL 4HZAA 3LMJL 3GIVA 5C0BA 1IVLA 1IC7H 2A74B 3TPKA 2BY2A 3MUGB 1BFOB 3HG1E 1NBVL 1J8KA 3GMPA 1JL8A 1CGSL 4OFYA 3EYOA 1N64H 4Z0XA 4JE4B 2HLFD 2R4SH 1FFNA 1CDBA 5JIHA 3CU7A 3T3PE 4YGAB 4FQXB 3MBXH 3L7EB 3GMLB 2NY3D 3DGGA 5DGRA 3SJVD 4OB5L 2Y5TA 4O2FA 4MHHG 4LOUC 1U3HC 3EUUA 4NNYB 4PJBE 1PG7H 1XCQA 3DV6B 3UDWC 3SDCB 3MYJB 4KHTH 4PTUB 5JUEL 5E99L 3RWEB 2ZPKH 5JHDD 5DMKA 1U8IA 1OAKH 2Q76B 4TQEL 1CU4L 3P30L 1I1AA 3K1DA 5D7JC 2IPKB 2AK1L 5IM7B 2ZG1A 2EDKA 2P5EA 5EOQL 5BS0B 4P4KD 3NCBB 1YY9D 5KG9A 1BZ7A 1CD9B 4RFOL 1JJUA 4YHLH 1QSFA 4GMTL 4UB0H 3H2WA 3RKDD 1U8LB 3VFUA 3QEHA 3KXFD 5CD5D 3MCLL 1DSFL 1JK8B 5DDHA 3SJVA 1QFPA 2DM4A 4Z78B 1AXIB 3WE6A 1MHCB 3QI9D 1HHIB 2R0WL 2X1XR 3J7HA 4U1SB 5DFVC 1DQLL 4ELME 1ZWIA 2Z0BA 1S3KH 4X6FA 4Z95H 5FAAA 1V3LA 5I30H 3GBLA 4GRWF 4Y4KD 1U91A 2AQ2A 4HS3B 3VDAA 3MRHB 3ZKMD 3B2VH 2WNGA 3U4BH 3PWNA 4AIZB 1NEZA 4G8IA 1I8IA 3NH7H 3QNZA 1A7OL 1HHHA 4JFFD 4NQCE 1IILE 2CDEA 5KVDL 4F33A 1A0QH 1QTYT 3FO2A 4XNZC 2QV2A 5F1SA 1E4XL 2FB4L 4M3JA 1A9BA 1I8KA 3WJJA 4QRRB 3DRTB 2RJMA 1UENA 1XR8A 4KI5D 5ETUA 5I1KL 2OX5A 2AEWA 3HMXL 1PSKL 5A1AA 3KYNB 1N6VA 2I9LA 3VXQA 1AGCA 3TBTA 5I1DA 3FFDA 5D5MA 5IBLC 2LU4A 4FQIH 2VLJD 4P5TB 2A9NH 5D2LE 3ZYJA 1J7VR 4Y4KA 2KH2B 3P9MB 5ISZE 3IYLW 3MLTB 3QHFL 2R56H 3HC0A 1UYWH 3GBNL 5FM5M 4UUJA 4CDHA 3WBDA 2I9TB 3UTTB 1IBGH 4ETQB 4BM7A 3TBSB 2OL3H 4LEOB 3ARDD 5HDBF 2F8XC 4M00A 5BZWB 3KAAA 3HHRB 1YQ2A 1AO7A 2N1KA 2VDRL 4QT5B 5JNYB 2NYYC 1IARB 3N1QC 2VC2L 3QG6B 1KLUB 2W60A 4V1DA 1B88A 2AK4B 4XTRC 1MCOL 1OQOA 3GNML 1I1FA 4N0CC 4XVSH 3RDTD 3LPWA 5H37H 2CXGA 5ITFB 1HXMA 2ERJB 4TNVK 2WP3O 3HG1A 3TH3T 2RFXA 4XC3H 3D2UD 3BZ4A 4ALAL 3VRLE 2BVQB 5ENWB 4RNRA 2B39A 1I3GL 4UNTA 1X5GA 2J88L 2UWEB 1T0MA 5F8RC 4OI7A 3UZVB 4G7VL 5E8OB 3LS4H 2DKMA 1FP5A 1CFVL 2P45B 5I8EA 1S7XB 1UACL 1EFXD 2GUOA 5CJQH 4GRLA 2ZJSH 2YMXH 4G5ZL 2FEDC 1ZLWK 2A77H 5EOCH 4PJBA 3BVNB 2ICWA 1QQDB 1ZT4B 2GFBA 3SGJA 4WW2A 1NPUA 4HFUL 1JUFB 3PWUA 5FKPB 4OD1H 4IRSC 1B4JH 4P9HH 5HYQA 3IRPX 2IGFH 1E28B 3T8XA 1NEZG 3VG0L 4A6YH 2Z4QA 3VGBA 2BXYA 4PD4K 2X4OB 1MQKH 5I1AB 4HBCH 4GOSA 1A02N 3OB0K 1A64A 4PJ8D 4DQOH 2VXTL 5JXAL 4R0LA 1BQLL 5KSVA 2DICA 4F7PA 2BHYA 2EO1A 5E1AB 2FJFA 3B8SA 4CJ0A 1W0VA 3FQRB 2QADC 1FPTH 3C5ZB 3WL9A 4WHTA 4YDIH 2E9IA 1H3UA 3MFFA 1UVQA 3GMNB 4PJCF 2D0HA 4O58H 4ELMA 4Z5RB 4P9HC 4XI5D 3GSWA 1PQZB 1CTNA 4E9LA 2J8UB 3QQ9D 3ZDYE 3DUSA 4K3DL 3IAQA 1DUYB 4P2OD 3RPIB 3RU8H 3UYOD 5ISZD 4NT6A 4XPBL 1CQYA 3LEXB 1T2QH 3MV9B 3WS6A 4HW6A 1QP1A 1GAFL 4NQCA 4O00A 3IDMB 3DIFA 1XGQB 4XPTL 1CGYA 1N5AA 4HJ0C 1FO0L 5AWNH 3LKRA 5B8CA 2F74A 3HTLX 3QFDB 3D1MC 5IF0B 2YBRA 1I85A 3KPQB 5CBEB 3ULVC 2C7UA 2X44D 5JDSB 4U1IB 3GUTB 1N2RB 2ARWA 4PJ5B 2DQJH 1X4XA 1CDUA 4FABH 4K94C 5DD0L 5DQJA 4UIKL 2H3NB 5T1MB 1YY8A 5D2LA 2A6IB 12E8H 1F02I 3DURA 4JFZL 3BKYH 2ADIB 4F9LA 4JM2D 1QFWL 1ZHNB 2A0LC 5ISZA 5C2BH 4Q9QL 4JY4A 3RX5A 5CJ5A 1YA5A 1C5CL 2E9BA 4NNXB 1MPAH 5AZ2L 1RUPL 5TDNB 3NA9L 3L3GB 4R2GD 5FHAL 2XNAB 1BVLA 1HYRC 2R15A 1GGIL 3ARFB 4I0KA 4Y2DC 4YPGB 2FGZA 5JOFA 2VDNH 1SY6L 4HK3J 4O2CA 1UM5H 3SKUD 1N4XL 3EW3B 5EWIL 3BKMH 4ZSOB 4OLZL 3C9NA 1U8PB 5FGRA 4FQXC 3W9EB 4XNXL 1BBDH 1NMBH 3EOBA 5JIPA 5D7IB 4XAWL 3GKWL 4F80A 5LGJA 1TZGL 1QR1A 3RWIA 3BEWA 3IFNL 5F7DB 1EHLH 1PX3A 4WY7H 5EZLB 3U7YH 4NQSA 25C8H 3SDCC 4YHKH 2YKLL 2SEBA 1EEUA 2EXWC 2YD6A 3HZYB 5JW4M 1B0GA 2WBJC 3E6HA 4CVUA 3MV7D 4L3CB 2ITDA 4N8PA 4R90H 4FP8L 3ORJA 4L29B 1VFOA 4JKMA 4QRUA 4PB9L 4WO4C 1HSBA 5F89B 2QQQA 3RIFF 5F9WB 3G6DH 5CJXC 5BV7B 3BUYB 3LIZH 3O45B 3BP5A 3ESUF 3MREB 3Q6GL 1NGXA 1TVDA 4AMKL 4CN6A 1EZVY 2V7NB 5J6GA 4K7FA 3D25A 5F96H 1A1OB 3RY6C 4L4TE 4JFDB 1TETH 2HFEB 2Z92B 3ARYA 1XT5A 1SEBB 5C6PB 1NCTA 1B9ZA 5IW3A 3JWOH 1K2DB 3MRGB 5FYKU 3P0VH 1YPZE 1A22B 3RFZC 4OGXH 5ADOL 4DK3A 3GRWL 3FRUA 4ZOCA 2YUZA 1VCAA 5GJSH 5D1QC 4LPWA 4JVWA 4Z9KB 3PDOA 1RZIA 4QCIB 2J3SA 4U6VL 5E94A 4O4YH 5F7MC 1H3VA 1AJ7H 2J4WL 3BPNB 1QHOA 1C1EL 5LKNA 4MNQE 3LS5L 5TF1H 3BQUD 2CQVA 4A2LA 5GRUH 4WU7A 5EU6E 5IFHH 3JWOC 3W2DL 2HKHH 5DK2B 1RJZA 3WHE0 2JELH 2AV7A 1LDSA 4PRBA 2CIIA 4FS0A 1TNMA 2PETA 1XF2A 4L3ED 4P5TC 5CINH 1PLGL 4NC2B 1E4JA 4HJJL 3OKOA 4IJ3B 5FYKD 2HWZL 4M5YL 3B6SA 2XKNB 2V9QA 2EXYD 4E41D 3QEGL 3CGTA 2E5EA 4X80H 1FIGH 1JPGB 1H3PH 2VAAB 3DX8A 3UTSB 1O5DT 1SVZA 3TBWB 1LK3L 4M5ZL 4TULL 3QHTC 5E6IB 3QWOB 4AJ0A 1B3JA 5EC1B 2EDOA 1INDL 3BKJH 4BELD 3BQUA 4F57L 3IDJB 3O81A 3O2VL 1T20B 4YZFF 2Q3ZA 4YHMH 1HXYB 3RWDB 6CGTA 1CG9B 5IMKB 2LVCA 4YR6B 5GZND 4LLMB 5D72H 1JHLH 3L3DA 1J87A 4JO2L 3FT3A 5DZOA 4HH9B 1HHKA 1TQBB 1JPSL 2DAVA 3NIDE 1HKLL 3OXSA 1QLFB 1WISA 3A0OA 2P24A 3JTTA 5JIIA 3GHBH 1BECA 1BHGA 4V2CB 5DS8B 5KAQF 3BT2L 2YZ1A 3QULB 3NFNB 1A1NA 3F7VA 5C1MB 1U0QA 3HR5A 5C07D 1ITCA 5DA0B 4G80A 1J1OH 4F7EA 3QDME 3U0WL 1D5XA 5T5NG 1U41A 1I7UA 1AQDA 4BH8A 4JPWL 4QHLA 5JHLH 2APFA 2P48B 5DVOA 4K07A 4QWWD 5E8NA 5ALCL 3Q0HA 4PY8I 1QRNE 2EYTB 1EUTA 3O2DH 4PBWD 5D9SA 3SDXF 3TF7C 5H2BA 1HZHL 4Q2ZA 2FLRT 1FFPA 2X70B 4BZ1L 3IU3A 2V5YA 3ZE0E 1F5WA 2HRPH 4MLIA 1U8HB 4Z0BH 1CVRA 3L1OH 5FDWA 3VG9B 5HSFA 3TT1L 4XP1H 3FB7A 3MRNA 2FD6H 1OTSC 1KCUH 2PO6A 4M7LH 3SKNB 1YEKH 2BSRA 4X7CC 4K23H 3HNTH 4XP5H 3K2UH 3L7FB 3IXAB 3MSPA 4D0CB 5IT2H 5FM8A 1NL0L 4AG4H 1UB6A 1JGEA 5E2JA 2M1KA 3MV01 1JTOA 5BRZB 2Z9TA 4L8BA 3FAXA 1X4YA 1VGKA 2FGWH 3PDDA 4TNWF 4JGMA 4MD0A 5D7SH 1UZ8A 5GPRA 4W4NA 2UZIH 3MRQA 4LAQL 4X7SH 3SY0B 3WEXB 5T1LA 1BWMA 4JQXC 2G75A 2JJSA 4JHBA 1J10A 2WW8A 1MLBA 3B4NA 4WI7A 4L4TA 4BK5A 1LP9E 1IAII 3MOAH 4YHPB 5EU6D 1NLDL 1NC2B 1FVEA 1EK3A 4NKDA 3NAAH 1CGUA 4GKSA 3C5ZC 2K3TA 1JGUH 3MRPA 2APXA 3MODH 5D7LB 1NCWH 3OSKA 1YPZA 3QEQE 4RAUA 4WDIB 4PS4L 3BRFA 5I16B 4LCIH 2HJFA 3FB6B 4QRPB 2HLAB 3EIFA 2BZDA 3K0WA 1JNHB 3VFNB 3KHOA 3CC5B 2GQHA 3ABZA 2R2EB 4Y16B 1L0YA 4BQ6A 3P73B 3SKOB 3VCLA 2BVUA 1IEAA 4JVUA 1OPGL 5TQ2L 2XWBB 4U1NB 4MNQA 4JFED 2HMID 4H20H 3I6GA 1MHPL 1VACA 3PV6B 5IMOB 4HIHB 3ARGB 3K80A 3WD5L 4BQCA 3QUZA 3D0LA 2VISA 4TN9A 1S9KC 1CGVA 3AREB 1MFCL 4JDVB 4JM4H 2P7TB 3D9AL 4H1LA 1D5MA 4YDKH 5C3TA 3TO4B 4Z7OE 3LKNB 3O3AA 4JKKA 4ZQKB 4CGTA 4GG8A 5L6YH 1DBAL 3P11H 4D3CH 2BNRB 5FYJL 3QDMD 5FCSH 5HI5C 4EDWH 1KN2L 3MRLA 5I71B 1OL0A 1FV1B 3T65B 2A73B 4WGVB 5CMAB 3BP7B 3GJFB 4YAQA 4Z6AT 3REWA 3W11D 2ADGA 5J1AB 1OCWL 1QRND 4D9RE 1E4KA 1NMCB 1MEXL 1MHHA 3EHBC 2MCPH 4XCEB 4RGOL 3ARFC 4X4ZA 2GTWB 2UUDH 3CDFA 5D6DA 5BJTB 3CFCH 3S36X 5E2VH 1R24B 1XIWA 5MP6H 2GY7B 4FZ8L 4HKJB 4GQ9H 2L7JA 2IAMD 3MA9H 4P2RE 4YO0B 3BIKA 4LSTH 4EN3B 4IHOB 4JQVA 3PHOA 2F54B 2Y5EA 4FFVD 1HCFX 2B20A 3ULVL 3QDMA 2VQ1B 2CRMA 4YHIB 3WMSA 2QJDA 3PWPE 4GAJH 4ZG1A 2OI9C 1MRCH 4KK6D 4U1LA 5B3JF 4F2MA 3GSNL 2NQCA 1M7IB 1QRNA 3Q6FB 4K94L 1CN4A 1NCNA 5CHNB 1D6VL 2UY6A 5ITBH 4S2SB 5HYSB 2GJ6D 1ORQB 4ODSH 1KCSL 3NPZB 4DGVH 2XA8H 1A6TA 1NCUA 4MA7H 4Y1AB 2YPLD 4J3VA 2CKBH 5FF6B 3B9KD 1XZ0A 5DJXA 4TVPL 5T3XL 5ERWB 5F9WC 2CUIA 1MJ8L 5BV7C 1WBZB 3G5YB 4L8DA 3T0EE 2G2RA 4NKIL 2EYRA 3UXFA 1BD2D 3VFWA 5CEZL 3S88H 1FNGA 1NCCH 1BLNB 5FO8B 1FAIH 2BOCB 4GS7C 5HHNB 4UU9B 3T0WA 1AH1A 4ZUVB 4LPCA 1XH3A 3W82A 4WNQB 4YXKH 4P46D 3BZEB 2P8LB 2XTJE 4TSAH 3ZSTA 3MUZ1 4QHMB 3QFJA 2FSEA 2VDLL 3N1GC 1AGBB 1LEKA 4LCYA 3KPRB 3OKNA 3FQNB 1WJ3A 5IB3B 5EN2A 4OCSH 3T08A 4TUOB 5F6IB 5BVJA 3SE9H 1FN4A 1UM6H 1MAMH 5IVXE 1SM3H 1ETZA 2AABH 1KTKE 4PUBH 3QZWA 4M61A 3JBG7 2DLFL 1F58L 5INCB 5DI8A 4H1LG 3B9KA 3RGVB 4J4PD 4HSQA 4RCAA 1U2HA 3QEQA 1P7QD 2BFVL 1OAZH 1DFBH 1BM3H 1GZQB 4Z7UF 1A14L 4YNYB 2XZQL 1BVKB 1S7RA 3TYGH 2DF3A 3BPNC 2P5WB 1AKJD 3VXUB 5T1DL 4K2UL 2OS7A 1HILB 4GMSL 4CBPA 2EZ0D 3MROB 2ICCA 2DQIH 3H7BB 4R7DB 3U30B 3BH9B 1WBYA 4X0KA 3VGGA 2IQ9L 3AS2A 1AD0A 1CICB 1MCPL 2NY4D 4PLJC 5HHXH 2GAZB 2X1OA 4F7TA 4GAGH 1Q94B 3ULUH 4XMLL 2OZ4H 4KQ3L 5EU4B 5HVGB 3FT4A 3HE6D 2R2CA 4HPOL 4UDUB 4IJ3C 1HK6A 2D31B 4UOW0 4K9EH 4DZ8B 1BJMA 5SX4I 2PYEB 4M7KH 4AH2A 3MRJB 1P7QA 1NC4B 3OKDA 2YXFA 5F7UA 4P2RD 1GC1L 2D03L 3ARUA 1I9JH 1MUJA 4NKOA 1BPVA 5HGDA 1AKJA 1NAKL 3DECA 1BFSA 3STLA 3V6ZA 1K8DB 3KYAA 4MAUL 5KOMC 4L9LC 1MRFL 1R3KA 3PWPD 2R0LL 4POUB 3VXSE 1TQBC 3ULUC 1XR9A 3GB7A 4R96B 2HG5B 5IKCB 3HE6A 4JJHA 3MJ7B 5IK3B 3O4LE 1GGCL 3MJ9H 4K9EC 1OD9A 2IADB 5H8DA 5BVPL 3KYMA 1FFQA 3O41B 2R29L 3U2SB 4XRCA 1HN1A 2ZSWA 3T0ED 2VE6B 6FABH 2F5BL 2IFFH 4RAVB 1HHJB 2ADJB 3SGEI 2GITB 4P2RA 1A6WL 3CK0L 4FQ2L 4PLNC 5LBSL 4NRYA 3VFSB 3V5DB 4N0UE 3S5LG 1KEGH 2IPTL 3OX8B 1MJ7H 4U6XB 3K46A 3LQZA 4XGZA 1Q9LA 2HVKA 2MQ0A 4KK9C 5I17B 1KUMA 3PWPA 4CN4A 2NY6D 3PGDB 2KZWA 1R3LB 2OCFD 5H94B 3RAJL 1TVHA 1DLFL 8CGTA 2YD4A 1XEDA 3DVNA 1CGWA 3CSPA 1EPFA 1CDJA 4KUZL 1C7SA 2D7TL 3OGOE 2WWMC 5IQ7L 1REIA 1SMOA 4ZPVB 4UAOC 2UVEA 2H8PA 3ARSA 3T0EA 1U8MA 4X6DB 5MHSE 3I2CL 5FA3B 3OKKA 4C54A 1E4XI 2FIKA 4LASH 4CRPA 2DBLH 1YECH 1T4KA 3E2HC 4P59H 4J3WA 2IANB 5KZCD 4I2XB 1IGML 3C5JB 1MI5B 2O61B 1CYGA 4L5FL 1OSZB 3F7QA 4OZHB 1QFWM 4KVCH 1WFNA 1BBJA 4JG1L 1RJYB 2JK5B 3TO2B 3UTQA 3L3JB 3AS3A 4PY8J 1FVCA 4BFEA 3IDIA 1QSVA 5E2UL 3X3GH 4JCMA 1X44A 1INEH 3ILPA 4HS8L 4D9LL 3DX9B 5IVXA 3QXUA 3CFEA 1YEFL 2YUVA 3L9RB 2FNBA 4LU5L 3TBYA 3BWAB 4GRMB 1DLHA 5DJZB 3UTZA 5J1SC 1CK0L 4OFPA 2W0KA 4L8SB 5AG8A 2HN7A 3VRJA 3G08A 3WFHB 1XF3A 3F8UB 4HK0B 4M1GL 4Y4FA 3VXPB 5ILTH 4QOKB 2MHAB 1QO3B 1YEDB 2Z31A 2YN3A 1MAKA 1RIUL 2QQLL 5BOPA 2HFGL 3CFKB 4HWZA 5CD3B 3ARGC 5DMIH 4WV1B 5GSVB 5ACZA 3ZTNH 5LGHL 2CRIA 4OCRH 1CL7H 4XNQA 1FCCA 4X5XA 3U6RA 3VXSD 1NAMH 3AREC 3GIVB 3QDAA 4W4OA 3V2AR 1SJXA 4G6KH 2DM2A 4JO3L 1I9RL 2VZ3A 3GMPB 2I24N 4JHAL 3TO4C 3RGHA 3EYOB 4Z0XB 1VHPA 1EVTC 4XNYL 4ORGA 3SE4C 1FFNB 3S37X 4AY0A 2EDHA 1T7VA 3QUXC 4JY5L 5I8CA 3RTQD 3MGAA 1IEBB 1MJUH 3DGGB 4I4WA 5DC0A 1U6AL 5TPWH 2AEPL 2Y5TB 4K55A 1U95A 4O2FB 5CSGA 1XCQB 3DBXA 3NA4A 4Z7QF 3ZHKA 1G7IA 3EOTL 1CFTA 2X5PA 3JV0A 5KSAD 3MZGB 3QXAA 4HIXL 4K3JL 5EO0A 4L4VE 4NRZA 2EIZA 3SE8L 2CDGB 4JFPA 3STZB 3VXSA 3GKZA 4U7SA 2OXHA 1U8IB 1GGTA 3GM0A 2IALB 3IKKA 2LU7A 4F7MA 1WK0A 1V05A 2X1WL 2NR6D 1I1AB 3EZ8A 1IAOA 1JCKA 1RY7B 4M1CD 1OAUL 3WN5A 2P5EB 3O4LA 3U9UA 3PG2A 4JKWA 1A7BA 4MAYD 1KELL 5KS9F 2KZ1B 2XN9E 4NCC1 1F3JA 3UZEA 5KG9B 1BZ7B 4ZAKD 5FCUL 1QSFB 2XTLA 3FN3A 5I1CH 1P5VA 2W9EL 3KJ6L 3VFUB 1RPQA 5B21A 1M7DB 5DDHB 3O4OB 3SJVB 4FZEL 4MJIE 3GO1L 3RNQA 1FLTX 1KXQE 1LO4L 5GGVH 5FK9A 1KC5L 4P2QE 3WE6B 4BH7A 4N0UA 1BFVH 5LG1A 3SQOL 1ZWIB 3HKFA 4X6FB 4FQHA 1FZOA 1IC4H 3UBXI 4OIIH 4XNUH 3VWJB 3BD5A 4J6RH 1U91B 2XG5A 4UT7L 5I18H 2D9CA 2BY1A 2UUDK 3VMOA 1ZLUH 3PWNB 4G8IB 1I8IB 3QNZB 1QFHA 1HHHB 3ARBD 3GGWA 2CDEB 1NDGA 4F33B 5I1JH 3FO2B 4MAYA 2BVPA 4U0RC 1A9BB 1I8KB 1L7IL 3BRGC 5J0BA 2BDNL 1XR8B 3DMMA 5ETUB 1CBVH 3KXFB 4NOFA 4R7NA 2AKRB 1VENA 4DTGH 2I9LB 3VXQB 4HUUB 1AGCB 5DUBA 1GGBL 3TBTB 5I1DB 1R3IH 4NC1E 5FOBA 4FG6C 3FFDB 5C0AE 4AL8H 5F6IC 4FMKA 4MGXA 5D70H 5D5MB 4OI9A 1JGVH 2J5LC 5GJTL 2IPUK 1A6UH 4EI5A 3TJHD 3D3VE 3CNKA 1N8ZA 3UYRH 3G9AB 4IOSD 1EBPA 2W0FB 1MWAH 2V6HA 4LEXL 4Y4KB 3AAZA 1MJJA 1QD0A 2Y6SD 4YH6A 3HC0B 3IRZA 2NZIA 4ZODA 5EBLA 2YHGA 2AJVH 3R0MA 1UKSA 4NRXA 1J5OH 1BEYL 4LSDA 4YBQD 5TQ0H 5IVOA 4EKXA 4LSSH 3U30C 1EVUA 2WINB 3MLWH 3DVGA 3SKJH 1AO7B 3MGTA 1CICC 5BV7L 3TNNA 5B38A 2PNDA 3V6FA 5HVHB 3KYOA 3NFPA 4JKLA 4EXKA 3U0PA 5SWSE 4Y5VA 5E8DH 3FCTB 3MLVH 3VD5A 1FO0A 3MV8D 3PE9A 4Y4HC 3SDXE 2F5AH 2W60B 4V1DB 2PXYA 4XB7A 1H3TA 4L4VD 4YHNB 3FQUA 1YEEH 1I1FB 4HXBH 2Z8VC 2W0LA 4AQ1B 5DJYA 4KDVA 1HXMB 3HG1B 1T2JA 3EJYD 1JWMA 3BZ4B 4RNRB 2B2XL 5C8JA 3CFJA 4HUWA 4PG2C 4OGAC 5E8EA 2XN9D 4NN5B 3TFKD 1T0MB 1RZGA 2JLLA 3RUGF 1UGNA 4KZEH 1I75A 5ADPL 4XZUA 5I8EB 3WKNA 1UM4H 2D4DA 2EE3A 2IG2H 2GUOB 4GRLB 3UJJL 4YPJA 4PJBB 2ICWB 2GFBB 4WW2B 4XBEH 1MREL 1FGVH 1NBYA 3PQYD 3PWUB 3V4UH 4PGDA 4YEEA 2RR3A 5EA0H 5HYQB 4L4VA 4Q7DA 3QWRA 3K7UA 5DMGC 4Z7NE 5HHPA 1MCCA 1SY6A 3T8XB 2A83A 3FN9A 1M71A 2Z4QB 4Z77A 2KBGA 1IT9H 2R39A 3D2UB 1AR2A 5EORL 2R9HD 2Z35A 4HLJA 2BSSA 2NY7H 4NZRH 2XN9A 1PG7X 1RVFL 5C09E 4R0LB 4P3CH 5KSVB 1AXTL 2CLRA 3N1FC 4HCRL 4F7PB 4GG6E 1DE4A 3T2NL 4JRWA 1U42A 2FJFB 5GGUB 1INQB 4R26L 2LU3A 1W0VB 3EYFA 3QQ4B 4JO4L 4NCDA 2R0KL 1OP5H 4MJIA 3OAYK 3WL9B 4WHTB 3TN0D 5A40E 5C0AD 3MFFB 4P2QA 3O6MH 4XMPL 4KY1L 1UVQB 3KG5A 3J8F7 3OKEA 1T0PB 5ECJE 4ELMB 3Q1SL 3GSWB 4JN1L 1AGFA 3D3VD 1RZFL 1A9EA 4MA8H 4FQJL 3BGMA 5C86A 4Y7MA 1W0YT 3EDFA 4Y19D 3SPVB 5CLTA 4NT6B 2GI7A 4PJDF 4WI2A 1RV6X 1EEQA 3RVTD 3LH2L 3P0YH 4NQCB 4MNGE 3WUWA 3DIFB 2PTUA 4UINH 1T04A 2EO9A 3LAFA 3MLXL 1N5AB 4PJ8B 3U46A 3LKRB 4LLQA 3BAEL 5B8CB 2F74B 1LWRA 5B38G 3AY4A 2YBRB 4HPYL 2MPAH 1FJ1A 1QEWB 1QFUH 2ZOKA 3AGVA 4HEPG 3VWJD 4S1DD 4KROB 3TN0A 5C0AA 4HKZA 2VLRE 3CXDL 1WTGT 4GT7A 4ESKA 4WFHE 4PY7A 3KGRA 3EYUL 5I19L 1P9MC 2LABA 2XY1A 2R69H 1S5IH 3D3VA 1YY8B 5D2LB 1KYOK 1ZANH 3DURB 4L8SC 4I18A 3W81A 1E6JL 3OWEA 2DYPA 4WCYH 4ZTOH 5ISZB 3RL2A 4NNPL 4JY4B 3KJ4B 1P69B 4ONOA 5EIIB 1CFNA 4H25A 4PGEA 2VSDA 3H6JA 2CDFA 4GLRH 1RIVL 4X9BA 2DMBA 1BVLB 4LKXA 3T0DA 5ID0A 3QJHB 2MKWA 1KBGL 1WTLA 5IG7A 3Q5TA 5JOFB 4TSBH 4O2CB 5EBGA 1XGRA 3V5KA 3OJMB 2B8OT 1DQQA 5SWSA 5HXMA 2AXJA 4TNVF 3SDXA 4QHKI 3C9NB 4LSPL 4CN1A 4MQXD 1A3RL 1QLRA 2VXSL 4QXWA 4RX4A 2ZKHH 3GBMH 4ZS6D 4OZGF 3JV6A 4X7DC 4JM2B 1KCKA 2Z8SA 4PJ9D 3EOBB 2AXGA 2VDMH 1FG9C 3HI5L 4JPKL 5LGJB 1T03H 4PLKC 3KR3H 3E1F1 3RWIB 3BEWB 3E8UL 3B9EA 3IDXH 1VKXA 3KYKL 5HVWA 4XCCH 4NQSB 4JDTL 4MSWA 5IB2B 1TTUA 4H8WH 5C09D 4R2GB 2XICA 1BZ9B 3QPQD 2SEBB 4TSCL 3GJFK 1SVCP 1B0GB 3E6HB 2ITDB 4I1NB 4QXTA 3RPKA 1MNUL 4GW1A 3RWHA 4OCWH 5F7LB 4QRUB 2R2HA 1HSBB 1BQUA 5JQ6L 1I1AC 4NM8H 4ODHL 4K3HA 3BP5B 2OP4L 3VGDA 1AXSA 1NGXB 1PBYA 4I0CC 4ZNEE 2VL4A 2QQNH 1HH6A 3VWKD 3BZFA 4TTDC 4K7FB 5J6GB 1R0AL 1MCIA 3D25B 4ONFH 1UWEL 1JNLH 2H2PC 2B5IC 4PJ9A 5GRWA 5L88L 3O4OC 3JUZA 1WFUA 1WZ1H 3VFOB 4BZ2L 5DVKA 1DL7L 4JJ5B 2OYPA 1WFOA 4H8WC 1YQVH 2OMNA 4K3EL 5IGXL 1ZVHA 1PJ9A 5C09A 2E3VA 2LTQB 4GG6A 3FRUB 4L3AA 1ODAA 1IM9D 3PDOB 4U6TA 3CSGA 1QBML 1IAIM 1RZIB 2VDKH 2R1XA 3AUVA 1JHKL 3SHSA 1A6PA 3U82B 2X4RA 2FX9L 2X1QA 2AJUH 1KJ3L 5E94B 5CEZE 5EZIH 3CSYA 4MWFB 2G5BA 3OJVC 4PRID 3WJJC 4CDGC 1VA9A 2GYSA 4WU7B 1J18A 5CD5C 1ZKAA 5HDQL 1UWGH 1W8OA 4MNGA 4MXQD 1RJZB 3HA0A 3BYTA 2AV7B 4PRBB 1YEHH 4NQDA 2YD8A 3I3EA 1XF2B 3EO0B 1KFAL 1J0IA 5D93B 4RMQA 1GPOH 4RGNE 1NLBH 1L0QA 1VEPA 1HHGA 3QQNA 5K9KA 3OKOB 3FB8A 2LE9A 1CDCA 3B6SB 2NY2B 1S5HA 4J12A 4HGMA 1VGEL 3FOMA 5EULV 2VLRA 5K59F 3IJYA 3TC9A 4APQD 4X83A 3DX8B 3OL2A 5ACMA 2VLKE 3LN9A 1OW0A 5MEOA 1NFIA 2XZAL 1P1ZA 5C6TL 3BQUB 3O8XD 3OPZL 15C8H 1F4XH 3WNOA 1F3DH 4DKFH 3L3DB 3L95A 5I1EH 1QLEL 3FT3B 3LEVL 4PBVC 1HHKB 5E03A 3S35H 2ICES 5I6XB 4M43H 2ZOLA 3QUYA 3OXSB 4XCYA 2P24B 3JTTB 3OB8A 5E08L 2QLVB 1Q0YL 3IFPA 5HDOA 1A1NB 3F7VB 1BGXL 4Q9BA 4AEHL 4M03A 5FFLA 4G80B 5GZOD 4EDXA 4F7EB 2WUBH 3GSVB 1D5XB 3H9SE 1AQDB 4BH8B 4QHLB 3V52L 1NGQH 3KPSE 1X5KA 2J8HA 3QRGL 5L2JB 3TVMD 4OLXL 5INDA 3CX5K 4KHTL 5E8NB 5TE4L 4KKBD 2HKFH 4AEFA 1ES0A 5D9SB 4Q2ZB 4WRLA 1FFPB 5C0RL 1A5FH 1WWWX 2PCPA 3LCYA 3IU3B 1N7ML 1C16A 1X5IA 3O8XA 4JFYA 3HZMB 1I1YA 4GRLC 5DXWA 4K8RH 1RUQH 3KNBA 3QIWD 1FC2D 3FB7B 3MRNB 3C6SA 2BSRB 5HHVL 3SGJC 2H2SD 1A7RL 4ZTPH 2VQUA 2EDDA 2AP2A 1CE6A 3X3FH 4LSVL 4S0TD 1MFDL 3QQ3A 3G6JE 1UB6B 1JGEB 1ED3A 3O2WH 5CJOL 4YHOL 3ZDZE 1DQDH 5F7EL 4L8BB 1YEIL 5C07B 4KJPD 3TH4T 3DETC 5K9JH 3FFCD 4MD0B 3C8KA 1DBML 1UZ8B 5FGBA 3MRQB 5GRVK 5A3ID 4UILH 5K9QI 5T1LB 3TVMA 5DT1H 4F58L 4ZNEA 2G75B 1WAAF 1C5DB 2QKIA 4KV5F 4EUPA 5CUSL 3V9FA 4R0LC 1TZIA 1MLBB 5C6WH 3C08L 4L4TB 2EEBA 3MNVA 3H8NA 5F97E 3LQAL 4HZLA 1U58A 5GISL 1FNSH 1DEEA 1FVEB 3MOBL 5JOEA 2H1PL 4K8RC 4NKDB 4YGVA 4EBQH 4GKSB 3HFMH 1J05A 2BHUA 3MRPB 5F70A 1FSKC 4H26A 1YPZB 4RAUB 1EO8L 4XVTH 4J7RA 3MLZL 1QOKA 2BSED 2AW2A 4M6NH 4NYLA 1MRDH 2HJFB 2XQYK 5DD5H 4MLSA 3F5WB 4AK1A 4FQ1H 1EXUA 5E5MA 3FZUD 5F1OB 3RVXD 4PJAF 3WS6C 4BSVA 2CD0A 5JPNA 2HT3D 3K4ZA 4I77L 1VESA 2VLKD 3VCLB 1CIUA 4OT1L 3CH8A 1IEAB 5B8CC 4NN6B 2AK4E 4MNQB 1OAXL 3ZYOA 1I85C 3IFOA 3WHXA 4O2EB 2NTSP 1RZ7H 5EU6B 1A7PH 2A74A 2I5YH 2QHLA 4KZDH 1H3WM 3QUZB 3D0LB 5F1NA 3A67H 4KROC 5JLZA 2VISB 1OAYL 5TDPB 3QIUC 4KGLA 5DJCB 3WFBL 4DN3H 2APWA 3MLSH 4GBXA 4G3YL 4WI6A 4H1LB 4YXHL 3PXJA 3OGCB 1OP5K 1NSNL 4YE4H 3KPLA 1I8MA 4XPHH 2UZXB 4GG8B 2YPKA 1FL5A 4PRAB 1OAQH 4F9LC 3JTSA 1UXSA 3KJ4C 3H9SD 3MRLB 2BJMH 1ZHKA 3AC0A 4XMKL 3DPBA 3LZFH 4YAQB 3VGAB 2VLKA 3REWB 2NY0D 2ADGB 1OTUC 2VIRA 2YA0A 3LY6A 3FMGH 4NWUL 2C4XA 2VLMD 1MHHB 3SKMA 1XF5B 4HWNA 3L5WA 1NQBA 5KS9E 4CADA 3RWEA 1K6QH 3QCTH 5ALBH 1GVIA 1OSPL 3S96A 3SCMD 1XIWB 5DR5H 3D69A 4C55A 3HE7A 4N1CA 2Z93A 1I7TB 4X7EC 1OGTA 2PR4L 3G5ZB 2FX8H 3BN9C 1A47A 3BIKB 3HC3H 5F9JA 4U6HB 5CJ8A 1KT2A 2FJHA 3VI3E 5MENE 5C0CD 3PHOB 2VITA 2O5YL 2ZZUT 4EXPX 3QDMB 2AAVA 3H9SA 1QFOA 4HKXA 3KPSA 1WEJL 1IQWH 4EUPG 4U1LB 1X5ZA 3MZTA 1CT8A 3BN3B 4F2MB 4XHQA 4QXGH 1I9IL 1QRNB 1T1WA 1KENL 4HG4K 5DJAA 1L7TL 4HT1L 4P5KA 4U1SA 2VYRE 3EDKA 4KWUA 5CFHA 4LSRL 1T89A 3L6FA 1A6TB 4F9PC 1XZ0B 2DQUL 5DJXB 1KCVL 2ORBH 1FNHA 2I60L 3FN0L 3RZCD 4L8DB 2EYRB 3VFWB 4ODBD 2FX7L 2IAMB 1FNGB 3ZDXF 3G6JA 1JRHI 2VZSA 5IMLA 3ALWA 4EOWH 1XH3B 2AJYL 2GEEA 1IKNA 1GRWA 4N5UA 1R5WA 4Y8AA 1TPXB 2ZCHL 4MQ7A 2VL5A 2XWJA 2W1NA 3MXVL 4QHKJ 2FSEB 1LEKB 4WI8A 5I2IA 3WUZA 2ILLA 3NGBB 2X4NA 3OKNB 5EN2B 2LTQC 1F6AA 1RFDH 5BVJB 2VUYA 1LP9B 3FT2A 1FN4B 3SO3B 5FOJA 1BWWA 2OK0H 1CLCA 5T3ZL 2F58H 5JZ7D 1ETZB 5DVNA 2FDBP 3QZWB 3MLTA 4GFTB 5DI8B 3B9KB 5ANME 2YWZA 4KAQH 1CZ8L 3QEQB 3BGAA 2AJ3A 2OR8A 5D1ZD 2RCSH 3RZCA 1L4IA 3DYMA 4R4FL 1NMAH 1S7RB 1J1PH 3RVVD 4S1QL 4PJXE 1ZXQA 4IMLA 5GRYA 4CVZB 3F65A 3SDDA 1TDQA 4QT5A 3GSOA 1WBYB 4X0KB 1AD0B 5I9QC 1JF6A 4F7TB 2AGJH 1RAMA 1TLKA 3T0AA 1PEZA 1BIIA 5D93C 2AK4A 3FT4B 2D7OA 2XZCH 4RMUA 2DTSA 1PFCA 3SGKA 3BYYA 3RWCB 1GHFL 5IHUL 3ULVF 4OZ4A 4C83A 2NY2C 5ITFA 5D7IE 1Z5LB 3VXRE 3ZSSA 2JB5H 4N0YH 1H0DA 1QYGL 4ZFOA 2FWOA 4RAHA 1QNZL 4LQFH 4X4XA 1IAKA 4JEGB 2NZ9D 4AH2B 5J6HA 3OAZH 1P7QB 5EUOF 3DSFH 1IE5A 3OKDB 5DFWH 3RP1A 3V8CA 4UZGA 5MEND 1MUJB 3L5XL 4NKOB 5J3HC 5HGDB 1AKJB 3BQUC 4QRQA 5T1KD 3STLB 1YYMH 4FFZH 4IIQA 1R3KB 5L2KE 1MCSA 4XAKE 4XP6H 2F53D 4U1MA 4C57C 1OB1A 5I6XC 1DVFD 1S7SA 1XR9B 3HNSH 1LO3H 3GB7B 5IR1A 3EAKA 1RUMH 5FKPA 5TE6H 5KTEH 3D85D 3HE6B 5KS9A 1N0LA 3HCVB 4WHYG 4XPFH 3CJJA 2Z91A 43C9A 3KYMB 4A2MA 2FLBT 1S9VA 5DZLA 4H5SA 4DKAA 4XRCB 2ZSWB 1UWXH 4LSUL 3ILQD 1C5BH 4YHKL 1G7QA 5F7WC 1B90A 3MJ6A 3RWFA 1YNKL 4P2RB 1U3YA 3JXAA 4NRYB 3PABB 1BZQK 2W9DL 4WFGD 5MENA 5T1KA 1H3XA 2VWEE 4DWHA 1ZK9A 3LQZB 4XGZB 1Q9LB 3PWPB 4HF5L 3R8QA 1TJGL 2PO6C 5CZXD 3D18A 1KTDA 1MFAH 4ZD3H 4KKAC 1BIHA 1TVHB 3QUMH 5EOCJ 1CLYL 3DVNB 3D85A 4JFQA 5LQBH 5C0NC 2GHWB 2R4RH 3VXTA 5C08E 4TRPL 2VDQH 5B4MD 4KRPD 5A2JH 2H8PB 2IH3A 1P4LB 3T0EB 3T4AA 1U8MB 3IDMA 4KTEL 3OKKB 2VABA 1K4DA 1IFHH 2FIKB 2JJSC 4YK4B 1LEIA 1T4KB 4JN2B 3QFDA 2RIKA 2VQTA 3HZKB 5IF0A 3KPQA 3MRIA 5F7HA 1T1XB 4CMMA 3GIZH 4PJFE 3T4YA 4PJEE 2XTJB 4U1IA 5CSBA 4AEEA 4C4KT 3GUTA 4J8RB 1BBJB 3HUJE 2MCG1 3TA3A 4X4ME 2NY6B 4O4YL 3UTQB 3I9GH 1G7HB 3UTSE 3IDIB 4H1LH 5J11B 3ILPB 35C8L 2GTZA 3O6FD 2FL5B 4MNHA 4P9MH 5IVXB 3QCUL 3PIQA 3TBYB 3WV0A 4HIJA 3VXRD 1DLHB 4KFZC 3UTZB 1WCQA 5ANMA 3NMEA 4ZO9A 4OUOA 3O0RH 3LN5A 2HN7B 3VRJB 3G08B 4I8DA 5HI3C 3VFTA 3CX2A 4LDEB 1XF3B 4N9GA 1XGYH 3QRFM 5L7XH 4Y4FB 5D71H 2Z31B 4OLUH 4NN6C 3RJQB 5ICYA 4PJXA 2YPVL 1EJOL 5KZCB 2Y07H 3WJLC 4HWZB 4HWBL 5L9DH 4W6YB 5L2KD 1CR9H 2C3XA 5ACZB 3QUZC 4XNQB 4MMXC 1ZLVH 3U6RB 2NY5H 2QEJA 1ACZA 3X13A 1A4KA 3V7MA 1SJVA 4G9DA 4HLZH 1A6VH 1N0XL 4HKBB 3EJZD 3OR6B 2IBZX 1KN4H 1N59A 3GK8H 3RIAK 3I6LD 3T0BA 5LCVL 3SOBH 2DQDL 4Q6IA 5D7IA 3H0TA 5GS0D 4FXLA 3VXRA 4KTDH 2DI8A 4I4WB 3VGAC 3H3BC 1EEZA 5FUCE 1E4KC 2BNUA 3MUHL 1N6UA 3JSSA 4XCNA 1U95B 3GMQA 3WCYA 2C3GA 3QIBC 4NOBA 3S7GA 3DBXB 5I1GL 4PR5A 5D6DC 1CFTB 3E0GA 5L2KA 4LVHB 3QXAB 4CMHB 5EO0B 2NY5C 3PL6A 2AJSL 3AVEA 4NRZB 1XIWC 1VFAA 5DQDH 2FRGP 3VXSB 4JFPB 3HAEA 4PGCA 2QBWA 3U1SL 4OQTH 4DFIA 4F3FA 4F37F 2ZP0T 4UTBL 4DGIH 5IW1A 3WXWH 1MIML 3OKYA 4F7MB 5DWUL 1BOYA 4KDWA 2JJWA 4U3HA 1IAOB 3LKPA 4JQVC 3WN5B 2H45A 1A1OA 3O4LB 3U9UB 5J4MA 3KPPA 2Z92A 5KN5A 2YK1L 4OF7A 4DUWA 1F3JB 1KCUL 4D8PA 4EJ1C 3RNKA 1JPTL 1K2DA 4Q0XH 5TGBA 1J8HE 5D7LE 5JW5A 2V2WB 4LQ1A 3RNQB 5AG9A 3GHEH 5D1XD 4PFEA 5HHME 1Y6MR 4ONHA 2X09A 1WCBA 5FK9B 2MNUA 1J86A 3ARQA 2UWEF 3WNMA 3EYQC 4BH7B 4N0UB 5SWZD 4P23D 1PYWA 3VA6A 5I1LA 4QRPE 5C0FA 3MLRL 4FQHB 1FZOB 3OQ3B 3TZVD 1IGCH 1WWBX 2C5DC 3HB3D 5JA9A 3KLHC 4LGRB 1OGAD 3GGWB 3D6GA 1NDGB 3IU4L 5F3BA 4MAYB 3NIGF 4NO0D 2BVPB 4DGYL 5C08A 1TPXC 2NXYD 5DK2A 1ZAGA 2PW1A 4KK6C 4R7NB 4LSQH 4JB9L 3NABH 4OM1H 5HVFB 1FZKA 2DD8L 2K7PA 4WUUE 2DI7A 3IXTA 5D1XA 5DUBB 5FOBB 3MFGB 2G60H 4I3SH 3M07A 3SO3C 3AB0C 1X6NA 3LKOB 5EZOL 4PJFA 4OF5A 4EI5B 4PJEA 4FNLL 2DIAA 1KG0B 4XCFH 1N8ZB 4HCRA 1DCLA 2FZ3A 3HUJA 4X4MA 3TZVA 3B9KC 3AAZB 2BVYA 3PUCA 1MJJB 3CZJA 3UTSA 2ARJQ 1VPOH 2J6EL 4QKXB 5HJ3A 3TBWA 4K7PL 1RIHH 2V7HA 4OM0H 5E0QA 2R8SH 5EBLB 5J13C 5HYJE 2J8UF 5FYLE 3N85H 1WZKA 2OTWA 3DJ9A 4KKLC 4NRXB 2FEEL 2Q86A 4UMGA 3BD4A 1GH7A 4NO0A 2FR4A 4XXDA 4OBRA 5CIPH 2WIMA 3DVGB 4YJZL 5KVFH 3WFEL 1RMFH 3MGTB 3SDYL 1V7NH 3TNNB 5B38B 4LMQE 3Q48A 3V6FB 4MVBC 4XC1L 3S97C 2DTML 3NFPB 1D9KD 4XWOD 1I1RA 3DARA 3U0PB 4Y5VB 3GI8H 3V0WH 1IGIH 4ETYA 2B0SL 5DRWA 1OP3K 3U7WH 1FAKT 1FO0B 3O6LL 4N5ED 5IBTH 2PXYB 1BJ1H 5BQ7A 1MVFA 1W8NA 3HAEG 3MX0A 2QHRH 3HMWH 5DJYB 5D8JH 2D4FA 3BO8A 3LMJH 1H5BA 3GMOA 4RGMC 1JNJA 1JFQL 1JWMB 1NBVH 3O9WD 5C8JB 1GCFA 3CFJB 1CGSH 2IPUG 4HUWB 5E8EB 2HJLA 1XAUA 2EZ0C 1QZ1A 1RK1A 1AD9A 1RZGB 1JGDA 3VI4F 3VFGL 2COQA 2E7LA 1EEYA 1UC6A 2HT4D 4XZUB 2WUCL 1I1CA 4WHCA 4PJGF 4Z7VF 4OB5H 4JANA 1Q1JL 4QEGA 3HE6C 4KV5E 3BI9X 4PRHD 3MV8B 1NBYB 1X7QA 4PGDB 3EBAA 3L3HA 5I1HL 4L4VB 5DD3L 1D7FA 1EHAA 3SDAD 5JUEH 5E99H 3EGSA 3LKSA 2A83B 1M71B 4R6UA 4Z77B 3C60D 4JRYE 4JKPL 4GH7B 3TLRA 4TQEH 1CU4H 2RBLA 5EFIA 3P30H 2Z35B 3DUHA 4N8VA 2BSSB 2AK1H 2XN9B 4CU7A 5EOQH 4JFHE 4J2XA 2IMNA 2CLRB 3CLEL 3MTRA 1MCWW 5DYOB 1ADQL 1DE4B 3SGEH 4RFOH 4GMTH 1J8HA 5D7LA 2GW5A 2NY1D 2VZVA 3GM8A 3EYFB 1T5XA 3VD7A 4MJIB 4WDIA 3MCLH 1DSFH 5B39B 3CXHJ 3B43A 3PDGA 4MXWL 5EB9A 3VW3L 4P2QB 4YXKL 1JWSA 1W72L 3CLFL 4QRPA 3OKEB 4OLWL 3PQYB 1AGFB 2R0WH 3VFNA 1ERNA 3E6FA 1DQLH 1A9EB 3BGMB 4ZO6A 4UV4L 2C9AA 3QAZB 4BQ8A 4Y16A 4G9FE 3T0EC 5E6YA 5KSBE 1AY1L 5CP7A 4X6CE 1CL7I 4IRZL 4UOJA 2CRYA 4FOMA 3WUWB 1HIML 5FYLD