2ENWA

Mutant y92h structure of tthb049 from thermus thermophilus hb8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRHKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutant Y92H structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
total genus 59
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2enwA00
2F90A 4D4MA 4JOBA 1C80A 3DCYA 3F3KA 2BIFA 2DWOA 3IT2A 1YFKA 2AXNA 5AJXA 2ENWA 2HPAA 5HTKA 5AJVB 1BIFA 1FBTA 1H2EA 3R7AA 4JODA 2WNHA 4AROA 2GFIA 2P77A 2IKQA 2HIAA 1UJCA 1DKNA 4ODIA 3E9EA 3IT1A 1SK8A 3MBKA 2WNIA 3LNTA 5CU7A 3D4IA 2OWDA 1DKPA 2PA0A 3F2IA 5AJYA 3HJGA 2YN0A 4JOCA 3QPUA 1ND5A 3D6AA 1IHPA 3LG2A 3LL4A 1DKOA 1V37A 3FDZB 3K4QA 3QPVA 2P9ZA 3GP5A 3ZHCA 1QFXA 1CVIA 2P75A 2EKZA 2H0QA 4FDTA 4FDUA 1TIPA 4TSRA 4ARSA 4ARVA 3E9CA 1NT4A 5CX4A 4PZ9A 3EOZA 3PGMA 1DKMA 3QPWA 2P2ZA 4IJ6A 4PGMA 1DKLA 4D4JA 3IT3A 4EO9A 5PGMA 1XQ9A 3MXOA 3GW8A 3OI7A 2P78A 4IJ5A 4GPIB 1BQ3A 3EZNA 3NFYA 2H52A 3IT0A 2OWEA 3C7TA 1H2FA 2P30A 4GPZA 3O0TA 2EKBA 2QNIA 1V7QA 1QHFA 1QWOA 2H4ZA 5AK0A 2HHJA 5AJZA 1K6MA 1BQ4A 4E3WA 1T8PA 1EBBA 1RPAA 1DKQA 3FDZA 1E58A 2A9JA 4D4LA 1FZTA 2P9FA 3NTLA 3BIFA 1SKBA 2DWPA 2RFLA 2H4XA 3E9DA 4PZAA 4HBZA 5AJWA 4MA4A 2P9YA 1UJBA 3DB1A 1YJXA 2EOAA 3FJYA 3D8HA 4ARUA 2P6MA 1ND6A 2P79A 4EMBA 3KKKA 1E59A 1RPTA 1SKAA 4QIHA 5CDHA 1C7ZA 2P6OA 2YN2A 2P2YA 1C81A 2I1VB 3GP3A 5HR5A 1SK9A 2A6PA 1RIIA 3K4PA 4D4KA 2WU0A 2ENUA
chains in the Genus database with same CATH superfamily
3R9KA 4II7A 1PX0A 3F96A 1GTL1 1O54A 2FEXA 4C6RA 2LCFA 2HYDA 2DWOA 4GKBA 4ZJUA 1OFIA 1MIOB 2FPKA 1V39A 3EF3A 3FCCA 3KOUA 3Q9NA 4OUDA 5LP6F 3MBOA 3BREA 3ISVA 4TN5A 3A6HA 4YBZA 1FMLA 3N9IA 3I37X 1OX4B 4H6PA 1K89A 1A5ZA 5A0VA 3O8DA 3LKDA 2FLKA 1VYHA 4PYOA 4M98A 3VZRA 2A84A 5EXTA 5I4IA 2C7RA 1Z56C 2W2TA 3ECAA 4KR3A 3C85A 5CBPA 4AP5A 4OH7A 4UBIA 3R5SA 4KK3A 5A71A 3E81A 5I9MA 3LNTA 3IDZA 4HQ0A 4AZSA 1N2HA 3DLCA 4EUNA 2VLBA 3O84A 5B2ZA 2XE4A 2EJTA 4DQXA 1EESA 5HDBB 4ZT7A 3A1UA 1NJFA 1AGYA 3NKVA 4HDMB 3NHKA 1E3TA 3TIVA 4CFSA 2FR0A 4Q7LA 4PLCA 1B0PA 4D97A 1UMCA 2IDKA 1ETHA 2BT4A 2V65A 3D2BA 4CM7A 3HXMA 4N0PA 1XFAA 3ODGA 1AX9A 3VVLA 1V8OA 1YVDA 4C08A 2MSNA 1H8HA 1EFPB 3DTTA 3OLZA 1EWYA 4BATA 1V95A 2CDRA 4DKJA 1C9KA 4ARVA 3WKBA 2W2KB 1W6UA 1C7RA 2JZCA 1L3BA 5LQAA 1OIVA 2H8KA 3GHYA 3AM1A 2AYXA 2HRZA 4BCBA 1NX9A 3V8BA 4RTOA 2Y6UA 1H9CA 1ZIDA 3GLHB 1KSHA 4MUMA 1A9XB 3NU1A 1NQUA 2CHEA 4YUAA 4I4TA 1L4NA 4D7AA 4XLLA 3SHOA 1TU3A 1TEXA 2QMOA 4BTLA 3RVDA 4IHQA 1OAAA 3AW9A 3FMPB 3TXXA 4GKKB 3OT1B 1WKVA 1NQVA 4BWFB 3JQFC 4D5GA 3GEMA 3DV0B 4ZZ2A 4OJKA 2PMDA 1VA5A 1EWTA 1P77A 2BKEA 2GAAA 2PYIA 2VZ8A 3PR2B 4ZI7B 2X5XA 5AM4A 4RHYA 4IEFB 1K6MA 3DF9A 3QG1A 5C46F 1NBMA 1VP3A 1I3MA 1RVDA 3OU7A 4H4EA 3UCFA 3OVMA 1JE1A 2LRHA 3GCZA 1QB8A 4EEXA 1P18A 1Z4LA 1L7BA 2G04A 1NVGA 2NZXA 3SBDA 3ZZMA 3NBQA 2FX2A 4HR7A 4EHIA 2HIHA 4JJIA 5JCPA 1NLFA 1X1DA 2GTIA 5BSEA 1CY6A 5CT4A 2BE7A 4O1IA 4RKFA 1V16A 1BH2A 3VYSB 2J5BA 4X3CA 2QRUA 1XN1A 4JP8A 5C18A 2VYCA 4NDZA 3T7IA 3M4ZA 4ESVA 4UKDA 1NBHA 1X13A 4I4CA 1VPWA 4IEIA 5DCUA 1N2SA 4LTDA 4D3SA 2CYCA 1M2GA 1JI0A 4X5OA 4HRAA 4X60A 3ICWA 3QY9A 3NTVA 3AESB 4E32A 3MFYA 1LF5A 3HGTA 4Y3UA 1OV4A 1ZZEA 1TTTA 4X3OA 3KYCA 3MERA 2BN4A 3UY4A 1WMAA 3ZZTA 4I1RA 4FC6A 5JNTA 1TZ2A 1LSUA 5LB2A 4AZ0A 1CUEA 3HCFA 2ZWMA 2BMFA 1VG1A 2GBGA 4R8SA 1V8FA 4UXIA 4L9SA 5ERXA 1U8YA 2C58A 3ABSB 3M6UA 2ZVJA 3PHGA 1GRRA 1H4VB 2NZJA 2V7PA 2BKXA 3L7KA 4PSUA 1DBQA 4U0JA 4WEQA 4QJBA 2L17A 5KTYA 3N86A 5LJIA 3TQTA 4JKIA 1TU0A 3FZQA 3T7AA 4Y9RA 3HADA 3HJUA 1BCSA 4U6NA 4YALA 2C0CA 3OEHA 4FEGA 3A4NA 4QNNA 4YR9A 5CFZA 2I6SA 2VNKA 4YGYA 3SEAA 4M1TA 4ETMA 2G1JA 2G88A 5HCUA 1TLFA 5MGBA 3EUAA 1K06A 3LUKA 2H0RA 2J1LA 1WHTA 1XEWY 4R9RA 4XQCA 3W5SA 4FE3A 2OG2A 1MT0A 2QS9A 3HXLA 1X74A 3EZGA 3FJOA 5T4EA 13PKA 4YP7A 3RYHA 2HA5A 1M2VA 1BE6A 1CB0A 1POWA 2PGJA 4W8GA 3GQBA 1QX3A 5DBOA 3HSKA 4EF5A 4M4SA 3INGA 3UUGA 1UXGA 2QLLA 1HXHA 2QQFA 1BH6A 5ICFA 1GQFA 5H82A 2SBTA 4M99A 2B3DA 5AW2A 2IPAB 1NXPA 1K7EB 1Q0ZA 1WDTA 4OH1A 1E2UA 1I2ZA 4G5OA 5SY4A 4EFMA 4YQYA 4YP5A 1OB5A 4PG6A 3HDYA 4WTOA 1Z2DA 5CB0A 4M1EA 4U6SA 3SZUA 3DFUA 5BP7A 3D8NA 1QOPB 5E2AA 2BGGA 1PQUA 4Z9YA 2EEPA 4JNKA 1LVUA 3EQ7A 4MICA 4YRPA 1HYEA 4MV4A 4MQBA 3TRJA 1I5OA 2VT2A 1BCRB 2DHEA 3DZIA 3HEAA 1Q1ZA 1X8KA 1TF2A 2JRLA 1R6DA 1FS5A 3H75A 4QQRA 1A8HA 1II9A 2XA9A 2XGSA 1QXSA 4R83A 5T6MA 3O4RA 2AVDA 1QIHA 4UNPA 2X40A 2X0IA 3NNNA 4LNAA 3TG8A 4KPYA 3T7SA 4NFLA 4M7OA 3MB5A 4B76A 5B6IA 1I2BA 1TFUA 2V0CA 4EOGA 4MP6A 3UWMA 3DHVA 1OOEA 4RXMA 2DWPA 1RNLA 5A4FS 1MENA 1TYAE 1UBUS 3O7MA 4WXYB 4KQHA 1S02A 3VKFA 3FHTA 1I51A 4PGGA 4Q15A 4Y0NA 1ZD8A 4ZCQA 1C4KA 1RYFA 3BTSA 3PUVA 5H70A 5CVDA 3B36A 3LJKA 4CG0A 4D96A 1JSRA 1NGSA 1NMZA 4Q16A 2QX9A 3AV0B 3TM5A 3U19A 4M7WA 4PBRA 3TDMA 3HYNA 1KP9A 1OI4A 3R76A 2LW7A 3D3JA 3WV4A 4CTJA 1GPMA 4JHXA 4MJLA 1XEWX 4BUCA 1I10A 1JPUA 1Q17A 3ASYA 4YLYA 1PIWA 3SYMA 3FTQA 1OWNA 3KVNA 1RJ9B 3DOUA 3PHCA 4JLOA 1WDKA 3KLNA 4A7PA 2IS6A 4NYMQ 1H9BA 3ORSA 1SC4A 5ADHA 5KQSA 4A6XA 3BIOA 1X7ZB 5BN4A 1K7YA 3VA7A 1BDIA 1K7SN 5KBYA 1AQLA 1EI9A 3S7TA 1ZUWA 5JQGF 3D0OA 4H31A 3B5JA 1BXRA 1SUEA 3QE0A 3B6ZA 3PXCX 4COOA 2P6UA 5JWRA 1RU3A 2IIBA 2NUPA 3KXKA 4BVKA 5A7HA 4U00A 5HA5A 2WF6A 2OZPA 3LNCA 4LRTB 2C42A 1QIIA 1P5JA 5EI5A 3LSTA 3UAZA 5BNWA 3UOAB 3I9LA 1VECA 3EF1A 4K86A 3QIVA 1NULA 2JBWA 3H2IA 1WTAA 1PE0A 1SN7A 4IQ4A 5LKRA 3PGKA 4J43A 3RJ9A 1O58A 2QAGB 3RM3A 4DLZA 3DLHA 1A9RA 4KNYA 1PJQA 3VO2A 4JJ4A 2CVHA 4IWXA 3AONB 1U5BA 1E2NA 1E3DA 3V48A 3IAXA 3LQKA 4RF2A 3M33A 1ESZA 3E1SA 2O0KA 4BJ6A 5IFKA 5E6RA 5D3MB 1SUPA 3D0KA 4O2LA 5ECGC 2O20A 4CM8A 3I61A 2JGLA 1W48A 1E3WB 3A6DA 1AGPA 1ZX1A 4XRRA 3TCNA 3S1AB 4N7BA 2DKNA 1E1QD 1PHPA 1PV2A 4AN0A 4URYR 4REQB 3ZDAA 1KXZA 3MWJA 5L6MB 4FDVA 1CLEA 3OM1A 3LW8A 3QQPA 5LL6P 5ECWA 3NJ4A 2YJ6A 4C88A 1ICIA 5BVGA 4UVDA 3TOCA 4KQGA 1K68A 2BFPA 2VSOA 1PVOA 4RD1A 1FFCA 2JIZA 1KARA 2IYTA 2V4MA 3V4FA 2D59A 3GMTA 1DIBA 3B1FA 3IILA 4U7HA 2W7TA 3WJ7A 4NKRA 2WB4A 3E1KA 2WRZA 2J67A 3T7CA 1BWPA 4OI4A 4RD3A 4RZUA 5IBRA 4NVRA 2JK1A 4O3FA 5E3IA 2ZM6B 3CWCA 3ROEA 5DRTA 4GPD1 2IEBA 3OSUA 3DEFA 1NUSA 3C1OA 3EQ9A 5AK0A 2RG1A 3Q8LA 5BV1A 4L6IA 2B21A 3T0GA 1XA3A 5DHQA 1HEUA 4HRVA 3D59A 3C5WP 2F67A 3OTWA 2VQEB 1G1MA 3HU1A 2XECA 2NYAA 3EEQA 4EQ6B 4E2ZA 2NQ8A 1PZMA 3I64A 1HYBA 5A03A 4A23A 2NTJA 4QG3A 4Q9KA 3BJEA 4YROA 4G1FA 3ZTYA 4YMLA 3ZGLA 2P5SA 4YMUA 1DQPA 3EK2A 5DNYB 4FFWA 3ER9A 1AHHA 2GEVA 1XMXA 2XMRA 4F6RB 1S3FA 3A1DA 3DMTA 1QB7A 3NBFA 4PU0A 2G09A 3G7SA 3HCBA 3VDMA 2Q6IA 1BVHA 1SRQA 2H2WA 4FNOA 1V0JA 4BAUA 4DA7A 5KX5F 2BVNA 3D6MA 3HMQA 8ATCA 3FRJA 1TW3A 1NI4A 2Q4RA 2AN5A 2OAGA 4UBLA 4WIAA 1MU0A 4K28A 5E8JA 1RHRA 1P2SA 4F9TA 2VP0A 2JNWA 3IJEB 1GNTA 3LGXA 1P5ZB 4R7TA 1NDUA 3WRYC 3CT4A 3KPUA 5KYUB 1UZAA 2QM8A 2QBYB 1TMYA 4D4KA 5K03A 4FBLA 5FRDA 2KHZA 2WHXA 2ICAA 5DZSA 1TJ3A 4L5JA 3SZLA 5LNK1 5LZ9A 1JZSA 1KAQA 4E0BA 1QC5B 2IQ5A 3B51X 1NVVQ 1ID8A 5B3KA 2Z04A 2YASA 4JN6B 4IIGA 1B16A 1W47A 1B0ZA 4BO9A 1Z2OX 1Q20A 3LA6A 1GTZA 1JYFA 1FU8A 4Q05A 4R6XA 3ZJ5A 2WDZA 3MTIA 3WGMA 2PZLA 4QBFA 4UMDA 3V8RA 2K6GA 2QTFA 4YV1A 1LVGA 4S3MA 1HA3A 3EXEA 1JP7A 2FN3A 4TWIA 3TYXA 3NIFB 3FF1A 3R5TA 4EYGA 4PAQA 1KQOA 1Y7HA 4WA7A 5E4TA 3OPYB 4I55A 1PQWA 1ZM2A 1NYRA 3CSDA 5B12A 3UANA 3H05A 5DGHA 3HZOA 3QVGB 3GVCA 2AMVA 4G5XA 2IYNA 4CKYA 3GGCA 4MWOA 2CEKA 3K6RA 1O2DA 1F2UA 4B79A 4EBFA 1RI2A 4IIHA 3RVJA 2YIVX 4AO8A 4C29A 2HCBA 1ZPDA 4MP8A 4L9AA 1TK3A 1E9FA 1R10A 1VG0B 1DZ3A 5J2UA 1GPBA 4PFKA 2W37A 2XT0A 8MHTA 2IEGA 2V6MA 2Z95A 4Y6OA 1DJMA 4LXYA 3V97A 2NAPA 2CNDA 3GUHA 1FP4A 2GTPA 5FH9A 1B8PA 1QTRA 2PL9A 4MWZA 1XD2A 2WPDA 3JR3A 2AFHE 2IX9A 1J9GA 1ZY2A 1MZVA 3VSAA 4KWCA 1TRKA 5LKAA 5K3DA 1QRDA 4K3UA 4MS1A 5G02A 4IIBA 3SR3A 2BP7B 2WAAA 5JJCA 2QI9C 4AY5A 2SNIE 1Z33A 2HCFA 4X63A 4Z54A 3AETA 1QBKC 4ND7A 3O4VA 2BFMA 1OWPA 2P78A 4TKMA 1VOTA 2VN8A 2ZUBA 3GZJA 3HE3A 1M6YA 5FOQA 2ZI6A 2C00A 3QVSA 3U9TA 1H0KA 4BLUA 1DAFA 1T2DA 4KEAA 4YI3A 3URKA 4HX5A 5EYPB 2ZS8A 3B3AA 7ABPA 4AJIA 3MM4A 3TMKA 2CLHB 4L9WA 3KPWA 3I30X 1ZVVA 3LC7O 4TUYA 3ZLBA 1GDTA 3KKZA 5F4ZA 1QS0B 5FI0B 3TVDA 4CL0A 4E4RA 1IY2A 3GFGA 3ZQUA 4COKA 1X1QA 2D5CA 3LUDA 3RIEA 1HM5A 2BTQB 3RB8A 4E5DA 4BQQA 4EJ6A 2MR5A 2DGDA 3D8SA 3A4LA 1KDYA 1FDOA 1T9HA 4I99A 1IYZA 5AXAA 5C8VA 2IPMA 3D54D 3KL2A 4MVJP 1U2SA 2B2NA 2R6AA 3GBVA 5CW1A 1W25A 2BGIA 5FX2A 2XUJA 7AT1A 3RYCB 1ZGBA 4OSPA 3CZCA 1KFCB 3ZDYB 1G20B 1F5NA 1EFVA 4RY2A 2PWAA 2BFBB 3RJMA 4AWAA 1UINA 1OX5A 2IEYA 3AR9A 2RJNA 1IZ0A 2IPNA 3L7AA 4G01B 4JWTA 2C8JA 1S0UA 3BOSA 3NXKA 4IVQA 4CMAA 2M1ZA 2AZDA 3ESDA 4ZYZA 5GJCA 2O8DB 3T4XA 1R2QA 4JFRA 4M38A 5K6AA 1CS4C 4UUQA 1TF7A 1W5AA 3HCDA 2EFGA 4L4RA 1Z82A 2WAYA 2WR8A 2DSNA 3B6KA 4UFNA 1V7CA 4GR9A 1RD4A 1YUNA 4PTLA 5AJXA 4BEBA 1N2CA 3OQOA 4PQFA 3W8RA 2AOWA 2A7XA 4N49A 1JIIA 5K6RA 1M0EA 2V6JA 2P69A 3CR8A 1KDOA 2PBLA 1Z5OA 4KE7A 4PNHA 4TMVA 1HSZA 4AMUA 2TMYA 3LLSA 1DMSA 1OFGA 4BO3A 4DIKA 5KKCA 1WZ2A 5B57C 3F4BA 1IUKA 1B2RA 4B3BA 4EG7A 2WDPA 4XFKA 2A9RA 1GCUA 2OO5C 1T5DX 2W8BB 1FS4A 1WY7A 2ZRNA 4GWKA 1A88A 3WBJA 4LV8B 5HGJA 4IDGA 1FFGA 3E61A 1QV7A 2XYPA 4CTKA 5HSGA 4WWHA 2G72A 2FP4A 2GM5A 4G0OA 1T10A 2XBMA 3N0WA 5FI5A 3BH7A 5EJ2A 1PO7A 2C07A 1GUBA 2P8JA 3WLQA 1SHTX 3RT1A 3SS7X 4PIVA 3STHA 4XJSA 2GUGA 9MHTA 3HUFA 3LI2A 1X1BA 3FLEA 1EVLA 1GR0A 3SZMA 1F8YA 4IKOA 4BFUA 1VG9B 2FWJA 3PNBA 2RGAA 2V7XA 3SJUA 3L02A 1FFYA 1Y8QA 3TUIC 2A3RA 2GD1O 2WLSA 2YJ5A 4L85A 1MQSA 2WNSA 3GRAA 4ASUD 3DQQA 1WB4A 4KWHA 5CFOA 3RF6A 1B6RA 2ZDGA 4ZVTA 2H7XA 2CY0A 4JEMA 4QUEA 4LI0A 3FPLA 1F4VA 2QM7A 1THTA 1GUYA 3WTCA 4LI3X 1JN0A 4FCWA 3NT4A 5HRCA 1DC8A 4C6TB 1XLWA 3SQLA 5ALVA 1U8TA 1JXOA 1O95A 1OUMA 4AZWA 1CJMA 3FLMA 2R65A 3JQAD 4WLFA 1YQUA 5IAGA 1OMOA 3QJ5A 4KFTA 1Y6GA 4TLAA 2R47A 1G2IA 2CT8A 1ATIA 4ITRC 5CXXA 4XQ0A 4H1WA 1WPGA 5ER9A 1PT9A 2I7VA 3UMVA 3FTEA 1YB7A 1HDGO 1RYNA 4GEKA 3USZA 1B0UA 2XWBF 5D5HA 5ER6A 1AMUA 2GZHA 1EGHA 2WMYA 4BU0A 2QZSA 2I71A 2O05A 1R6XA 1OU4A 1JLLB 3ANXA 4DCNA 3GEIA 1QLHA 1Y8CA 2X5OA 1CS0B 1TC2A 2ZJ8A 4FBGA 4FLFA 1SELA 4TS4A 4D74A 4OA5A 4RSRA 4NQRA 4Q93A 1O8CA 3NYIA 3JASB 4QVKA 5GOTA 1B73A 1IEXA 4UAGA 5DK6A 3TZCA 3NG1A 5ES4B 1CQJA 3JYLA 1AKRA 2AQHA 1DO8A 2FOLA 3QV1A 3O3CA 3QMVA 4BNWA 1R8YA 2A9JA 4BNFA 5K05A 5KTNA 4NXNB 3QA3E 3EMVA 2IZ5A 4Y2GA 3PGLA 2DSTA 2HSWA 3LVFO 4KE9A 4MV6A 1J5XA 3RBZA 1G4HA 5DNAA 1NI4B 2B36A 3L18A 3UG7A 3IEMA 1Y37A 3ZDDA 2YXNA 4NZZA 1ZXXA 4DAOA 4Y2YA 4YMWA 5TF0A 1ACLA 3D43A 2R66A 2ZG6A 2RK6A 1GTG1 3GMIA 1D7OA 1VGVA 3DS8A 3DTVB 3L1VA 3ZEIA 1NLUA 2EKDA 4OGLA 2IYLD 1HT2E 3K70D 3M5DA 1IRIA 4LN1A 2PXHA 5CK5A 1ZOPA 3HA2A 4EUEA 1IH8A 5KB3A 5AI8A 1SVMA 4KQJA 5CNIA 2W4MA 4CEIB 1DTSA 1J0BA 5HKAA 2IS1A 4KH1A 3MTAA 3KEFA 1UIRA 2QRQA 3GYGA 4UHCA 3DDHA 3EMBA 4GXTA 2QP3A 2NO0A 3CPEA 3ZPXA 1G60A 1TCCA 3QX3A 1BVRA 2QRHA 5JVDB 1E1RD 1EDZA 3KJEA 3N6RA 4ON9A 3VU8A 4FGKA 2FX3A 4S1TA 1GNPA 3L46A 2ZJAA 4I55B 2W2PA 3CPHA 5BUCA 1DBIA 3BL5A 3C97A 4YX9A 4M7RA 1QH8A 5AYVA 1SIWA 4P0QB 4MR9B 2Q28A 4KGXA 3BCRA 3WYDA 3OZEA 5ICSA 1H1LB 2I2XB 2WD7A 2J8ZA 1X7HA 4OXNA 1UT6A 2P2LA 2QZJA 3DFMA 5B1IA 2PUGA 4GMGA 1TM5E 5CCXA 4UTXA 3ZCSA 4PQYA 1IIBA 1MAUA 1OTXA 5HYVA 1L1EA 4AJKA 2WKQA 4YAWA 3KYIB 4MQEA 4Z2AA 2J5XA 1LQTA 5AVSA 1C0KA 4KLNA 4UNSA 1LFDB 5AJYA 3KQNA 1W2HA 4UATA 4H7HA 3W9YA 2OHHA 3A1SA 3B7GA 4QEZA 1HQCA 3IAHA 3BMNA 3O1LA 1IZZA 5BN5B 4NK4A 5K3FB 3WADA 4D3FA 2Q8NA 3SY8A 2NO6A 1T2CA 2XRYA 3L43A 1SCIA 3LBAA 3QPBA 3R0ZA 1YZHA 4G36A 4PG4A 2IK8A 5BR8B 3I12A 1QPZA 3WLPA 2BCJQ 1KQGA 1JPNA 2NU9A 4FYMA 2P9EA 1Z47A 4GOLD 1KBQA 4QRHA 4E94A 4ZXPA 5I01A 3K1JA 1T29A 1IY1A 2WUWE 3NYWA 4ENWA 1G6OA 1TT5A 4WZAE 1E7QA 4YC7A 1P0PA 2AJLI 5BW4A 1AKQA 1IQUA 3PFHA 2XQJA 1OC4A 5ESXA 3IB3A 4G0YA 2G67A 4W9NC 3KOYA 2C8KA 1XIVA 4RANA 2GPWA 2LV8A 1H05A 5AICA 1AUVA 4XVUA 2LUOA 4JI8B 5AWFC 1Y48E 4AKSA 3PENA 1MAAA 3TNYA 3RFTA 4BVJA 2WFLB 4HAVA 5I48A 3ZOKA 1MJGM 1XVTA 2O2DA 4EMUA 1DIOB 3WR5A 5HZMA 4ZK6A 4BNUA 4K9PA 4F85A 1YASA 4EVRA 4RUKA 1K6EA 4WZBE 3RKSA 4CQMD 2DKFA 2O2EA 2ODWA 4TLDA 3RKUA 1GPYA 3UJ6A 5BPFA 3BT7A 5C1IA 3OCUA 3UK1A 3C6QA 1ORRA 1INLA 3DFFA 3PFFA 2WVGA 1RBMA 1U1EA 3GC6A 4KXYA 2PL1A 4C7JA 2IDZA 5CB4B 1KJJA 1GTRA 4N5HX 2XVXA 3QVUA 1EDEA 3KXLA 3VSEA 2YXPX 1GQRA 5T5QA 2EWVA 2ECKA 2GA8A 2PY6A 2XDYA 4KO4S 3LK6A 4CLHA 3HUUA 1IE3A 2PMBA 3TTWA 4E5YA 1JHDA 3EUFA 2R8YA 1SCQA 1XRPA 1JF8A 2NSYA 2HHLA 3KM0A 4NZNA 4C4TA 4TMTA 5BSWA 1ICEA 1L5HB 1Y0BA 2DE0X 4U3JB 3GH1A 1PGOA 4FS8A 4I5DA 3HU3A 4D44A 5EJ5A 4KRFA 1M6VA 4LY6A 1VBKA 2Q9AA 4UD2A 4BJHB 1YI8A 1R64A 4Z5XA 3EBLA 1SUSA 5A2QA 2VAMA 3ON5A 4Q66C 2IOQA 3NWBA 4RLFA 4JH0A 3ER6A 4DEXA 3OBBA 1EBFA 2RGEA 4QEDA 4MUXA 2IXTA 3RHZA 3X1MA 1RIIA 3ZZ0A 2ETXA 1Z0KA 5TEVA 2B4TO 2IUEA 1D5WA 3HI6A 4UXHA 5ALSA 3ZYZA 5JEDA 2C96A 4Q3CA 3ZWMA 4MQ6A 4WNAB 5KDOA 4Z4FA 1RBZA 3UATA 4CGYA 1TVKB 4M0UA 3UMYA 1A4XA 2ANBA 3R24A 2XNKA 5KCMA 1GAJA 1GWNA 2DHQA 1L5NA 5B58C 5EIBD 1YNSA 1SU7A 4QNRA 5AR1A 1AUXA 3K9LA 4FYJA 4LY3A 3IJPA 5FT9A 1HK7A 3FPHA 2A0KA 3AFHA 3K1ZA 2FCRA 4L4UA 3IAEA 5KYYB 2JLWA 3JQ7A 1DADA 4Y1RA 3IR5A 2CSUA 3VZBA 3GLIA 1EU1A 3RC2A 3MQ4A 4DLLA 5EZYF 1JEDA 4IIJA 5TQ2A 4C30A 1PYDA 3UB4A 5CBKA 3CRW1 4S1OA 1AY0A 5HK9A 3PX3A 5GGXA 5DYTA 1IM8A 2BZSA 3ZLVA 3P9IA 1BHQ1 3PGXA 5IARA 4XR9A 1ILEA 4WT7A 5AHXA 3ZWCA 1FDWA 2NWQA 1AUOA 3QBJA 4KB5A 4M1ZA 5BW5A 2O8CA 3U13A 1JTFA 3PEYA 4DR6B 1CP2A 3AERB 1CQZA 3WQBA 2AA3A 1L3IA 3IAAA 2JG3A 2YVQA 3M34A 5CTAA 3NHFA 1IB6A 1J5PA 1H2BA 2IXEA 2KPOA 4HBGA 1XT6A 2F55A 3ZDZB 1O9HA 1Y9ZA 2IU3A 2CK3D 5IEJA 4FDAA 4Z8YA 1FXSA 3AW8A 3IDOA 4EL0A 3V00A 1GQ2A 1SZCA 1XK6A 4IP0A 4ZZ3A 4DSTA 1D03A 4RK7A 1LTKA 1PEKE 1WIWA 3NDRA 4TYPA 1KOLA 2D2VA 3P32A 2L2QA 2R6R1 3E84A 3ICVA 1P4GA 1KZ1A 3GFVA 4RE5A 4RIIA 4W7HA 1Q57A 3E9QA 2FMHA 3S2IA 3VU3A 2WV7A 3RAPR 2ODNA 5FPHA 2V98A 4B0PA 1GRQA 1Y34E 2FY8A 2VQ6A 2IBTA 5HMLA 4IHJB 3B85A 4AMZA 3K70B 1N2BA 3E7XA 4BN0A 1U0TA 3R2JA 4GPZA 3EDOA 3Q10A 4GGOA 3IUMA 3A11A 3OHSX 3EDQA 5ALWA 2PT5A 1HI9A 2VWGA 3H2JA 4RHTA 4AUMA 4IO1A 4JBXA 4P38A 4EHKA 1YIAA 2AOVA 3DWIA 2BW0A 1WP9A 1LCIA 1O6CA 1QH1A 4WBXC 1M2VB 3HPRA 3EISA 3LDGA 4GZMA 4UCXA 5G1PA 2Y0EA 1JEEA 4C0LA 1SBQA 3FJ1A 1GO2A 2W6PA 5B6JA 4BKOA 5KEIA 2PX4A 2IUSA 2CVFA 4DNXA 1PW5A 1OQAA 5EZYA 4MV3A 5G4LA 1RXEA 1RKXA 2JCVA 2V7BA 1A98A 2OTCA 3HDTA 3RUIA 4MPJA 3UYKA 4MS4A 5H02A 2FPIB 3G8BA 3UFBA 4JVOA 5IU6A 1U8CB 5AW6A 3OO1A 3L8HA 3TR0A 2GAJA 2GBIA 1F8GA 1WZEA 3GL9A 4ME6A 1GFWA 1PNVA 2IHTA 3RGGA 4LOAA 3QSGA 1M1NA 2FE4A 5J1TB 5I7EA 4NV3A 4QDJA 5AXCA 3UK0A 1KNXA 1PX2A 3MD0A 1ZINA 3NNDA 3EGIA 1FYXA 1EM8A 5ALLA 5P8WA 3VO9A 1KRWA 5KNBH 2J9FA 2ATXA 4OK3A 2AJBA 3OH8A 3DP7A 4TQUS 1DTEA 4WSOA 3IE0A 1IY9A 3L4BA 2BUBA 1KU0A 2E0IA 1TEVA 4HLNA 4GGMX 1F51E 3PRYA 2Y0CA 1D3AA 3TOXA 1MX5A 3WL6A 5JNWA 1J7KA 1R15A 1US8A 4IV5A 4J75A 3TQQA 3ZHRA 3FUUA 3GRCA 4OA8A 5AOAA 4IDQA 3DNMA 4UUOA 4RSHA 3OIVA 1OE0A 2ASEA 3HJTA 4FZ3A 4IYJA 5JNSA 4M8SA 3HH8A 1OZFA 2XXBA 3KQUA 4AJHA 4M8LA 2VHTA 1WCYA 3RKRA 4BFXA 3ICEA 1S1MA 3NASA 2XE7A 4QTZA 4I3FA 4U2BA 1JPVA 4Y6GB 3MD9A 3CVOA 3QKRB 5EP2A 2X4GA 3GJ3A 5I7RA 2CDBA 1A7UA 3D0QA 4FDLA 2AOUA 2GS9A 5E1BA 1K1EA 1SEVA 4CCWA 1O95D 3OOYA 3CZMA 4IIDA 1L5MA 1SO8A 1N5IA 3QLUA 1ZN8A 4HMQA 4P33A 4LXHA 5REQB 4F0JA 5CT9A 1L4YA 3GRRA 4EW2A 5JQWA 1K5GA 2OZKA 3C6MA 3EXFA 2ZI5A 5K2MA 2CVZA 1GYRA 3CX7A 5IP5A 1Z63A 1QM5A 2ADOA 2QJFA 3CTPA 4RKYA 4I3GA 2GCNA 4KV7A 2ZQ5A 2XHEA 1IAQA 2JGMA 2VUHB 4ASUA 1L5WA 1YC2A 3L4SO 3GLIB 2Y68A 1UPFA 4B3MB 1K9VF 1Y63A 1R9NA 1DAEA 2J5RA 4QGAA 4O2BB 3R7WB 3RYFA 3EG9A 4QOIA 5EGSA 4CMIB 3KTAB 3VNUA 1S5PA 1SU4A 4KREA 1KVRA 5HQ3A 4MDHA 2SECE 4NMMA 1TYBE 1H2ZA 3FWZA 3LRXA 3ZCXA 3I52A 1T15A 4DCCA 3NT2A 3EPLA 1KQFA 1BXRB 3KEOA 3O8QB 3ZGNA 1EG2A 3HI4A 3W90A 4YRAA 4IDNA 1C5KA 1OBHA 2W00A 1H65A 1XV5A 5ENVA 3GEPA 4LZPA 1VJTA 5HMMA 2B9VA 2J07A 1B1CA 1N9ZA 3P20A 4GR4A 1R6VA 3E3MA 2B20A 3I42A 3PRJA 3QIAA 2HGZA 2A35A 2G0NA 1C4OA 2PLAA 1YS1X 3DO6A 1EZ4A 5L7WA 3JVVA 4Z1MA 2G8LA 1DWOA 3T38A 5J23A 2IP1A 3QBDA 4XM1A 4UU8A 1JAYA 4HLUC 3UT5B 2TMGA 3I6BA 8ADHA 3PWSA 5ALHA 3QYJA 1U8FO 4XDGA 1T1GA 5E1DA 3FRHA 4LYFA 5ALQA 2Q2NA 1MW9X 2AV6A 3H0EA 1D1QA 4DCSA 1LI4A 4YFYA 4A2QA 4S2EA 4TMWA 2VT7A 5KCZA 4EGFA 4ERNA 1A8PA 3SOZA 4N3CA 1OY1A 1ZK1A 1GGFA 2V6GA 1C1HA 2RFLA 2Z5FA 3A7DA 3R23A 3FNFA 4ND3A 4PS1A 3TVYA 4GI5A 4MKRA 4BU1A 3AT1A 1I7SB 2G6TA 2JLUA 3HBMA 4GYJA 5F5XA 5AUQA 4RVDA 4B6RA 1HTBA 1ULZA 1N2JA 5TQJA 1VJDA 2PBFA 4Q7EA 4NP6A 3X1JA 1TM7E 1K6IA 1IWPB 2MTBA 4QA9A 3F9CA 1QE5A 2CFTA 4W99A 6Q21A 3KX2A 4LHVA 2NSLA 4JYZA 3AUUA 2O54A 3AF0A 2JIOA 3G2MA 5G3YA 1LFAA 2QOEA 4O4IF 3I2KA 4YRRA 1V6AA 2GX6A 3NIWA 2FPIA 2P6OA 2GCOB 4JLWA 2ODQA 4KQXA 1KZ9A 3QOWA 3O73A 4K9SA 3RC1A 3ZVLA 1YJCA 3ZWWA 4XVHA 3JALB 5ALOA 4EPWA 1FIUA 1KAEA 4N7RA 3SF0A 4PX5A 3EZ6A 1I1HA 2W9XA 4F92B 1N2ZA 3DL7A 4HAWA 4QSHA 1Q7GA 2XNDD 3VX4A 4FR2A 3OKCA 4D1YA 3A3KA 1Z2PX 5A9SA 1TUBA 4BNDB 3LF1A 1D6JA 1G8HA 2J31A 5HP4A 2PPLA 1OA1A 3N2KA 4N39A 4FNAA 2AE1A 3NOOA 4I08A 4KSYA 4UBOA 3U37A 1W9HA 2RHJA 4X1IA 1N77A 3ZUGA 1NVDA 3OOEA 1DUVG 1P44A 5A3QA 1SM4A 5FB3A 3CV3A 3EQ8A 5SZIA 5B3JC 4I8DA 2GILA 1H5QA 5CEFA 1I36A 3IAM6 4JJGA 4XUCA 4X6UA 2GM4A 2WTEA 2R7AA 1G3IA 4RMJA 1K8QA 2HT6A 1SAYA 4W6ZA 1PWYE 2C7VA 1KI1A 2GMWA 4UHEA 2AS0A 3K3PA 5CM9C 5LDHA 5JHGB 3F78A 2HJVA 2WE8A 4ML3A 4JOCA 1BHO1 3UEOA 4ZMBA 1I2DA 4YFVA 5L95A 1EH5A 1OI2A 5GY7A 5L9AA 1TCVA 1IOLA 1UC5B 4US0R 4XTCS 4DJJA 1XMVA 3QPVA 1KY2A 2OD9A 1VE3A 3QUSA 4PGHA 1X7WA 2HBQA 2HMTA 2D2FA 1ZJ6A 4B8ZA 4J16C 4XTRA 1Z6AA 4K9DA 4ZCLA 2G08A 3R5HA 1IOWA 1F1JA 3IVMA 2GYVA 3EIOA 5IBQA 4ALJA 4NRDA 3N8IA 5TPWB 1W1UA 3QF4A 3JS5A 3PPVA 4KLCA 1G8KA 1Z6PA 4G1VA 4RJ2A 4XKJA 2MSKA 5CAEB 4ZI2A 1UAGA 5L4SA 1U11A 3GA0A 1FTSA 4LZLA 3TGLA 3LCRA 4LSZA 5DE3A 4BP9A 3SIXA 3ICOA 4HY3A 3RAFC 4HAUA 2DLDA 1W87A 4P1ZA 4M89A 1WUKS 5EOVA 2I80A 4ZO7A 5C35A 5IXSA 4Z4GA 1J5EB 1AHPA 5B55A 1FL9A 2JH9A 4NARA 5DHUA 3X44A 3FMFA 1ISRA 1OIWA 2PWZA 2WIDA 3EZNA 3N74A 1YI1A 3VZSA 1EFTA 1MFZA 1NW3A 2OT3B 3O4GA 2VEOA 3ROGA 1LBIA 2LZ0A 4EG1A 3KEMA 1DEKA 2TSYB 4EATA 1N7JA 4JJ6A 4MUAA 3AY3A 3EYWA 4LZJA 2YRXA 2QY6A 5AT1A 2HU8A 2YN4A 1LQUA 2FPSA 2UZ4A 5JG7A 4DZZA 1NG9A 3F8SA 2NGRA 4EZEA 1QAOA 1ZJZA 3NVAA 4HNGA 3JVIA 4J0QA 2J4FA 5DHRA 3GPDG 4DQKA 4YCMA 2GB4A 2ID8A 2IHUA 5A6VA 2BFEB 5K0ZA 2PU7A 1PNQA 3DAOA 3H3XA 3KVYA 4JCOA 5J43A 1RLOA 1FP4B 1ZI8A 2E4YA 3R6WA 3SDBA 3OMXA 4CQNA 4OK6A 2JGJA 1NSTA 5CVTA 2B1IA 4KUHA 5T3UA 5KREA 1M75A 3EAQA 1N3LA 4TMZA 3KIPA 3KLOA 3F74A 2X9QA 1KORA 5GP1A 2Q4BA 1KYTA 3NPMA 4U9UA 3H13A 4AJ2A 4D26A 4BRUA 4K6CA 2XSZD 3OPXA 3NANA 2J6HA 5AKXA 1KXJA 3FUTA 1RPTA 3LY8A 1UWLA 2WWVD 1P2VA 1DIRA 4MVJE 3IE1A 5K0TA 1PR0A 3ENWA 3OLVA 4RSMA 3WO1A 1KQNA 2FTKE 3H11B 2YYZA 5AM3A 1R8JA 4PX9A 2IL1A 2ZYIA 4KITB 4Q4LA 3TBHA 2HDNB 2PUCA 2FZEA 3C1TA 3L05A 2FG6C 3QKSA 3TQSA 1CZLA 1NU8A 3DXYA 5AUOB 1V11B 3Q1LA 3L01A 4CF5A 3M81A 3PD0A 4JSTA 3OZBA 3GLIE 2NUTA 2AMYA 3H5VA 1P9RA 2VJPA 4GKVA 3RC8A 1N5OX 2ATIA 2DBVO 4ZALA 4HLDA 1T6YA 1ZSVA 1W0CA 3NEJA 4FZRA 2J6CA 5H0IA 1E6LA 1U2QA 4JI3B 3FTPA 4G67A 4HGZA 3U7JA 3W7AA 1P6XA 4ZEWA 4X20B 3CE6A 1VI6A 1DTWA 3LUAA 3ZBUA 1RM5A 3MMXA 1NC1A 3K2BA 3NCHA 2JFGA 1NW9B 3H99A 5J5AA 5AKEA 3WK4A 3NBXX 2AKAB 4MAFA 5DTQA 4MYTA 4EQZA 3D4BA 3FKJA 2PKXA 3VZQA 5E4FA 1KSGA 4RF4A 3CVXA 2Y1CA 1T4DA 2OCXA 3VQTA 5G0TA 1E6MA 4DDMA 1N7IA 3RYFB 2V7QD 4MKHA 4LMRA 4QECA 3GJ8A 4X66B 4AY2A 1T25A 3NHUA 2A86A 2QYTA 2R8XA 2EJWA 2F3PA 1JKXA 1NX6A 4QTXA 2QXTA 2C2XA 2C9YA 3A6FA 4I19A 3Q6MA 4IJVA 5SYMA 3VYRB 2QX8A 3KOMA 3I5YA 4IBOA 2B4YA 1KH2A 1QMPA 3STTA 3ZVMA 1AXRA 1QFXA 4IJMA 1P4HA 1E7YA 4L5AA 3T4UA 2L0XA 4Q9IA 1EVKA 2ZI4A 1O94D 4D9MA 5LZ2A 5C1DA 1Y42X 2YMLA 3AY6A 2QRPA 2YOHA 1G0OA 4FC7A 5EEHA 2ORYA 1XNQB 3OLQA 2HUPA 4DPKA 1CY0A 4S35A 4H59A 4D4JA 2D8MA 4F38A 1YE8A 3QVLA 4WLEA 2GWRA 4XLTA 1S2OA 5LIPA 4MR7A 3RG2A 3VPXA 1FJXA 1JQEA 1CLUA 3EGXB 4N41A 2R8RA 4AJLA 2XZPA 2AXEA 5IC4A 4OL9A 1KI3A 4Z1OA 1ZUNB 4PLYA 4FPXA 4F5DA 1UC9A 2HD4A 2CMGA 2VTDA 2XUAA 4Y18A 3L5KA 1QHFA 2Q6LA 2GDZA 3NBYC 1SCNE 2OOKA 3RYHB 3AI7A 3LC0A 3O4IA 4MRMB 4QTTB 3I58A 2RI6A 1H22A 2QL5A 4N5NA 1RAHA 3ZIDA 4LV6A 4G5RA 4RPIA 5EN4A 3P45A 1GV1A 3O8LA 4NJEB 2YUIA 3BSFA 3G8YA 4RHFA 1NVFA 3ABRB 4EG0A 4DUYB 1X1EA 1BJKA 2GEDA 4FOTA 3TLCA 1W2WB 3LS2A 1E2QA 1W0KD 2IZOA 3FF4A 1SHLA 1G1AA 3PC6A 2NYRA 4L72A 3U3KA 1WX1A 5DKFA 4JI2B 2I2BA 3DLIA 3JQAA 2X0RA 1DAHA 4YV7A 3KKNA 4E12A 2VAWA 3MTQA 2BFEA 3GX1A 4CM1A 3BXXA 3M4YA 2WM2A 2PFGA 221PA 3I2IA 5IC5A 3T3HA 3VR5A 5JAOA 4Z4HA 4HUTA 1NMYA 3B3FA 1IXSB 3IVXA 5E0KB 3EVGA 4YDQA 5KQMA 3HXOA 4EA7A 1USKA 2C97A 2CNWA 4JZYA 3JQRA 5IT0A 1CX9B 1WZUA 3AVOA 3BWXA 2V9CA 3D6TB 3CX3A 3I45A 4IXNA 4F46A 4XUGB 4RZSA 1R1DA 1X7GA 1X92A 2R87A 4QOGA 1XCJA 4RMHA 1T9KA 5AVTA 1OFUX 2A0XA 3SD7A 2PKYX 3AP1A 4YAOA 3J81k 3AEYA 5F1PA 2O8DA 2PUAA 1TIBA 3CXUA 1CQJB 1C9MA 1UJ6A 4RPGA 4QT4A 4WX2B 5AVXA 5LLTA 1WY5A 3N2IA 3DLBA 3A6PC 2HK7A 4X3PA 2JJ8A 3VKGA 3G17A 3BHIA 2Z9CA 3EDYA 3JAWA 5JH7A 1XHLA 2OSVA 4UUMA 4CN8A 2QTHA 4S0XA 2G28A 1CZKA 4ZTBA 5EC8A 5JECA 5F73A 1V5WA 4LF4B 4JJZA 1K6JA 5C8XA 3RQSA 3HV2A 2FFHA 5CT5A 3RNOA 1WB9A 1HF3A 3DW3X 2BPOA 4JYMA 3CH6A 3N2EA 5BYKA 3L6CA 3PIIA 1J00A 2D1YA 1IJKA 5JC1A 4E31A 3ZJTA 1DPFA 3W1VA 4R2HA 3DXZA 2VP6A 1DTWB 1JU3A 2H1WA 3E4CA 3PUXA 4L0QA 3ZLTA 5HOQA 1NRIA 5FI3A 4UVHA 5G4KA 3QOXA 3PPWA 2F8SA 1WKCA 3QF4B 4YO8A 4MI9A 3ZZNA 1DKOA 3A04A 2NNLD 1B7GO 4KAAA 1BWQA 4GI7A 1NBME 3FIJA 4FOSA 1F8XA 2FYTA 4JBGA 4KQ6A 2W4QA 5AVJA 5AVUA 1Q14A 2PR7A 2EJCA 5DV9A 1EFKA 2A33A 2MWMA 1SIUA 4LISA 4NNOA 2IPOA 3BG5A 4MZXA 1UBGA 3CUSA 5EE9A 1B0AA 4QGFA 2BEUB 2WILA 3K05A 1RWQA 3PDUA 4RKRA 5L7TA 3WL3A 3GRVA 2H00A 2KW5A 4RFVA 3RU2A 1UJ5A 1AN0A 5FUVA 1QK5A 2GPSA 3H9EO 1XDBA 1JXQA 4AAYA 2FE1A 2QUJA 3N8KA 3NHPA 3PKJA 1LK5A 4H9GA 2CJYA 1W52X 4BNHA 3S5JA 2OWEA 5AKJA 3I2JA 1OGYA 4UXJA 3MEQA 2D7DA 4LG1A 3AO0B 3ESRA 4OD0A 5EP4A 1UQTA 3I09A 4ALNA 5EP1A 2XDQB 3P0IA 4RJJA 1E1RA 1C0PA 4YMTA 2G9NA 2QLTA 3EXHB 3GVHA 4NBUA 3SICE 1NJSA 2PRYA 4PQRA 5KSPA 4LRQA 4MB6A 1L7EA 4WKCA 1TRHA 3SBEA 3WP1B 1H0RA 4PNPA 1VG8A 3OPQA 1XQ6A 3NAQA 1MAVA 4NU6A 1YZNA 3TJZA 4BZWA 3DCNA 3ELUA 4Y30A 3OMWA 1YJAA 2HU7A 4OBXA 1L5OA 2X15A 2ZIEA 3S2GA 2P1RA 1YBVA 4NENB 1CJKC 1OKKD 3PL1A 3ZCUA 1ADJA 2R3SA 5KOYA 3EXIA 4XSGA 1FTWA 2A5LA 2BZ1A 5LBIA 4LQLA 5IDXA 5KTOA 3ZHZA 5DOZA 3SBOA 3BFXA 4E5MA 1PAUA 3TRDA 1JZQA 3W4IA 5IDQA 5LM3A 4BLPA 4EEKA 4E2YA 4FR0A 4GZ5A 2RI1A 4CDGA 2VRBA 5BSMA 3M1YA 4C5CA 2HSZA 2V0NA 4RCVA 4B35A 4E5NA 2VCHA 3A4YA 5IZ4A 5JZMA 2J6IA 1J2TA 3SQOA 3KQHA 2QY9A 1B23P 1SCUA 4LXTA 2J41A 2IOFK 3F3KA 3MOGA 4MO9A 3OT5A 4ZAWA 4C76A 4K6HA 1KZGB 4B09A 2A1TR 2O5CA 1R66A 4LF7B 2BMDA 2QPAA 2DAPA 2VF5X 4D8TA 2R6ZA 1GZ4A 2WNHA 2XWSA 3N0TA 5LR6A 2DJ5A 3A26A 3QNWA 3NWEA 4IS3A 5E7QA 1E6WA 3AFOA 3K53A 4FNGA 4MQFB 4UW9A 5BO5A 5ADUS 1NATA 2XNDA 2FGKA 2HHAA 5LDGA 4O2RA 3S99A 2NO4A 4OI1A 2F8LA 5EIEA 2NXEA 2ETVA 4B8WA 3BWCA 4C04A 3VTFA 2Q2OA 3FBWA 3AVYA 3WGGA 1M5UA 3K09A 3PXBA 1Z4PX 3DMGA 3KDAA 4KPUA 5K3EA 1PT6A 4KBGA 5TJHA 1EFDN 4XQGA 1CZHA 3NJRA 2QX7A 3C43A 5EJMA 4RQUA 4QVIA 4UJ3A 3P27A 2GHTA 3WRYA 1SEPA 3CIFA 5J1SB 1AE1A 3O83A 2I78A 2XWQA 1HNZB 2XVAA 2F1JA 3FCOA 4CT5A 1SG9A 1IB0A 2GFHA 1XP8A 2Q62A 4HEJA 4TSRA 4P2BA 2I62A 2OGSA 3BMNB 1DQYA 1FP2A 3NORA 5K3FA 4OFZA 2EKPA 3N7AA 4UHJA 4D0NA 5M7EA 3DMTC 1U0SY 2GLTA 1FDRA 4LHEA 2VJKA 3BFPA 5DYYA 1U1DA 2ZYDA 1UK7A 5AKLA 2YY7A 1LDYA 4M0LA 3MAJA 4BFZA 1WHSA 2D6FA 4Y1RB 3PU6A 2VTEA 2Q5JA 4NEGA 4NICA 4R1LA 4P82A 1W0JD 4NJEA 2XGOA 3I9MA 4Q3NA 2P30A 1HG0A 1HFEL 2Y66A 4YIHA 1PF7E 3GPCA 2Q3JA 3PQ4A 3M4NA 3QPDA 2F9FA 3A1EA 3UFXB 2O1EA 1K4KA 4AZTA 3UOGA 5JCZA 4L57A 2YNMD 4BMCA 1DHRA 4ESHA 3QWBA 3Q11A 1G5PA 4LYHA 4R2XA 1W4ZA 3H5WA 4E2FA 5A4DA 3SSMA 5JZBA 2DEUA 1HNNA 4BCCA 3TNJA 1FMJA 4PS0A 1KKLA 1IFXA 1KJZA 3KRTA 4DLYA 4PPGA 2ONYA 1GPWB 3DM9B 3LHSA 2V3CC 1U1IA 1O6FA 2UZIR 2XUOA 3MYYA 4IKPA 4QX6A 2WT4A 3ZNOA 3OA2A 4UUNA 4F8YA 3BN3A 1G8JA 3G88A 4GWGA 3M3HA 4FYXA 1USIA 1MV5A 1SVOA 2ZB2A 3IEXA 4Q1VA 2P6MA 3NUZA 4EA9A 3G85A 5J2UF 2NYVA 1XNRB 2PTGA 4LDZA 1Z7EA 1ECLA 2E3JA 3C3YA 3C74A 2HMYB 2IFTA 1CUSA 1DNPA 3IAFA 3TLJA 4A8JA 1FSSA 2C7BA 2EFJA 1B41A 1XZMA 2Q3DA 4RVSA 4UTVA 3HDJA 1KYIA 3MJCA 2CXOA 2EKQA 1IVSA 1Z8HA 1JSXA 1Q1BA 3RARA 4F3TA 3Q3CA 4Q3DA 1TCAA 1LSSA 2N1BA 3UXMA 1YQWA 1TMOA 1M7BA 2PGNA 3EXIB 4Q24A 1ZK3A 1RI3A 3B48A 5HF6A 4CETA 1P1KA 3CZ4A 4GBJA 1WSWA 4LVUA 3UMFA 2PFKA 2WV9A 2BZGA 3ZK7A 5K09A 1U2DC 1UKYA 2IP2A 3SNHA 4EGAA 1M2JA 5LZ7A 3DCJA 1R50A 1KR2A 2RJOA 1JQ5A 5J2TA 2UZAA 5JSYA 3G82C 3UT6A 3I3SR 2PQMA 3AWIA 4GM4A 5BSUA 3VR5H 4YUXA 1T8UA 2WJHA 2E85A 2J48A 3PJRA 2ZROA 4XPIA 5HS6A 5IVHA 2P3LA 3ZI7A 3U60B 5T4HA 3IQFA 4MS4B 1O4VA 3H16A 5KC9A 1CE8A 3O7WA 4KQ2A 1R0KA 1CVLA 1USWA 4L8VA 3AL3A 4KC0A 2VSFA 5E6SA 3E9YA 2ZPAA 2P6NA 3W2GA 4A8JC 4IMIB 3JYNA 1SKYE 2JZNA 4HN4B 3OFND 2WT8A 3FMVA 2XKBA 2YC2C 4LUCA 1GZSA 2GWHA 5DBHX 5FBKA 1VBNA 4BJ5A 2EZ9A 1QR6A 2JA1A 3H5RA 1E3LA 1RZVA 3D7SA 1M73E 1SVIA 1I5EA 2BHLA 3EQ6A 3L8DA 4B2LA 2OOSA 2L82A 2OM2A 1U0NA 1CVIA 5L4NA 1CF2O 5JASA 5L4LA 1OAKA 2HRBA 2GJ9A 5A0TA 1JJBA 2FHPA 1AS2A 2V4UA 3EC1A 5CFQA 1ZVKA 1U6IA 4RVUA 3ENNA 1XYYA 2Q46A 3W3ZB 3QPWA 3HNPA 2HBRA 3UHFA 2C5EA 4Q3OA 1BVUA 5DU2A 2O8CB 3NP9A 2JIRA 1YT5A 3KUCA 5AW1A 2C57A 1XD2B 2XDQA 3IMEA 4HDAA 3M6IA 1YMUA 5CH8A 2BGNA 2YXLA 3KWFA 1JAHA 5KC8A 2CSXA 1HLPA 1W5TA 2ZUVA 5HKLA 1PL0A 5B1YA 3ZE2B 4XD7A 4PHCA 1H2FA 1SXJB 4YJHB 1XF1A 1DEXA 2QN8A 4HN9A 1G8FA 1OZGA 2F1HA 3PDHA 2FSFA 4Q9DA 5ESRA 5FR2A 1XZJA 5EJIA 2AN9A 1HYGA 5CA1B 2ZJBA 3PTLA 1Z39A 1JRLA 2D0DA 2YV2A 3NHSA 4OKSA 4CHTA 4TVSA 5CFPA 1U04A 1WTCA 2A1IA 2Q7XA 4RA9B 3V8PA 3FM9A 4WJLA 3ZS9A 2ET6A 5C51B 2H2GA 2H8GA 2FF5A 2BR5A 3F6YA 3JQGB 2XIQA 1KEEB 2OFPA 4P31A 4PZAA 2GAFA 2I34A 2ZATA 3L49A 1YDFA 1T2UA 2LKCA 4KO2S 3I04M 4X91A 3W3AH 5GONF 1X80B 1KYWA 3MRXA 4RK1A 1N0UA 4JB3A 2VJQA 3EAGA 1Z07A 1GILA 3R3SA 6REQA 2PLNA 4C3UA 1P7CA 2GEJA 4XE5A 1C8LA 3HG7A 5MN5A 2GSDA 4LKOA 2AMLA 5B1EA 2QAGC 2X1MA 3W4JA 3GVXA 2V3WA 3EVFA 4DM4A 1TVMA 4H0CA 2XQGA 3QYPA 1D2MA 1ZLXA 2VUUA 1Q12A 4NS1A 1HT3A 1P91A 1RPNA 4AJEA 1PZFA 5HRUA 2P2YA 4UM8B 3D4OA 4QDTA 2KMLA 3N5KA 4Z8XA 5IYZA 3Q3JB 2WSMA 1RDFA 2FKNA 3H1FA 4G25A 4DT1B 2V1XA 5C8YF 1PFVA 2DUWA 2O4CA 1T3GA 2R1ZA 1L5RA 5TGTA 3WMRA 4JOBA 4FILA 4G85A 3NRCA 4BQFA 3SJ7A 4BYMA 1C3LA 4GEGA 3OZ7A 3EZ7A 2GEBA 4DB4A 1GPAA 4GLBA 2FQXA 2QMUA 4F2PA 2XCSB 1XYGA 2PKEA 2A0UA 4HAOA 3CURA 4IOLA 3QP9A 1VL8A 3ICQB 1UFRA 1GRCA 1X1SA 4O4LF 2GD0A 1RHJA 2JIZD 2FKAA 3QFRA 2QRNA 4F04A 1PLKA 1ECFA 4HH0A 2DM6A 4M36A 1EGQA 4R40A 2EERA 5G0UA 3ANMA 3IOYA 3LQ1A 4P08A 7REQB 5I5EA 4B33A 1B1AA 4J3JA 4KZKA 2CCJA 2E5FA 3N1UA 1YHNA 4PZ0A 4AIRA 2VDLB 3FOAA 1Z2CA 1R74A 1SZPA 2HO5A 2CDNA 4NBTA 5A3SA 1XZEA 5FOVA 5CVUA 3X1DA 4A9AA 4DEYA 1JFVA 3KUDA 1WSBA 2I7CA 3P2EA 4ZU1X 5BSGA 4HMOA 1LS1A 1PW7A 4O2AA 1LBEA 5BOVA 3PSAA 3ZCPA 4QDUA 3W5AA 1NZDA 3HB5X 5JXJA 3HA3A 2AC4A 2ZAIA 4HHEA 4MYUA 1F7UA 3K4HA 3IH5A 1Q77A 1X1RA 5IVPA 5C5IA 2NM0A 1D07A 5ICEA 5LQNA 4ARSA 3UUWA 2R6FA 1NQ5A 1UDAA 2FWBA 2V4ZA 3C16C 1PJ4A 2OHIA 2Q29A 2CB0A 4M55A 3M4XA 4RVOA 3H2SA 1V8PA 2VPTA 1GQOA 3H9UA 4LBWA 3RRNA 3FTCA 3FGOA 3AF5A 3CRMA 2JGNA 1OVMA 2VK8A 5L3SA 1CUVA 3SZOA 2CJWA 4EGCB 1N75A 3AU9A 2QE7A 3FYDA 4QL3A 3FYHA 5E9AA 1NW7A 2A5YB 2IHVA 1XTPA 3HZRA 4KO3S 1EM6A 4QSMA 3SE7A 4C01A 1NG1A 3BHNA 3IT0A 4XUDA 2XMBA 3L8GA 4WEOA 3BCSA 4GI3A 3WWPA 4DC0A 2FJUA 1UOPA 1NF2A 2L18A 1UDBA 1Z0UA 1E2KA 2PH7A 3KQPA 5K0SA 2H4ZA 3COYA 1S8NA 5D6NA 4FN4A 3NGLA 2GJ4A 4C89A 4B31A 3ORQA 2C7OA 5HTOA 2FSSA 2P9FA 1G16A 3PJGA 1X7WB 5CJ2A 1FNNA 2RKBA 2X9VA 1FUUA 4FHGA 2NU9B 3IEUA 5D5PA 4ZKEA 5I5GA 4BQRA 1XYVA 2YXEA 3ZW8A 1SQFA 1ZD9A 3FPEA 4F45A 3F6EX 1ZMXA 4P3PA 3GD7A 4RA9A 1Z16A 3V8VA 2J3MA 1PG0A 3P97A 4UFOA 4RTKA 1AHIA 3EMDA 1YGPA 2ZDHA 2HMSA 3MJHA 2NXNA 1COWD 5A5FA 2E2WA 3FBGA 4EW3A 2P91A 5A4JA 4RV5A 4X84A 3SX2A 1RRVA 4BECA 4ZVKA 3KPYA 3OZVA 4G5SA 3DDUA 1QHHA 3U4AA 2H4YA 4BQNA 1P81A 3GRFA 3D31A 4W4TA 4DRYA 1AXGA 5FHQA 3LDAA 5HIIA 3UK6A 4RZQA 2Z8XA 4F1JA 2X5KO 2VHYA 5AXBA 1GIAA 4UQOA 4RCZA 4DDHA 3OE5A 4EFLA 1YULA 2CUNA 2H18A 2O19A 4ZOBA 4FFBA 1NIPA 2ONKA 1B8UA 1WUTA 4G26A 1YFKA 1H3EA 1KJ9A 4B87A 1C0EA 2HPAA 3GXBA 4UE2A 1AVTA 3WRXA 5BUQA 3HR4A 2XLBA 5H68A 4QU5A 1GG5A 4FOLA 3ECSA 4CTOA 5TSDA 1E0KA 2C9ZA 2VPPA 1E7SA 2XD9A 1YB4A 3HL0A 1EVIA 3BQ9A 1G7TA 1ZXLA 3C8MA 5DGDA 5JCJA 4E4YA 4F9EA 3RDPA 3ERCA 4R84A 4M83A 4RABA 1RM3A 4R2JA 2PXCA 1M0SA 2JK0A 3VGJA 4BEJA 1M72A 2G6BA 3PI6A 3WBBA 3MGKA 2OXEA 1J8VA 3ZU6A 1OC2A 1U9JA 4C2AA 4H17A 3CKKA 4MUJA 1VGQA 4JUIA 4P86A 2JLSA 2X42A 4MI3A 4D6PA 2GK7A 5KTRA 1QK3A 1JKIA 4M1MA 5FLEX 3JCZA 5TARA 3NEAA 3QYAA 2NG1A 3MMZA 4U8HA 1FFAA 1MRSA 1WBJB 4AMYA 3E23A 3T5GA 1T0UA 1PZXA 4IAOA 1XJ5A 2R1UA 4MQEB 2XKKA 4G6ZA 4BQIA 4OU4A 1V11A 3G49A 4KQFA 5JD4A 2HV8A 1I4EB 1Q3TA 2FPPB 1KJNA 2RHBA 2D54A 2HBZA 3GEBA 5HOEA 4AS3A 4C87A 4KE8A 5IUNC 3NM5A 1U3CA 3LXRA 2ID7A 1CG6A 3I5XA 4JITA 3M3PA 4JVLA 1S2IA 2X2FA 3RFUA 1ZR2A 4B83A 5KHOC 4YJGA 3QLTA 2YDXA 4OHXA 5B4UA 4R9VA 4V0MA 5LZ5A 4Y6QA 4B8YA 4X65B 3EGCA 3I01M 5DO9A 3RG8A 3UK7A 2OD7A 2BWJA 2Z3WA 4OEHA 1XX6A 2DCMA 4EM6A 3T1HB 2IW1A 3WDLA 1FDUA 1C3JA 1G64A 1P72A 2X9NA 4O8CA 3RR2A 3WK5A 5I3CA 2ZPUA 1RYDA 1Q22A 2QM3A 1JZTA 2ZYAA 3OPMA 3II6X 2VBCA 3F5MA 1X0XA 3KWJA 3PJFA 2ZUDA 3GCDA 4LPKA 5CP8A 3VZCA 4BGVA 4DNPA 2AMFA 1ZFNA 3M5WA 1KYQA 1T35A 4OBWA 3KAQA 3QMWA 3LC1O 4Z4IA 1GQYA 3GCXA 3H9CA 4ZODA 3DR3A 4A3SA 4YMHA 1K3FA 2AOTB 1F3LA 3OD1A 1P0MA 2E18A 3U9LA 1M2EA 4CIBA 3VR3D 1WPQA 3YASA 1QPBA 3SZ3A 4C3ZA 5TJ9A 1LLDA 1K4MA 3F7TA 4Q7KA 5FQNA 3KVOA 2HRQA 2A94A 4HX2A 3UWKA 4F4UA 2Q1SA 3ZCQA 1LX7A 3JD4A 4L8LA 3QTTA 4NFHA 4Z0TA 2ZRLA 3DJYA 4LYYA 4N48A 2G9ZA 4CBVA 5KQGA 2RONA 4TWJA 3S28A 3CJTA 3V5NA 3FZEA 2P2DA 5TF4A 1HYHA 4YCDA 3SIWA 3WNZA 3ZNPA 4EJMA 1VLLA 4ZZIA 3CCFA 4PG5A 1EQUA 3TRFA 4M7PA 3KT8A 1TCBA 2YOFA 3SC2B 4AUEA 1HR0B 4IHJA 2ZJYA 4L22A 4QREA 3I8XA 5H16A 1D5CA 2ZI9A 3SOPA 3MYRA 4FXPA 4WFJA 3QI2A 4IV8A 1YVEI 3SQDA 4HMPA 1BXZA 2H4FA 3Q5EA 5COQA 1BXGA 2FSHA 5B37A 4CR7A 3KFXA 3NIDB 4U63A 3T3EA 2ZVDA 4BX9A 2WUGA 3H11A 5B3JA 3NHLA 2D06A 4JX9A 1QF6A 3VKWA 4LOJA 1CR2A 2LR0A 2BRUC 5FWXB 3OEWA 4KVAA 5DN6A 4BVFA 2GYYA 4RJIA 4MIEA 5IAKA 1NYTA 2C3UA 1IEVA 2GKGA 4MRVA 4OATA 4CM4B 4I5FA 4WUVA 3E9EA 4TSFA 3O94A 5A02A 2BFNA 2QVCA 4WNAA 3IHWA 1PLJA 1EUYA 3HR8A 3IVGA 1K66A 5TLSA 1GDHA 5CPFA 1CY2A 2C8VA 2Q3FA 3D4IA 2J5KA 4W9RA 1MN6A 3TKLA 2A78A 1U0JA 1SCAA 2JGDB 3H1BA 3UJPA 3AJ8A 4WK0B 5FLXA 3G2LA 1XTZA 1EK0A 2ZUCA 3G7NA 1JW9B 4ZWNA 3I0NA 4IIEA 4PAWA 5K0FA 4ZP1A 1W75A 3EULA 3WRVA 1QQBA 2X2OA 1W5EA 5F5LA 3SPXA 1O6GA 2AH5A 3DAFA 4FTWA 4IJUA 5ALXA 3OECA 5FYDA 4BPRA 3O9MA 3TW6A 1G2OA 4ABYA 3T54A 2QUBA 2A5JA 2CHGA 2NU8B 1NJ5A 3VNSA 2X8BA 4RQAA 4N7MA 4J0HA 2OV1A 5E4JA 1ZH0A 1FFEA 2CLSA 4PZ9A 1UOEA 3RU3A 3AYZB 3IERA 2XI4A 1XXHE 2D3TA 5GM2A 5KTTA 3Q7SA 4RIFA 2H92A 3IPXA 1ZK4A 1RWNA 1ISPA 2YYAA 5A4KA 2WFZA 2GZMA 4AG5A 4EARA 4P34A 5HPYB 2XBLA 1QJ4A 4UMFA 2A9KA 3HP4A 1H3NA 2ZJ5A 3ZXIA 3CZRA 2ZBPA 4OO3A 3UUFA 3WFJA 4DSAA 1EK6A 4JA0A 1JMYA 4IIYA 1T8YA 2YJGA 4JXZA 5CDUA 1O97D 3SQWA 2ZTMA 4UU0A 5F1YA 1ODLA 4MVCA 4XDHA 4YGXB 1RRKA 3K8YA 5HKOA 5HIMA 3BWDD 1DINA 1YZTA 4E3WA 1W96A 2LVBA 3BIWA 1EFAA 5FPTA 5LZ4A 2BFCA 2R1VA 3DBVO 2JRCA 4MRAA 1BD3A 2J5QA 3H83A 4FI3C 3F7NA 4DQ0A 1KWGA 4OQDA 1R00A 2FJPA 3MCAA 1KMCA 1ABFA 1BD4A 1ZNZA 3HJAA 3Q87B 4S1VA 4JBYA 2R00A 1QGUA 1U3UA 3GT7A 4DIFA 5HQ3B 1Q11A 3DM5A 4JK3A 4KQCA 1GN9A 4EMSA 1ARZA 1UZNA 3FJYA 1DP4A 4QOFA 4ZYUA 1UXKA 2D7JA 2QORA 3I0MA 3MGAA 4R8LA 3IMFA 4L4SA 1GQQA 3MT0A 2C20A 2CFCA 5A06A 1OTHA 3U0VA 5IC6A 4B4OA 2BEUA 4B40A 1BKYA 2OK7A 3K0KA 2B2XA 4XB6B 4CV0A 4OJTA 1GITA 4CMEC 3DF7A 5LYJF 3V4VB 1QZXA 3SQMA 3L0CA 4Z53A 3Q6IA 1VPTA 4ZV7A 3GJZA 5AI0A 1GNRA 3HWRA 3BGWA 1CBUA 2IEDA 2PRIA 1JAXA 1H1DA 1KZ4A 3CLTC 3CLTD 4WADA 4X94A 5BQ3A 2BR4A 1P3Y1 2C4MA 3QLUC 2YWXA 4RK4A 1RBQA 1FMFA 1EM8B 2FZLA 1PR2A 1ZCJA 2TYSB 2QTWB 4FINA 2O2CA 4QJIA 3CEMA 3IP9A 1WPRA 4ENSA 3GN2A 3BE4A 1OWLA 3WJ2A 4JLKA 1WE2A 2O8EA 1A8IA 3JATB 2X0KA 4KMRA 5C8ZA 3M1LA 1GU1A 3I28A 2C5SA 3AUTA 3D6UA 4ATNA 2ECFA 4YPFA 3B1YA 1H5UA 2H57A 1T9CA 2O6HA 2ZM5A 1T2VA 1U1GA 4KYIB 1MVLA 4L08A 3GFOA 3KTFA 3CNEA 1CYDA 4LTNA 5J4KA 1L5VA 3CLUC 1R6UA 1W73A 5JH7B 4F9FA 1W88A 2VL7A 3EZYA 3GJ5A 1OLOA 1RLTA 3I72A 1L4LA 4HWSA 1LU9A 5AQEA 4DV4B 4O1MA 4OQXA 1YV9A 5AI9A 2VPWA 3BQMB 2YL2A 2GCGA 3BD6A 3GVPA 4EPXA 4DSNA 2EZUA 3LQYA 5HDQA 2D5LA 5TVKA 2ZBRA 1E5XA 5D2CA 3HB7A 4KXXA 2QX6A 2NMVA 4GBGA 1FYVA 1Q16A 2ZYHA 3C3MA 4IZ6A 4JI7B 1RJWA 1DJOA 3ILXA 2Q41A 2WG0A 1SCUB 1P4SA 4N12A 5K6AC 3PGVA 2CNKA 4HAZA 4X71A 4A15A 5FTKA 1WUHS 4CMCA 4HS4A 3I6ZA 3L7YA 4UMEA 1GPNA 2CD9A 2ZJ4A 4WOKA 1LLQA 4RPCA 2D5BA 5FJJA 2W0SA 4D9BA 5J5CA 1HRKA 2Z98A 4B47A 4BNNA 4FEEA 4INZA 3OJ0A 4R1NA 5JWHA 1DX9A 2PPVA 1DKLA 3I9KA 4KJZA 1A72A 3HBJA 5D3KA 3E3NA 4DLTA 3P26A 5ALZA 4B5KA 2ECPA 2VUIB 4M9CA 3MXOA 3ESBA 5CBPB 1PDWA 1CSEE 1RYYA 4FT2A 5LQSA 4DMRA 1T4GA 3W5DA 3C5HA 2VK4A 1OI7A 3LH5A 4GQBA 2OC9A 3ZGOA 5MFPA 3M1IA 3R3UA 2HBYA 4QC2A 5HCIA 4BLQA 1BGVA 4ND8B 2SKDA 1QWOA 4RLQA 1USUA 1EUDA 3K0CA 5AKGA 4V0LA 1L7XA 2QQGA 4EG8A 2HLHA 1TQHA 1R5NA 1G55A 3LQ2A 4JFAA 1U2PA 2GYUA 2GSWA 2XKJE 4DLPA 5F76A 4IDEA 1RE0A 4TTRA 3E0QA 5T7BA 4AJNA 2G4LA 3BK7A 4PZYA 2IU4A 3F6RA 3CSUA 1EFPA 4EA8A 1U7DA 4HI0E 3WK8A 5HZGA 1D2AA 1C1XB 2C98A 3C6KA 3DHYA 3IURA 4LNUB 3SDZA 3N2GB 4CF4A 4RD0A 4PN3A 1V5GA 2O8VA 3OX4A 1QRTA 1MX3A 2YW2A 3MCVA 4KXVA 4HSGA 1NFQA 2IKSA 3KHKA 4OMCA 3HCOA 1L4EA 1VKHA 2RHTA 1XC7A 1BHSA 2IF0A 1D09A 3TRIA 3EEOA 1NRWA 3OIUA 1BXGB 1LDMA 2WD9A 1M34A 3IESA 2GESA 2PSJA 4PC6A 4ICIA 5F9MA 5LP6C 2UVPB 3HFJA 2QN1A 2YZ2A 4GKAA 2HSDA 1D0SA 3QG5A 1UF9A 3N2ZB 4PO1A 3IIIA 2ZRCA 5FOUA 4M0PA 1J0AA 1CUIA 1KO7A 1V48A 2LTAA 3OT1A 3SMQA 1JAIA 3UAOA 1GLVA 2PUHA 5IH7A 2G25A 3FSGA 4J49A 1UXIA 4X61A 3WNQA 4E30A 2EWWA 2VYFA 4R4JA 3AHEA 4LE0A 2PGOA 1VE9A 3PFBA 5AP9A 5EWJA 4EJSA 1X6VA 1KE2A 3MTJA 2D1TA 1XFDA 4X9XA 4JX8A 3C7KA 2VBIA 1JEYA 3N07A 4KIGA 1T0IA 3JZFA 1SRRA 1X7XA 3BFVA 4XA8A 3NAGA 3TL3A 4Q18A 1G3MA 2V54A 2ZJOA 1Q0QA 1IUPA 3SG0A 2CMKA 1V16B 5A9SB 3LUBA 4RDCA 4NFSA 1E3QA 4GE3A 3WY9A 3D6JA 1W5SA 4KG7A 3GJQA 3KZVA 3CE9A 4GPTA 1YRLA 3ILHA 3WLAA 4NYJQ 4UCFA 4ZANA 1P8AA 2ZRQA 4RL6A 4YJ3B 1JILA 2M6SA 1N6HA 3VR6H 3VPBA 5B6PA 3AESA 3T9CA 1UMKA 3ICPA 1E7MA 4FSXA 3OQJA 1I4LD 2J33A 1EFCA 3MELA 4I1OA 4QO8A 4YRDA 4YP1A 1JVNA 3FMOB 3KT6A 3KU1A 3LXXA 1NV9A 3C2QA 1THGA 4Q3EA 2Q4EA 2HCJB 1AGRA 3ZHCA 3WNVA 4EAAA 1NKVA 2C2KA 2NUTB 3HN6A 2VZEA 1R0XA 1HEIA 4MEJA 4OYHA 5HFJA 4Z3DA 2ZCUA 4PSKA 3A37A 4EH1A 2PKCA 3B5EA 1FJHA 3K2IA 2Q7DA 4C0AC 1P2UA 1B42A 1NHGA 3ESXA 2QYSA 3B13B 3TIFA 4F4HA 1EJ2A 3EOZA 1SBCA 3B20A 1JS1X 4AP9A 1F8FA 3OE7A 1YAJA 3T7JA 3IQEA 3RTAA 4MROA 4EO9A 3THWB 2BEKA 2FH5B 3JQFA 2VOJA 2FEOA 4WGGA 1UANA 4ZI7F 1V1MA 4GX2A 2MYUA 3TOSA 1T4BA 3FFTA 3RSFA 4BMXA 2Z2IA 2O8FA 4M6WB 5EERA 1XHFA 1ADYA 3L0OA 5I45A 1ORHA 3B5IA 4O63O 1W4BA 1R4AA 2JZOA 3H9GA 3L0PA 4QXOA 3T5CA 3HKCB 5BSHA 2NV6A 4D9JA 2BGJA 1V6CA 1ESEA 1GKYA 2I0FA 4HWTA 4QGGA 4WQMA 5FNVF 4EZBA 2D0IA 4IJKA 3H1GA 1QR2A 3FR7A 5I9LA 2F1KA 2WUEA 5EHIA 1J9ZA 2RIPA 4E1VA 1PDOA 2EBWA 2QPLA 1CRQA 1K86A 1ZK2A 3BK2A 5KVSA 5AHOA 3R5JA 2FOXA 2FW1A 4URXR 4XH9B 2H4XA 1V47A 1UK9A 2Y0PA 4DKXA 3CVJA 3HHPA 2WU3A 4BN4A 4D4HA 1C9NA 5DBIA 3BSSA 1N1EA 3G8CA 4L4XA 3WGLA 2JVIA 2YS7A 1EUDB 1P2GA 1S8FA 3GYBA 3IQIX 2XXAB 2AJCA 1J8MF 2QENA 2ZFUA 4KVFA 1N6OA 4MQ4A 1GPLA 2PUFA 2FMFA 1IU9A 1OH7A 4WXMA 2ZT7A 2PN1A 4YCAA 1H8ED 1AO3A 5ADVA 4PRZA 4TSFD 3R7DA 1Y3CE 3H1TA 4TRNA 3OJEA 4CKBB 3IIJA 1HQDA 1U81A 2CL5A 4KACA 4IHAA 1KGSA 4LF6B 3VNAA 4R41A 1BSVA 1NA5A 1NURA 3ZG6A 3EZLA 4CMKA 2FW8A 4ZHSA 1L1QA 3A36A 4POAA 4B2YA 3QRWA 3C39A 3HNRA 4XIIA 1RFGE 3LP6A 4U7TB 3SDSA 5IF9A 2A5GA 4LZOA 4CU5A 4GL4A 1YBHA 2GNPA 1RZUA 1JFFA 1X3SA 2V5AA 3JASA 3O4FA 3CNHA 2Z9BA 2QTAA 4KN5A 3WLJA 5E1OA 4V2UA 2COEA 4D45A 2IZ0A 3FDIA 3CW2A 2CKMA 4HQLA 1P4RA 3LHDA 3U80A 1U3TA 2O9JA 4B3CA 3A9VA 1PYGA 4EJSC 4ZHQF 2GYWA 4LE1A 4P4TA 4XVRA 5JY1A 4BV9A 3EPKA 1GT6A 3JQAB 4OQYA 1VLMA 3GUUA 4O4HA 1J8YF 3GLRA 4CCYB 1F0NA 2B34A 3P96A 2REQB 1S7CA 1T3TA 3M9LA 4KNVA 1Y6FA 4KXQA 5DBGA 4Q3BA 1RI1A 3DYBA 3NATA 3Q98A 3WL7A 3CH4B 2YMQA 4RHEA 3L6EA 2FA9A 3UHAA 2MSCB 5JY6A 3S1LA 4Y6PA 5E0OA 5DYIA 1NW6A 5EZ6B 4EW1A 3P2KA 4UM7A 3G1UA 1YC5A 3R0XA 2AD1A 3R8CA 1Q21A 2MMGA 3PICA 3KOZA 3E2MA 3EH2A 2QAIA 1W0KA 4DT1A 1QRRA 3GEHA 5K9ZA 2PU5A 1UXOA 1X38A 1M2OA 3DE3X 1UP7A 2C4VA 4BNYA 1JJAA 1KMMA 1YQTA 2R79A 1SOUA 1P1BA 1Z5PA 3GCGA 1KI4A 2X9GA 3EBOA 3KYBA 3CBGA 5KAPA 4FHFA 4O3MA 3AM3A 3GK3A 3Q0EA 1SWVA 4J1NA 1XMJA 3B7WA 4BO6A 5KNCA 3HP1A 3WO0A 3TNFA 5DXJA 3UPDA 3NUQA 5AO9A 1KC1A 5KDLA 3CISA 4P5PA 4QFCA 4UBMA 1W7AA 1L7QA 4HFNA 4HGOA 4J2OA 3DT6A 3RVQA 4Q4JA 2HL6A 3J7AC 3EVZA 3JV7A 1U8AA 4MB0A 1QCYA 2UDPA 1P0QA 2XOKA 4X97A 2IUUA 3RASA 1PJTA 1EIWA 2ZE6A 4LY9A 4P35A 2O23A 5CDSA 1MB9A 1O0SA 2AFIE 3FFXA 4M46A 4E6EA 4I9GA 5DX8A 4TS3A 4FE7A 4DSZA 1GSIA 3RS3A 4ZAFA 1H6CA 4B71A 5THXA 2WK1A 1BWRA 1MMFB 1QHYA 3UPTA 1GG2A 4B3XA 2H07A 1W59A 4CL2A 2VXCA 3NVKI 1JR3D 1ODFA 2PD4A 3FHOA 1V41E 1LWOA 3C8UA 4MVJH 1U7HA 4MGIR 2VPQA 4EUKA 3QE9Y 3HVHA 5A2GA 5HKBA 1ECJA 2YMPA 3VAZA 4UOZA 1D2EA 1E6UA 1HT1E 4ZVSA 4MV9A 4MUIA 3W9BA 1U02A 3U7HB 2FW6A 4UPVA 4FJ2A 4Q48A 1C0IA 5CG2A 5EQFA 5A3VA 4BBZA 3FVQA 2AQKA 4ZIRB 3PXXA 1LI5A 1F0PA 4NBSA 1P1CA 4TKLA 5AK6A 3ETNA 3BRSA 4IH9A 4CV2A 3RH0A 1IULA 2QSJA 3JPYA 1ZRNA 2AG6A 4UREA 2R97A 1BDHA 2OXRA 3S55A 1T34A 2XB4A 3EQZA 2WHQA 3HB0A 4X8HA 1FU7A 1ULSA 3GO4A 3I05A 4FOPA 4KKVA 4LSWA 4TWAA 2C7GA 5IAJA 3U7QA 2O2ZA 2PQ0A 3DONA 1PSZA 3WNBA 5EFOA 2ZEJA 2H3HA 3P4UA 2HFKA 4WCDA 1IN4A 1HTWA 2GETA 5K8TA 2R5FA 1UR5A 2D2EA 2JF0A 2AN4A 3EJ6A 2P9QA 4Y6SA 2UVQA 5EVJA 3ZE7A 4BYGA 1PNTA 1KJQA 2Z0MA 2PYZA 2CMDA 2X14A 3KL4A 4UAUA 2BP7A 3DLAA 4LMAA 4WAUA 1QIFA 3ZOZA 3G2PA 4DWJA 3T1YB 3VV2A 4BQPA 4LGYA 3MUNA 4QLOA 1JFFB 2JDID 3ZX5A 1J2YA 5K8JB 1Z6GA 4OHPA 2JL1A 1G21E 3SSOA 4EKNB 1RW4A 1YOBA 3OZUA 4KLRA 1QU2A 3CF4A 1VCMA 1WZIA 4OKNA 4AY3A 1FRVA 2QMYA 4DADA 4ZOQI 1U4OA 1EXMA 2B2CA 4P53A 2ZTVA 4XCXA 4OFXA 1M6VB 2H1LA 5JBQA 2Y71A 1PNOA 2V8BA 3MRVA 1WWKA 3PEUA 4J91A 4MMYB 5AKIA 5CYPA 4CKXA 1F9AA 1YFJA 1ZRSA 3PR3A 3WGVA 3VPFA 3AVWA 1P5FA 3MRSA 4DA0A 4U0KA 5KYUA 4BGDA 1ESDA 3D02A 5GVRA 5D7NA 2K4MA 5D86A 1P2DA 4PQGA 3DEIA 5DNVA 3U49A 1NXSA 2AWNA 2FR8C 4JUCA 5K3BA 5GZ1A 3LVRE 5BYBA 1EUQA 3ZJVA 3EGWA 4OBBA 4C7OB 4RS3A 3FPCA 4ZYYA 4HJXA 4P7KA 4DVGA 3QMMA 3VHXA 4AM8A 3K0BA 5JWOA 2X0EA 2RKWA 3BQNB 3IO5A 3SC3A 1VIDA 3HBFA 2EIHA 2XPCA 3NUGA 3ZWYA 1J0XO 2R4UA 2XZLA 1CFZA 2FZKA 2PQ6A 5G1OA 3THYA 1QQ7A 2QIPA 2MSLA 1OXMA 1PEAA 4J0EA 1JDBB 2V55B 2XYQA 4NOMA 3BXZA 1T2AA 4R9SA 4B43A 3VR0A 3LZCA 4J7XA 4M2LA 5EMMA 4AZ0B 4KRXA 4BOYA 5KX5A 2AKYA 5AKZA 2G1UA 1DJLA 3QENA 1EVEA 2WZCA 3CH7A 3D6HA 1O97C 5EZSA 3G2KA 4H77A 4DSUA 1BO6A 4HDCA 2C2HA 1ZBQA 3BGIA 3OCWA 1RHKA 1AIPA 1XU9A 3ORYA 2I7DA 4ZVLA 1ZIPA 3FZNA 1EIZA 3ONDA 2H1FA 1LJ8A 2NT3A 4Q03A 2WM3A 4JQSA 1W9MA 2D0OB 1F14A 1JIQA 2BSAA 1XZPA 3S68A 5IZCC 1U99A 2V45A 3LZ6A 4U9HS 1H3FA 4I4NA 2C92A 2JKZA 5HGXA 1IM5A 3J81A 2WF8A 1WO8A 4M0FA 4W5HA 4S12A 3E5MA 3TE6A 3V80A 3P8ZA 1QO0D 3AXSA 1TJNA 5FD8A 2ZYSA 4BTVA 2WD8A 5J3JA 1ORWA 3C70A 3LCVB 4J0CA 10MHA 4RV4A 2TMDA 4ZI3A 3AVTA 5JCXA 2IP4A 2V96A 2OENG 1MHPA 4FP9A 4DIDA 5JNVA 4OY3A 1TLLA 3D7LA 3M6AA 4OFBA 1E3JA 5KVCA 3JWIA 1BWSA 1UMDA 1T0BA 1N78A 2MIIA 3EBPA 1AQ6A 2GLXA 1P1JA 1C3OB 2A8YA 4J29A 1VFPA 2CNNA 2QB5A 4GD3Q 4YAEA 4R1PA 4KE6A 2OG1A 2WIAA 3DVAB 3E15A 5ILQA 1JHRA 4R68A 4Q5IA 2YJZA 3GRKA 3JY6A 3T1VA 2Q27A 4QDKA 5B2FA 2AOTA 2JJMA 4Q6WA 4A27A 4FS3A 3EARA 1H2EA 1KDZA 5THKA 3W6ZA 5DW3A 4ACAA 5KVVA 4C4XA 1AV7A 2Q0SA 3L6OO 5SZJA 1Z35A 5EJ6A 3ASVA 3K6SA 2XGJA 5CDGA 3AF3A 3NIBA 3KSRA 4GMXA 1FVFA 1PGNA 1DAOA 4WW0A 3K20A 3IHLA 2OHXA 1KTVA 3OESA 3U2QA 4MIOA 3UXEA 4G1CA 2CLDX 1PJ8A 1WNFA 4MVJI 4H1TA 4L8GA 1Z38A 3L1HA 4Q7JB 2CUTA 3FHJA 5F2OA 2I76A 3JARA 4GP9A 1U90A 4A36A 5D01A 1COWA 4E5SA 5HJ7A 2WTXA 3HJRA 1A95A 3M1AA 4Z9AA 1ZYUA 2J9FB 1V4VA 3A0UA 1D8AA 3I73A 3C4QA 4KXUA 4HYYA 4WA8A 5A7GA 2X3UA 3QXXA 2ZETA 3MMPA 5CM8B 3SC2A 1D2RA 1Y89A 3OG9A 4IDCA 4A2PA 4NOJA 3NO4A 3JQBC 3ZCVA 3U56A 1QG2A 1FFHA 1Z4OA 2DBYA 3OM0A 4NAVA 4PRKA 1KC3A 1EFHA 2MSWA 4KAJA 4EB6B 1QLJA 4DVJA 2NVUA 2PV7A 3OLWA 4X7BA 4QQ8A 4Z0PA 1T6BY 4I3HA 1KA9H 4H6VA 5J63A 2A0FA 3DV2A 1E6CA 1A4RA 1UH5A 1P2FA 3M6MD 4QD3A 5DTIA 1IN6A 1DKMA 2FWAA 3UAYA 2D4AA 5DH9A 2A9OA 3O9VA 2XH8A 3LUFA 2XW6A 5IUKC 2NTNA 5CLLA 4U02A 1C8KA 1WDLA 3WIDA 5J4HA 2QGZA 3CKMA 5AHWA 3NGXA 3SFZA 1YK0A 1RKQA 2FP4B 2VXBA 4L7QA 2WB2A 4QGBA 3WLHA 1F1BA 5LD2B 4JDUA 1KJWA 2R1TB 3C3XA 3TECE 3ORHA 4YT5A 3ZV5A