2ENYA

Solution structure of the ig-like domain (2735-2825) of human obscurin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
104
structure length
104
Chain Sequence
GSSGSSGHVGITKRLKTMEVLEGESCSFECVLSHESASDPAMWTVGGKTVGSSSRFQATRQGRKYILVVREAAPSDAGEVVFSVRGLTSKASLIVRERSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obscurin
publication title Solution structure of the ig-like domain (2735-2825) of human obscurin
rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 8
structure length 104
sequence length 104
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2enyA00
3A0OA 4M6ML 2ERJC 3QUXC 4UMGA 2EEAA 2P8LA 3R4DA 4G8GE 5C6TL 5DDHB 5BV7B 4OZIF 4ZPTA 4F8QA 3D25B 1IBGH 4JJ5A 4X6DE 2PXYC 5CP7B 4KK5D 3SO5A 4OZIB 5HD8D 4IRSA 3K4AA 4CDGC 1JRHL 5EFIB 2HLAA 2DJ4A 1DZBA 4NZJA 2R2BA 1HYRC 5IBTH 3B2VH 2J5LB 1VFBA 2AI0H 5K9JL 4X6FB 3SGEI 3RY6C 2VLJB 4O2CB 4MQXD 5F89B 3RDTB 4PGDA 2DIBA 2UYLA 2WUCL 3N9GH 2DWDA 2QSCL 1YYMH 3KYKL 4LLWA 4QLRA 1HOCA 5F6HJ 5C0AB 1MCJA 5BRZE 4NPYA 2VKWA 3QDGB 5JZ7D 3SDCC 4OD1L 1T21A 4IM8A 1WLHA 3IU4H 1FO0B 3MJGX 3PHOB 5BVPL 1A6WL 1BD2A 5ACZB 4UIKH 4YO0B 3D87B 4DEPB 4OKVA 4WV1B 3V0VB 5ANME 4OFVA 3QXAB 2X4NA 5HDQH 3MR9A 3ZL4L 1DLHA 4X0KB 2Q3ZA 3JTSA 1V3KA 1RIHL 2E9IA 3IU4L 1SYSB 4ERSL 3OHXB 4NT6B 5T3ZH 1ONQB 2OMBA 4QEGA 1OM3L 4U05A 2P8MB 5DMKB 5LWYH 4WTZA 5IVZB 3FTGA 3TCXA 2BNQD 1XGRB 5KAQF 4TUOB 2CO6B 3G5ZB 4I18A 1WTLA 1AGEB 4FQXC 1NL0L 4CVXB 1BQLH 5IBLC 3B9KD 4G3YH 2ZWLT 1CE6B 3AS2A 3H42H 3ARBD 1ED3B 2IANB 4POZD 4RIRB 5BO1H 4Y16C 3V4VH 1ORSB 3LKPA 4R2GC 3SE8H 5KTEL 2X4QB 3FOMB 4F3FB 3ILQD 3TYFB 2CKBH 1YMMB 2G2RA 3QI9C 4DZ8B 1WAAE 1OAUL 2GSGA 2C3VB 5F3HB 1EDQA 3H42L 4G9FE 1WUNT 2FO4B 4TUKL 5F6HI 3V4VL 4H8WH 5DJXA 1NJ9B 3U7YH 4HCRH 4PP1D 3THML 4UDUA 3BDYL 4WW1A 4XGZA 5HYSA 3OZ9H 1MJ7L 3PWLA 1T1WA 1EX0A 3BRGC 3GIZL 4R4NC 1EVUA 1CGXA 5TE4H 3WHE1 5LXGL 3KLHC 2H2SD 4W68A 4LSSH 3MRCB 5I1HH 5F7FA 2ZOKB 4NQED 4Y2DC 1QA9B 4DKDC 1MCWW 4JPWL 4H8WL 1Q0XL 2NY3C 5IR1B 2P5WD 3SDXF 4HQQH 2JJWA 1FIGH 3K2UH 3SDXB 2PYFB 4ETQB 3M1BB 1IM9B 3NCYS 4UB0L 1FJ1A 4GOSA 3WKNA 2H9GB 4ODTH 3IDNB 4PJEA 1NC4B 5K9QI 4ZUUA 4QF1B 2N7AA 3MV8E 5C3LD 3LQZA 1U3HC 4N5UA 5FHBL 5C08A 4XBPB 3REWB 4HBCH 2X42A 4HQQL 4Y4HA 1FIGL 4OCYL 4F9LC 4Y5VB 2H3NB 3TVMB 2GKIA 3FQWA 3GSNB 5EDXA 1C5CH 5DD5H 4P59H 3WFHA 1FFQA 3QFJB 2DIJA 3SO3B 1FSKB 3EO1A 4QRPE 1XZ0A 1FVEB 2GFBB 3X12A 2LU3A 2H1PL 1CXIA 5DQ9B 1I1AD 3MNZA 3OAUH 5C8JB 4FQJH 4PJCE 4P4KA 4IJ3C 3HG1D 3T0EC 3TCLA 4K71C 4F7EA 2CJUL 3O3BB 5DD5L 3RKDD 4P59L 1GGCL 1YDPA 1NLBL 1P9MC 2BNRB 5IMKB 4UV4H 1EMTL 5ENWA 1T2XA 2I07A 3NAAH 4OLXL 4LEXL 3WUWA 4QHNB 4A2LA 1TJHH 1RQ5A 3C6LD 1GPOL 4MMZC 2WINB 4GMSL 1N26A 5L6YH 3ARDB 3QNYB 2EZ0C 4F37F 1CXFA 1RJYA 5DT1L 2DN7A 5ICXA 4LSTH 4P0DA 4U1IA 2Z93B 4NC1E 4LPWA 2EKJA 3NAAL 5JLZB 1SMOA 2OJZL 4EI5B 2X4PB 2AERT 3LQAC 4KQ3H 1JL8A 1UKSA 1TJHL 1JMZA 2NXZC 1YY9C 3B6SA 4CL7A 3LKOB 1QO3B 4XVSH 3HRZA 5IJKA 1BBJA 43C9B 1G6RB 3MQIA 4OLYL 4P2CG 1M7DB 4K8RD 4X5WA 5AYUL 1MAMH 2BHZA 3MOAH 5E00B 4HZLB 4KQ3L 1U8LB 3L3GB 1KFAL 1YYLH 3W5MA 2NXYB 3MYJA 4GQ9H 1QLFA 3C09B 3CH1B 1TLKA 1MWAB 4OI7A 3VJ6A 3SKOA 2ATPB 1MHHA 1CLOH 1BBDL 2NY7L 4OFIA 3O3DA 3KHQA 1A4KA 1NBYB 1UKTA 5IW6B 1EIBA 3D2UB 4APQD 2R0KL 1FZJA 2V5SA 5FECB 5C7XH 5DVKA 1RU9L 3IRZA 1AGFB 2HTLC 3VXRA 5KN5A 2YRLA 3G9VA 2V9RA 4P5MB 1P7QB 4YGAB 4HEME 3S36H 1HDMB 1QVOB 1YJDH 5T3XH 4ZQKB 3FONA 3S88H 3HR5B 4P46B 5IFAH 3F65A 1ZS8A 4LGSB 4YC2C 5JUEH 5EOCL 2AJXL 2WLZA 3ULSA 4PLNC 4Y19D 4OFYA 3UO1L 2GHWB 2DQUH 3IXAB 4PJAF 3LKNB 1LO4H 3MRQA 4HS3B 3S36L 4F8TA 2NQCA 4JFYB 5JQ6H 3L1OH 1DQLL 3J7HA 5KSAD 5T3XL 4XVUC 3UTSA 3QUZC 1JWMA 1UA6H 1NLDL 2VL5B 2EO9A 2VJXA 1AHWB 3QG7L 3BKYH 4PS4L 3T65B 4RRPA 5ECJE 5IB3A 4PJGA 4I1NB 1IT9H 4Z95L 3C60C 1UWXH 3QNXB 5HHMD 3U7WL 1WIUA 3SQOL 1SM3H 4RQQA 4H88H 4ZDHA 2G5BB 3VW3H 1RJCA 2Q7NA 2CLRB 4PTUB 1N7MH 4LDOB 4XNXH 2H6PB 3VFTA 5JXEA 4ESKA 3WXVL 4Y5XC 5IQ9B 4GKSB 3QPQC 3W82A 4FQ2L 5C0CD 4O5LL 2XTJE 1U8JB 2VIRB 4QXUL 3PXHA 3SE9H 1S9YA 4D0DB 4JQVA 1N5YH 3V8CA 1N7ML 5HI5D 4Q9RL 4WU7A 1LO5B 3EYUH 1BEYH 5IW1A 4I77H 1CXEA 2DWEB 3GMLB 4MGXA 1TTUA 4WO4D 2CMRH 4KI5D 4GW4A 5EH1A 3JWNC 1YECL 4LP5A 4OF3A 3T0VA 3QXWA 3PWVA 1I7ZA 4E41B 5A2FA 2IAMA 2JJUA 1N5YL 3O6LL 3V6FB 5FV1L 3KWWB 5KW9H 1BEYL 4U6HA 3L3JA 3O6KH 1G9EA 1OGAA 3HC4H 1Z3GL 4XPTH 3EJYC 2DDQL 1MCOL 4PG9B 5D93C 4L4TA 1ZGLB 5E8OB 1ZE3C 3O4LB 5E2VH 3ARGB 5F1IB 2X7LB 2YWZA 2AEPH 5ABDE 2RR3A 1VA9A 1QNZH 3K4ZA 3UBXA 3W0WE 5F7MC 4PP2B 4XT1C 4O4YH 3P0GB 4JRXE 2A6DB 5KOMC 3BUTA 5C0DA 4NO5B 3GB7B 2R1WA 5C9JB 1A6ZB 4Z7WE 2NY2B 4Q0XH 2JK5A 2XKNA 4LLAA 4X6CF 2DL9A 4RWYH 2IPUG 5EO9B 4X9FA 4IHOB 2EYSB 1NCWL 3RIAK 4BH7A 2I25N 4H5SB 1UADC 5ITBH 3KPRE 3KPOA 1DFBH 3NABL 2VE6B 3QDAA 5DSCB 2F54D 5HGHB 1KGCD 1VDGA 1W8NA 3RJDA 4HMCA 5IT2L 4HWBA 3VI3E 2YD2A 4Z7OF 1DFBL 4FABL 3PQYB 4Z78A 1A8JH 2ZUQC 4HKZB 5LVEA 1FNSH 3B5TA 3AUVA 2GSIA 5JQHC 4L5FH 3GJFA 3RQ3A 3OR6A 3QUYD 2NW3B 1KCRL 1JYVA 1VFUA 4MNHA 2JE8A 4Z76A 2ADGA 3BJ91 4YDLC 3G6JA 4PRPA 1NMCB 3AY4A 2UWEA 8FABA 1YEGL 4UAOC 2IBZY 4U1HB 4Z7NF 4BFBD 4M61A 3WS6C 1NGWB 5SX5K 1ZEAH 5F9AC 5HY9A 2Y5EA 3DETD 1RD6A 3FQUA 3I75B 1E0OB 4JO4H 3VH8B 5D7LD 5AD0B 1G7IA 2D0FA 1Q94B 1YPZA 4KK6C 3WBDA 3LS5L 1NDGA 3DGGA 3V6ZA 5DHYA 2VZ3A 2VZVA 4HIEA 1ZEAL 5D1ZB 4EN3A 2D0GA 4LRIC 3S5LA 5JW5B 12E8H 5JXAL 4LLMA 4GAGL 1VPOH 5FCSH 3X3GH 3KG5A 4RBPH 1Q8MA 4QOKE 4FQ1H 3QR2A 3WNOA 1CFVL 1WQVT 4WFHD 2BK8A 1KPVA 3GHBH 3EOBB 3O4OB 3I85A 1I7RB 4LVEA 3IDGA 3NCJL 4KV5E 5AZEL 1DUZB 1I8KA 1EO7A 1JUFB 1KV3A 4AH2A 1A64A 3FFDB 1VPOL 2OP4H 3FQXB 2LVCA 4AENB 3B5HA 5FYLE 3G6DL 3SCMC 1T20A 1KN2L 1HHGB 3RWIA 5IEHA 3QH3A 4O02L 5ID0B 4WI2A 2DM2A 4XXCC 2O61B 1ZVHA 1U91B 3ES6B 4GG6F 3QO1B 2X4OB 3CFDA 1K5NA 1MI5D 4YGVA 3BPOB 5FKPA 1GCFA 2IJ0C 3MRPA 4XP6H 5I1AA 1EA9C 5IB4B 4NHCL 2WBJC 1MELA 3ZTJG 5J12C 3UPCA 2GK0B 3P4OB 4K3JL 3MBED 4I9WD 4XVJH 3EJZC 4DK6A 3TIEB 3F58L 4UU9B 1U93B 5HHNA 3OV6A 2WWKT 3JUZA 1TTGA 3VXMA 4M6OH 2QKIA 1IL1B 1JNLH 1RFDH 3P77B 4P5TA 2DD8H 4ZG1A 4OM1H 2ICWB 3LZFL 3UDWC 1T0NA 3FRPG 4XVJL 3UTTB 3MXWH 5I8CB 4UINL 5FYJE 1A9BA 1U2CA 4MA7H 1E4XH 1JNLL 4JVPA 4NWTL 1JWSB 4XP4L 5DGQA 1KTLA 4GRLA 1J86A 4LSRH 5ISZA 4LCWD 2OS7A 1RIVH 4JKWA 3S37X 1XF1A 2MKWA 3PXJA 3NCMA 1MJJA 3D69B 2VDOL 4R97C 4JZNA 5FA3A 1S78D 5CIPH 3SY0A 3C5ZA 1OAYL 2VLLA 1NFIB 1S7UA 3HUJE 4Y1AD 1OTTD 5J0BA 1NMAH 2UVFA 4U7MA 5JA9A 1MAJA 5IHZB 4TOYL 4YPJA 2E5EA 2ZCKL 1PKOA 4GT7A 4HFWA 3MUY1 4ORGA 1I8IA 1L0XA 1UWEH 1RK1B 4RFNC 3BUYB 1UC6A 4L3EB 4I4WA 3MGAA 5I8KL 3GSUA 1K8DB 4DZBA 4JRYE 4N8CH 4PJHF 4PJDF 5C0JA 4NZRH 4PJHB 1B6UA 2MHAB 4AG4H 3GMOA 3TZVA 3V0WH 5JORA 4P4KC 1SJEA 3V5KB 5I30L 3FN0H 3P11L 1WFNA 2YBRB 4P2QB 1AD0B 5F8RC 4QHUA 3CXDL 1DQMH 1YEEH 2VXQH 4MZ2A 3NGBC 4N0CD 1F58H 1UM5L 3TA3B 5IIEA 3SQBA 5T33H 4F7PA 4PJAE 4U1SA 3RI5F 4YXLH 5E9DB 3HMXH 2FR4B 3LEYH 3V0WL 1M7IB 3HNTH 3JV0A 4ZODA 2B2XL 3DI2B 2EH7H 3FO1A 2XN9B 4QYOA 1YZZA 4FTVE 4NQDA 1T83C 4LQ1A 3HC0A 4P23B 3F7RA 1WZ1L 4OGXL 1K4CA 1ETZB 3VWKB 5F96H 2X4TA 4LIQL 4X5LA 2EH7L 3D39D 3Q6GH 4ZO7A 3BQUA 1HXYB 3HI6H 4U6YA 1KSRA 1JCKA 3EAKA 2APWA 3WDJA 1INDH 5GJTH 4G43B 4CADB 1CFNB 3HB3D 2CKNA 2EDFA 5F7KC 4OUUA 1T66C 1HN1A 5C0FA 1G7QB 5DS8B 3KPSA 4S1RH 4OTXL 3O45B 4GSDL 2FECL 4OZGB 1IAKB 4HKXA 2F53A 2YXMA 1FC2D 1WC7B 3PL6C 4D9QD 1YEKH 5B38B 5KVEH 1SVZA 5FKAA 1QSFE 3GO1L 4H26A 1QBBA 4JFFD 1PX3A 3VFNB 5ESQB 1S5HA 5EZIH 1INDL 4PTTB 5F1NA 5E4EB 3S98A 1WFOA 2A77H 3TNMB 3GJEB 2DAVA 4S1RL 4RX4D 4B5EA 3STZA 1ZK9A 2BVQA 1H0DB 1M4KA 4C56B 4LBEB 1FORH 3CC5B 4V1DB 3F5WA 4OJFH 2Y5TB 4PRHB 4R7DB 2J2ZA 3VWJB 1FCGA 1ZSDA 3W39A 4HJ0D 5EZIL 4I2XE 1UVQB 4LCYA 2Z91B 1DBAL 5DWUH 3B43A 1LNUA 1OF2A 4Z0XB 3LKQA 5TFSL 4ENEC 5DK2A 3NCCB 3BESR 1UEMA 1HZHL 5FYKL 4OCMC 4M6NL 3K2MC 4XP5H 1XGTA 5I76A 3H9SB 1ZANL 4PV9A 4LLYA 4ZFGH 5FF6A 2RCSL 1SYVB 5DWUL 5IK3B 3EOAB 1A6AA 5F9DC 5T1DH 2B7DT 4TSAL 5I8EB 3TWCH 4X6CE 5FUOH 4MLIA 4MLSA 3RZWA 4DTGH 3CUPB 2HJLB 5L8LB 1JYNA 1G7MB 1PDKA 1DBML 4HMEA 1RZJH 5DRWB 4NNXB 5GGSA 3FB8A 2Y6SD 1YC8A 1TZHB 1OP9A 4F7TB 4ZFGL 4K9EL 4YAQB 5T1DL 1BVLA 4N8VG 1MFDH 5JDSB 2R4SL 2BNQE 4JHWL 5MERB 5CSGA 3EYOB 1LE9A 2ITCB 5GRVK 4N0FA 4KJPC 2IAND 4TNVK 4JFOB 5JXEC 1UYWH 4Z7OE 1KJ2B 2YMXH 4EI6A 4UNUA 2WBWB 1VSCA 4ZFFB 3QCVH 5TQ0L 2NTFB 3N50A 1AH1A 4YHIB 1ACZA 2GJ6D 5JW3H 4JFDD 3FQTB 2V2XB 3HZMB 4HIHA 3SGKA 2IMNA 4UILL 1UG9A 3ULVD 1RK0A 3EDJA 5E99L 5J1AB 4JKPL 1ACYL 4ZUSB 5GGSY 2X4SA 2Q8BH 1UQSA 1UT9A 4QHKJ 4DVBA 5CZXD 4MNQD 4Z77B 4ODSL 3QQ3B 4LVOC 5A2LH 5D72L 4QO1A 1QQDA 5F93C 4PJ9A 5JW3L 3CDGB 4WUUA 1VADB 4NQCA 5B3JF 1I1CA 4WNQA 2DLGA 43CAA 4NQEE 2QQKL 5I1JL 4OGYH 3HNVL 2HT2C 4FXKB 2A73A 1NGQL 4P2OB 1NCNA 3EYQD 3NBNA 2UZXB 2Q8BL 1IARB 5ADOL 4LSUL 3OF6D 4Z7VB 1E27B 5DHVB 5DLML 1OPGH 3HAEB 3KYMA 1KIPB 5DUMH 3TH3T 5EC1B 4OIIL 5FYLH 2AW2A 1S7XB 3IFLL 2NY4C 3PNWA 4PJIA 5INCA 3TLRA 3AS1A 5GGRY 3TBSA 4ZNEE 4MJ6A 3ZT6A 2IH3A 3GHEL 1I8LA 1QRNB 4ZS7L 4OD2A 3ULUL 1INEH 1D5XB 1WK0A 2EIZB 4PUBL 3TJHC 3W2DL 3JZ7A 5TF1H 5FOJA 4YHZL 2ORBL 2XZCH 2AS5M 4K7PH 4LLQA 1MJ8L 5JOFB 1BZ7B 3DROA 1J8HD 2GJJA 1A9EB 2EIEA 1INEL 2AV1A 1J0YA 2PKDA 3L5JA 2XZQL 1BF2A 4MAUH 4HLZH 3PJSB 5EA0L 5JOEA 4GG6E 3HG1E 3O3AB 2A9NL 2HVKB 3U6RA 4GG8B 1BFOA 3MRNB 2O5YH 2YA2A 5TF1L 4ZSOA 4G8EA 3N1FC 1A1OA 5SX4I 4IS6A 1NBVH 4BH8A 3UPRA 4QHKI 4L4JA 5FYJH 2A83B 5E03A 1QSZA 1FRGL 4ODHH 4YNYA 3D18A 1JHTA 1D6VL 4AIXA 4GW5B 3RX7A 3VGHA 1QBLL 1T0MA 2NY5C 3ARDD 1PVHA 4J3OC 4W4OA 3W9EA 4F58H 3SGDH 3U9UA 4A2MA 5I1EL 1PEWA 3O8XC 2NR6D 2P44B 1PG7X 5BOPA 4MD0A 1T22A 3SKUD 3MUJA 4WI9A 5DC4B 3MRGA 4G8IA 2VISB 3C08L 2EE6A 1UH3A 2O5ZH 1AXTH 1H5BA 5BS0D 1MCSA 1CGSH 1QSEB 1X9QA 3EOTH 2DQHH 3OXRA 1SEQH 1CYGA 1VACA 3GIVB 1KIUA 1P84K 4OQTH 2HT4C 2ICES 4OBRA 3KR3L 4HT1L 3NMEA 1YN7A 5I66A 1B4RA 1C5DB 1CXKA 1DN0A 1D5BA 2DQHL 4BUGA 1Z9LA 1SEQL 5CJOH 4L8SC 1B4JL 4X4ME 1BFSA 1A2YB 1IQDB 3BN9C 4NO3A 3PHQB 2ADIA 2LTQC 5IGXH 1S9XB 5DJCB 4NRZB 1C16A 3MRLA 3WSQL 4QTHA 4E0RA 3IU3A 2AXFA 2APXA 3QXDA 2FZ3A 2ILLA 1QEWB 4PJDE 2VSDA 4HGKC 2C3XA 4KRMB 3H3KA 4YX2L 5D5MA 4KVNL 4JFQB 3O9WB 2WWMD 2HVJB 2R0ZH 1UACL 3I9GH 5DRZA 4Y19E 3WEXA 3AXLB 4LAQL 4PRAA 1T04B 2LAGB 4I8DA 3CFBB 1RZ7L 1CDHA 1VFAB 1M6OB 2R56H 3MNVB 3VDBA 1EXUA 3DV4B 4Y4FC 1IGTB 4M48H 1RULH 3E6HA 1BOYA 2R0ZL 1QP1A 1S7WA 5L0QB 2YOCA 4N5EC 5DK0A 3NIDE 4LCCC 5L2KA 3DTXB 2C1OA 2JJSA 5E5MA 4YHKL 2V9TA 3GSVA 4NQXA 3VI4E 4YHYC 1A7PH 5K9KB 1GZPB 4WI5A 3DX6B 5I9QB 5HHME 1OAQH 3GSWA 4WVRA 2Q76B 4BKLA 2ADJA 3NA4A 4U6XB 3ALXA 1KC5L 4IOIA 5J6HB 2HTKC 1VGKB 1MHPL 4AL8H 4LKCB 1QFHA 2VQUA 4NIKB 4HLJA 2BC4A 4H1LB 2B1HH 3QIWA 5E2TL 4OAWA 2ERJB 3QUXB 2JB6A 4ALAL 4UBDC 5C0CE 1BVKA 3SKJH 5C2BH 1I7TA 1DE4A 5DD0L 4K94H 2B5IC 1S7TB 3SDDB 1WVZA 2G60H 5LBSL 3QAZC 3VGEA 4FQPA 1O7VA 3QCUL 3EFDL 4XX1G 3LSOB 2VXUL 3UTOA 2Z35A 4MB4A 4PJXF 3U4EB 4HPOH 4KI5E 4PJXB 4M1GH 2WSKA 2DTML 4V2CB 4HZAA 4K94L 4PJ5D 2EC9U 4H8WC 4E41D 1HHJA 1TPXC 3TO4A 1CL7H 1RZFL 1I9RL 1Q9LA 3SDCB 2JJTA 1A3LH 1V5JA 4JQIL 2DI9A 2IQ9L 3WIIL 4FNLL 1BLNB 1P1ZA 3LN5B 1AKJA 3CSBA 4QRUB 1FN4B 1MIML 5FGCE 1MCKA 1Q72H 3P0VL 5J9PA 3CX5K 4HAGA 2R2HA 4M00A 1FZKA 4PRID 3MRHB 2CGRH 4U2YA 1AR2A 1UCBH 3DECA 3KYOA 3GBML 1XMWA 3CZFB 3QJHB 4W6YB 1IEAA 1HXMB 2P42B 1I75A 4BZ1L 1KIQB 4S1DD 1I8MA 4F7CA 3RUGA 3PDOA 3VRJA 1Q72L 5TDPA 5MHSD 4TTGA 5I8OL 1S7QA 4YHML 3TIDB 5DRNB 1ADQA 1CDGA 4NP4H 4FQXB 5D2NC 5CLWA 5HDOA 1KG0B 2F54E 2WW8A 3Q1SH 4GMTH 5TDNB 1Y6NR 5DO2D 3U46A 1KGCE 2EH8H 4Y16B 1FVDA 4R2GB 2R23A 2CPCA 3GJFK 5I1GL 3P4NB 4FFVD 3KDMA 5EUOA 1A21A 4LVNC 2OL3L 3DRQA 1ZVYA 3X14A 1AXIB 1KCVH 4G6MH 3QI9B 4N0UA 4PY7B 4ZNCD 4D94A 5HHXL 1OSPL 2I60L 4A6YA 1OB1A 2Z31D 5D1XC 4K3HA 2V5MA 3MLSL 2QHRH 2FSEB 4YWGH 3MUGB 1K6QH 4GJTB 4FFYH 3HMXA 5E7BA 1QPPA 3ULVF 3FB7B 1R5WB 1IGMH 5C09D 2XKUA 1KCVL 2YSSA 1I9IL 4LARH 4OZFH 1A6TA 2F15A 4IMKC 4E42A 4Y2DB 5CP3H 1UZ8A 4X7TA 4OLEA 4RA0C 3EYVA 4JPVH 2QHRL 3TO2A 2NY3B 1JF1A 5FYJU 1UENA 4G42A 4FFYL 5KS9B 4KDTA 3RTQD 5HHOB 5DDHA 5FGBA 4NQTA 2DQTH 4RAVB 3MA9H 4OZIA 2SEBB 2HLFD 2M1KA 3P9MB 5EFIA 1Z9MA 1PKQB 1U3HB 3DI3B 3RNKB 1LEGB 3QRGL 5D2LB 5C0RH 2VB5A 4IRJC 1T7WA 1K3ZA 2X09A 1V3MA 1NCCL 4M5YL 2VLJA 4O2CA 3NH7H 5F89A 3RDTA 3QIUA 3VXSB 2OK0L 1KNOB 2HJKB 5JIKA 3QDJB 1T4KB 1C5BH 3S3SA 2ZZUT 4X8XA 2ED7A 3MA7B 5C0AA 1PD6A 2YPVH 1AO7B 3PV6B 3QDGA 4PLOB 3OBAA 2HG5B 5IFJA 4IJ3B 4NZTL 5I17B 1FO0A 3PHOA 1CZ8L 3T0EB 3GM8A 4K71B 4D3CL 1OOAA 4R90H 5ACZA 2V17L 1TFHA 3WKMH 4YO0A 4MZ3A 5GIRB 4WV1A 3V0VA 4RMQA 3LRGA 3QXAA 1KELL 3DUSB 4X0KA 1MI5E 1XF3B 1YJDC 1GC1H 3QQ9D 2A9MH 5FM5O 4GH7B 3NIFE 1SYSA 4OZ4B 2C4FU 4R26H 3OHXA 3PABB 4I9WE 4NRYB 3DRTB 1D9KA 1ONQA 5HYIA 5DJ2B 3H8NA 4WCYH 4NCC2 2O5XL 5DMKA 2VLRB 2WUBH 5IVZA 1MREH 1MUJB 3EYFB 1XGRA 3L3DB 4TUOA 2A9ML 4BUHA 3G5ZA 1AGEA 3FQRB 2NXZB 3BXNB 4CVXA 2KUTA 4K8RH 4XCFL 4P2YA 5JW4R 1CE6A 1ED3A 4RIRA 1OY3B 2GAZB 3M45A 1NGPH 5DJAA 2X4QA 3FOMA 3UJJL 4F3FA 4L8BB 3GBNL 1ZLWK 4KQ4L 15C8H 1MSPA 3SDAD 4XMKH 1YMMA 4LCWE 4DZ8A 1V7NH 5F3HA 3VMOA 4IMLA 1DVFC 2FO4A 5TF0A 4G6KL 1BJ1J 2X4UB 4ZUVB 3TFKC 1NJ9A 4MSWB 3UTQB 2BX5A 2P4AB 1B0RB 3FHAA 3WJLC 3ZHKA 4MXWL 1VKXB 4NBXB 1Q38A 4Y1AE 2ZJSH 1L9NA 3VFGL 1KJ3L 1M05B 1A3RL 4RMSA 5C0BA 2JELL 3MRCA 5D6CB 1KPUB 5C0EB 2ZOKA 4NM4H 4DK3A 1QA9A 1RZGA 4XCYB 3HE7B 5EORL 4KROC 1SJHB 4YFDB 2ZG2A 5IR1A 5ACMA 4XAWL 2R9HC 5DFVD 4X9HA 4HK0A 4YDIH 3SDXA 2PYFA 4ETQA 4JQXA 1IM9A 2FGWL 4M5ZL 1A6PA 1CICB 2W9LA 3IDNA 4YC2B 1NC4A 3AB0B 4WI7A 4XNQA 3I50H 1EUTA 3GMRB 3OKKB 5H94A 3M07A 2ARWA 4XBPA 3REWA 3JV4A 1R3IH 1FAIL 1OAZH 4Y5VA 1F8TH 2DYPD 1MH5B 2K9UA 4O58H 3GSNA 5CD3B 3QUZB 4HIXL 1XH3B 1KXTB 3LH2H 1S7RB 1FQ9C 3QFJA 4MDJA 4Y4KB 2Q8AH 5E56A 1NKRA 4KJQC 1FVEA 2GFBA 4FN0A 4G7YL 4HDIB 1HEZB 4JFEB 5DQ9A 4OCRL 4RFOL 5KVMC 3AU1B 4LAJH 1IJ9A 1NBZB 3C60B 5IMLB 4XPHH 3WLWC 3BZDA 4ZAKD 5EZOL 4LRNH 3U79A 3GK8H 4HJJH 5BW7A 1JE6A 1PYWB 2BNRA 5IMKA 3INUH 3ZYZA 4FZEH 1YMHA 4LHUB 3UP1A 5L7XH 3RL2B 4LASH 1F4WH 1ULVA 3W11C 4PLKD 4QHNA 2XWJB 1HSBA 1LD9B 3BAEH 2FCBA 3D39E 1G9NL 4XPHL 3IFOB 5HVGB 4TNWF 2WINA 3MRKB 3K8KA 3SGEH 4HUVB 3F7VB 35C8H 4FZEL 4G42B 1FVCB 4JB9L 4W6WB 5B22A 1RUMH 3QDMD 5JLZA 1IMHC 4EI5A 1GOFA 4WI8A 4WHTB 1OAKH 4D9QE 5BZWB 3VFOA 4ELMF 1FPTL 3UTPD 3BE1H 4ELMB 4P5KB 3ARFC 2DQIH 3LKOA 4JFFE 1QO3A 4AEEA 3RAJH 3MX0A 2QBWA 4OFKA 4ZUTB 43C9A 1MRFL 1G6RA 4NSKB 5AZ2L 1WBXA 4GBXD 1GJIA 1W72B 2P46B 3T2NH 4YHLH 4FQIH 2YRZA 4KJYB 5E00A 4HZLA 1U8LA 5IQ7H 1OWRM 3L3GA 5GRJH 5C92A 1CIUA 1EGJA 1GGBH 1PY9A 2HFFB 3CH1A 5D93B 1MWAA 3RAJL 1Q1JL 4UOJA 2ATPA 5DMGC 1NBYA 4I0KA 4IOFC 5IW6A 3D2UA 1WZKA 3I2CL 5FECA 3VXPB 4XHJC 1GGBL 5GGQH 4NUGL 3LY6A 3AMLA 1SBBA 4GRWB 2F9BT 1PAMA 2NY1D 1E28B 3NVQA 1RZ8B 4TPRH 3LS4H 1EBAA 4G7VH 1N4XL 3BP6A 4JRYA 4X99B 2ZP0T 1QVOA 1ZA6B 1UKQA 4M4PA 4ZQKA 2DICA 3GFUA 2PO6C 4NBZB 1A0QH 4E5XB 4M7KL 2BVPB 3VG9C 3HR5A 4MJIE 4P46A 4EOWH 2Y7QB 3MV9B 4PD4K 5GGQL 2R8SL 4YDKL 3CNKA 1I9JL 5C07B 1W2KT 1M1SA 1GHFL 4KRLB 4LQFH 2F19L 2R69H 5FCUH 5HYJD 2E7HA 1MHEA 3LKNA 4QGYA 4HS3A 4JFYA 3WMSA 4YEEA 3E8UH 3BP4A 2YKLH 2YPLD 1A0QL 5JPMA 5CJXC 2ZUQB 3KLDA 1BJMA 1A5FL 1FDLH 3VXQB 2VL5A 3QIWC 1L7IL 1AHWA 4PJ8D 2BFVL 2N7BA 2P8LB 5D71H 3AS3A 3EO9L 3S6CA 4U1JB 3IYLW 2CIKA 4G5ZH 4C4KT 1TZGH 1RVFL 4NC1C 4YDLB 1RHHB 3WDHA 2GJ6E 4UAOB 3QNXA 2R2BB 4JFDE 4NYLB 3ULVE 2G5BA 1J11A 5I6XC 5EOQH 3FCTB 5I19L 2AV7B 2CLRA 5D71L 4PTUA 4YK4C 3HE6C 4WTZG 2H6PA 1EERB 4JFHD 1TZGL 5IQ9A 4GKSA 2DWDB 4MNQE 3UZVB 4XP9L 3QCTH 2VIRA 3RY4A 2XRAL 4PJ7E 5IVNA 4D0DA 4KAQH 1KCUL 2BY3A 4AT6A 2V5YA 1QSFA 1ZHBB 2DBLL 2X1OA 1LO5A 1G7PA 3OKMB 4X9GA 2GITA 3GMLA 5KVDH 1DEEB 4MDIB 2X4NB 3MR9B 3QCTL 4KY1H 3JTSB 2DQEL 1U95B 1JTTA 5HYSG 4KZEH 1J12A 4S1SL 5CGTA 1QBML 3V6FA 2QSVA 1VGEL 4DVRH 3MO1B 3SCMB 2EXWC 1XGYH 4PG9A 4ODVL 3Q6FB 1ZGLA 1VFOA 3O4LA 4UDTA 3ARGA 3L7EA 3KPNB 3MLVL 3QQ4A 3S35H 1F6FB 2X7LA 3CVHB 3OKLA 1J8HE 3G08B 1EZVY 1EJ6A 4UQ3B 3LAFA 2CK0L 4PP2A 2A6DA 5J12B 4UQ2B 4NO5A 2NZ9D 3BIAX 1XGYL 2AGJL 3GI8H 1SHMA 2VN7A 4KK8C 1GIGL 2NPLX 5EO9A 4DN3L 2G2RB 4X6CA 4IHOA 1JN6B 4RMTA 3S35L 3SBWA 2EYSA 3ZLQC 3GNML 3QEHB 3NFPB 4H5SA 2ESVE 1F5WA 5GHWH 3PWPD 4CN1A 2VE6A 5DQDL 4O9HH 5DJXB 5DSCA 3WNKA 4RDQF 4YIQB 4WW1B 5HGHA 2ZPKL 1T1WB 3TT1L 2VDMH 3E3QE 1C1EL 4X7EC 3ZE1E 3IB4A 1M7XA 4ZD3L 4U49A 1D7FA 4YH6A 4MAYD 5I1CH 3BDXA 4FQHB 2OI9C 4JO1L 4NO0D 5MEND 3PQYA 3TPUA 1LO0L 4ELKB 2XTJC 4XNMA 4GAJH 1PQZA 3ARTA 4RZCB 3A6CH 4OGAC 2XA3A 5BS0E 4ISVB 3WUWG 4I0PC 3UYRH 4R97B 3ZKSD 3TYGH 1B2WL 1UB5B 5B4MD 4PLJD 3LQZB 3GZKA 5C08B 3SOBL 1NGWA 1AY1L 3CLEH 1G7HA 5B39B 2VLMD 4ZXBD 1DBKH 3D3VD 3I75A 2B1AH 1NFDF 4DGIL 25C8L 4RFNB 3VH8A 5AD0A 1Q94A 4FQLH 2MJWA 2CDGA 4LGRB 4OIBA 2F58H 4ZTOH 1TNNA 2D7MA 3X12B 4ONGL 5EO0A 3ARUA 2Y06H 1MAKA 5D1ZA 5T5NF 4MYWB 5JW5A 2EICA 3MNZB 1FFNB 4X98B 4S0TD 5CSZB 4P4KB 1LEKB 1U8KB 1CVRA 4ONFL 1GGIH 1YDPB 3CXHK 1OARH 1U8OB 3NGBB 4FQLL 1VHPA 5I74C 3EOBA 2VSCA 4RBPK 2I07B 3AVEA 1ZTXH 3TN0C 4RMRA 1C12B 1DUZA 2AXJA 2MQ3A 1JGLH 5LGJA 2LQRA 3MFGB 1JUFA 3H9HB 2YPKB 3U2SB 3UCRA 1EV2E 2F8VA 5EU3A 1PSKL 3FQXA 1IQWH 1D9KC 2X1QA 3T0AA 5J13C 2BDNH 4OCXH 3P9WB 5ICXB 3K8LA 1HHGA 1ZTXL 1JPTH 4Q97A 5L8JB 3K4DA 1QR4A 4RISH 4WHDA 3H3BC 3IJSB 4D8PB 2C7UA 2O61A 1JGLL 1U91A 3ES6A 4WWID 5DK3A 5C0GB 3QO1A 5E94B 2X4OA 2NX5B 3RWFB 1DANU 5K59F 5IB4A 2DLFH 2GK0A 3P4OA 1RZJC 5GZND 2VRAA 3FZUC 2WBKA 3TIEA 2MPAL 4UU9A 5F9WC 4K3EL 4H20H 1EK3A 3V8OA 1CD1B 5I16B 1F6LL 3MYJB 1QLFB 3P77A 5TH2B 1JNHB 3VXUD 3PDGA 3PL6B 1A47A 5INDB 2ICWA 1NC2D 1XEDA 4Z7UF 4PY8J 1T80A 5FHAH 1UB6B 3UTTA 2B39A 2XTLA 3SDDD 2P43B 3PF2A 4M02A 5BV7L 4U1KB 2I9LB 2OR9H 3RVVC 1P69B 4LNVA 1QUNA 1DLFH 5KN5B 1MPAH 1I1FB 1KXQE 1RUAL 1A7BA 3ZKMD 3LIZL 4PJ5E 3HKFA 3QEGL 3RPIA 1IAMA 4HEPG 2ZCHH 1T1ZB 3D69A 3SN6N 1GZQA 1WJ3A 5FFLA 1NFIA 2LU7A 3EDDA 2JCCE 4Z5RB 4DUWA 4URTB 4PBVC 2R1YA 2QQNL 1A4JA 5IHZA 2DMBA 3EUUA 4QT5B 3JBG7 3MRDB 4K23H 1FO0L 3ZYOA 3QJFA 1ZLVK 1XIWC 4XWGL 4PRIE 1RK1A 1QFUH 4WWKD 2DQJH 3BKMH 1J1XH 3BUYA 4OZHF 3HMWH 4L3EA 1FLTX 1MCQA 2EDYA 1TDQA 4OZHB 1UJ3C 1K8DA 3ALWA 4G6FD 1NGYA 3QQNA 4PJHA 3LRSB 2AK4B 4K23L 4NJ9H 2MHAA 3ALPA 4YFLF 4M1CD 2IPTL 2X40A 1CD9B 5MHSE 5SWSD 3KHOA 2YBRA 1CDUA 4P2QA 1AD0A 4RQQB 3DSNA 3BKML 2W38A 5AWNL 1H3XA 4R4BA 4G6JL 4JG0H 1A6UL 4PY8I 3TA3A 3V9FA 3T77B 2A6KB 4Y19A 3LMJL 4Y16D 4MS8C 4JPKH 3QZWB 5E9DA 2FR4A 3MLYH 4JM2C 4HH9B 1CXLA 1M7IA 3ULVH 2NY0D 1JI2A 3UBXG 4HWZB 3ARED 2B4CH 1AR1C 1F4XL 1P4BH 4S1QH 2EDQA 3IJYB 1IKFL 5D7JC 2KDGA 4U33A 5CEZE 4EDWH 5GGVY 1N5AA 4JPKL 1KN4L 5IW1B 2YXFA 4NHUB 2R29H 4MVBD 2NYYD 4P23A 4K55A 3KXFD 1ETZA 5D1QA 3VWKA 5C09E 4LVOB 4Y89A 1I7ZB 4S1QL 3WFCH 4KRPC 3ZSTA 1HXYA 3TEUA 4G43A 4CADA 1CFNA 1DANT 2HT3C 3L3JB 3ZDXE 1G7QA 1OGAB 3AM8A 5DS8A 1A7OH 3CLFH 3O45A 1DP0A 5I1LA 1IAKA 5B38A 2Y4SA 4CDHA 5TPWL 2NY4B 5DI8B 5ESQA 1HE7A 3CSYA 4PTTA 3TNMA 4GXVH 5HGDA 3MLTB 1H0DA 1YEIL 2XKNB 2WK2A 4LBEA 4C56A 4V1DA 3CC5A 3OAYH 3RGVC 5MEQB 3MLWH 2Y5TA 2J88H 4PRHA 5L88H 3QDJD 1P5VA 4R7DA 1PJ9A 3VWJA 4AEIH 2BOCB 3GSNL 1UVQA 3KPOB 2Z91A 4Z0XA 1NMBL 1JZ7A 1YQVL 4FFWC 1NANH 2A0LC 5CAYB 4ACPA 5L88L 3S5LG 2BERA 4FZ8H 4UT7L 4KDVA 2P5EB 3H9SA 1U0QA 1KLUA 8CGTA 3CDYA 5GRXG 1SYVA 5IK3A 3BN3B 4I3SH 4F57L 2AKRA 2XWTA 4JEGB 1RSFA 3QIBD 5I8EA 1PGRB 1RJZB 1O7SA 2OR8A 1XGPA 2PYEB 3G5XA 2EDXA 3OR6B 3C8DA 3HNSH 4JM4L 3CUPA 2HJLA 5KANG 5GRUH 1G7MA 1QTYT 2ADGB 5DRWA 4FZ8L 3G6JB 1LP9F 3HRPA 4LVHC 3WD5H 2UWEB 1LP9B 8FABB 4F7TA 3O8XB 4M61B 4YAQA 3O2DA 1CBVH 5HY9B 2DI7A 1IZJA 5JDSA 1SJXA 1UJTA 2ITCA 3W5NA 4XMLL 5GRUL 1G7IB 5ELIA 2NCMA 2X9YA 1KJ2A 4KPHH 3V6ZB 2D31A 4HD9A 2NTFA 4XPBH 1G6RL 4YHIA 3S5LB 4QY8A 5DUPH 5IWLA 2XIDA 1HNGA 2Q3AA 3FQTA 2V2XA 4LSQL 3HZMA 1U9KA 4YBQD 3SJVB 3NA9L 1EGJL 5J1AA 4MCYB 5GSRB 3FT4B 4MA1B 4QNPF 2W0FB 4ZUSA 4AIOA 2CK2A 1MWAL 4KK5C 4NFBA 5HD8C 2MQ0A 4R3SB 3IJHB 1RZKL 4L8SB 3QQ3A 3VD4A 1HHKA 2LTQB 5DYOB 5BMFL 4AH2B 3B2UD 4K94C 3Q5TA 1NFDE 4MQXC 4MX7B 4HS6A 4MA3A 2VDKL 3MGTA 3HE7D 4DKFH 4JG1H 1OTUD 2Z8SA 3M17B 2J8UF 1S5IH 1XT5A 5KSBE 2J8UB 2KQNA 2OSLB 5DMIH 3FL7A 2PR4L 1E27A 5DHVA 4Z18A 3HAEA 5JZ7C 5EC1A 3RU8H 4R6UA 1I3GL 1CICD 1S7XA 2ADFH 1P84J 2UUDH 3ZO0A 4HF5L 3CFDB 3C6SB 3JTTA 1RPQA 1YNTB 1OD7A 4W4NA 1MRDH 3B83A 1KBGH 5ALCH 4U31A 4R4FL 5ID1B 1QRNA 1D5MB 4P3WA 1OTSD 4QRRA 1AI1H 5HHNB 5E6ID 3F6LA 1D5XA 3HTLX 2VH5L 4Y4FB 3BMVA 4KUZH 2QKIB 2X70B 4Y4KD 4CJ0A 1JPFB 3S36X 1XGUB 3QWRA 4JR9L 4M8VA 3KNBB 3SHSA 1A9EA 1F00I 4LCCB 1F4HA 1KB5H 5T1LA 4O00A 5TE6L 1A9BB 1RUPL 4YHYB 3PJSA 3HZYB 1JWUB 5FXCH 4WFFD 3O3AA 5C71A 2HVKA 4GG8A 1B90A 4JZOB 5TQ2H 4PJFB 1KENH 3B9KC 5LGHL 3ARBC 2VO5A 4X9BA 4POZC 3WNMA 2HAZA 1U92A 4F37K 3VGFA 4QRTB 4JY6A 2DQGH 5KZCD 2A83A 2EDWA 2EDDA 3MV01 1PW3A 4QHLB 3MV7B 4HHAA 4GW5A 2FX9L 3ILQC 1CF8L 3P0YL 2UZIH 1YEHH 2B5IB 2WV3A 1S7UB 4J3TA 4UOW0 4ZTPH 3QAZB 1OT1A 3QDME 2CKBB 2W60B 4JVUA 1H3VA 2VABB 3JSSA 4PP1C 5I18L 1F4YH 3UTPE 4F9PA 2Z0BA 2VISA 1X7QB 4J1UA 1GL4B 4PB9L 3B8SA 4WTXA 5EU6D 4ZFOB 4C54A 2H2SC 3D85D 1FBIH 3ESVF 4LKXA 1JGVL 4K7FB 5FB8B 1QSEA 3GKZA 1TPXB 1OVZA 2DOCA 4GLRH 2FHCA 3EFFB 2MWCA 3EGSA 3GIVA 1IC5L 2HKHL 3K8MA 1CU4L 3GMOB 2XQYK 3QHZH 4JO2H 1BFVH 3VE0B 3SDYH 4J4PA 4CU6A 3GMQB 1I1YB 4Y1AA 5IBUG 5F7HA 3TBWA 4YE4L 1HCFX 4LHQB 1A2YA 4DOHE 4Y88A 3FO9B 3PHQA 4KZDL 1S9XA 5DJCA 3S9DB 5DD1H 4NRZA 3A6BL 3I3EA 3WJJA 4OV5B 1PZ5A 3QHZL 3REVB 5HHQB 1S7SB 1GOHA 2E9WA 1MNUL 4NQDB 4Q7DA 3BH9B 3V7AG 1EHXA 1I1AC 2P7TB 1MY5A 1NFKA 2EDBA 5D2NB 4YHPA 1E6OH 3O9WA 2O93L 2HVJA 4ZPVA 1Q0YH 1HHIB 3RKDC 5TE7H 3BPCB 3AXLA 4C58B 5CEZH 3X3FL 3MACH 5HYJE 3CFBA 2J7LA 2W9EH 3D0LA 1A7RH 1VFAA 1M6OA 4LVNB 5BZDB 5J6GA 1TCRB 3MNVA 4U4BA 3DV4A 3RP1A 3ZDYF 1IC4H 2YPLE 1IGTA 3EJJX 3KPSB 4M7LT 2X10A 1EFXB 3C6LC 4HKXB 3OGOE 2OXHA 5D1XB 1D5ZB 4BQ8A 1P7KA 1HHHB 2YD7A 4H26B 3MACL 1GC1C 1QZ1A 2CH8A 2XXCB 1DL7L 2W9EL 5DURD 3DTXA 4IRSD 5F1NB 2AEIT 2ZUWA 5K9KA 2AAVA 4LOUD 2E27H 3V4PH 1G0XA 3MRFA 7FABL 2Q76A 2BVQB 2YR3A 1UWGL 3ETBF 5J6HA 3PP4H 2M26A 3F5WB 2UVEA 1VGKA 4LKCA 4H1LA 4JFHE 3MLRH 3QUXA 1MLCB 4KC3B 4K8RC 3BX7C 4MQ7B 3OKNB 2WIMA 3V4PL 2PXYA 1S7TA 3MLUH 4P4RB 5CZVH 1BD2D 4IRJB 4ZS6D 1R5VB 1XGTB 3RNQA 5I76B 3RY6A 3LSOA 4DGYH 5FF6B 2DIAA 3U4EA 4APQC 5A2JH 3RZCD 3IAQA 3UBXI 4PJXA 4U1NB 4S2SB 3OJDA 2CLZB 5BJTB 5I71C 4C4KO 4NGHH 1FGVL 1JPSH 3SDCA 1X6NA 1CD8A 1J87A 2I5YL 1J10A 5SX4H 3ZHDA 4EBQL 1BLNA 5E70A 3O3EB 3TV3H 3HS0B 4HK3J 3CDFA 4CU8A 1LHZA 3DXAB 4NZUL 1DBBH 2CDFB 1TQBC 3WS3B 3KYAA 5D7IF 3MRHA 3UTZB 4NGHL 5D7IB 4M7JL 3WIHA 3E1F1 5E2WH 3BT2H 3CZFA 2ID5A 5KSAC 1KIQA 5MI0C 1EEZA 3F7PC 5FUZL 4K2UL 3U1SH 4HIHB 4X7CC 3TIDA 1BQUA 4AEHL 4MJIA 3DMMD 3PWPE 1EHLH 3BT2L 3PWUB 4FQXA 2X4SB 1ZOXA 3IGAB 1KG0A 1FGNH 3NFNB 3QPXL 4EUPA 4OCSH 1CFTB 2HKFH 4M3KB 5TDNA 1E4WL 4KKAD 4L1DA 1ZHLA 3HPJA 3GSQB 3IDMB 5GS2D 3P4NA 4WUUB 4NQCB 3U1SL 4JZJC 4H0GA 4LSPH 2J6EA 4WDIA 4KUCD 1NAMH 4M93C 3ZTJH 3BZ4B 2A73B 2L0DA 3QI9A 3QUMH 5MENE 4PY7A 4G8GB 1FGNL 3UAJD 4X6DB 4CW1B 2FSEA 1CK0H 2DS4A 3PNWB 2D7NA 2VKXA 3FB7A 1R5WA 2VDLL 3MXVH 5HI5C 3TBSB 4QNPE 5C08D 1RURL 2KBGA 4RGMC 4Y4HD 2CXGA 4WO4C 3V6OE 4KI5C 4Y2DA 5FO8A 1FHGA 1WISA 3D3VE 1F90H 4KROB 1D6EB 1NUDA 5KANI 1K2DB 5EB9A 5BRZB 5KS9A 4Z0BH 1HKLH 5HHOA 4HC1A 5IKCA 4Q2ZB 1MCWM 1JHKL 1N0XH 3D0VB 3DROB 3LKRB 5H37G 4RAVA 5GGVL 1ZT7A 2SEBA 2EYTB 5FYKD 3HFMH 5D7SH 5CHNB 1Y6MR 3CK0H 3S96B 1PKQA 1U3HA 3C9NB 3RNKA 1LEGA 3BD4A 2X6MA 3U6RB 4BFIB 3BKCL 2AJYH 4LDLB 2EKSB 3S4SG 4G8EB 4F9LA 5C86A 3KJ4C 3VXSA 1N0XL 5JW4M 1KNOA 2EIDA 2HJKA 1ZT4A 1DQDL 1T4KA 3U30C 3HFML 5D7SL 2Y72A 4M62L 4DGVL 3PV6A 1AO7A 4XTRD 3VFVB 2QADD 4UTAH 2AK1L 1PLGH 2AJYL 3FFCA 3V2AR 2YD5A 2HG5A 3HCVB 3ROLB 4P9HH 3U9UB 4JN1H 2HRLA 3PE9A 5I17A 2KL6A 3PV7A 3T0EA 4MD5B 4NN5C 1L0YA 4UNVA 1P9MA 3BVNA 5GIRA 1EEUA 5K9QG 4MD0B 3TBYB 2MCG1 3MRGB 3HI1B 4P3CH 3DUSA 1CLZH 1HNFA 1XF3A 4HUUA 1LO3H 1T2QH 3MLXL 5CJ8A 4Y5YC 1MCDA 1H5BB 4QTIH 4OZ4A 3MJ9H 2VDNL 3A67L 3TC9A 1WAAF 5E6YA 2XWBB 3JVGC 4NRYA 5D4QA 3B3IB 3K1DA 1F3DH 3LV3B 4BFGA 2GJZB 4NN6C 3GGWB 2ESVA 1CS6A 2VLRA 3BGFC 1CLZL 3VU2A 3VGAC 3QUYC 1XR9B 1MUJA 3VXUE 3EYFA 5A43C 3L3DA 4J7RA 2FX8H 4OKDA 3FQRA 1DN0B 4OM0L 1D5BB 2X05A 3ARFB 4HS8H 5JIIA 1UXSB 2GAZA 1CN4A 1HINH 1EVTC 1FH5H 3GBLA 1F3RB 3DETC 3VXRD 1C16B 2H32H 3OKEB 2Z4QB 3MRLB 3GRWH 4L8BA 3WFDH 4E0RB 2FX8L 1ZT1B 3CFEB 5I1KL 4RCAA 4TULL 2FZ3B 4MQSB 3MPCA 3IVKA 4Y8DC 2WP3O 5EPMB 1SBSH 2BXZA 2X4UA 4ZUVA 4MSWA 3UTQA 3MV8B 1B0RA 3LEXB 3NZHL 1VKXA 4OFYD 3ULUD 1MQKL 1M05A 5JHLL 3O6MH 1JHLL 3I6KB 4L9LA 1MLBA 5D6CA 1KPUA 5C0EA 5E8NB 3MGOB 2JIXA 3UTSD 1AC0A 2D7QA 4QRPB 2VDRH 3ZTNL 1MJUH 1AD9B 3E6HB 3VG0L 1T03L 1KEML 2PO6B 4PJCF 4PJCB 1Y18A 3T4YB 2Y23A 4ZFZB 2C1OB 4XX1E 3RI5K 3GMRA 5JR1H 5SWSE 1MJUL 4X5XB 1U8MB 3GSWB 5DJ0B 1EUUA 1I3RA 2DQDH 4GRMB 4IBLT 2OTWB 4JKMA 3OKYA 5MEOB 3O2DL 1MH5A 3VD5A 5T1KB 3HC3L 5CD3A 3QUZA 3V79C 3QIWB 3KPQB 2E9JA 4U0RB 2X1XR 3MBEC 4ZOCA 2D03L 1I7TB 5H35B 2DQCH 4HXBL 5JR1L 4HDIA 1HEZA 1XF2B 5JPNB 1KJ2L 4JFEA 2A6JB 2IG2L 3D9AH 3AU1A 1NBZA 3C60A 1AJ7L 4XZUB 2B0SH 1QFWL 4B0MM 1PYWA 5FO7A 5DFTA 4LPTA 2MCPL 4P9MH 4LHUA 3RL2A 3SE3C 3CVIL 4WJ5B 4YK4B 3HE6B 1W0WB 4X80H 3CFKB 3KXFE 3S37L 4Y5XA 3R1GL 2V5TA 3X11B 1LD9A 2IAMD 3IFOA 1A7NH 2VC2H 1DQQB 3IKKA 4BSJA 1OAXL 2VXSL 1KT2B 4B41A 2YRPA 3S34L 2OZ4A 3F7VA 2XA8L 3T8XB 1OGAD 1DDHB 1TETH 1FVCA 5IF0A 3OPZH 3LHPH 3BFOA 4L4TD 5CUSL 1N6QL 2AEWA 4OLWL 5J9PB 2IFFH 5BZWA 1S78C 1MIEL 2R2HB 4ELMA 4P5KA 1OTTC 1Z9OA 3D48R 3FO2A 4OF6A 3MZTA 5IFHL 4J3SA 2A6IB 1C8PA 4ZUTA 1KJMA 4NSKA 2BSRA 3OPZL 5CIPB 1W72A 1W0YT 5L9DH 1HI6B 4KJYA 1BOGB 3VRJB 3ARPA 2HFFA 1LDPH 3QFDA 3QDJE 4XHQA 3QEQA 5AUMB 5IVXF 3BD3A 3BD5A 4UTBL 3R0NA 3T3PE 4XNUH 2H26B 1X5HA 1S9WB 2BJML 4LMQI 2Y36L 4JAMB 2GW5A 1MCPH 1CDYA 1FVDB 1SQ2N 2R0WL 4F80A 3X17A 2ARJQ 1BWWA 4CBPA 4N0CC 2LFGA 2VDPL 1N8ZA 1FCCA 3WE6B 4DQOH 2E8ZA 2YC1B 3KDMB 4PRIA 4OF7A 4XNUL 3X14B 1E28A 3LCYA 3MLZL 4J3XA 1RZ8A 5I15H 1IC7H 3UPAA 4L9DA 2VXTH 4X99A 4FQCL 1MCPL 2RIKA 1ZA6A 4QKXB 4ZO8A 3QO0B 1VB9A 4E5XA 2BVPA 1MVFA 1YNLL 2Y7QA 3MV9A 4FRWA 5DD3L 1KPRB 5C07A 5CD5D 4PRPD 4OSUH 2ICEB 4JDZB 4M6MH 3BEVB 3HHRB 4JO3L 4XMPL 3RHWF 1KACB 4XP1L 5C6TH 5ESVA 3ZE2E 3WUZA 4YDVB 4NKIH 3RBSA 2BVYA 5GGTH 1GOGA 5IHUL 2VXTL 2IF7A 1UZ8B 4P2RE 4U1GC 4X7TB 2OI9B 2FBJL 2WNGA 3M8OL 4RGND 3BHBA 2XTJB 5K9JH 3VXQA 3MMEB 4OSUL 3WHXB 4JFZH 1WITA 1HILB 3D5OF 3HB3C 4U1JA 2WUCH 4EN3D 4I0PB 4NKIL 2R0LH 3OG4B 1RHHA 2QSCH 3MJ8B 5GGTL 3KYKH 4CRPA 4TSCL 2R2CA 5JMOC 2RGSA 2AABL 1HQRB 4D9RE 3WS6A 4PJEF 3IXTB 4NYLA 5BV7C 2AXGB 3OAZH 4OD1H 4JFZL 3FCTA 1JPST 2AV7A 3FB5B 3QIUB 5BVPH 3I02B 1A6WH 3BWAB 3WDIA 4CMHC 2J5LC 2R0LL 5KAQG 2H41A 3VA6A 3CX2A 3ZL4H 3O6FD 4OLVL 4LRIA 3IDXL 1RIHH 2BSSA 5CEXB 5IFJB 4HJ0C 5E7FA 4ERSH 1FYTA 1IC1A 3RTQA 1ZHBA 4HX1B 4J3VA 4MD4A 2DKUA 3OKMA 4XAKE 1CGYA 5I74B 1OM3H 1DEEA 4MDIA 3W0WB 2L7JA 4FMFA 3TN0B 4EIGB 4OF8A 4JRXB 2VDQH 1K85A 4Z7WF 2GCYB 3ZT5A 1U95A 4Z7WB 3LOWA 4OGZA 1NL0H 5D70L 1T1XA 2F74B 2IBZX 4NKMA 1FNHA 1D9KB 3PP3K 5J13B 3MO1A 3VXMD 1NSNL 4NM8L 3SCMA 1BECA 2R15A 5KTEH 3CJJA 3KPRB 1XR8A 4P5TD 4TVSa 3Q6FA 2VDQL 2BSED 3P9LB 1CE1L 1SEBB 4XXCA 1BF8A 3KPNA 2Y6SC 3CVHA 1OAUH 4OCLC 1WGOA 1WT5C 3G08A 1XGQA 2Q87A 4TUKH 5DA0B 4UQ3A 3VI3F 4BYHA 2WBJA 3CXHJ 5DJAB 4F7MA 4UQ2A 4WFFE 3THMH 3BDYH 3WV0A 1MJ7H 4GRLD 4WFGD 5ISZD 5F9WB 5EU4B 4DAGL 4QXGL 3GIZH 5LXGH 1JN6A 5F3BA 3SEPA 5KSUB 3QEHA 4IMLB 3NACL 3NFPA 4JPWH 1BMGA 3OG6B 1Q0XH 3UDWA 1MQ8A 1JPGB 4YIQA 3C5ZD 4KKCD 5MP6L 3ULVC 4UB0H 5HI3D 3H7BA 1BPVA 4J8RB 4MCZA 5C0BB 4LNRB 3MLPA 2B4CC 2FLRT 5KG9B 2OMNA 4FQHA 1RZGB 5JHDE 3C8KB 5CZXC 1A6VL 5FHBH 4B53A 2PW2B 4ELKA 3DUHA 5EU6E 4HK0B 4RZCA 4OCYH 1NUFA 4ISVA 3SDAA 3MZGB 5F72S 3EYQC 3TZVD 4QOKB 1UB5A 4XNQB 3NZ8B 5ICYA 2ENSA 4KHTL 5H94B 4ETYA 4M7LL 1EJOL 2H1PH 1AE6L 1LE5B 3JV4B 5B39A 4KV5F 1XIWB 3DX7B 4F15B 2CJUH 3RRQA 2CRYA 5EZJB 1GGCH 1NLBH 1NFDA 4MDJB 4J6RL 1CQKA 4LF3B 1EMTH 2OTPA 1DBJL 2UZYB 1UJ3B 2FIRT 5I73C 4GRWE 5HHVL 4OLXH 4LEXH 4L4VD 1J8KA 2CDEA 1FFNA 2Z8RA 4X98A 2VLKD 1FSKC 3F7YB 3FRPA 1QG3A 3D6GA 5CSZA 2VYRE 1LEKA 3ZKQD 1GPOH 1U8KA 5ILTL 4NQDD 3PWNB 4GMSH 4PJGF 1U8OA 1YMHB 5DT1H 3Q5OA 1K8IB 1B0GA 1B6DA 4FG6D 2DI8A 2OJZH 1J1OL 4JM2F 1ZKAA 1C12A 3MOQA 2EE3A 1HSBB 5LGKA 2XZAL 3BQUD 3H9HA 2YPKA 3U2SA 4EDXA 1TITA 3T1FB 4OQ1A 2XQYG 2Z92B 4ODWB 2J6EL 5D7JB 4OLYH 2F53D 3IETB 3AROA 1PG7L 5AYUH 4HIJB 1T83A 2AQ2A 3ARDC 3IJSA 5DJ8B 4D8PA 3UROR 5IUSA 5BXFB 3VFOB 1KFAH 3E3QC 5C0GA 5E94A 5CJ5A 2NX5A 3RWFA 2N4IA 4LSVH 4CKVX 1L9MA 1AQDA 2NR6C 1Y6KR 3ME0A 4XVTH 1BBDH 4KRPB 2NY7H 1WBXB 3PIQB 5I1IL 2R0KH 3H0TB 5KBNC 1CD1A 1RU9H 5I16A 4KXZH 1UM6L 4Z8FH 4OD3L 5TH2A 1UXWA 1JNHA 1LGVA 4LSVL 3PL6A 2HN7B 5INDA 3HUJF 2XQBL 5CKAA 4TSBL 4Q9QL 4XVTL 3HUJB 5EUKB 1QYGL 1UB6A 4ODXA 4Z7UA 4HC1L 5EWIH 1W0VB 2BVOB 3WHE0 1N2RB 4U1KA 1F45A 2I9LA 1BD2E 2QR0A 3SKNB 4J3WA 4Z8FL 1I7UA 1SY6H 1XCTB 4L9LC 5I0DA 3VFUB 4YR6B 4IDLA 5EOCH 2AJXH 2BVEA 3BSZL 3Q5YA 3HR6A 4CMMB 3RGVB 3CFCL 3UO1H 3ILPB 1I1FA 3X13B 3L5XL 4XCEB 3FQNB 4BK5A 3ARVA 4DKAA 3BP6B 4JRYB 4LPVA 5EWIL 1V8HA 1DQLH 1FL6B 4EZMA 1T1ZA 3AS0A 4JRWA 1SY6L 1MRCL 3GMNA 3BIBX 2D4DA 1NLDH 4KGLA 5IVXE 3BOVA 3QG7H 4PS4H 4L3AA 1OCWL 4MWFB 1OLLA 5CCKL 4Z5RA 4YDJB 5GS1C 1MHEB 4QT5A 3MRDA 3RWJB 4Z95H 4PJAB 2WWMC 3BP4B 3U7WH 5JPMB 4Q58C 4WEBL 1BAFL 3SQOH 4CVUA 1IFHL 5EBMB 4M8QA 1SMAA 3F62A 4OZHA 3NTCH 2CIKB 1FZOB 3WXVH 3LRSA 2AK4A 4FTVB 4LVHB 4FQ2H 4O5LH 4NZDA 3C2SA 4QXUH 2WAHA 5EBLA 4KK9C 2V2TB 3FAXA 1JVKA 2X89A 4LIQE 3T77A 2A6KA 3NTCL 3LQAL 4Q9RH 3QB7C 4UOW1 3QWQB 2FHBA 3QZWA 2WMPA 3NCYP 1FG9C 4G9DB 4HH9A 4PJ9D 1UM4L 1X4YA 4NQCD 3EKCA 3ZDZF 1JGDB 1YECH 1YPZF 4HWZA 1R3JB 2F5BH 3MUZ1 3DOSA 3IJYA 4AT6B 2H8PB 1QOKA 1BZ9B 1G0YR 1QSFB 3O6LH 3U0WL 1G7PB 1IKNC 3B4NA 2GITB 5JA8B 2W1NA 4NHUA 1Z3GH 2P48B 2G9HB 2DDQH 1MCOH 2HH0L 4PJEE 4HJGB 4V2BA 4EEEA 2F5BL 1J5OH 2OYPA 4ONHA 4TTDD 2MSPA 3C87A 2OXGA 5JNYB 1MCIA 2N1KA 4KKBD 3IT8D 5C70A 4NKDB 4GKNB 1QLEL 3GSXB 2Y07L 4HFUL 2AJUL 3JWOH 1EPFA 4JKKA 1QKZH 3UC0L 4UDTB 3L7EB 3QQ4B 1J5OL 1NCWH 5DI8A 3OKLB 5JOPD 3DUUB 5FYKE 3ROOB 3NABH 1L6ZA 3CMOL 1IGFL 3HA0A 5AYQA 3I6LD 3VFWB 1I1RA 1UEYA 1MY7A 2GTZB 3MLTA 5JW4N 1MEXH 3JWOL 3DHJA 1QKZL 1MFAH 5MEQA 2ARJB 4X6CB 2EDOA 1P6FA 3ECBB 1ZAGA 5IT2H 1L0QA 2BOCA 2I26N 5KVGL 4S1DC 4FABH 3VH8G 2D9CA 4GS7C 3WFEL 4D0CB 4XPFL 2VITB 1MEXL 2APFA 4RMUA 4XNYL 4OLUH 5F6IB 1IGIH 1MFAL 2BNQB 3N1QC 5E08L 1KCRH 4PBWD 2WZPD 5CILL 1TZIB 2P5EA 3B9KB 3TGXA 5HGAB 1YEGH 3ARBB 1F11B 4EQ2A 5DO2C 1U42A 2FEDD 3TPUB 3T0WA 4XNMB 1PQZB 1RJZA 2W59A 5DVOA 3RFZC 2PYEA 4OLUL 1IGIL 1HIML 4WGWB 1X4ZA 2ZSWB 1T6VN 5A16A 4J2XA 1LP9A 5HVHC 3LS5H 1WWAX 3O8XA 2OZ4L 2XFXA 2Z31C 4PYHA 1G7HB 4LLUB 5A40E 5IMOB 4KWUA 5JXAH 2W07A 1U36A 4KHXL 4GAGH 1BFTA 1JFQH 4RA3A 2YD1A 4C57C 1KTKE 2PCPA 2UV3A 1CFVH 4U1LB 4PBXA 2CDGB 4NQEB 1HCVA 1F6AB 3VXRE 1MFBL 4UIMA 5EO0B 3NCJH 5AZEH 5FUCE 4XPAH 1W72L 4JJHA 1JFQL 3FN3A 2Z9TA 3RTQC 1D3CA 4X8JB 5EO1A 3G6DH 4ZO6A 3SJVA 2ZUYA 4MCYA 5GSRA 3FT4A 2VR5A 2W0FA 4GRWH 2EDRA 1KN2H 2HLFC 2X5PA 4R3SA 1FG2B 1R0AL 1GH7A 3IJHA 4NRXB 1RHFA 4L8SA 1U6AL 4O02H 3PGDB 4XPAL 3ULUE 5LGJB 2HRPL 1FV1B 5DYOA 2DM7A 4ZO9A 2IBGA 4XCCH 5EU3B 4UT9L 4MX7A 5F7DB 3DX8A 2EDHA 4NHCH 5ALBL 3M17A 3UTSE 4K3JH 4LCUB 2J8UA 2OSLA 3C8HA 1U41A 4ODBD 3F58H 3AMKA 4HV8B 2C7UB 3TBVA 2IC2A 4G6AD 2WLYA 1I1AB 3TBTB 3VD3A 5L2KD 4XCCL 4PJGE 3C6SA 4GG6B 3HG1B 1YNTA 4GAYB 4OLZL 4WY7L 4D0BB 5E8DH 3LZFH 5ID1A 3VRLE 4XNZC 1YN6B 1D5MA 4HH8A 2VZUA 4MNGE 1T7YA 4UINH 3H3PL 5I1DA 1LMKA 2ZG3A 1FFOB 3QQ9C 5D7KD 4Y4FA 4BQCA 1TENA 1Z2KA 2C26A 2X70A 1P4LB 4NWTH 4XP4H 3C6LB 1Q9OB 4M1DL 1JPFA 5D8JL 1IM3A 5E8DL 4RSVA 1UCTA 1XGUA 4WW2C 3KNBA 3RGHA 1SJVA 4LCCA 1G9MH 4U6VL 4CN4A 2QQQA 5IESL 3HZYA 1JWUA 3DWTA 2VDOH 3HLAA 2CRMA 4JZOA 4PJFA 1OAYH 4TNWK 1IE5A 4D2NA 1CCZA 3L3OB 3Q0HA 4QRTA 3QUKB 4TOYH 4K3GA 3DPBA 1G9ML 4QHLA 2ZCKH 1NCAL 2Q20A 3MV7A 2XOTA 2HWZL 3RPIB 3TO4D 3BPNB 3SDAC 2K1MA 4TVPL 4MXQD 1GZQB 1Z5LA 3IDIB 5I8KH 3VXUA 1AKJD 2R1YB 1A4JB 3OMZA 2CKBA 2W60A 4L4TE 2VABA 1I4FB 3GSRB 3QJFB 5DFWH 9CGTA 4APQB 5I30H 3P11H 1X7QA 4ZFOA 1CFBA 4OT1L 2FH6A 3CXDH 5KJRL 4DN4L 3LDBB 3PG2A 4HCRA 4K7FA 1UM5H 5F1KC 5FB8A 5I71B 5T5FL 1WTGT 1NGYB 3IF1B 3EFFA 4PJDB 1L6XA 3CSGA 5DFVC 1ERNA 4MJ5B 5HVFB 2B2XH 4NQSB 1I3UA 3VE0A 4WEMB 5A3ID 4KMQA 3IAGC 4R4BB 2BRRH 3GMQA 1I1YA 3IDJB 1TQBB 4U2ZA 4Y19B 2GUOA 1IEHA 2K7PA 5B38G 3MRBA 2GIYA 3FO9A 5HTSA 2NMSA 1WZ1H 4OGXH 4I0CC 3DBXB 4OV5A 5MI0B 1WCBA 3REVA 2D7TH 5HHQA 3MCLH 4LIQH 1S7SA 1YEJL 2BRRL 1N3NA 3NFSL 2QJDA 3MRJB 3NIDF 4PIRF 4AK1A 5GRVL 1N5AB 3OTTA 4HUWA 3BH9A 4NN7B 2NY6D 5GS2H 1WICA 3VI4F 1WF5A 2VR4A 1CXHA 2P7TA 1J0ZA 4OTXH 5D2NA 3S35X 4MA8L 4GSDH 5GGRB 4ZAKC 5D1QB 4PRPE 5HHMB 4GXUN 2UWEE 2D7TL 1EAJA 1HHIA 3MCLL 5J1SC 3GO1H 3KS0J 3BPCA 4JPIB 3MODH 4JZJB 4P9HC 5BZDA 4PLKC 1TCRA 1S9VB 3V52H 3OX8B 5SWZE 3RVTD 4N1CA 4RGNE 3ZDZE 5C0CB 2VUYA 1YPZE 3O2VL 5I1LB 1EFXA 5LAXB 1U8QA 5D1XA 4X6BB 1D5ZA 3CIQA 1WBYA 1HHHA 1X5YA 4C55A 3FKUS 3QWOB 1DTUA 1PG7W 3MODL 4OB5H 4QRSA 3CSYB 1TJGH 2BNUB 1DBAH 3V52L 2X9XA 2Z8WC 1J05B 4PJIF 4RGMB 5HGDB 2V7NA 3EIFA 4KI5F 5TFSH 4IMKA 1AC6A 2VLJD 3FO0L 3RDTD 3QIUD 3ORJA 5JTWA 1HZHH 1EO8L 5FYKH 4M6NH 4OB5L 5EBGA 3VFPB 4GBXC 1ZANH 2VMFA 3CU7A 1TJGL 1MLCA 5C0AD 2OQJA 3TH2T 2RCSH 5A2KH 4XRCA 4MQ7A 3OKNA 3QDGD 1P5UA 4TSAH 4P4RA 2E7LC 5FGCB 3BYTA 3VD9A 5K93A 1JGUH 4IRJA 1TJIL 3HZKB 1JK8B 4DW2L 1DBMH 4Q6IC 1R5VA 4X7SH 2X1PA 3N85L 2J1KA 1KLUB 4MQTB 1S3KL 3LEVL 3KJ4B 4K9EH 2AKRB 2XWTB 1TMCB 2YZ8A 2FWOB 2R4SH 4S2SA 4U1NA 4QRQB 4JHWH 2DLIA 3U30B 4DCQB 1XGPB 2CUMA 5LCVL 3G5XB 4PG2C 4M7ZC 2CLZA 5BJTA 1TVHA 1JGUL 1D9KD 2NY1C 1CTNA 4X7SL 2FX7H 3RA7L 3VXME 5M7QA 3QT2A 1MFNA 3O3EA 3HS0A 3CPLB 5TQ0H 3DURA 3DXAA 2YN3A 1T1YB 2F54B 4KTDL 2CDFA 4TRPL 3GMPA 2BSTB 4QWWD 3WS3A 4OF0A 3UTZA 1YA5A 4UILH 5D7IA 3RVUD 3HAEG 5E99H 4JKPH 1ACYH 2FX7L 4Y5YB 3LN4A 4U3XA 1WEJL 1WWCA 2IGFL 1KB9K 5L8KB 1D5IL 2D31B 3KYNB 4ODSH 4WFGE 4NN6B 1YMMD 5D72H 5ISZE 4QY8B 1RMFL 4PJ8C 1NPUA 5DR5L 2YEZB 3BGFB 4J23A 3QUYB 1NGZA 5I1JH 2QQKH 3HNVH 1J7VR 3PWUA 1NGQH 1OW0C 3GKWL 3IGAA 3NFNA 1V3LA 2YUWA 3WLBA 5ADOH 1CFTA 4LSUH 4HIIB 5DLMH 1HHKB 3GSQA 2E6JA 1CDJA 4OIIH 4P2RA 5C0BD 3IDMA 3IFLH 1WIPA 1Z0MA 1H3UA 3WIFB 4C59B 4HS6B 4D9LH 2CQVA 1B88A 5K9OB 4MA3B 3MGTB 2Q6WB 2BHYA 3BZ4A 3GHEH 4G8GA 4ZS7H 2P5WE 3ULUH 4B7IA 1DVFA 2ICWJ 4Y0GA 1IM9D 1A14L 1T0PB 4X6DA 4PGJA 4CW1A 2R2EB 2IPKB 4PUBH 4L8DA 2APBA 1NC4D 3W2DH 3WJLA 1IZKA 3JTTB 2YD3A 4D9LL 3ARRA 4X83A 5D5MF 4YHZH 2ORBH 5F9OL 4FFZH 1DCLA 1MJ8H 3EZJB 3WNLA 3HZVB 3LRHA 3VMNA 3AFLA 5KVFL 3QP3A 1T5WB 4QRRB 3TVMD 1JBJA 2XZQH 2ZUXA 3O0RL 3O81A 5EA0H 1D6EA 2A9NH 1K2DA 3EW3B 4HKBB 5D96C 3QFJD 5BRZA 5FO9B 3BO8B 2ZCLL 1VFMA 2DQFB 2BMKB 5J57B 4FFZL 4Q2ZA 3D0VA 4I48B 4F2MB 5E0QA 3LKRA 1OP3H 1FRGH 1CFQA 4L4VE 3OWEA 1D6VH 1CT8B 1AIFB 2EYTA 5T1LB 2VLKE 5CHNA 3S96A 3C9NA 1QBLH 5C2UB 3DYOA 4PJBF 2VZTA 2BNRD 4NQDE 5ANMA 4BFIA 4L8CB 1QRKA 6FABH 2EKSA 1MI5B 1BM3H 1S7VA 4YXKL 5I1EH 1OT2A 1HSAB 1U92B 1X5AA 3NIFF 3BP5B 4JY6B 5FDWA 1IVLA 2NZ9C 2R1XB 3MBEB 3N1MC 2FYYA 4HHAB 5C0IA 3C08H 3LN9A 3VFVA 4WU5B 6FABL 4GW1A 5LJYH 3HCVA 3ROLA 3RY5A 1BM3L 2IH1A 4YUEL 4MD5A 4EI5D 1YEFH 2VQTA 2ICWI 2CSPA 2F53E 4L29B 4NOFA 1AQKL 4FA8A 1GVIA 3TBYA 3S8WA 3HI1A 3KR3H 4RFEB 4J1UB 4HT1H 5DUBB 4LKXB 4FOMA 4MAYC 2FATL 2D7PA 3UJIL 2XWBA 4LCWB 1B0WA 4XC3L 3T4AB 1YEFL 3TH4T 3B3IA 1B4JH 1WAAA 3EGSB 3LV3A 2GJZA 1K9TA 4G9FA 2P45B 5ERWA 3V7AE 3GGWA 2NXYD 2FGZA 2BY2A 3P2TA 3WSQH 4LLVA 1BREA 1XR9A 3Q3GB 4IIQC 3T2PA 4WI4A 1ZVSB 5B8CC 3P30L 1KTDB 4AYFA 4Y1AB 3ARFA 2PN5A 4PLJC 3TBWB 4IDJL 5B4MC 3L5HA 3D2UD 1OL0A 4YX2H 4XBGB 1UXSA 3V6OC 3KJ6L 4AEFA 4ZXBC 4KVNH 4O2FB 3OKEA 5JHDA 3VRIB 2Z4QA 1OQOA 1PZ5B 1UACH 3K46A 1P7QD 2E7CA 1ZT1A 3CFEA 4FS0A 4I5BA 3RWDB 4LAQH 3JV6A 2V7HB 2ZSVB 4XH2B 4XBEL 4JRYD 2BCKA 4BM7A 1RZ7H 5EPMA 4P46D 5CWSB 4HWBH 2W92A 4H1LG 4NNYA 3MV8A 4HXAL 4YHPB 3LEXA 4LL9A 4LMQE 4ZPVB 1PZUB 3U7AA 4JHZA 2C9AA 1RUKL 3IFNL 5IOPA 3I6KA 1JNNL 3GJFH 3D0LB 2FDBP 5E8NA 3ZSSA 4YHKH 3RVXD 5J6GB 3DSFL 5HI4D 3MGOA 2F5AL 4QRPA 4HWBL 3SPVB 1NEUA 5L2JB 3VD7A 1JZ2A 5FYKU 1AD9A 5EUOF 5IG7B 1KC5H 2PO6A 1P7KB 2YD4A 1MHPH 4P99A 4PJCA 1MCCA 3SE4C 3T4YA 5GS0D 5E2TH 4ZFZA 4RGOL 5J3HD 2NY5L 4ALAH 2VERN 4TYUA 5CJQH 5DD0H 2IQAA 3OGCB 1P4IL 4X5XA 1U8MA 1L7TH 4RAUB 5DJ0A 4GRMA 3MRFB 4R7NB 2OTWA 4U1GB 5MEOA 4NFCA 3QNZB 5LBSH 5T1KA 2P1YA 3D39B 5CJXA 3QCUH 3EFDH 4NQVB 3O11A 4LPUA 3KPQA 5GZNC 2VXUH 3FOLA 1F3JA 5CJQL 1AFVL 1IGJA 4JCMA 5H35A 1XF2A 1DR9A 5JPNA 2A6JA 2DTMH 1HYSD 1L7TL 1H8SA 2PXYB 1QSFD 4XZUA 3QYCA 1ZLUK 1RZFH 1I9RH 3RNQB 4N90D 4JFFB 2ATKB 4JQIH 4M6AA 2IQ9H 3WIIH 4FNLH 3L95B 4WJ5A 2YS4A 3HE6A 4CNIB 3SDDC 1W0WA 4PJIE 3U9PH 5GZOD 4CMHB 3CFKA 1MIMH 3ARYA 3PGFL 3DV6A 3P0VH 3X11A 3RWCA 4YPGB 3OJDB 5EOTB 4EUPG 1DQQA 1P2CB 1KT2A 1Y0LB 3S3PA 3MYZA 3T8XA 3ZKMC 3CH8A 1DDHA 1IBGL 3DO3A 1X5FA 3GBMH 4BZ1H 4GKZB 4P57A 4HAFA 5I75C 3U9PL 1S8DB 5IBTL 3B2VL 3IAPA 2JLLA 1RJLB 2AI0L 3O4LD 1NAKH 3ARGD 1ODAA 1HWGB 3T2QA 5I8OH 4YHMH 4PGBB 5JOPE 1HKFA 3BEWA 3N9GL 2A6IA 4N1HB 3CD4A 1YYML 4U6TA 3STLA 1NQBA 3I6LE 5CIPA 2NY2D 5F7NC 5CBEB 4ZSOE 3RZCA 4U0QB 1EEZB 1HI6A 3L3HB 1BOGA 1NAKL 4WWKC 2GY5A 5F7YC 2ED9A 5I1GH 3TJEH 1SVCP 1BGXH 5AUMA 1R3KA 4MJIB 3F6IA 5MEPB 4UIKL 2OL3H 3ZT7A 5IVXA 2H26A 2EC8A 2DM3A 4G8FB 3T1WA 1S9WA 1KLGB 4M1CC 5F88A 3BPLC 5HDQL 5HHXH 1OSPH 3MCKA 2I60H 4JAMA 4EUPB 2VZOA 1T6WA 1ZHLB 3HPJB 3MLSH 1MVUA 3U0PA 3U0TA 3TJEL 1NBQA 3WE6A 1BGXL 2YC1A 4WDIB 5T3ZL 1ZLWH 2ZUSA 3PQYD 1CGVA 1I9IH 3CCHB 4IEFB 4NKOB 3TNNA 5DD6B 3N1PC 2NY0C 5LWYL 3QO0A 1DUYB 3U36B 3AREC 2GJ6B 4ZYKA 1FL3B 1QFWI 4PGZA 1KPRA 1BQLL 2GT9B 1U8IA 4G3YL 4HPYH 4JFDB 3KPMA 2ICEA 4JDZA 4NNPH 3BEVA 4RWHA 3E6FA 5F7UA 5BO1L 3DMMA 4YDVA 3SE8L 3P4LA 4MVBC 2NYYC 5FM5M 5FO8B 1RZIB 4FHBD 4WFED 2CKBL 2LABA 4MNQB 2FLBT 3QRGH 5E4IA 2L4OA 2LV4A 5D7LE 4HPYL 2QL1A 3MMEA 3WHXA 4NNPL 1NCCH 4DFIA 1HILA 3PHSA 4M5YH 4LCIH 4ZFOL 4PJ7F 5JW4Q 2H2PD 5IKCB 1EZVX 2OK0H 2X2YA 4PJ7B 5D1ZD 4I0PA 3U7YL 4HCRL 1H9VA 3JXAA 1EHNA 3MJ8A 1ZT7B 1CD0A 3OZ9L 5E2UH 2EEDA 2KH2B 1H15B 1HQRA 1UFUA 5TE4L 3IXTA 4FMKA 4LSSL 4EIZC 5D5ME 2AXGA 5I1HL 4LCIL 3FB5A 4WFHE 4NZTH 3VFSA 1CZ8H 4D3CH 1BQSA 3I02A 3BWAA 2V17H 3PWJB 5GJSH 1ZT4B 3OAZK 5HGBB 1ZLSH 4RAHA 3K2UL 1KELH 5E2UL 5I73B 4EXPX 1PY4A 3FFCB 3W9DB 4ODTL 5CEXA 3K3QA 3L3KB 2EC9T 2ZKHH 3OXSB 2AJZA 4HBQA 4HX1A 5GJSL 1HH9B 3BVNB 4HBCL 1J8HB 1FIEA 1ZLSL 3B8YA 2ITDA 3MROB 3W0WA 4PJBE 2I27N 2O5XH 5GXBB 3TN0A 5L2KE 4JRXA 4HUUB 1C5CL 4XWOD 2GCYA 1UH4A 4Z7WA 2EEBA 2ZKHL 2F74A 4XCFH 5JIHA 1J0HA 4JDTH 4AIZB 3DGCR 2Q86B 3QIBC 3OAUL 5D7KE 4FQJL 2ESVB 3KPRA 3UJJH 1CIDA 3GBNH 3P9LA 4KQ4H 1SEBA 4BK4A 2IFGA 3UJTH 4UV4L 1EAPB 3ZE1F 3UTTD 4NCDA 4JDTL 5FA4B 4RMVA 4G6KH 3TM6A 5HPMB 2ZOLB 3V7MA 1U8PB 2HMID 4MXWH 1N6VA 5C3TA 5EU4A 5L6YL 3VFGH 1KJ3H 3UJTL 1A3RH 4LSTL 3IVKB 2JELH 5KSUA 3B5GA 5BS0B 1KUMA 3H9YA 1ZA3B 5SWQB 3LB6D 5EORH 1FL5A 1QFOA 2QSQA 1JPGA 4XAWH 4R0LC 4XVSL 2FGWH 4M5ZH 4YBQC 3L6FB 2YK1H 4J8RA 4L9LB 1MLBB 4LNRA 3QHTC 2HFTA 5KG9A 4YHNB 2WWKO 3C8KA 1MAML 2JIXB 3MOAL 2PW2A 1JIBA 1YYLL 4LHUG 3B2UC 4GQ9L 5I0ZA 2FIKB 4L3ED 1FAIH 3CZJA 2XXMB 5DEGB 4Z7QE 3HE7C 2YK1L 4HIXH 3C5SB 1OTUC 5HYFA 1CLOL 1Y18B 3TF7C 3RUGE 4QOKA 3NZ8A 3ZKND 4G7YH 5DJ6B 4P2QD 5C7XL 1QSVA 5GS1B 4IRZH 1LE5A 1CICC 4OCRH 5IROC 2Y1VA 1I3RB 4RFOH 1XIWA 3AB0C 2VUOA 3TA3D 3DX9A 2BY0A 5EZOH 3DX7A 4UNTA 5TJWK 1INQA 3BW9B 4BQ6A 2RFXB 5EZJA 5E9DD 2JTDA 3JWOC 1X5JA 5EC2B 4WUKH 1T5XB 4LF3A 1TXKA 1U8NB 3WN5C 3CAFA 1YJDL 1IEBA 1UJ3A 1VESA 1OTSC 3S88L 5E6IC 5EUOE 4IRZL 5IFAL 2XN9D 4Y2OA 5JUEL 5J1TC 4Y4KC 1G9NH 3F7YA 4HUXB 4N0UE 5BCAA 4N9GB 1YC7A 2ED8A 3PWNA 2DQUL 3RWEB 5FO7B 4HWNA 4W6XB 4WUKL 1LO4L 1Q9KB 3QA3B 4P23D 1K8IA 5JQ6L 3L1OL 4JB9H 2GTWA 1X4XA 5D1QD 3VWKD 5IJVB 4Y5XB 2E7BA 1UA6L 4JM2A 4MNGA 1FPTH 2EDNA 3BKYL 1KYOK 1MCFA 4JN2B 1KB5B 3T1FA 3G04A 3UXFA 1KJVA 3LD8C 1IT9L 5GRZA 1MRFH 2Z92A 4ODWA 5F7WC 5AZ2H 5IF0B 1H3TA 5HHPB 5D7JA 4ORZC 4POUB 5DJDA 3IETA 1I85C 2C4FT 4OF5A 4HIJA 3AC0A 1SM3L 5DJ8A 4H88L 5BXFA 3VW3L 3BRFA 3FO2B 3OB8A 1GSMA 4OZIE 4XNXL 1Q1JH 1K3IA 1KJMB 1OWWA 2EXYD 2BSRB 2BHUA 3PIQA 5F9JB 4W70A 4K07A 4C56D 2DTSA 4V1DD 2VLJE 3H0TA 5CJBA 3SE9L 3I2CH 2ZNXA 4PJ5B 4PRHD 4FP8H 4NUGH 4K7PY 3VWJD 3QFDB 4KKLD 1JF6A 3QEQB 4GUPB 1MF2H 4KMLB 2HN7A 5C0AE 3EYUL 1W8OA 4PRNB 2JCCF 4I77L 3N1GC 2D3VA 4N68A 3HUJA 3QDGE 5EUKA 2JCCB 2CMRL 1N4XH 1OSZB 3CFJB 1W0VA 1A1MB 1ROWA 2BVOA 3FHQA 3MRRB 1N2RA 4M7KH 3RVWD 4FP8L 5ETUB 2NNAB 3SKNA 2R8SH 1TVBB 1XCTA 4YDKH 1I9JH 1N8ZB 3VFUA 3H9SD 4YR6A 4PRIB 4CMMA 4KJWD 3R06A 4OQTA 1MF2L 1GHFH 2F19H 4X7FC 3RGVA 3X13A 3ILPA 5KW9L 4XCEA 3FQNA 3O6KL 1PFCA 3HC4L 4XPTL 3RIFF 1CFSA 3FT3B 1FL6A 5E2VL 4GS7B 1A5FH 2AEPL 3VXOB 1L7IH 2BFVH 3NOIA 4MWFA 1QNZL 5ESVB 3EO9H 3BWUC 5IB5A 4YJZL 1BHGA 4O4YL 3B9AA 4YDJA 5H37H 1GGYA 1RVFH 3BZFB 3RWJA 2C3WA 5J89A 1B9ZA 4PJAA 4JY4B 4Q0XL 4HUMB 2PTTB 5FEBA 3AGVA 4RWYL 3BHBB 2IANE 4JFPB 3SGJC 3RJQB 5EBMA 1JZ5A 2HFEB 3QEUB 5DZNA 5I19H 4XXDA 5ITBL 1FZOA