2EO2A

Solution structure of the insertion region (510-573) of fthfs domain from mouse methylenetetrahydrofolate dehydrogenase (nadp+ dependent) 1-like protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
71
structure length
71
Chain Sequence
GSSGSSGSTQTDKALYNRLVPLVNGVREFSEIQLSRLKKLGIHKTDPSTLTEEEVRKFARLNIDPATITWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adult male hypothalamus cDNA, RIKEN full-length enriched lib
publication title Solution structure of the insertion region (510-573) of FTHFS domain from mouse methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like protein
rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 7
structure length 71
sequence length 71
ec nomenclature ec 6.3.4.3: Formate--tetrahydrofolate ligase.
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.770 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2eo2A00
2EO2A
chains in the Genus database with same CATH superfamily
2R18A 4LF7M 4B3TM 2DAEA 4MGIE 2XZFA 2XEPA 3CF2A 1ZMUA 4GC5A 1C1KA 2HWJA 3L28A 3KDSE 3MMPA 4DR5M 1NY6A 1IBLM 3FTEA 3GLGB 5EXTA 5ITYA 4G4NA 1G71A 2VQFM 2EUCA 2HHHM 3IHPA 4LF5M 2XZUA 2KRUA 3GRVA 2JZ1A 1IXSB 4XBOA 3IECA 1L8QA 4WURA 4JXJA 1H6UA 3KW6A 4QOSA 4NRWA 1QQWA 1DGHA 3IG8A 5ITUA 3KOWE 1NSFA 4PT5A 4JN6A 2K47A 4NSRA 3VFDA 2EO2A 3GP1A 2QENA 3U6LA 2E5LM 2LBCA 2O01F 4B3SM 2Y20A 3SAUA 2F5NA 1XXHB 2CHQA 1NNUC 3SBJA 2L7IA 2DHRA 2GNOA 2LHGA 1E32A 4MGZE 3VDUA 1PJTA 1SXJE 2JUJA 2UXCM 1E9RA 1Z5BA 5KQDA 1TF0B 3GPPA 2G3QA 3ILKA 2KA6B 3FRIA 2JY8A 4M0DA 4P17A 2C5RA 1IBKM 3VKHA 2CE7A 3ZQJA 2MR9A 4ANRA 2HL7A 4GKJM 3HKPA 4KT0F 3T38A 1QAOA 1X37A 3HX3A 5EP1A 4I8OA 3I4VA 5DFLA 1HR0M 4AQYM 4JI0M 1TDHA 3MJ5A 3E4RA 1KSFX 1EFUB 2Z8YM 4X65M 1R2ZA 5FTKA 3SYKA 1A5TA 1XWIA 4IBGA 4LZZA 3UJNA 3KVWA 4OW0A 2Z3XA 2F5SA 2HAKA 8CATA 3VLFB 4MGYE 1QVRA 4GH9A 3LCVB 2R4EA 1CUKA 4IBIA 3FUUA 3HHXA 5L8RF 3LQRA 1IXZA 3DZDA 3M7GA 4JI8M 4BB9A 1MX0A 2JWSA 3R9XB 1WJ7A 3QWLA 2CUZA 2R4JA 4IBCA 4PD2A 3W68A 2B3TA 1NHGC 3GLFB 4LRTA 1Z5CA 2KHHA 3J27B 3LCUA 4B7HA 2D7GA 3TL4X 2J5YA 4DV7M 4DR7M 2DAKA 1TR8A 3B74A 4YY3M 4JI5M 2XF3A 3J81S 1VDDA 2JY5A 2J7OA 1GL6A 5EP4A 1I94M 1LTMA 4QNRA 2V1CA 4B08A 2OOBA 4AKHA 4DR6M 3D8LA 1RU3A 2M5ZA 3SMPA 2JZ0A 4RKUF 3SMSA 3UMMA 1XC8A 2MJ5B 1MN3A 5DYIA 4X66M 1IY0A 4D82A 1ZV1A 1KYIA 4LJ5A 1NV8A 4AG6A 3GLIE 3D8BA 2WSFF 4M9ZA 4B7GA 3GLHE 1DGBA 1NHWC 1Q3CA 2LWXA 5IWAM 4JYAM 4OVZB 2UXBM 4FCTA 3AOGA 4CISA 2LHCA 3PNVA 3UGJA 4DV3M 4PDGA 1PJIA 2L09A 4DR2M 1ZAEA 2KXEA 2BNKA 1HT2E 3OTOM 5IZ7D 3RE8A 5KPTA 2FFJA 3T6PA 4G4QA 4FW9A 3VK7A 4I4LA 1TH2A 3CF0A 2KNAA 2H1RA 4DR4M 1JR3E 1IY2A 3FE3A 3GLIA 4AW4A 1W5TA 1UM8A 3GLHA 1GLNA 3DFZA 4LFCM 3VK8A 2UXDM 4OX9M 1NO1A 2DWZB 5FSWA 1MU5A 4LJ6A 2A5YB 2C99A 3A42A 2JA2A 2JY7A 2L4FA 4RF1A 3B7QA 4D80A 4PDIA 5KO3A 1SG9A 3LQQA 1WIVA 2DZOB 3U6EA 3J7BA 2CHGA 2CRUA 1DGHB 1GVNA 2RGOA 3GPUA 2ERCA 1JR3A 3KS8A 1G3IA 1AUAA 4G4OA 2R44A 1WXQA 1EE8A 2DZNB 4Y28F 4JI4M 4AI6A 1L1TA 3FUWA 2ZBKB 3L26A 1OFHA 2L6OA 2C9OA 3AOEA 1T43A 4LZJA 3KSJA 2G5GX 2LVAA 3NWLA 2CV2A 4GIPA 1C7YA 1WGLA 3E46A 3HJSA 1N32M 3U6DA 1Q3BA 2QZ4A 3TE6A 4FCWA 4ZPXA 4CGYB 3IG5A 4DUYM 4UN2B 2V1UA 4Q7JA 4JV5M 1J09A 1G59A 2KZSA 2EJSA 3B9PA 2CWBA 2DAMA 2EKFA 2R65A 1JR3D 1OTRA 4LFAM 3T15A 3FYCA 4G4RA 4LRSA 3U60B 1GO5A 3T1YM 1DGFA 1I4WA 1YSYA 3LVWA 1D2NA 4CJ6A 1KFVA 3SARA 1SXJB 2DENA 3MHVC 3PVSA 4BLCA 3ZCBB 3CGWA 4MM3B 2LXEA 3M0EA 2M60A 4IBKA 3TWLA 2UUCM 3HU1A 1V33A 3I4YA 2MROB 4B3MM 4L78A 3K1JA 4I5SA 4DV1M 1OFIA 4LJ8A 4JI7M 1OAIA 4AZFA 1N34M 5KPRA 5KPZA 1L2CA 2QBYB 5LMUM 1J7KA 4LF4M 1V34A 2DHYA 5BPVA 3U5ZA 2DNAA 1QYRA 4JI6M 2LH0A 3GQ5A 4B7FA 1L1ZA 2AHMA 3A98B 2OO9A 3NBXX 5EJCA 1L2BA 1NV9A 2KEBA 3B7ZA 4LJAA 4IBDA 4LGMA 3SAVA 1K3XA 3JR4A 3U6OA 1XNQM 5FTLA 1GKIA 3K9PA 1QANA 3FD9A 2QHOB 3NBIA 4AG5A 4F1IA 5BR8M 1JB0F 3U6MA 1J5EM 1EIJA 3BBZA 1HQYE 1ZMVA 2D7HA 4LG2A 2LVNC 1GL7A 1W5SA 3FTFA 2OOAA 4L6V6 1HJPA 2CFOA 3GRUA 1FNNA 2XFTA 3V76A 4L8RC 2ZAOA 1E94E 2WSEF 4R7GA 4LF6M 4M9SA 2JXNA 4LJ4A 3E21A 2BJVA 4MGHA 1VEGA 2MH8A 3F92A 5DNYA 4X62M 1Q39A 2C9CA 1ORYB 5FTMA 1SXJC 4NSOB 3L25A 3KOYE 1QZMA 5E26A 4X64M 2MGWA 4L4UA 3LW5F 4K0KM 4DV6M 1GABA 4M0WA 4CHTB 1OJLA 2RRUA 1Y8GA 2APLA 3BOSA 3U6QA 1OAOC 1YE9A 1DGGA 3Q8XA 1PJQA 2K0BX 4XGIA 3HHYA 3UZUA 3HGIA 1Z6TA 3GPYA 4DV4M 5EXSA 3GLIB 5IT9S 4RF0A 4GHLA 1F4IA 3GLHB 2L4EA 5IREB 2ZM6M 2VQEM 3RGPA 1IN4A 5A2QS 4LF9M 5EP2A 2FS1A 2YQZA 1YLAA 3GRYA 3H4JA 3H4MA 3BXWA 3M6AA 3U6SA 2EKKA 2X8AA 1DO2A 4B3RM 1V92A 4GITA 1TGUA 2R45A 4NXMM 2LVPC 1E9SA 3WHLA 1T6OA 7CATA 4EIWA 3W0FA 4GMQA 5FTNA 3GO8A 1R4GA 2NQ8C 1Q02A 3L2AA 4HL4A 5E6JA 2LVQD 3SYLA 2XLJA 3SFZA 3GRRA 2UU9M 1N75A 1IY1A 4GC9A 5ITRA 1IFYA 1BVSA 2Z7JA 3WHKA 3GLFA 3FYDA 2L7HA 2ZTCA 4NC6A 4A3VB 3AV0A 4RNAA 2YR0A 4NXNM 4Z6YA 2R46A 3LMMA 1NJFA 2F5PA 1VG5A 2XSZA 2Y21A 1G8PA 1IXRC 1XMQM 3K9OA 1DO0A 2K6BA 4FD2A 3W0LB 1PJSA 2FOIC 2RGHA 2Y0QA 3HZJA 4L15A 1Z59A 3FTCA 4XK8F 3W67A 4DBGB 2R62A 4IJFA 4MH0E 4NRVA 2CP8A 4IIWA 4HEOA 5ITXE 2YNMD 3I51A 4REZA 4OVZA 4Z8XA 3HJQA 4G3OA 4GRIA 3T1HM 1QDTA 1S3SA 3PFIA 3AFHA 1OQYA 1NJGA 1QZEA 1ZQ9A 2R6FA 3I01M 4FCVA 1L2DA 4PCZA 1MJGM 3AKZA 4NL4H 2UUAM 2BWEA 2X4AA 3EIHA 3CF6E 2K9DA 2XSZD 1N77A 3U5ZB 3KOXE 1LV7A 2QNJA 2KRKA 3U6PA 5ITXA 2CEAA 5FTJA 2GQFA 5EP3A 3PXGA 3AOEC 3KFUG 1GJSA 1G41A 4R71A 4MB7A 4CIZA 2QCUA 2QQ8A 2VDBB 3FTDA 3PNYA 4P16A 4DV5M 2Y0TA 3FUVA 3HU2A 1TDZA 1XNRM 1G4AE 2BJWA 4II7A 4R3DA 3B89A 2QPAA 3GLGE 3HWSA 4IBFA 3ZH9B 1R5LA 3C3DA 2EA0A 4FWHA 1R2YA 4KO8A 4IBEA 4LGYA 1WHCA 2VIIA 3L29A 1IN5A 1IN6A 1OKSA 3QYEA 3U61A 3J80S 5F3WA 4NOOB 2C96A 1WR1B 4QHSA 1K82A 4DUZM 5DYGA 2F5OA 3KXEC 1UFZA 5EXPA 2VF8A 4M9XA 4OU7A 1XMOM 2QP9X 1XXHE 2C98A 5C18A 4DR1M 1DV0A 3SHFA 1T3TA 4JI3M 3DOAA 3VDPA 3C3EA 5LMNM 1QUSA 3GLGA 3CTWB 2N35A 3C58A 2DAGA 3K2LA 5EXXA 4DV2M 1FJGM 3HU3A 2DAIA 2J7NA 5FLXS 4IJEA 1IXSA 2OQ4A 2ZTDA 2LTUA 4KHPM 4L16A 4F2LA 4HLQA 1D0LA 4LY6A 2O25A 3HY5A 4AKIA 2DKLA 2DZLA 1HQCA 3FUXA 2G8LA 3ZC7B 1Z5AA 2CV0A 4JI1M 3J7AS 4GHAA 3SC3A 1VEKA 3JR5A 4GEWA 3U60A 4GKKM 2VF7A 1XXHA 4LJ9A 2Z4SA 1SXJA 2LNHC 1TTEA 2I7PA 2KNVA 5JI2E 3AJIB 2L2DA 3SAWA 3KSXA 1HNZM 3FUTA 2QSFX 3SATA 3SASA 3TPZA 4LFBM 2D7EA 2ZANA 3A46A 2HCBA 1XB2B 1P3QQ 5H37D 5C1BA 3AL0C 2DWMA 3JAMS 3QAUA 5GKNA 2R0IA 2JP7A 4IBJA 3TWMA 4JI2M 1K3WA 2QBYA 3RFWA 1NY5A 4QHTA 4KODA 2FNAA 4WP2A 2FE8A 3KOZE 3Q8GA 3EIEA 4KLNA 1PM5A 4D81A 1GJTA 4WW0A 5EQTA 3FRHA 3J2PB 3SHGB 4LF8M 4AKGA 1IN7A 1HT1E 2OPFA 3GLFE 4LJ7A 1D0KA 3KP0E 1SXJD 1IBMM 3RGSA 2DWLA 3HHZA 1PRBA 2HKJA 1N33M 2O5RA 5ITQA 3MK6A 2DWNA 4QOZC 4ITQA 4S12A 3TWKA 4DV0M 1AIPC 2KW0A 1ZMWA 2I7NA 2BWBA 3K92A 2ZAMA 3E9SA 3LVVA 2P5TA 2F4VM 1IM2A 2JNHA 3DA1A 3KS4A 2KDLA 2V6ZM 4MGKE 4FWGA 3GPXA 2CV1A 3FKEA 1R7RA 1WGNA 1N36M 1IQPA 1QAMA 4QNMA 2RKOA 1NVMA 1NNJA 4FVMA 3KP1E 1QDRA 1OIZA 1QUTA 1PJJA 1OIPA 4TUWA 2W82A 2F5QA 3TQSA 3C9PA 3A45A 2UUBM 1VEJA 1YUBA 2WZJA 2XGNA 4IBBA 2X49A 2Z4RA 4W5WA 3HHWA 1TH4A 2DI0A 3GQ4A 1TH3A 1IN8A 1R6BX 1D0MA 3UK6A 3K8ZA 3THGA 4YHHM 1HNXM 2H5XA 3QYBA 4LCBA 3B7NA 3R8FA 3U6CA 3I04M 4BBAA 2KNZA 2JY6B 3VKGA 4DR3M 1QAQA 5ITTA 2XH9A 1XHBA 2DVWB 1N78A 4I81A 5KQ8A 2CHVA 2KZUA 4FWDA 2LVOC 2Q2EB 3L27A 3GQ3A 4G6ZA 3HJ8A 2DXIA 2WSCF 1HNWM 1PGYA 2YFQA 2FH0A 3U61B 5JI3E 1VDLA 1JQJC 1VQ1A 2XFSA
chains in the Genus database with same CATH topology
2R18A 4LF7M 4B3TM 4MGIE 2XZFA 3CF2A 4GC5A 1C1KA 3L28A 3KDSE 4DR5M 1NY6A 1IBLM 3FTEA 3GLGB 5EXTA 5ITYA 4G4NA 2VQFM 2HHHM 2EUCA 4LF5M 2XZUA 2KRUA 3GRVA 1IXSB 4XBOA 1L8QA 4WURA 4JXJA 1H6UA 3KW6A 4QOSA 4NRWA 1QQWA 1DGHA 3IG8A 5ITUA 3KOWE 1NSFA 4PT5A 4JN6A 2K47A 4NSRA 3GP1A 2EO2A 3U6LA 2QENA 2E5LM 4B3SM 2Y20A 3SAUA 2F5NA 1XXHB 2CHQA 1NNUC 3SBJA 2L7IA 2DHRA 1E32A 4MGZE 3VDUA 1SXJE 2UXCM 1E9RA 1Z5BA 5KQDA 3GPPA 3ILKA 2KA6B 4M0DA 2C5RA 1IBKM 3VKHA 2CE7A 2HL7A 4GKJM 3HKPA 3T38A 1QAOA 1X37A 5EP1A 4I8OA 3I4VA 1HR0M 4AQYM 4JI0M 1TDHA 3MJ5A 3E4RA 1KSFX 4X65M 1R2ZA 5FTKA 3SYKA 1XWIA 4IBGA 4LZZA 3UJNA 2Z3XA 3KVWA 4OW0A 2F5SA 8CATA 3VLFB 4MGYE 1QVRA 4GH9A 2R4EA 4IBIA 3FUUA 3HHXA 3LQRA 1IXZA 3DZDA 3M7GA 4JI8M 4BB9A 1MX0A 3R9XB 3QWLA 2CUZA 2R4JA 4IBCA 4PD2A 1NHGC 3GLFB 4LRTA 1Z5CA 3J27B 4B7HA 2D7GA 3TL4X 4DV7M 4DR7M 4YY3M 4JI5M 2XF3A 3J81S 1VDDA 2J7OA 1GL6A 5EP4A 1I94M 4QNRA 2V1CA 4B08A 4AKHA 4DR6M 3D8LA 2M5ZA 3SMPA 3SMSA 3UMMA 1XC8A 4X66M 5DYIA 1IY0A 4D82A 4LJ5A 1KYIA 4AG6A 3D8BA 4M9ZA 4B7GA 1DGBA 1NHWC 1Q3CA 2LWXA 5IWAM 4JYAM 4OVZB 2UXBM 4FCTA 3AOGA 4CISA 3PNVA 3UGJA 4DV3M 4PDGA 1PJIA 2L09A 4DR2M 1ZAEA 2KXEA 2BNKA 1HT2E 3OTOM 5IZ7D 3RE8A 5KPTA 2FFJA 4G4QA 4FW9A 3VK7A 4I4LA 1TH2A 3CF0A 2H1RA 4DR4M 1IY2A 3GLIA 4AW4A 1W5TA 1UM8A 3GLHA 1GLNA 3DFZA 4LFCM 3VK8A 2UXDM 4OX9M 2DWZB 5FSWA 1MU5A 4LJ6A 2A5YB 2C99A 3A42A 2JA2A 4PDIA 4RF1A 4D80A 5KO3A 3LQQA 3U6EA 2DZOB 3J7BA 2CHGA 1DGHB 1GVNA 2RGOA 3GPUA 2ERCA 1JR3A 3KS8A 1G3IA 4G4OA 1WXQA 1EE8A 2DZNB 4JI4M 4AI6A 1L1TA 3FUWA 2ZBKB 3L26A 1OFHA 2L6OA 2C9OA 3AOEA 4LZJA 3KSJA 2G5GX 3NWLA 2CV2A 4GIPA 3HJSA 1N32M 3U6DA 1Q3BA 2QZ4A 3TE6A 4FCWA 4ZPXA 4CGYB 3IG5A 4DUYM 2V1UA 4JV5M 1J09A 1G59A 2KZSA 3B9PA 2R65A 1JR3D 4LFAM 3T15A 3FYCA 4G4RA 4LRSA 3U60B 3T1YM 1DGFA 1I4WA 1YSYA 3LVWA 1D2NA 1KFVA 3SARA 1SXJB 3MHVC 3PVSA 4BLCA 3ZCBB 4MM3B 2LXEA 3M0EA 2M60A 4IBKA 3TWLA 2UUCM 3HU1A 3I4YA 4B3MM 4L78A 3K1JA 4I5SA 4DV1M 1OFIA 4LJ8A 4JI7M 4AZFA 1N34M 5KPRA 5KPZA 1L2CA 2QBYB 5LMUM 1J7KA 4LF4M 5BPVA 3U5ZA 1QYRA 4JI6M 2LH0A 3GQ5A 4B7FA 1L1ZA 2AHMA 3A98B 5EJCA 1L2BA 2KEBA 4LJAA 1K3XA 4IBDA 4LGMA 3SAVA 3JR4A 3U6OA 1XNQM 5FTLA 1GKIA 4AG5A 1QANA 3FD9A 3NBIA 5BR8M 3U6MA 1J5EM 1HQYE 2D7HA 4LG2A 1GL7A 1W5SA 3FTFA 2CFOA 3GRUA 1FNNA 2XFTA 4L8RC 2ZAOA 1E94E 4R7GA 4LF6M 4M9SA 4LJ4A 2BJVA 4MGHA 4X62M 5DNYA 1Q39A 2C9CA 1ORYB 5FTMA 1SXJC 4NSOB 3L25A 3KOYE 1QZMA 5E26A 4X64M 4L4UA 4K0KM 4DV6M 4M0WA 4CHTB 1OJLA 3BOSA 3U6QA 1YE9A 1DGGA 3Q8XA 4XGIA 4DV4M 3HHYA 3UZUA 3HGIA 1Z6TA 3GPYA 5IT9S 5EXSA 3GLIB 4RF0A 4GHLA 3GLHB 5IREB 2ZM6M 2VQEM 3RGPA 1IN4A 5A2QS 4LF9M 5EP2A 2YQZA 3GRYA 3H4MA 3M6AA 3U6SA 2X8AA 1DO2A 4B3RM 4GITA 1TGUA 2R45A 4NXMM 1E9SA 3WHLA 7CATA 4EIWA 3W0FA 4GMQA 5FTNA 3GO8A 2NQ8C 3L2AA 4HL4A 5E6JA 3SYLA 2XLJA 3SFZA 3GRRA 2UU9M 1N75A 1IY1A 4GC9A 5ITRA 3GLFA 2Z7JA 3WHKA 3FYDA 2L7HA 4A3VB 3AV0A 4RNAA 2YR0A 4NXNM 4Z6YA 2R46A 3LMMA 1NJFA 2F5PA 2XSZA 2Y21A 1G8PA 1IXRC 1XMQM 1DO0A 4FD2A 3W0LB 2FOIC 2Y0QA 2RGHA 4L15A 1Z59A 3FTCA 2R62A 4IJFA 4MH0E 4NRVA 4IIWA 5ITXE 2YNMD 3I51A 4REZA 4OVZA 4Z8XA 3HJQA 4GRIA 3T1HM 1S3SA 3PFIA 3AFHA 1NJGA 1ZQ9A 4FCVA 1L2DA 4PCZA 3AKZA 4NL4H 2UUAM 2X4AA 3EIHA 3CF6E 2XSZD 1N77A 3U5ZB 3KOXE 1LV7A 2KRKA 3U6PA 5ITXA 2CEAA 5FTJA 3PXGA 5EP3A 3KFUG 3AOEC 1G41A 4MB7A 2QCUA 3PNYA 3FTDA 4P16A 4DV5M 2Y0TA 3FUVA 3HU2A 1TDZA 1XNRM 1G4AE 2BJWA 4II7A 4R3DA 2QPAA 3HWSA 4IBFA 3ZH9B 1R2YA 2EA0A 4FWHA 4KO8A 4IBEA 4LGYA 2VIIA 3L29A 1IN5A 1IN6A 3U61A 3J80S 5F3WA 4NOOB 2C96A 4QHSA 1K82A 4DUZM 5DYGA 2F5OA 3KXEC 5EXPA 4M9XA 4OU7A 1XMOM 2QP9X 2C98A 5C18A 4DR1M 3SHFA 1T3TA 4JI3M 3DOAA 3VDPA 5LMNM 3GLGA 3CTWB 3C58A 3K2LA 5EXXA 4DV2M 1FJGM 3HU3A 2J7NA 5FLXS 4IJEA 2OQ4A 4KHPM 4L16A 4HLQA 4LY6A 4AKIA 1HQCA 3FUXA 2G8LA 3ZC7B 1Z5AA 2CV0A 4JI1M 3J7AS 4GHAA 3SC3A 3JR5A 3U60A 4GKKM 1XXHA 4LJ9A 2Z4SA 1SXJA 2LNHC 2I7PA 5JI2E 3AJIB 3SAWA 3SATA 3KSXA 1HNZM 3FUTA 3SASA 3TPZA 4LFBM 2D7EA 2ZANA 3A46A 2HCBA 5H37D 5C1BA 3AL0C 2DWMA 3JAMS 3QAUA 5GKNA 4IBJA 3TWMA 4JI2M 1K3WA 2QBYA 3RFWA 1NY5A 4QHTA 4KODA 2FNAA 2FE8A 3KOZE 4KLNA 3EIEA 1PM5A 4D81A 4WW0A 5EQTA 3J2PB 3SHGB 4LF8M 4AKGA 1IN7A 1HT1E 2OPFA 4LJ7A 3KP0E 1SXJD 1IBMM 3RGSA 2DWLA 3HHZA 2HKJA 1N33M 2O5RA 5ITQA 3MK6A 2DWNA 4QOZC 4ITQA 4S12A 3TWKA 4DV0M 2KW0A 2I7NA 3K92A 2ZAMA 3E9SA 3LVVA 2P5TA 2F4VM 1IM2A 3DA1A 3KS4A 2V6ZM 4MGKE 4FWGA 3GPXA 2CV1A 3FKEA 1R7RA 1N36M 1IQPA 1QAMA 4QNMA 2RKOA 1NVMA 1NNJA 4FVMA 3KP1E 1PJJA 4TUWA 2W82A 2F5QA 3TQSA 3A45A 2UUBM 1YUBA 2XGNA 4IBBA 2X49A 2Z4RA 4W5WA 3HHWA 1TH4A 3GQ4A 1TH3A 1IN8A 1R6BX 3UK6A 3K8ZA 3THGA 4YHHM 1HNXM 4LCBA 3R8FA 3U6CA 4BBAA 3VKGA 4DR3M 1QAQA 5ITTA 2XH9A 1XHBA 2DVWB 1N78A 4I81A 5KQ8A 2CHVA 2KZUA 4FWDA 2Q2EB 3L27A 3GQ3A 4G6ZA 3HJ8A 2DXIA 1HNWM 2YFQA 3U61B 5JI3E 2XEPA 1JQJC 3VFDA 2XFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EO2 A; 
#chains in the Genus database with same CATH topology
 2R18 A;  4LF7 M;  4B3T M;  2DAE A;  4MGI E;  2XZF A;  2XEP A;  3CF2 A;  1ZMU A;  4GC5 A;  1C1K A;  2HWJ A;  3L28 A;  3KDS E;  3MMP A;  4DR5 M;  1NY6 A;  1IBL M;  3FTE A;  3GLG B;  5EXT A;  5ITY A;  4G4N A;  1G71 A;  2VQF M;  2EUC A;  2HHH M;  3IHP A;  4LF5 M;  2XZU A;  2KRU A;  3GRV A;  2JZ1 A;  1IXS B;  4XBO A;  3IEC A;  1L8Q A;  4WUR A;  4JXJ A;  1H6U A;  3KW6 A;  4QOS A;  4NRW A;  1QQW A;  1DGH A;  3IG8 A;  5ITU A;  3KOW E;  1NSF A;  4PT5 A;  4JN6 A;  2K47 A;  4NSR A;  3VFD A;  2EO2 A;  3GP1 A;  2QEN A;  3U6L A;  2E5L M;  2LBC A;  2O01 F;  4B3S M;  2Y20 A;  3SAU A;  2F5N A;  1XXH B;  2CHQ A;  1NNU C;  3SBJ A;  2L7I A;  2DHR A;  2GNO A;  2LHG A;  1E32 A;  4MGZ E;  3VDU A;  1PJT A;  1SXJ E;  2JUJ A;  2UXC M;  1E9R A;  1Z5B A;  5KQD A;  1TF0 B;  3GPP A;  2G3Q A;  3ILK A;  2KA6 B;  3FRI A;  2JY8 A;  4M0D A;  4P17 A;  2C5R A;  1IBK M;  3VKH A;  2CE7 A;  3ZQJ A;  2MR9 A;  4ANR A;  2HL7 A;  4GKJ M;  3HKP A;  4KT0 F;  3T38 A;  1QAO A;  1X37 A;  3HX3 A;  5EP1 A;  4I8O A;  3I4V A;  5DFL A;  1HR0 M;  4AQY M;  4JI0 M;  1TDH A;  3MJ5 A;  3E4R A;  1KSF X;  1EFU B;  2Z8Y M;  4X65 M;  1R2Z A;  5FTK A;  3SYK A;  1A5T A;  1XWI A;  4IBG A;  4LZZ A;  3UJN A;  3KVW A;  4OW0 A;  2Z3X A;  2F5S A;  2HAK A;  8CAT A;  3VLF B;  4MGY E;  1QVR A;  4GH9 A;  3LCV B;  2R4E A;  1CUK A;  4IBI A;  3FUU A;  3HHX A;  5L8R F;  3LQR A;  1IXZ A;  3DZD A;  3M7G A;  4JI8 M;  4BB9 A;  1MX0 A;  2JWS A;  3R9X B;  1WJ7 A;  3QWL A;  2CUZ A;  2R4J A;  4IBC A;  4PD2 A;  3W68 A;  2B3T A;  1NHG C;  3GLF B;  4LRT A;  1Z5C A;  2KHH A;  3J27 B;  3LCU A;  4B7H A;  2D7G A;  3TL4 X;  2J5Y A;  4DV7 M;  4DR7 M;  2DAK A;  1TR8 A;  3B74 A;  4YY3 M;  4JI5 M;  2XF3 A;  3J81 S;  1VDD A;  2JY5 A;  2J7O A;  1GL6 A;  5EP4 A;  1I94 M;  1LTM A;  4QNR A;  2V1C A;  4B08 A;  2OOB A;  4AKH A;  4DR6 M;  3D8L A;  1RU3 A;  2M5Z A;  3SMP A;  2JZ0 A;  4RKU F;  3SMS A;  3UMM A;  1XC8 A;  2MJ5 B;  1MN3 A;  5DYI A;  4X66 M;  1IY0 A;  4D82 A;  1ZV1 A;  1KYI A;  4LJ5 A;  1NV8 A;  4AG6 A;  3GLI E;  3D8B A;  2WSF F;  4M9Z A;  4B7G A;  3GLH E;  1DGB A;  1NHW C;  1Q3C A;  2LWX A;  5IWA M;  4JYA M;  4OVZ B;  2UXB M;  4FCT A;  3AOG A;  4CIS A;  2LHC A;  3PNV A;  3UGJ A;  4DV3 M;  4PDG A;  1PJI A;  2L09 A;  4DR2 M;  1ZAE A;  2KXE A;  2BNK A;  1HT2 E;  3OTO M;  5IZ7 D;  3RE8 A;  5KPT A;  2FFJ A;  3T6P A;  4G4Q A;  4FW9 A;  3VK7 A;  4I4L A;  1TH2 A;  3CF0 A;  2KNA A;  2H1R A;  4DR4 M;  1JR3 E;  1IY2 A;  3FE3 A;  3GLI A;  4AW4 A;  1W5T A;  1UM8 A;  3GLH A;  1GLN A;  3DFZ A;  4LFC M;  3VK8 A;  2UXD M;  4OX9 M;  1NO1 A;  2DWZ B;  5FSW A;  1MU5 A;  4LJ6 A;  2A5Y B;  2C99 A;  3A42 A;  2JA2 A;  2JY7 A;  2L4F A;  4RF1 A;  3B7Q A;  4D80 A;  4PDI A;  5KO3 A;  1SG9 A;  3LQQ A;  1WIV A;  2DZO B;  3U6E A;  3J7B A;  2CHG A;  2CRU A;  1DGH B;  1GVN A;  2RGO A;  3GPU A;  2ERC A;  1JR3 A;  3KS8 A;  1G3I A;  1AUA A;  4G4O A;  2R44 A;  1WXQ A;  1EE8 A;  2DZN B;  4Y28 F;  4JI4 M;  4AI6 A;  1L1T A;  3FUW A;  2ZBK B;  3L26 A;  1OFH A;  2L6O A;  2C9O A;  3AOE A;  1T43 A;  4LZJ A;  3KSJ A;  2G5G X;  2LVA A;  3NWL A;  2CV2 A;  4GIP A;  1C7Y A;  1WGL A;  3E46 A;  3HJS A;  1N32 M;  3U6D A;  1Q3B A;  2QZ4 A;  3TE6 A;  4FCW A;  4ZPX A;  4CGY B;  3IG5 A;  4DUY M;  4UN2 B;  2V1U A;  4Q7J A;  4JV5 M;  1J09 A;  1G59 A;  2KZS A;  2EJS A;  3B9P A;  2CWB A;  2DAM A;  2EKF A;  2R65 A;  1JR3 D;  1OTR A;  4LFA M;  3T15 A;  3FYC A;  4G4R A;  4LRS A;  3U60 B;  1GO5 A;  3T1Y M;  1DGF A;  1I4W A;  1YSY A;  3LVW A;  1D2N A;  4CJ6 A;  1KFV A;  3SAR A;  1SXJ B;  2DEN A;  3MHV C;  3PVS A;  4BLC A;  3ZCB B;  3CGW A;  4MM3 B;  2LXE A;  3M0E A;  2M60 A;  4IBK A;  3TWL A;  2UUC M;  3HU1 A;  1V33 A;  3I4Y A;  2MRO B;  4B3M M;  4L78 A;  3K1J A;  4I5S A;  4DV1 M;  1OFI A;  4LJ8 A;  4JI7 M;  1OAI A;  4AZF A;  1N34 M;  5KPR A;  5KPZ A;  1L2C A;  2QBY B;  5LMU M;  1J7K A;  4LF4 M;  1V34 A;  2DHY A;  5BPV A;  3U5Z A;  2DNA A;  1QYR A;  4JI6 M;  2LH0 A;  3GQ5 A;  4B7F A;  1L1Z A;  2AHM A;  3A98 B;  2OO9 A;  3NBX X;  5EJC A;  1L2B A;  1NV9 A;  2KEB A;  3B7Z A;  4LJA A;  4IBD A;  4LGM A;  3SAV A;  1K3X A;  3JR4 A;  3U6O A;  1XNQ M;  5FTL A;  1GKI A;  3K9P A;  1QAN A;  3FD9 A;  2QHO B;  3NBI A;  4AG5 A;  4F1I A;  5BR8 M;  1JB0 F;  3U6M A;  1J5E M;  1EIJ A;  3BBZ A;  1HQY E;  1ZMV A;  2D7H A;  4LG2 A;  2LVN C;  1GL7 A;  1W5S A;  3FTF A;  2OOA A;  4L6V 6;  1HJP A;  2CFO A;  3GRU A;  1FNN A;  2XFT A;  3V76 A;  4L8R C;  2ZAO A;  1E94 E;  2WSE F;  4R7G A;  4LF6 M;  4M9S A;  2JXN A;  4LJ4 A;  3E21 A;  2BJV A;  4MGH A;  1VEG A;  2MH8 A;  3F92 A;  5DNY A;  4X62 M;  1Q39 A;  2C9C A;  1ORY B;  5FTM A;  1SXJ C;  4NSO B;  3L25 A;  3KOY E;  1QZM A;  5E26 A;  4X64 M;  2MGW A;  4L4U A;  3LW5 F;  4K0K M;  4DV6 M;  1GAB A;  4M0W A;  4CHT B;  1OJL A;  2RRU A;  1Y8G A;  2APL A;  3BOS A;  3U6Q A;  1OAO C;  1YE9 A;  1DGG A;  3Q8X A;  1PJQ A;  2K0B X;  4XGI A;  3HHY A;  3UZU A;  3HGI A;  1Z6T A;  3GPY A;  4DV4 M;  5EXS A;  3GLI B;  5IT9 S;  4RF0 A;  4GHL A;  1F4I A;  3GLH B;  2L4E A;  5IRE B;  2ZM6 M;  2VQE M;  3RGP A;  1IN4 A;  5A2Q S;  4LF9 M;  5EP2 A;  2FS1 A;  2YQZ A;  1YLA A;  3GRY A;  3H4J A;  3H4M A;  3BXW A;  3M6A A;  3U6S A;  2EKK A;  2X8A A;  1DO2 A;  4B3R M;  1V92 A;  4GIT A;  1TGU A;  2R45 A;  4NXM M;  2LVP C;  1E9S A;  3WHL A;  1T6O A;  7CAT A;  4EIW A;  3W0F A;  4GMQ A;  5FTN A;  3GO8 A;  1R4G A;  2NQ8 C;  1Q02 A;  3L2A A;  4HL4 A;  5E6J A;  2LVQ D;  3SYL A;  2XLJ A;  3SFZ A;  3GRR A;  2UU9 M;  1N75 A;  1IY1 A;  4GC9 A;  5ITR A;  1IFY A;  1BVS A;  2Z7J A;  3WHK A;  3GLF A;  3FYD A;  2L7H A;  2ZTC A;  4NC6 A;  4A3V B;  3AV0 A;  4RNA A;  2YR0 A;  4NXN M;  4Z6Y A;  2R46 A;  3LMM A;  1NJF A;  2F5P A;  1VG5 A;  2XSZ A;  2Y21 A;  1G8P A;  1IXR C;  1XMQ M;  3K9O A;  1DO0 A;  2K6B A;  4FD2 A;  3W0L B;  1PJS A;  2FOI C;  2RGH A;  2Y0Q A;  3HZJ A;  4L15 A;  1Z59 A;  3FTC A;  4XK8 F;  3W67 A;  4DBG B;  2R62 A;  4IJF A;  4MH0 E;  4NRV A;  2CP8 A;  4IIW A;  4HEO A;  5ITX E;  2YNM D;  3I51 A;  4REZ A;  4OVZ A;  4Z8X A;  3HJQ A;  4G3O A;  4GRI A;  3T1H M;  1QDT A;  1S3S A;  3PFI A;  3AFH A;  1OQY A;  1NJG A;  1QZE A;  1ZQ9 A;  2R6F A;  3I01 M;  4FCV A;  1L2D A;  4PCZ A;  1MJG M;  3AKZ A;  4NL4 H;  2UUA M;  2BWE A;  2X4A A;  3EIH A;  3CF6 E;  2K9D A;  2XSZ D;  1N77 A;  3U5Z B;  3KOX E;  1LV7 A;  2QNJ A;  2KRK A;  3U6P A;  5ITX A;  2CEA A;  5FTJ A;  2GQF A;  5EP3 A;  3PXG A;  3AOE C;  3KFU G;  1GJS A;  1G41 A;  4R71 A;  4MB7 A;  4CIZ A;  2QCU A;  2QQ8 A;  2VDB B;  3FTD A;  3PNY A;  4P16 A;  4DV5 M;  2Y0T A;  3FUV A;  3HU2 A;  1TDZ A;  1XNR M;  1G4A E;  2BJW A;  4II7 A;  4R3D A;  3B89 A;  2QPA A;  3GLG E;  3HWS A;  4IBF A;  3ZH9 B;  1R5L A;  3C3D A;  2EA0 A;  4FWH A;  1R2Y A;  4KO8 A;  4IBE A;  4LGY A;  1WHC A;  2VII A;  3L29 A;  1IN5 A;  1IN6 A;  1OKS A;  3QYE A;  3U61 A;  3J80 S;  5F3W A;  4NOO B;  2C96 A;  1WR1 B;  4QHS A;  1K82 A;  4DUZ M;  5DYG A;  2F5O A;  3KXE C;  1UFZ A;  5EXP A;  2VF8 A;  4M9X A;  4OU7 A;  1XMO M;  2QP9 X;  1XXH E;  2C98 A;  5C18 A;  4DR1 M;  1DV0 A;  3SHF A;  1T3T A;  4JI3 M;  3DOA A;  3VDP A;  3C3E A;  5LMN M;  1QUS A;  3GLG A;  3CTW B;  2N35 A;  3C58 A;  2DAG A;  3K2L A;  5EXX A;  4DV2 M;  1FJG M;  3HU3 A;  2DAI A;  2J7N A;  5FLX S;  4IJE A;  1IXS A;  2OQ4 A;  2ZTD A;  2LTU A;  4KHP M;  4L16 A;  4F2L A;  4HLQ A;  1D0L A;  4LY6 A;  2O25 A;  3HY5 A;  4AKI A;  2DKL A;  2DZL A;  1HQC A;  3FUX A;  2G8L A;  3ZC7 B;  1Z5A A;  2CV0 A;  4JI1 M;  3J7A S;  4GHA A;  3SC3 A;  1VEK A;  3JR5 A;  4GEW A;  3U60 A;  4GKK M;  2VF7 A;  1XXH A;  4LJ9 A;  2Z4S A;  1SXJ A;  2LNH C;  1TTE A;  2I7P A;  2KNV A;  5JI2 E;  3AJI B;  2L2D A;  3SAW A;  3KSX A;  1HNZ M;  3FUT A;  2QSF X;  3SAT A;  3SAS A;  3TPZ A;  4LFB M;  2D7E A;  2ZAN A;  3A46 A;  2HCB A;  1XB2 B;  1P3Q Q;  5H37 D;  5C1B A;  3AL0 C;  2DWM A;  3JAM S;  3QAU A;  5GKN A;  2R0I A;  2JP7 A;  4IBJ A;  3TWM A;  4JI2 M;  1K3W A;  2QBY A;  3RFW A;  1NY5 A;  4QHT A;  4KOD A;  2FNA A;  4WP2 A;  2FE8 A;  3KOZ E;  3Q8G A;  3EIE A;  4KLN A;  1PM5 A;  4D81 A;  1GJT A;  4WW0 A;  5EQT A;  3FRH A;  3J2P B;  3SHG B;  4LF8 M;  4AKG A;  1IN7 A;  1HT1 E;  2OPF A;  3GLF E;  4LJ7 A;  1D0K A;  3KP0 E;  1SXJ D;  1IBM M;  3RGS A;  2DWL A;  3HHZ A;  1PRB A;  2HKJ A;  1N33 M;  2O5R A;  5ITQ A;  3MK6 A;  2DWN A;  4QOZ C;  4ITQ A;  4S12 A;  3TWK A;  4DV0 M;  1AIP C;  2KW0 A;  1ZMW A;  2I7N A;  2BWB A;  3K92 A;  2ZAM A;  3E9S A;  3LVV A;  2P5T A;  2F4V M;  1IM2 A;  2JNH A;  3DA1 A;  3KS4 A;  2KDL A;  2V6Z M;  4MGK E;  4FWG A;  3GPX A;  2CV1 A;  3FKE A;  1R7R A;  1WGN A;  1N36 M;  1IQP A;  1QAM A;  4QNM A;  2RKO A;  1NVM A;  1NNJ A;  4FVM A;  3KP1 E;  1QDR A;  1OIZ A;  1QUT A;  1PJJ A;  1OIP A;  4TUW A;  2W82 A;  2F5Q A;  3TQS A;  3C9P A;  3A45 A;  2UUB M;  1VEJ A;  1YUB A;  2WZJ A;  2XGN A;  4IBB A;  2X49 A;  2Z4R A;  4W5W A;  3HHW A;  1TH4 A;  2DI0 A;  3GQ4 A;  1TH3 A;  1IN8 A;  1R6B X;  1D0M A;  3UK6 A;  3K8Z A;  3THG A;  4YHH M;  1HNX M;  2H5X A;  3QYB A;  4LCB A;  3B7N A;  3R8F A;  3U6C A;  3I04 M;  4BBA A;  2KNZ A;  2JY6 B;  3VKG A;  4DR3 M;  1QAQ A;  5ITT A;  2XH9 A;  1XHB A;  2DVW B;  1N78 A;  4I81 A;  5KQ8 A;  2CHV A;  2KZU A;  4FWD A;  2LVO C;  2Q2E B;  3L27 A;  3GQ3 A;  4G6Z A;  3HJ8 A;  2DXI A;  2WSC F;  1HNW M;  1PGY A;  2YFQ A;  2FH0 A;  3U61 B;  5JI3 E;  1VDL A;  1JQJ C;  1VQ1 A;  2XFS A; 
#chains in the Genus database with same CATH homology
 2R18 A;  4LF7 M;  4B3T M;  4MGI E;  2XZF A;  3CF2 A;  4GC5 A;  1C1K A;  3L28 A;  3KDS E;  4DR5 M;  1NY6 A;  1IBL M;  3FTE A;  3GLG B;  5EXT A;  5ITY A;  4G4N A;  2VQF M;  2HHH M;  2EUC A;  4LF5 M;  2XZU A;  2KRU A;  3GRV A;  1IXS B;  4XBO A;  1L8Q A;  4WUR A;  4JXJ A;  1H6U A;  3KW6 A;  4QOS A;  4NRW A;  1QQW A;  1DGH A;  3IG8 A;  5ITU A;  3KOW E;  1NSF A;  4PT5 A;  4JN6 A;  2K47 A;  4NSR A;  3GP1 A;  2EO2 A;  3U6L A;  2QEN A;  2E5L M;  4B3S M;  2Y20 A;  3SAU A;  2F5N A;  1XXH B;  2CHQ A;  1NNU C;  3SBJ A;  2L7I A;  2DHR A;  1E32 A;  4MGZ E;  3VDU A;  1SXJ E;  2UXC M;  1E9R A;  1Z5B A;  5KQD A;  3GPP A;  3ILK A;  2KA6 B;  4M0D A;  2C5R A;  1IBK M;  3VKH A;  2CE7 A;  2HL7 A;  4GKJ M;  3HKP A;  3T38 A;  1QAO A;  1X37 A;  5EP1 A;  4I8O A;  3I4V A;  1HR0 M;  4AQY M;  4JI0 M;  1TDH A;  3MJ5 A;  3E4R A;  1KSF X;  4X65 M;  1R2Z A;  5FTK A;  3SYK A;  1XWI A;  4IBG A;  4LZZ A;  3UJN A;  2Z3X A;  3KVW A;  4OW0 A;  2F5S A;  8CAT A;  3VLF B;  4MGY E;  1QVR A;  4GH9 A;  2R4E A;  4IBI A;  3FUU A;  3HHX A;  3LQR A;  1IXZ A;  3DZD A;  3M7G A;  4JI8 M;  4BB9 A;  1MX0 A;  3R9X B;  3QWL A;  2CUZ A;  2R4J A;  4IBC A;  4PD2 A;  1NHG C;  3GLF B;  4LRT A;  1Z5C A;  3J27 B;  4B7H A;  2D7G A;  3TL4 X;  4DV7 M;  4DR7 M;  4YY3 M;  4JI5 M;  2XF3 A;  3J81 S;  1VDD A;  2J7O A;  1GL6 A;  5EP4 A;  1I94 M;  4QNR A;  2V1C A;  4B08 A;  4AKH A;  4DR6 M;  3D8L A;  2M5Z A;  3SMP A;  3SMS A;  3UMM A;  1XC8 A;  4X66 M;  5DYI A;  1IY0 A;  4D82 A;  4LJ5 A;  1KYI A;  4AG6 A;  3D8B A;  4M9Z A;  4B7G A;  1DGB A;  1NHW C;  1Q3C A;  2LWX A;  5IWA M;  4JYA M;  4OVZ B;  2UXB M;  4FCT A;  3AOG A;  4CIS A;  3PNV A;  3UGJ A;  4DV3 M;  4PDG A;  1PJI A;  2L09 A;  4DR2 M;  1ZAE A;  2KXE A;  2BNK A;  1HT2 E;  3OTO M;  5IZ7 D;  3RE8 A;  5KPT A;  2FFJ A;  4G4Q A;  4FW9 A;  3VK7 A;  4I4L A;  1TH2 A;  3CF0 A;  2H1R A;  4DR4 M;  1IY2 A;  3GLI A;  4AW4 A;  1W5T A;  1UM8 A;  3GLH A;  1GLN A;  3DFZ A;  4LFC M;  3VK8 A;  2UXD M;  4OX9 M;  2DWZ B;  5FSW A;  1MU5 A;  4LJ6 A;  2A5Y B;  2C99 A;  3A42 A;  2JA2 A;  4PDI A;  4RF1 A;  4D80 A;  5KO3 A;  3LQQ A;  3U6E A;  2DZO B;  3J7B A;  2CHG A;  1DGH B;  1GVN A;  2RGO A;  3GPU A;  2ERC A;  1JR3 A;  3KS8 A;  1G3I A;  4G4O A;  1WXQ A;  1EE8 A;  2DZN B;  4JI4 M;  4AI6 A;  1L1T A;  3FUW A;  2ZBK B;  3L26 A;  1OFH A;  2L6O A;  2C9O A;  3AOE A;  4LZJ A;  3KSJ A;  2G5G X;  3NWL A;  2CV2 A;  4GIP A;  3HJS A;  1N32 M;  3U6D A;  1Q3B A;  2QZ4 A;  3TE6 A;  4FCW A;  4ZPX A;  4CGY B;  3IG5 A;  4DUY M;  2V1U A;  4JV5 M;  1J09 A;  1G59 A;  2KZS A;  3B9P A;  2R65 A;  1JR3 D;  4LFA M;  3T15 A;  3FYC A;  4G4R A;  4LRS A;  3U60 B;  3T1Y M;  1DGF A;  1I4W A;  1YSY A;  3LVW A;  1D2N A;  1KFV A;  3SAR A;  1SXJ B;  3MHV C;  3PVS A;  4BLC A;  3ZCB B;  4MM3 B;  2LXE A;  3M0E A;  2M60 A;  4IBK A;  3TWL A;  2UUC M;  3HU1 A;  3I4Y A;  4B3M M;  4L78 A;  3K1J A;  4I5S A;  4DV1 M;  1OFI A;  4LJ8 A;  4JI7 M;  4AZF A;  1N34 M;  5KPR A;  5KPZ A;  1L2C A;  2QBY B;  5LMU M;  1J7K A;  4LF4 M;  5BPV A;  3U5Z A;  1QYR A;  4JI6 M;  2LH0 A;  3GQ5 A;  4B7F A;  1L1Z A;  2AHM A;  3A98 B;  5EJC A;  1L2B A;  2KEB A;  4LJA A;  1K3X A;  4IBD A;  4LGM A;  3SAV A;  3JR4 A;  3U6O A;  1XNQ M;  5FTL A;  1GKI A;  4AG5 A;  1QAN A;  3FD9 A;  3NBI A;  5BR8 M;  3U6M A;  1J5E M;  1HQY E;  2D7H A;  4LG2 A;  1GL7 A;  1W5S A;  3FTF A;  2CFO A;  3GRU A;  1FNN A;  2XFT A;  4L8R C;  2ZAO A;  1E94 E;  4R7G A;  4LF6 M;  4M9S A;  4LJ4 A;  2BJV A;  4MGH A;  4X62 M;  5DNY A;  1Q39 A;  2C9C A;  1ORY B;  5FTM A;  1SXJ C;  4NSO B;  3L25 A;  3KOY E;  1QZM A;  5E26 A;  4X64 M;  4L4U A;  4K0K M;  4DV6 M;  4M0W A;  4CHT B;  1OJL A;  3BOS A;  3U6Q A;  1YE9 A;  1DGG A;  3Q8X A;  4XGI A;  4DV4 M;  3HHY A;  3UZU A;  3HGI A;  1Z6T A;  3GPY A;  5IT9 S;  5EXS A;  3GLI B;  4RF0 A;  4GHL A;  3GLH B;  5IRE B;  2ZM6 M;  2VQE M;  3RGP A;  1IN4 A;  5A2Q S;  4LF9 M;  5EP2 A;  2YQZ A;  3GRY A;  3H4M A;  3M6A A;  3U6S A;  2X8A A;  1DO2 A;  4B3R M;  4GIT A;  1TGU A;  2R45 A;  4NXM M;  1E9S A;  3WHL A;  7CAT A;  4EIW A;  3W0F A;  4GMQ A;  5FTN A;  3GO8 A;  2NQ8 C;  3L2A A;  4HL4 A;  5E6J A;  3SYL A;  2XLJ A;  3SFZ A;  3GRR A;  2UU9 M;  1N75 A;  1IY1 A;  4GC9 A;  5ITR A;  3GLF A;  2Z7J A;  3WHK A;  3FYD A;  2L7H A;  4A3V B;  3AV0 A;  4RNA A;  2YR0 A;  4NXN M;  4Z6Y A;  2R46 A;  3LMM A;  1NJF A;  2F5P A;  2XSZ A;  2Y21 A;  1G8P A;  1IXR C;  1XMQ M;  1DO0 A;  4FD2 A;  3W0L B;  2FOI C;  2Y0Q A;  2RGH A;  4L15 A;  1Z59 A;  3FTC A;  2R62 A;  4IJF A;  4MH0 E;  4NRV A;  4IIW A;  5ITX E;  2YNM D;  3I51 A;  4REZ A;  4OVZ A;  4Z8X A;  3HJQ A;  4GRI A;  3T1H M;  1S3S A;  3PFI A;  3AFH A;  1NJG A;  1ZQ9 A;  4FCV A;  1L2D A;  4PCZ A;  3AKZ A;  4NL4 H;  2UUA M;  2X4A A;  3EIH A;  3CF6 E;  2XSZ D;  1N77 A;  3U5Z B;  3KOX E;  1LV7 A;  2KRK A;  3U6P A;  5ITX A;  2CEA A;  5FTJ A;  3PXG A;  5EP3 A;  3KFU G;  3AOE C;  1G41 A;  4MB7 A;  2QCU A;  3PNY A;  3FTD A;  4P16 A;  4DV5 M;  2Y0T A;  3FUV A;  3HU2 A;  1TDZ A;  1XNR M;  1G4A E;  2BJW A;  4II7 A;  4R3D A;  2QPA A;  3HWS A;  4IBF A;  3ZH9 B;  1R2Y A;  2EA0 A;  4FWH A;  4KO8 A;  4IBE A;  4LGY A;  2VII A;  3L29 A;  1IN5 A;  1IN6 A;  3U61 A;  3J80 S;  5F3W A;  4NOO B;  2C96 A;  4QHS A;  1K82 A;  4DUZ M;  5DYG A;  2F5O A;  3KXE C;  5EXP A;  4M9X A;  4OU7 A;  1XMO M;  2QP9 X;  2C98 A;  5C18 A;  4DR1 M;  3SHF A;  1T3T A;  4JI3 M;  3DOA A;  3VDP A;  5LMN M;  3GLG A;  3CTW B;  3C58 A;  3K2L A;  5EXX A;  4DV2 M;  1FJG M;  3HU3 A;  2J7N A;  5FLX S;  4IJE A;  2OQ4 A;  4KHP M;  4L16 A;  4HLQ A;  4LY6 A;  4AKI A;  1HQC A;  3FUX A;  2G8L A;  3ZC7 B;  1Z5A A;  2CV0 A;  4JI1 M;  3J7A S;  4GHA A;  3SC3 A;  3JR5 A;  3U60 A;  4GKK M;  1XXH A;  4LJ9 A;  2Z4S A;  1SXJ A;  2LNH C;  2I7P A;  5JI2 E;  3AJI B;  3SAW A;  3SAT A;  3KSX A;  1HNZ M;  3FUT A;  3SAS A;  3TPZ A;  4LFB M;  2D7E A;  2ZAN A;  3A46 A;  2HCB A;  5H37 D;  5C1B A;  3AL0 C;  2DWM A;  3JAM S;  3QAU A;  5GKN A;  4IBJ A;  3TWM A;  4JI2 M;  1K3W A;  2QBY A;  3RFW A;  1NY5 A;  4QHT A;  4KOD A;  2FNA A;  2FE8 A;  3KOZ E;  4KLN A;  3EIE A;  1PM5 A;  4D81 A;  4WW0 A;  5EQT A;  3J2P B;  3SHG B;  4LF8 M;  4AKG A;  1IN7 A;  1HT1 E;  2OPF A;  4LJ7 A;  3KP0 E;  1SXJ D;  1IBM M;  3RGS A;  2DWL A;  3HHZ A;  2HKJ A;  1N33 M;  2O5R A;  5ITQ A;  3MK6 A;  2DWN A;  4QOZ C;  4ITQ A;  4S12 A;  3TWK A;  4DV0 M;  2KW0 A;  2I7N A;  3K92 A;  2ZAM A;  3E9S A;  3LVV A;  2P5T A;  2F4V M;  1IM2 A;  3DA1 A;  3KS4 A;  2V6Z M;  4MGK E;  4FWG A;  3GPX A;  2CV1 A;  3FKE A;  1R7R A;  1N36 M;  1IQP A;  1QAM A;  4QNM A;  2RKO A;  1NVM A;  1NNJ A;  4FVM A;  3KP1 E;  1PJJ A;  4TUW A;  2W82 A;  2F5Q A;  3TQS A;  3A45 A;  2UUB M;  1YUB A;  2XGN A;  4IBB A;  2X49 A;  2Z4R A;  4W5W A;  3HHW A;  1TH4 A;  3GQ4 A;  1TH3 A;  1IN8 A;  1R6B X;  3UK6 A;  3K8Z A;  3THG A;  4YHH M;  1HNX M;  4LCB A;  3R8F A;  3U6C A;  4BBA A;  3VKG A;  4DR3 M;  1QAQ A;  5ITT A;  2XH9 A;  1XHB A;  2DVW B;  1N78 A;  4I81 A;  5KQ8 A;  2CHV A;  2KZU A;  4FWD A;  2Q2E B;  3L27 A;  3GQ3 A;  4G6Z A;  3HJ8 A;  2DXI A;  1HNW M;  2YFQ A;  3U61 B;  5JI3 E;  2XEP A;  1JQJ C;  3VFD A;  2XFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...