2EO2A

Solution structure of the insertion region (510-573) of fthfs domain from mouse methylenetetrahydrofolate dehydrogenase (nadp+ dependent) 1-like protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
71
structure length
71
Chain Sequence
GSSGSSGSTQTDKALYNRLVPLVNGVREFSEIQLSRLKKLGIHKTDPSTLTEEEVRKFARLNIDPATITWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the insertion region (510-573) of FTHFS domain from mouse methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like protein
rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Adult male hypothalamus cDNA, RIKEN full-length enriched lib
total genus 7
structure length 71
sequence length 71
ec nomenclature ec 6.3.4.3: Formate--tetrahydrofolate ligase.
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.770 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2eo2A00
2EO2A
chains in the Genus database with same CATH superfamily
5FTJA 3VFDA 5ITRA 3K2LA 4AG6A 1AUAA 1TR8A 2UXDM 4NC6A 2V6ZM 4JI4M 1QYRA 3KXEC 1C7YA 2BWBA 4G4QA 2MJ5B 2XEPA 4X66M 4JI1M 1L2BA 3FTEA 3ILKA 3EIEA 2FE8A 3SYLA 1N77A 2CHQA 2CV1A 2W82A 4LJ8A 2JZ1A 2FH0A 1K3XA 3I4VA 1G71A 3MHVC 2I7NA 2C98A 2JP7A 3J7AS 3GLIE 4KHPM 1JQJC 4DV7M 1G59A 3KP0E 1HT1E 1NY6A 2LVPC 3PVSA 1JR3D 4RF1A 1TH2A 3I04M 2X4AA 4LF4M 2X8AA 2G3QA 4NL4H 1OFIA 2F5PA 4X62M 2WSFF 4DV6M 3MMPA 3UGJA 1SXJA 3A98B 3MK6A 4I81A 1I94M 3K1JA 2BNKA 1G8PA 2OOAA 3VLFB 7CATA 4MGKE 2RKOA 1VQ1A 4LGMA 1QUSA 1QANA 1YSYA 3FE3A 4L6V6 5ITXE 1WR1B 1Q02A 4Q7JA 1N34M 1LTMA 2VF7A 1OAOC 1XHBA 2LHGA 3HHYA 2CV0A 5EP2A 2C99A 2EJSA 3KW6A 2KDLA 3LW5F 1DGGA 4X65M 1KFVA 3VK7A 3M6AA 4QOZC 1ZV1A 2KHHA 2CHVA 1R4GA 2JXNA 4JI3M 2UUBM 3GQ4A 1E9SA 2K47A 4I4LA 1ZQ9A 4XGIA 4RF0A 1VEGA 2H5XA 1I4WA 1NJGA 1NVMA 2LVOC 1HQYE 4AKIA 3QWLA 2R4EA 2RRUA 4IBCA 2OPFA 4B3SM 2I7PA 3FRHA 2LTUA 1JR3A 1Q3CA 1MJGM 2MROB 4WW0A 3L26A 2V1UA 3M7GA 3L25A 3SAWA 1Q3BA 2Z4RA 4OVZA 3C9PA 3BXWA 3HWSA 3U6EA 2QSFX 1AIPC 1GL6A 3KP1E 4MH0E 3DOAA 1VEJA 3TPZA 3TWKA 1DGBA 4B08A 4YHHM 3FTFA 2N35A 4PDGA 4FCVA 1D0KA 1QDTA 3CTWB 2CRUA 3L2AA 1HNZM 3K9PA 2XZUA 4IBJA 2G5GX 1NHGC 4IBKA 4QHSA 3W67A 3HU2A 2EO2A 1LV7A 1TTEA 3KSXA 3AOEA 3T6PA 2R65A 2HKJA 3SC3A 4AZFA 1Z5CA 3HU3A 4DUZM 4LF9M 2BJVA 2VQFM 1HT2E 4DR2M 3GRRA 3GRUA 2L7HA 4GMQA 3ZH9B 4GKKM 1T43A 4IBGA 4JN6A 2L4FA 4QHTA 5EP1A 4LJ6A 1EIJA 3J80S 2DXIA 2XZFA 4KLNA 4YY3M 2C96A 2R18A 4B3MM 4GC5A 2DWMA 3KOXE 1IXSB 3E9SA 3GLGE 4M9SA 5BPVA 2K9DA 2DKLA 4DV1M 4PDIA 2M5ZA 2P5TA 3EIHA 4CIZA 4FWGA 1KSFX 1V92A 1QZMA 3PNVA 8CATA 1A5TA 2F5QA 4L8RC 1IXZA 1EFUB 1J7KA 5BR8M 1RU3A 2KNZA 3AKZA 3DA1A 2A5YB 3L29A 1E94E 4QOSA 5KQ8A 2MR9A 1CUKA 1WHCA 1OKSA 3FRIA 4L15A 2UU9M 2LHCA 2QBYA 1PJSA 1L1TA 1NJFA 5IREB 2XFTA 4IBDA 1QAQA 2QZ4A 2R45A 1JB0F 3GPPA 3L28A 2DENA 1IFYA 3UK6A 3HZJA 2OOBA 1NY5A 2O25A 2XF3A 2DAIA 3HJ8A 2D7EA 4CHTB 4DV3M 3U6PA 1UFZA 2O01F 4M9ZA 4TUWA 1XB2B 1Q39A 2CUZA 3AOGA 3U61A 1R2YA 3HGIA 4G4OA 2CE7A 1SG9A 4IBIA 4D80A 5KQDA 3BOSA 1D2NA 2X49A 4HEOA 2FFJA 3K8ZA 4MGHA 5IZ7D 2KNAA 4IBEA 1XWIA 1E32A 4LJ4A 3KOWE 4BB9A 4L78A 4R71A 2DZOB 2D7HA 2KNVA 3U5ZA 3HKPA 1XMOM 2DAMA 2ZAMA 3K92A 3SAVA 1PM5A 1UM8A 2KW0A 1D0LA 4XBOA 1KYIA 4JYAM 3VDUA 2R0IA 1QQWA 5EJCA 1N75A 4CISA 4MGYE 1PJIA 1IBLM 1IM2A 4MGZE 3RGPA 3ZQJA 2QP9X 3FUWA 1SXJC 4KO8A 3KSJA 3U6DA 3FYCA 5EXXA 3QYBA 3T15A 2LVQD 3LVVA 2JZ0A 2XGNA 4LF6M 1QUTA 2APLA 2R46A 5KO3A 1L1ZA 4FW9A 2QQ8A 1IN8A 4QNRA 5DYGA 4Z8XA 4CJ6A 4JI7M 4DR5M 3C3DA 1ZMVA 4NRWA 4LY6A 2LH0A 2F4VM 2F5NA 4S12A 3GLIA 4GC9A 2DNAA 1TGUA 4F2LA 5L8RF 3UJNA 3GLGA 4ZPXA 3FUVA 2R6FA 4IBBA 3UMMA 2KEBA 3C3EA 4DV2M 1K82A 1IBKM 2DWNA 1IQPA 3GLIB 4NRVA 1QZEA 1DGHA 4NSOB 3GLHB 1VG5A 3AJIB 2ZANA 1GJTA 2CHGA 3HJQA 3MJ5A 2C9CA 3E4RA 2C9OA 4LZZA 5H37D 2BJWA 1QAOA 5F3WA 3JAMS 3B7ZA 1PGYA 1NNUC 1XNQM 4G6ZA 2QENA 3SHFA 3SASA 5FTKA 2FS1A 1ZMUA 1GABA 2QPAA 2JY8A 2WSCF 2LWXA 2DAEA 2DHRA 2OQ4A 3GRVA 2JY5A 4FCTA 5A2QS 4GITA 1Z59A 1GJSA 3HHZA 5DNYA 4DUYM 2CFOA 1OIPA 2K0BX 3RGSA 3GLGB 2Y0TA 4F1IA 1OIZA 3J2PB 3FKEA 4Z6YA 3U6QA 3SMPA 3B9PA 2Z7JA 4FWDA 3LCVB 4W5WA 1G4AE 1OJLA 3HX3A 3U60B 5IT9S 4WURA 3QYEA 5FLXS 3GLHE 2LBCA 4LGYA 4B7FA 3U5ZB 3WHKA 1SXJE 2BWEA 4JXJA 2NQ8C 2C5RA 3LQRA 3CF6E 5C18A 4UN2B 4IBFA 4JV5M 1K3WA 3A42A 2CWBA 1IY2A 5EXPA 3SFZA 1TDHA 4AKGA 3U6SA 1BVSA 3LMMA 1R2ZA 3SBJA 1PRBA 2YR0A 5EXSA 5EP4A 1XC8A 2J5YA 5ITTA 3FD9A 1HQCA 1FJGM 2XSZD 5ITUA 1IN4A 2DWZB 3LCUA 2L09A 1PJQA 1WIVA 4GHAA 2CP8A 1G3IA 1N78A 2YNMD 4HL4A 2KXEA 2EUCA 3SAUA 3B7QA 3J27B 1TDZA 4I5SA 2B3TA 1X37A 3U6OA 1E9RA 3GLHA 2VDBB 2Z8YM 4LJAA 4ANRA 1IBMM 1ZAEA 4B3TM 1NHWC 3FYDA 3GPXA 4JI8M 2Y21A 4LCBA 1NSFA 4RNAA 1SXJB 3FTCA 4LG2A 4AQYM 2HHHM 3TE6A 4DR3M 1Z5BA 3VKHA 3IG5A 3I01M 4NXNM 3AOEC 1XXHE 4P16A 4ITQA 4RKUF 1XMQM 2FOIC 1IN6A 1NO1A 3W0LB 5EQTA 2LNHC 3KFUG 2HAKA 3I51A 2MGWA 3HJSA 2KZSA 5DYIA 3VDPA 3B7NA 5FTMA 4KT0F 3K9OA 1OTRA 4JI2M 3A45A 3SATA 4NXMM 2YFQA 2ZBKB 4LFCM 4QNMA 2ZM6M 1GO5A 2LXEA 5ITYA 3NBIA 1R5LA 3CGWA 4NSRA 4OVZB 1HNWM 4OW0A 3JR5A 1V33A 2EKFA 5E6JA 2Q2EB 5ITXA 4CGYB 2K6BA 4X64M 1G41A 2J7NA 3VK8A 1QAMA 1V34A 1XNRM 1J09A 3AV0A 4B3RM 2KRUA 1SXJD 2KRKA 3NBXX 2Z3XA 3FTDA 1YE9A 2HL7A 4G4NA 2F5OA 4JI5M 1QDRA 2QNJA 3DZDA 1NV9A 3J7BA 1PJJA 4DR7M 5JI3E 2G8LA 2F5SA 3SARA 1GVNA 3IECA 4M0DA 3U61B 1MU5A 1S3SA 4MM3B 2DI0A 3R8FA 3SHGB 1ORYB 2DWLA 1WXQA 3FUUA 2UXBM 1FNNA 3SYKA 3TQSA 4GRIA 4P17A 2RGHA 5ITQA 1IXRC 2RGOA 1EE8A 2JY6B 4LRSA 3GPYA 1DV0A 1JR3E 1ZMWA 3GLFB 2QBYB 4B7GA 3NWLA 3HHWA 1HR0M 3GP1A 4MGIE 4R3DA 4NOOB 3JR4A 1T6OA 4LJ9A 3TWLA 3T1HM 4IJFA 1HJPA 1XXHA 5C1BA 3TWMA 2LVAA 4FCWA 1GL7A 1IN5A 3TL4X 4B7HA 1J5EM 1N32M 3VKGA 4LRTA 3KS4A 2VQEM 1NV8A 1D0MA 5LMUM 2ZAOA 1DGHB 3AFHA 3D8LA 4DV0M 1OFHA 2LVNC 2QHOB 2M60A 2YQZA 2L2DA 3F92A 5E26A 2DAKA 5FTLA 2Z4SA 3CF0A 2JA2A 1PJTA 4AW4A 2DZLA 2HCBA 1L8QA 4JI6M 1IN7A 3J81S 1IY1A 4LF5M 1F4IA 4AG5A 2CV2A 5KPTA 3M0EA 4R7GA 1Z6TA 1GKIA 1DO2A 1T3TA 3FUXA 3HU1A 4G3OA 5LMNM 3THGA 4HLQA 1VDDA 4Y28F 4AKHA 1QVRA 1C1KA 3GRYA 2H1RA 4OX9M 4EIWA 5FSWA 2V1CA 4JI0M 4DR4M 3UZUA 3Q8GA 1Z5AA 1H6UA 3RFWA 3HHXA 3WHLA 4PCZA 3L27A 5IWAM 4MB7A 2DVWB 2XH9A 4D81A 3GO8A 1NNJA 3H4JA 3KOZE 4M9XA 3W0FA 3DFZA 3B89A 2WSEF 5KPRA 1MN3A 2JNHA 4K0KM 1YUBA 2JUJA 1TH4A 2AHMA 4KODA 4XK8F 2O5RA 4AI6A 2R44A 3GLFA 5DFLA 3T1YM 2KA6B 1VEKA 3I4YA 1OAIA 3OTOM 2XLJA 3HY5A 1VDLA 4L4UA 4IJEA 4DR6M 2FNAA 2UXCM 2ZTCA 4LJ7A 3BBZA 1XXHB 2WZJA 4GH9A 2OO9A 2L6OA 3RE8A 4LJ5A 4LF7M 2Y20A 3U60A 4OU7A 4LF8M 4FD2A 4I8OA 5FTNA 2VF8A 2E5LM 2KZUA 2XFSA 4A3VB 5EXTA 2CEAA 2JWSA 4DV4M 1WJ7A 4GEWA 3B74A 3KOYE 5JI2E 4LFBM 2JY7A 3PXGA 3ZCBB 2MH8A 4PD2A 3LQQA 3AL0C 2L4EA 1HNXM 2ERCA 1YLAA 4L16A 3U6MA 1P3QQ 2GNOA 2UUAM 4DBGB 1IXSA 4IIWA 2D7GA 2EKKA 3SMSA 1L2CA 1GLNA 4GIPA 3IG8A 5EP3A 3W68A 4BBAA 3U6LA 3GQ3A 1OQYA 2VIIA 4II7A 3T38A 2J7OA 1WGNA 2HWJA 4REZA 3ZC7B 3KVWA 5GKNA 1Y8GA 2XSZA 2ZTDA 4DR1M 4GHLA 3IHPA 3D8BA 4FWHA 1TF0B 1WGLA 2Y0QA 3CF2A 4PT5A 2UUCM 1R6BX 1MX0A 2DAGA 2R4JA 3PFIA 4G4RA 4D82A 2L7IA 2DZNB 1R7RA 3GLFE 4FVMA 1DO0A 3A46A 3C58A 4WP2A 3E21A 4M0WA 3KS8A 4GKJM 4BLCA 3R9XB 2R62A 5KPZA 4LZJA 2EA0A 1W5SA 1DGFA 2GQFA 1TH3A 3FUTA 3E46A 3H4MA 1L2DA 1N36M 3KDSE 3LVWA 3QAUA 4LFAM 3U6CA 1W5TA 2DHYA 2QCUA 3GPUA 4DV5M 1N33M 3PNYA 3Q8XA 3V76A 3GQ5A 1IY0A
chains in the Genus database with same CATH topology
5FTJA 3VFDA 5ITRA 3K2LA 4AG6A 2UXDM 2V6ZM 4JI4M 1QYRA 3KXEC 4JI1M 4G4QA 2XEPA 4X66M 3FTEA 1L2BA 3ILKA 3EIEA 2FE8A 3SYLA 1N77A 2CHQA 2CV1A 2W82A 4LJ8A 1K3XA 3I4VA 3MHVC 2I7NA 2C98A 3J7AS 4KHPM 1JQJC 4DV7M 1G59A 3KP0E 1HT1E 1NY6A 3PVSA 4RF1A 1JR3D 1TH2A 4LF4M 2X4AA 2X8AA 4NL4H 1OFIA 2F5PA 4X62M 4DV6M 3UGJA 1SXJA 3A98B 3MK6A 4I81A 1I94M 3K1JA 2BNKA 1G8PA 3VLFB 7CATA 4MGKE 2RKOA 4LGMA 1QANA 1YSYA 5ITXE 1N34M 1XHBA 3HHYA 2CV0A 5EP2A 2C99A 3KW6A 1DGGA 4X65M 1KFVA 3VK7A 3M6AA 4QOZC 2CHVA 4JI3M 2UUBM 3GQ4A 1E9SA 2K47A 4I4LA 1ZQ9A 4XGIA 4RF0A 1I4WA 1NJGA 1NVMA 1HQYE 4AKIA 3QWLA 2R4EA 4IBCA 2OPFA 4B3SM 2I7PA 1JR3A 1Q3CA 4WW0A 2V1UA 3L26A 3M7GA 3L25A 3SAWA 1Q3BA 2Z4RA 4OVZA 3HWSA 3U6EA 1GL6A 3KP1E 4MH0E 3DOAA 3TPZA 3TWKA 1DGBA 4B08A 4YHHM 3FTFA 4PDGA 4FCVA 3CTWB 3L2AA 1HNZM 2XZUA 4IBJA 2G5GX 1NHGC 4IBKA 4QHSA 3HU2A 2EO2A 1LV7A 3KSXA 3AOEA 4LF9M 2R65A 2HKJA 3SC3A 4AZFA 1Z5CA 3HU3A 4DUZM 2BJVA 2VQFM 1HT2E 4DR2M 3GRRA 3GRUA 2L7HA 4GMQA 3ZH9B 4GKKM 4IBGA 4JN6A 4QHTA 5EP1A 4LJ6A 3J80S 2DXIA 2XZFA 4KLNA 4YY3M 2C96A 2R18A 4B3MM 4GC5A 2DWMA 3KOXE 1IXSB 3E9SA 4M9SA 5BPVA 4DV1M 4PDIA 2M5ZA 2P5TA 3EIHA 4FWGA 1KSFX 1QZMA 3PNVA 8CATA 2F5QA 4L8RC 1IXZA 5BR8M 1J7KA 3AKZA 3DA1A 2A5YB 3L29A 1E94E 4QOSA 5KQ8A 4L15A 2UU9M 2QBYA 1L1TA 1NJFA 5IREB 2XFTA 1IY0A 4IBDA 1QAQA 2QZ4A 2R45A 3GPPA 3L28A 3UK6A 4DV3M 1NY5A 2XF3A 4CHTB 3HJ8A 3U6PA 2D7EA 4M9ZA 4TUWA 1Q39A 2CUZA 3AOGA 3U61A 1R2YA 3HGIA 4G4OA 2CE7A 4IBIA 4D80A 5KQDA 3BOSA 1D2NA 2X49A 4MGHA 2FFJA 3K8ZA 5IZ7D 4IBEA 1XWIA 1E32A 4LJ4A 3KOWE 4BB9A 4L78A 1XMOM 2DZOB 2D7HA 3U5ZA 3HKPA 3SAVA 2ZAMA 3K92A 1PM5A 1UM8A 2KW0A 4XBOA 1KYIA 4JYAM 3VDUA 1QQWA 5EJCA 1N75A 4CISA 4MGYE 1PJIA 1IBLM 1IM2A 4MGZE 3RGPA 2QP9X 3FUWA 1SXJC 4KO8A 3KSJA 3U6DA 3FYCA 5EXXA 3T15A 3LVVA 2XGNA 4LF6M 5KO3A 2R46A 1L1ZA 4FW9A 1IN8A 4QNRA 5DYGA 4Z8XA 4JI7M 4DR5M 4NRWA 2F4VM 4LY6A 2LH0A 2F5NA 4S12A 3GLIA 4GC9A 1TGUA 3UJNA 3GLGA 4ZPXA 3FUVA 4IBBA 1K82A 3UMMA 2KEBA 4DV2M 1IBKM 2DWNA 1IQPA 3GLIB 4NRVA 1DGHA 4NSOB 3GLHB 3AJIB 2ZANA 2CHGA 3HJQA 3MJ5A 2C9CA 3E4RA 2C9OA 4LZZA 5H37D 2BJWA 1QAOA 5F3WA 3JAMS 1NNUC 1XNQM 4G6ZA 2QENA 3SHFA 3SASA 5FTKA 2QPAA 2LWXA 2DHRA 2OQ4A 3GRVA 4FCTA 5A2QS 4GITA 1Z59A 3HHZA 5DNYA 4DUYM 2CFOA 3RGSA 3GLGB 2Y0TA 3J2PB 3FKEA 4Z6YA 3U6QA 3SMPA 3B9PA 2Z7JA 4FWDA 4W5WA 1G4AE 1OJLA 3U60B 5IT9S 4WURA 5FLXS 3U5ZB 4LGYA 4B7FA 3WHKA 1SXJE 4JXJA 2NQ8C 2C5RA 3LQRA 3CF6E 5C18A 4JV5M 4IBFA 1K3WA 3A42A 1IY2A 5EXPA 3SFZA 1TDHA 4AKGA 3U6SA 1R2ZA 3LMMA 3SBJA 2YR0A 5EXSA 1XC8A 5EP4A 5ITTA 3FD9A 1HQCA 1FJGM 2XSZD 5ITUA 1IN4A 2DWZB 2L09A 4GHAA 1G3IA 1N78A 2YNMD 4HL4A 2KXEA 2EUCA 3SAUA 1TDZA 3J27B 4I5SA 1X37A 3U6OA 1E9RA 3GLHA 4LJAA 1IBMM 1ZAEA 4B3TM 1NHWC 3FYDA 3GPXA 4JI8M 2Y21A 4LCBA 1NSFA 4RNAA 1SXJB 3FTCA 4LG2A 4AQYM 2HHHM 3TE6A 4DR3M 1Z5BA 3VKHA 3IG5A 4NXNM 3AOEC 4P16A 4ITQA 1XMQM 2FOIC 1IN6A 3W0LB 5EQTA 2LNHC 3KFUG 3I51A 3HJSA 2KZSA 5DYIA 3VDPA 5FTMA 4JI2M 3A45A 3SATA 4NXMM 2YFQA 2ZBKB 4LFCM 4QNMA 2ZM6M 2LXEA 5ITYA 3NBIA 4NSRA 4OVZB 1HNWM 4OW0A 3JR5A 5E6JA 2Q2EB 5ITXA 4CGYB 4X64M 1G41A 2J7NA 3VK8A 1QAMA 1XNRM 1J09A 3AV0A 4B3RM 2KRUA 1SXJD 2KRKA 2Z3XA 2F5OA 3FTDA 1YE9A 2HL7A 4G4NA 4JI5M 3DZDA 1PJJA 4DR7M 3J7BA 5JI3E 2G8LA 2F5SA 3SARA 1GVNA 4M0DA 3U61B 1MU5A 1S3SA 4MM3B 3R8FA 3SHGB 1ORYB 2DWLA 1WXQA 3FUUA 2UXBM 1FNNA 3SYKA 3TQSA 4GRIA 2RGHA 5ITQA 1IXRC 2RGOA 1EE8A 4LRSA 3GPYA 3GLFB 2QBYB 4B7GA 3NWLA 3HHWA 1HR0M 3GP1A 4MGIE 4R3DA 4NOOB 3JR4A 3TWLA 4LJ9A 3T1HM 4IJFA 1XXHA 5C1BA 3TWMA 4FCWA 1GL7A 1IN5A 3TL4X 4B7HA 1J5EM 1N32M 3VKGA 4LRTA 3KS4A 2VQEM 5LMUM 2ZAOA 1DGHB 3AFHA 3D8LA 4DV0M 1OFHA 2M60A 2YQZA 5E26A 5FTLA 3CF0A 2Z4SA 2JA2A 4AW4A 4LF5M 2HCBA 1L8QA 4JI6M 1IN7A 3J81S 1IY1A 4AG5A 2CV2A 5KPTA 3M0EA 4R7GA 1Z6TA 1GKIA 1DO2A 1T3TA 3FUXA 3HU1A 5LMNM 3THGA 4HLQA 1VDDA 4AKHA 1QVRA 1C1KA 3GRYA 2H1RA 4OX9M 4EIWA 5FSWA 2V1CA 4JI0M 4DR4M 3UZUA 1Z5AA 1H6UA 3RFWA 3HHXA 3WHLA 4PCZA 3L27A 5IWAM 4MB7A 2DVWB 2XH9A 4D81A 3GO8A 1NNJA 3KOZE 4M9XA 3W0FA 5KPRA 4K0KM 1YUBA 1TH4A 2AHMA 4KODA 2O5RA 4AI6A 3GLFA 3T1YM 2KA6B 3I4YA 3OTOM 2XLJA 4L4UA 4IJEA 4DR6M 2FNAA 2UXCM 4LJ7A 1XXHB 4GH9A 2L6OA 3RE8A 4LJ5A 4LF7M 2Y20A 3U60A 4OU7A 4LF8M 4FD2A 4I8OA 5FTNA 2E5LM 2KZUA 2XFSA 4A3VB 5EXTA 2CEAA 4DV4M 3KOYE 5JI2E 4LFBM 3PXGA 3ZCBB 4PD2A 3LQQA 3AL0C 1HNXM 2ERCA 4L16A 3U6MA 2UUAM 4IIWA 2D7GA 3SMSA 1L2CA 1GLNA 4GIPA 3IG8A 5EP3A 4BBAA 3U6LA 3GQ3A 2VIIA 4II7A 3T38A 2J7OA 4REZA 3ZC7B 3KVWA 5GKNA 2XSZA 4DR1M 4GHLA 3D8BA 4FWHA 2Y0QA 3CF2A 4PT5A 2UUCM 1R6BX 1MX0A 2R4JA 3PFIA 4G4RA 4D82A 2L7IA 2DZNB 1R7RA 4FVMA 1DO0A 3A46A 3C58A 3KS8A 4M0WA 4GKJM 4BLCA 3R9XB 2R62A 5KPZA 4LZJA 2EA0A 1W5SA 1DGFA 3FUTA 1TH3A 1L2DA 3H4MA 1N36M 3KDSE 3LVWA 3QAUA 4LFAM 3U6CA 1W5TA 2QCUA 3GPUA 4DV5M 1N33M 3PNYA 3Q8XA 3GQ5A 3DFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EO2 A; 
#chains in the Genus database with same CATH topology
 5FTJ A;  3VFD A;  5ITR A;  3K2L A;  4AG6 A;  1AUA A;  1TR8 A;  2UXD M;  4NC6 A;  2V6Z M;  4JI4 M;  1QYR A;  3KXE C;  1C7Y A;  2BWB A;  4G4Q A;  2MJ5 B;  2XEP A;  4X66 M;  4JI1 M;  1L2B A;  3FTE A;  3ILK A;  3EIE A;  2FE8 A;  3SYL A;  1N77 A;  2CHQ A;  2CV1 A;  2W82 A;  4LJ8 A;  2JZ1 A;  2FH0 A;  1K3X A;  3I4V A;  1G71 A;  3MHV C;  2I7N A;  2C98 A;  2JP7 A;  3J7A S;  3GLI E;  4KHP M;  1JQJ C;  4DV7 M;  1G59 A;  3KP0 E;  1HT1 E;  1NY6 A;  2LVP C;  3PVS A;  1JR3 D;  4RF1 A;  1TH2 A;  3I04 M;  2X4A A;  4LF4 M;  2X8A A;  2G3Q A;  4NL4 H;  1OFI A;  2F5P A;  4X62 M;  2WSF F;  4DV6 M;  3MMP A;  3UGJ A;  1SXJ A;  3A98 B;  3MK6 A;  4I81 A;  1I94 M;  3K1J A;  2BNK A;  1G8P A;  2OOA A;  3VLF B;  7CAT A;  4MGK E;  2RKO A;  1VQ1 A;  4LGM A;  1QUS A;  1QAN A;  1YSY A;  3FE3 A;  4L6V 6;  5ITX E;  1WR1 B;  1Q02 A;  4Q7J A;  1N34 M;  1LTM A;  2VF7 A;  1OAO C;  1XHB A;  2LHG A;  3HHY A;  2CV0 A;  5EP2 A;  2C99 A;  2EJS A;  3KW6 A;  2KDL A;  3LW5 F;  1DGG A;  4X65 M;  1KFV A;  3VK7 A;  3M6A A;  4QOZ C;  1ZV1 A;  2KHH A;  2CHV A;  1R4G A;  2JXN A;  4JI3 M;  2UUB M;  3GQ4 A;  1E9S A;  2K47 A;  4I4L A;  1ZQ9 A;  4XGI A;  4RF0 A;  1VEG A;  2H5X A;  1I4W A;  1NJG A;  1NVM A;  2LVO C;  1HQY E;  4AKI A;  3QWL A;  2R4E A;  2RRU A;  4IBC A;  2OPF A;  4B3S M;  2I7P A;  3FRH A;  2LTU A;  1JR3 A;  1Q3C A;  1MJG M;  2MRO B;  4WW0 A;  3L26 A;  2V1U A;  3M7G A;  3L25 A;  3SAW A;  1Q3B A;  2Z4R A;  4OVZ A;  3C9P A;  3BXW A;  3HWS A;  3U6E A;  2QSF X;  1AIP C;  1GL6 A;  3KP1 E;  4MH0 E;  3DOA A;  1VEJ A;  3TPZ A;  3TWK A;  1DGB A;  4B08 A;  4YHH M;  3FTF A;  2N35 A;  4PDG A;  4FCV A;  1D0K A;  1QDT A;  3CTW B;  2CRU A;  3L2A A;  1HNZ M;  3K9P A;  2XZU A;  4IBJ A;  2G5G X;  1NHG C;  4IBK A;  4QHS A;  3W67 A;  3HU2 A;  2EO2 A;  1LV7 A;  1TTE A;  3KSX A;  3AOE A;  3T6P A;  2R65 A;  2HKJ A;  3SC3 A;  4AZF A;  1Z5C A;  3HU3 A;  4DUZ M;  4LF9 M;  2BJV A;  2VQF M;  1HT2 E;  4DR2 M;  3GRR A;  3GRU A;  2L7H A;  4GMQ A;  3ZH9 B;  4GKK M;  1T43 A;  4IBG A;  4JN6 A;  2L4F A;  4QHT A;  5EP1 A;  4LJ6 A;  1EIJ A;  3J80 S;  2DXI A;  2XZF A;  4KLN A;  4YY3 M;  2C96 A;  2R18 A;  4B3M M;  4GC5 A;  2DWM A;  3KOX E;  1IXS B;  3E9S A;  3GLG E;  4M9S A;  5BPV A;  2K9D A;  2DKL A;  4DV1 M;  4PDI A;  2M5Z A;  2P5T A;  3EIH A;  4CIZ A;  4FWG A;  1KSF X;  1V92 A;  1QZM A;  3PNV A;  8CAT A;  1A5T A;  2F5Q A;  4L8R C;  1IXZ A;  1EFU B;  1J7K A;  5BR8 M;  1RU3 A;  2KNZ A;  3AKZ A;  3DA1 A;  2A5Y B;  3L29 A;  1E94 E;  4QOS A;  5KQ8 A;  2MR9 A;  1CUK A;  1WHC A;  1OKS A;  3FRI A;  4L15 A;  2UU9 M;  2LHC A;  2QBY A;  1PJS A;  1L1T A;  1NJF A;  5IRE B;  2XFT A;  4IBD A;  1QAQ A;  2QZ4 A;  2R45 A;  1JB0 F;  3GPP A;  3L28 A;  2DEN A;  1IFY A;  3UK6 A;  3HZJ A;  2OOB A;  1NY5 A;  2O25 A;  2XF3 A;  2DAI A;  3HJ8 A;  2D7E A;  4CHT B;  4DV3 M;  3U6P A;  1UFZ A;  2O01 F;  4M9Z A;  4TUW A;  1XB2 B;  1Q39 A;  2CUZ A;  3AOG A;  3U61 A;  1R2Y A;  3HGI A;  4G4O A;  2CE7 A;  1SG9 A;  4IBI A;  4D80 A;  5KQD A;  3BOS A;  1D2N A;  2X49 A;  4HEO A;  2FFJ A;  3K8Z A;  4MGH A;  5IZ7 D;  2KNA A;  4IBE A;  1XWI A;  1E32 A;  4LJ4 A;  3KOW E;  4BB9 A;  4L78 A;  4R71 A;  2DZO B;  2D7H A;  2KNV A;  3U5Z A;  3HKP A;  1XMO M;  2DAM A;  2ZAM A;  3K92 A;  3SAV A;  1PM5 A;  1UM8 A;  2KW0 A;  1D0L A;  4XBO A;  1KYI A;  4JYA M;  3VDU A;  2R0I A;  1QQW A;  5EJC A;  1N75 A;  4CIS A;  4MGY E;  1PJI A;  1IBL M;  1IM2 A;  4MGZ E;  3RGP A;  3ZQJ A;  2QP9 X;  3FUW A;  1SXJ C;  4KO8 A;  3KSJ A;  3U6D A;  3FYC A;  5EXX A;  3QYB A;  3T15 A;  2LVQ D;  3LVV A;  2JZ0 A;  2XGN A;  4LF6 M;  1QUT A;  2APL A;  2R46 A;  5KO3 A;  1L1Z A;  4FW9 A;  2QQ8 A;  1IN8 A;  4QNR A;  5DYG A;  4Z8X A;  4CJ6 A;  4JI7 M;  4DR5 M;  3C3D A;  1ZMV A;  4NRW A;  4LY6 A;  2LH0 A;  2F4V M;  2F5N A;  4S12 A;  3GLI A;  4GC9 A;  2DNA A;  1TGU A;  4F2L A;  5L8R F;  3UJN A;  3GLG A;  4ZPX A;  3FUV A;  2R6F A;  4IBB A;  3UMM A;  2KEB A;  3C3E A;  4DV2 M;  1K82 A;  1IBK M;  2DWN A;  1IQP A;  3GLI B;  4NRV A;  1QZE A;  1DGH A;  4NSO B;  3GLH B;  1VG5 A;  3AJI B;  2ZAN A;  1GJT A;  2CHG A;  3HJQ A;  3MJ5 A;  2C9C A;  3E4R A;  2C9O A;  4LZZ A;  5H37 D;  2BJW A;  1QAO A;  5F3W A;  3JAM S;  3B7Z A;  1PGY A;  1NNU C;  1XNQ M;  4G6Z A;  2QEN A;  3SHF A;  3SAS A;  5FTK A;  2FS1 A;  1ZMU A;  1GAB A;  2QPA A;  2JY8 A;  2WSC F;  2LWX A;  2DAE A;  2DHR A;  2OQ4 A;  3GRV A;  2JY5 A;  4FCT A;  5A2Q S;  4GIT A;  1Z59 A;  1GJS A;  3HHZ A;  5DNY A;  4DUY M;  2CFO A;  1OIP A;  2K0B X;  3RGS A;  3GLG B;  2Y0T A;  4F1I A;  1OIZ A;  3J2P B;  3FKE A;  4Z6Y A;  3U6Q A;  3SMP A;  3B9P A;  2Z7J A;  4FWD A;  3LCV B;  4W5W A;  1G4A E;  1OJL A;  3HX3 A;  3U60 B;  5IT9 S;  4WUR A;  3QYE A;  5FLX S;  3GLH E;  2LBC A;  4LGY A;  4B7F A;  3U5Z B;  3WHK A;  1SXJ E;  2BWE A;  4JXJ A;  2NQ8 C;  2C5R A;  3LQR A;  3CF6 E;  5C18 A;  4UN2 B;  4IBF A;  4JV5 M;  1K3W A;  3A42 A;  2CWB A;  1IY2 A;  5EXP A;  3SFZ A;  1TDH A;  4AKG A;  3U6S A;  1BVS A;  3LMM A;  1R2Z A;  3SBJ A;  1PRB A;  2YR0 A;  5EXS A;  5EP4 A;  1XC8 A;  2J5Y A;  5ITT A;  3FD9 A;  1HQC A;  1FJG M;  2XSZ D;  5ITU A;  1IN4 A;  2DWZ B;  3LCU A;  2L09 A;  1PJQ A;  1WIV A;  4GHA A;  2CP8 A;  1G3I A;  1N78 A;  2YNM D;  4HL4 A;  2KXE A;  2EUC A;  3SAU A;  3B7Q A;  3J27 B;  1TDZ A;  4I5S A;  2B3T A;  1X37 A;  3U6O A;  1E9R A;  3GLH A;  2VDB B;  2Z8Y M;  4LJA A;  4ANR A;  1IBM M;  1ZAE A;  4B3T M;  1NHW C;  3FYD A;  3GPX A;  4JI8 M;  2Y21 A;  4LCB A;  1NSF A;  4RNA A;  1SXJ B;  3FTC A;  4LG2 A;  4AQY M;  2HHH M;  3TE6 A;  4DR3 M;  1Z5B A;  3VKH A;  3IG5 A;  3I01 M;  4NXN M;  3AOE C;  1XXH E;  4P16 A;  4ITQ A;  4RKU F;  1XMQ M;  2FOI C;  1IN6 A;  1NO1 A;  3W0L B;  5EQT A;  2LNH C;  3KFU G;  2HAK A;  3I51 A;  2MGW A;  3HJS A;  2KZS A;  5DYI A;  3VDP A;  3B7N A;  5FTM A;  4KT0 F;  3K9O A;  1OTR A;  4JI2 M;  3A45 A;  3SAT A;  4NXM M;  2YFQ A;  2ZBK B;  4LFC M;  4QNM A;  2ZM6 M;  1GO5 A;  2LXE A;  5ITY A;  3NBI A;  1R5L A;  3CGW A;  4NSR A;  4OVZ B;  1HNW M;  4OW0 A;  3JR5 A;  1V33 A;  2EKF A;  5E6J A;  2Q2E B;  5ITX A;  4CGY B;  2K6B A;  4X64 M;  1G41 A;  2J7N A;  3VK8 A;  1QAM A;  1V34 A;  1XNR M;  1J09 A;  3AV0 A;  4B3R M;  2KRU A;  1SXJ D;  2KRK A;  3NBX X;  2Z3X A;  3FTD A;  1YE9 A;  2HL7 A;  4G4N A;  2F5O A;  4JI5 M;  1QDR A;  2QNJ A;  3DZD A;  1NV9 A;  3J7B A;  1PJJ A;  4DR7 M;  5JI3 E;  2G8L A;  2F5S A;  3SAR A;  1GVN A;  3IEC A;  4M0D A;  3U61 B;  1MU5 A;  1S3S A;  4MM3 B;  2DI0 A;  3R8F A;  3SHG B;  1ORY B;  2DWL A;  1WXQ A;  3FUU A;  2UXB M;  1FNN A;  3SYK A;  3TQS A;  4GRI A;  4P17 A;  2RGH A;  5ITQ A;  1IXR C;  2RGO A;  1EE8 A;  2JY6 B;  4LRS A;  3GPY A;  1DV0 A;  1JR3 E;  1ZMW A;  3GLF B;  2QBY B;  4B7G A;  3NWL A;  3HHW A;  1HR0 M;  3GP1 A;  4MGI E;  4R3D A;  4NOO B;  3JR4 A;  1T6O A;  4LJ9 A;  3TWL A;  3T1H M;  4IJF A;  1HJP A;  1XXH A;  5C1B A;  3TWM A;  2LVA A;  4FCW A;  1GL7 A;  1IN5 A;  3TL4 X;  4B7H A;  1J5E M;  1N32 M;  3VKG A;  4LRT A;  3KS4 A;  2VQE M;  1NV8 A;  1D0M A;  5LMU M;  2ZAO A;  1DGH B;  3AFH A;  3D8L A;  4DV0 M;  1OFH A;  2LVN C;  2QHO B;  2M60 A;  2YQZ A;  2L2D A;  3F92 A;  5E26 A;  2DAK A;  5FTL A;  2Z4S A;  3CF0 A;  2JA2 A;  1PJT A;  4AW4 A;  2DZL A;  2HCB A;  1L8Q A;  4JI6 M;  1IN7 A;  3J81 S;  1IY1 A;  4LF5 M;  1F4I A;  4AG5 A;  2CV2 A;  5KPT A;  3M0E A;  4R7G A;  1Z6T A;  1GKI A;  1DO2 A;  1T3T A;  3FUX A;  3HU1 A;  4G3O A;  5LMN M;  3THG A;  4HLQ A;  1VDD A;  4Y28 F;  4AKH A;  1QVR A;  1C1K A;  3GRY A;  2H1R A;  4OX9 M;  4EIW A;  5FSW A;  2V1C A;  4JI0 M;  4DR4 M;  3UZU A;  3Q8G A;  1Z5A A;  1H6U A;  3RFW A;  3HHX A;  3WHL A;  4PCZ A;  3L27 A;  5IWA M;  4MB7 A;  2DVW B;  2XH9 A;  4D81 A;  3GO8 A;  1NNJ A;  3H4J A;  3KOZ E;  4M9X A;  3W0F A;  3DFZ A;  3B89 A;  2WSE F;  5KPR A;  1MN3 A;  2JNH A;  4K0K M;  1YUB A;  2JUJ A;  1TH4 A;  2AHM A;  4KOD A;  4XK8 F;  2O5R A;  4AI6 A;  2R44 A;  3GLF A;  5DFL A;  3T1Y M;  2KA6 B;  1VEK A;  3I4Y A;  1OAI A;  3OTO M;  2XLJ A;  3HY5 A;  1VDL A;  4L4U A;  4IJE A;  4DR6 M;  2FNA A;  2UXC M;  2ZTC A;  4LJ7 A;  3BBZ A;  1XXH B;  2WZJ A;  4GH9 A;  2OO9 A;  2L6O A;  3RE8 A;  4LJ5 A;  4LF7 M;  2Y20 A;  3U60 A;  4OU7 A;  4LF8 M;  4FD2 A;  4I8O A;  5FTN A;  2VF8 A;  2E5L M;  2KZU A;  2XFS A;  4A3V B;  5EXT A;  2CEA A;  2JWS A;  4DV4 M;  1WJ7 A;  4GEW A;  3B74 A;  3KOY E;  5JI2 E;  4LFB M;  2JY7 A;  3PXG A;  3ZCB B;  2MH8 A;  4PD2 A;  3LQQ A;  3AL0 C;  2L4E A;  1HNX M;  2ERC A;  1YLA A;  4L16 A;  3U6M A;  1P3Q Q;  2GNO A;  2UUA M;  4DBG B;  1IXS A;  4IIW A;  2D7G A;  2EKK A;  3SMS A;  1L2C A;  1GLN A;  4GIP A;  3IG8 A;  5EP3 A;  3W68 A;  4BBA A;  3U6L A;  3GQ3 A;  1OQY A;  2VII A;  4II7 A;  3T38 A;  2J7O A;  1WGN A;  2HWJ A;  4REZ A;  3ZC7 B;  3KVW A;  5GKN A;  1Y8G A;  2XSZ A;  2ZTD A;  4DR1 M;  4GHL A;  3IHP A;  3D8B A;  4FWH A;  1TF0 B;  1WGL A;  2Y0Q A;  3CF2 A;  4PT5 A;  2UUC M;  1R6B X;  1MX0 A;  2DAG A;  2R4J A;  3PFI A;  4G4R A;  4D82 A;  2L7I A;  2DZN B;  1R7R A;  3GLF E;  4FVM A;  1DO0 A;  3A46 A;  3C58 A;  4WP2 A;  3E21 A;  4M0W A;  3KS8 A;  4GKJ M;  4BLC A;  3R9X B;  2R62 A;  5KPZ A;  4LZJ A;  2EA0 A;  1W5S A;  1DGF A;  2GQF A;  1TH3 A;  3FUT A;  3E46 A;  3H4M A;  1L2D A;  1N36 M;  3KDS E;  3LVW A;  3QAU A;  4LFA M;  3U6C A;  1W5T A;  2DHY A;  2QCU A;  3GPU A;  4DV5 M;  1N33 M;  3PNY A;  3Q8X A;  3V76 A;  3GQ5 A;  1IY0 A; 
#chains in the Genus database with same CATH homology
 5FTJ A;  3VFD A;  5ITR A;  3K2L A;  4AG6 A;  2UXD M;  2V6Z M;  4JI4 M;  1QYR A;  3KXE C;  4JI1 M;  4G4Q A;  2XEP A;  4X66 M;  3FTE A;  1L2B A;  3ILK A;  3EIE A;  2FE8 A;  3SYL A;  1N77 A;  2CHQ A;  2CV1 A;  2W82 A;  4LJ8 A;  1K3X A;  3I4V A;  3MHV C;  2I7N A;  2C98 A;  3J7A S;  4KHP M;  1JQJ C;  4DV7 M;  1G59 A;  3KP0 E;  1HT1 E;  1NY6 A;  3PVS A;  4RF1 A;  1JR3 D;  1TH2 A;  4LF4 M;  2X4A A;  2X8A A;  4NL4 H;  1OFI A;  2F5P A;  4X62 M;  4DV6 M;  3UGJ A;  1SXJ A;  3A98 B;  3MK6 A;  4I81 A;  1I94 M;  3K1J A;  2BNK A;  1G8P A;  3VLF B;  7CAT A;  4MGK E;  2RKO A;  4LGM A;  1QAN A;  1YSY A;  5ITX E;  1N34 M;  1XHB A;  3HHY A;  2CV0 A;  5EP2 A;  2C99 A;  3KW6 A;  1DGG A;  4X65 M;  1KFV A;  3VK7 A;  3M6A A;  4QOZ C;  2CHV A;  4JI3 M;  2UUB M;  3GQ4 A;  1E9S A;  2K47 A;  4I4L A;  1ZQ9 A;  4XGI A;  4RF0 A;  1I4W A;  1NJG A;  1NVM A;  1HQY E;  4AKI A;  3QWL A;  2R4E A;  4IBC A;  2OPF A;  4B3S M;  2I7P A;  1JR3 A;  1Q3C A;  4WW0 A;  2V1U A;  3L26 A;  3M7G A;  3L25 A;  3SAW A;  1Q3B A;  2Z4R A;  4OVZ A;  3HWS A;  3U6E A;  1GL6 A;  3KP1 E;  4MH0 E;  3DOA A;  3TPZ A;  3TWK A;  1DGB A;  4B08 A;  4YHH M;  3FTF A;  4PDG A;  4FCV A;  3CTW B;  3L2A A;  1HNZ M;  2XZU A;  4IBJ A;  2G5G X;  1NHG C;  4IBK A;  4QHS A;  3HU2 A;  2EO2 A;  1LV7 A;  3KSX A;  3AOE A;  4LF9 M;  2R65 A;  2HKJ A;  3SC3 A;  4AZF A;  1Z5C A;  3HU3 A;  4DUZ M;  2BJV A;  2VQF M;  1HT2 E;  4DR2 M;  3GRR A;  3GRU A;  2L7H A;  4GMQ A;  3ZH9 B;  4GKK M;  4IBG A;  4JN6 A;  4QHT A;  5EP1 A;  4LJ6 A;  3J80 S;  2DXI A;  2XZF A;  4KLN A;  4YY3 M;  2C96 A;  2R18 A;  4B3M M;  4GC5 A;  2DWM A;  3KOX E;  1IXS B;  3E9S A;  4M9S A;  5BPV A;  4DV1 M;  4PDI A;  2M5Z A;  2P5T A;  3EIH A;  4FWG A;  1KSF X;  1QZM A;  3PNV A;  8CAT A;  2F5Q A;  4L8R C;  1IXZ A;  5BR8 M;  1J7K A;  3AKZ A;  3DA1 A;  2A5Y B;  3L29 A;  1E94 E;  4QOS A;  5KQ8 A;  4L15 A;  2UU9 M;  2QBY A;  1L1T A;  1NJF A;  5IRE B;  2XFT A;  1IY0 A;  4IBD A;  1QAQ A;  2QZ4 A;  2R45 A;  3GPP A;  3L28 A;  3UK6 A;  4DV3 M;  1NY5 A;  2XF3 A;  4CHT B;  3HJ8 A;  3U6P A;  2D7E A;  4M9Z A;  4TUW A;  1Q39 A;  2CUZ A;  3AOG A;  3U61 A;  1R2Y A;  3HGI A;  4G4O A;  2CE7 A;  4IBI A;  4D80 A;  5KQD A;  3BOS A;  1D2N A;  2X49 A;  4MGH A;  2FFJ A;  3K8Z A;  5IZ7 D;  4IBE A;  1XWI A;  1E32 A;  4LJ4 A;  3KOW E;  4BB9 A;  4L78 A;  1XMO M;  2DZO B;  2D7H A;  3U5Z A;  3HKP A;  3SAV A;  2ZAM A;  3K92 A;  1PM5 A;  1UM8 A;  2KW0 A;  4XBO A;  1KYI A;  4JYA M;  3VDU A;  1QQW A;  5EJC A;  1N75 A;  4CIS A;  4MGY E;  1PJI A;  1IBL M;  1IM2 A;  4MGZ E;  3RGP A;  2QP9 X;  3FUW A;  1SXJ C;  4KO8 A;  3KSJ A;  3U6D A;  3FYC A;  5EXX A;  3T15 A;  3LVV A;  2XGN A;  4LF6 M;  5KO3 A;  2R46 A;  1L1Z A;  4FW9 A;  1IN8 A;  4QNR A;  5DYG A;  4Z8X A;  4JI7 M;  4DR5 M;  4NRW A;  2F4V M;  4LY6 A;  2LH0 A;  2F5N A;  4S12 A;  3GLI A;  4GC9 A;  1TGU A;  3UJN A;  3GLG A;  4ZPX A;  3FUV A;  4IBB A;  1K82 A;  3UMM A;  2KEB A;  4DV2 M;  1IBK M;  2DWN A;  1IQP A;  3GLI B;  4NRV A;  1DGH A;  4NSO B;  3GLH B;  3AJI B;  2ZAN A;  2CHG A;  3HJQ A;  3MJ5 A;  2C9C A;  3E4R A;  2C9O A;  4LZZ A;  5H37 D;  2BJW A;  1QAO A;  5F3W A;  3JAM S;  1NNU C;  1XNQ M;  4G6Z A;  2QEN A;  3SHF A;  3SAS A;  5FTK A;  2QPA A;  2LWX A;  2DHR A;  2OQ4 A;  3GRV A;  4FCT A;  5A2Q S;  4GIT A;  1Z59 A;  3HHZ A;  5DNY A;  4DUY M;  2CFO A;  3RGS A;  3GLG B;  2Y0T A;  3J2P B;  3FKE A;  4Z6Y A;  3U6Q A;  3SMP A;  3B9P A;  2Z7J A;  4FWD A;  4W5W A;  1G4A E;  1OJL A;  3U60 B;  5IT9 S;  4WUR A;  5FLX S;  3U5Z B;  4LGY A;  4B7F A;  3WHK A;  1SXJ E;  4JXJ A;  2NQ8 C;  2C5R A;  3LQR A;  3CF6 E;  5C18 A;  4JV5 M;  4IBF A;  1K3W A;  3A42 A;  1IY2 A;  5EXP A;  3SFZ A;  1TDH A;  4AKG A;  3U6S A;  1R2Z A;  3LMM A;  3SBJ A;  2YR0 A;  5EXS A;  1XC8 A;  5EP4 A;  5ITT A;  3FD9 A;  1HQC A;  1FJG M;  2XSZ D;  5ITU A;  1IN4 A;  2DWZ B;  2L09 A;  4GHA A;  1G3I A;  1N78 A;  2YNM D;  4HL4 A;  2KXE A;  2EUC A;  3SAU A;  1TDZ A;  3J27 B;  4I5S A;  1X37 A;  3U6O A;  1E9R A;  3GLH A;  4LJA A;  1IBM M;  1ZAE A;  4B3T M;  1NHW C;  3FYD A;  3GPX A;  4JI8 M;  2Y21 A;  4LCB A;  1NSF A;  4RNA A;  1SXJ B;  3FTC A;  4LG2 A;  4AQY M;  2HHH M;  3TE6 A;  4DR3 M;  1Z5B A;  3VKH A;  3IG5 A;  4NXN M;  3AOE C;  4P16 A;  4ITQ A;  1XMQ M;  2FOI C;  1IN6 A;  3W0L B;  5EQT A;  2LNH C;  3KFU G;  3I51 A;  3HJS A;  2KZS A;  5DYI A;  3VDP A;  5FTM A;  4JI2 M;  3A45 A;  3SAT A;  4NXM M;  2YFQ A;  2ZBK B;  4LFC M;  4QNM A;  2ZM6 M;  2LXE A;  5ITY A;  3NBI A;  4NSR A;  4OVZ B;  1HNW M;  4OW0 A;  3JR5 A;  5E6J A;  2Q2E B;  5ITX A;  4CGY B;  4X64 M;  1G41 A;  2J7N A;  3VK8 A;  1QAM A;  1XNR M;  1J09 A;  3AV0 A;  4B3R M;  2KRU A;  1SXJ D;  2KRK A;  2Z3X A;  2F5O A;  3FTD A;  1YE9 A;  2HL7 A;  4G4N A;  4JI5 M;  3DZD A;  1PJJ A;  4DR7 M;  3J7B A;  5JI3 E;  2G8L A;  2F5S A;  3SAR A;  1GVN A;  4M0D A;  3U61 B;  1MU5 A;  1S3S A;  4MM3 B;  3R8F A;  3SHG B;  1ORY B;  2DWL A;  1WXQ A;  3FUU A;  2UXB M;  1FNN A;  3SYK A;  3TQS A;  4GRI A;  2RGH A;  5ITQ A;  1IXR C;  2RGO A;  1EE8 A;  4LRS A;  3GPY A;  3GLF B;  2QBY B;  4B7G A;  3NWL A;  3HHW A;  1HR0 M;  3GP1 A;  4MGI E;  4R3D A;  4NOO B;  3JR4 A;  3TWL A;  4LJ9 A;  3T1H M;  4IJF A;  1XXH A;  5C1B A;  3TWM A;  4FCW A;  1GL7 A;  1IN5 A;  3TL4 X;  4B7H A;  1J5E M;  1N32 M;  3VKG A;  4LRT A;  3KS4 A;  2VQE M;  5LMU M;  2ZAO A;  1DGH B;  3AFH A;  3D8L A;  4DV0 M;  1OFH A;  2M60 A;  2YQZ A;  5E26 A;  5FTL A;  3CF0 A;  2Z4S A;  2JA2 A;  4AW4 A;  4LF5 M;  2HCB A;  1L8Q A;  4JI6 M;  1IN7 A;  3J81 S;  1IY1 A;  4AG5 A;  2CV2 A;  5KPT A;  3M0E A;  4R7G A;  1Z6T A;  1GKI A;  1DO2 A;  1T3T A;  3FUX A;  3HU1 A;  5LMN M;  3THG A;  4HLQ A;  1VDD A;  4AKH A;  1QVR A;  1C1K A;  3GRY A;  2H1R A;  4OX9 M;  4EIW A;  5FSW A;  2V1C A;  4JI0 M;  4DR4 M;  3UZU A;  1Z5A A;  1H6U A;  3RFW A;  3HHX A;  3WHL A;  4PCZ A;  3L27 A;  5IWA M;  4MB7 A;  2DVW B;  2XH9 A;  4D81 A;  3GO8 A;  1NNJ A;  3KOZ E;  4M9X A;  3W0F A;  5KPR A;  4K0K M;  1YUB A;  1TH4 A;  2AHM A;  4KOD A;  2O5R A;  4AI6 A;  3GLF A;  3T1Y M;  2KA6 B;  3I4Y A;  3OTO M;  2XLJ A;  4L4U A;  4IJE A;  4DR6 M;  2FNA A;  2UXC M;  4LJ7 A;  1XXH B;  4GH9 A;  2L6O A;  3RE8 A;  4LJ5 A;  4LF7 M;  2Y20 A;  3U60 A;  4OU7 A;  4LF8 M;  4FD2 A;  4I8O A;  5FTN A;  2E5L M;  2KZU A;  2XFS A;  4A3V B;  5EXT A;  2CEA A;  4DV4 M;  3KOY E;  5JI2 E;  4LFB M;  3PXG A;  3ZCB B;  4PD2 A;  3LQQ A;  3AL0 C;  1HNX M;  2ERC A;  4L16 A;  3U6M A;  2UUA M;  4IIW A;  2D7G A;  3SMS A;  1L2C A;  1GLN A;  4GIP A;  3IG8 A;  5EP3 A;  4BBA A;  3U6L A;  3GQ3 A;  2VII A;  4II7 A;  3T38 A;  2J7O A;  4REZ A;  3ZC7 B;  3KVW A;  5GKN A;  2XSZ A;  4DR1 M;  4GHL A;  3D8B A;  4FWH A;  2Y0Q A;  3CF2 A;  4PT5 A;  2UUC M;  1R6B X;  1MX0 A;  2R4J A;  3PFI A;  4G4R A;  4D82 A;  2L7I A;  2DZN B;  1R7R A;  4FVM A;  1DO0 A;  3A46 A;  3C58 A;  3KS8 A;  4M0W A;  4GKJ M;  4BLC A;  3R9X B;  2R62 A;  5KPZ A;  4LZJ A;  2EA0 A;  1W5S A;  1DGF A;  3FUT A;  1TH3 A;  1L2D A;  3H4M A;  1N36 M;  3KDS E;  3LVW A;  3QAU A;  4LFA M;  3U6C A;  1W5T A;  2QCU A;  3GPU A;  4DV5 M;  1N33 M;  3PNY A;  3Q8X A;  3GQ5 A;  3DFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...