2EO2A

Solution structure of the insertion region (510-573) of fthfs domain from mouse methylenetetrahydrofolate dehydrogenase (nadp+ dependent) 1-like protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
71
structure length
71
Chain Sequence
GSSGSSGSTQTDKALYNRLVPLVNGVREFSEIQLSRLKKLGIHKTDPSTLTEEEVRKFARLNIDPATITWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the insertion region (510-573) of FTHFS domain from mouse methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like protein
rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Adult male hypothalamus cDNA, RIKEN full-length enriched lib
total genus 7
structure length 71
sequence length 71
ec nomenclature ec 6.3.4.3: Formate--tetrahydrofolate ligase.
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.770 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2eo2A00
2EO2A
chains in the Genus database with same CATH superfamily
3RGSA 1NY5A 2LVAA 1L2BA 1SG9A 4JYAM 2LH0A 3J27B 2OO9A 4DR6M 1IN6A 4LF5M 4LG2A 3KOXE 1AUAA 5EQTA 2ZAOA 3ZCBB 1KFVA 1IXRC 4JI0M 2AHMA 3E21A 4JI1M 3I4YA 1WJ7A 2UU9M 3C3DA 2JZ0A 4GITA 5FTJA 5IT9S 1D0KA 3JAMS 1QUTA 4MGYE 4QOSA 2F5QA 4M9SA 5FLXS 4P16A 5DYGA 3CF2A 2R4EA 1YUBA 3B9PA 4PD2A 3GLIE 2RGHA 3C3EA 1UM8A 4IBJA 2OOBA 1XHBA 4RF1A 5BPVA 1DGFA 4ITQA 1TTEA 1PJSA 2R46A 4D81A 2XEPA 1P3QQ 4DV4M 3HU1A 3KW6A 4LF6M 4NSRA 4X64M 4JV5M 4G4RA 2EA0A 1S3SA 3FUWA 3UMMA 2F5SA 3U6EA 2R45A 4F2LA 3ILKA 2DWMA 5EXXA 3A98B 4OX9M 2UUAM 1GO5A 2D7EA 3UZUA 1A5TA 1KYIA 1GKIA 2C96A 3L25A 2DENA 1Z5AA 3KP0E 4CGYB 3FKEA 3VK7A 4YHHM 3LW5F 4B3RM 4FWHA 2K47A 3RGPA 2A5YB 3PNVA 4WW0A 1IQPA 2XGNA 4L15A 5ITXA 3A42A 2E5LM 1IN8A 4IJEA 1PJIA 3B89A 4R7GA 3HHXA 4W5WA 1XXHA 4B7FA 1N33M 2NQ8C 4AI6A 5KQ8A 3QAUA 3GPPA 3SMPA 3K1JA 1W5TA 3L27A 1HT2E 3HY5A 4HLQA 4XGIA 4LZJA 5LMNM 1XXHB 3AOEA 2Y20A 2J5YA 4LY6A 1WGNA 4DR2M 2EJSA 2YQZA 1WIVA 1IXSB 5IREB 2LVPC 2CP8A 2KZSA 1GLNA 3HHYA 2XFSA 2ZTDA 4FVMA 4LFCM 2XSZA 1JR3A 1IXSA 2LBCA 2LVNC 3IHPA 3L2AA 5EP2A 2DKLA 2QBYB 3AOEC 1QANA 5KQDA 5ITXE 3U5ZA 4IBBA 1N78A 3TL4X 2JA2A 1XB2B 3I4VA 4AQYM 1SXJA 3SMSA 4IJFA 4Z8XA 1XXHE 3FTDA 1NHWC 5C18A 1OQYA 2G8LA 5E6JA 1T43A 4DR5M 4KO8A 4MGIE 1ZMUA 3U60B 4L4UA 3KOYE 2KA6B 4DBGB 1D0LA 1IN7A 4FCWA 4JN6A 1CUKA 1R2YA 4AG6A 2HKJA 4MH0E 1Q39A 3AKZA 1PJQA 1NNUC 2CWBA 1DGHB 2QPAA 4GMQA 4LRSA 3GLIB 3KS8A 1F4IA 1V92A 8CATA 5FSWA 4NXNM 1OAOC 3C9PA 3AL0C 5EXSA 3ZH9B 1Q3CA 1NSFA 3PXGA 3NBXX 3U6DA 5JI2E 1NNJA 3BXWA 2JY8A 1TR8A 4B3MM 3H4JA 1JR3E 1TH4A 3B7QA 4NSOB 1IN5A 3HJ8A 4G6ZA 5ITTA 1HQYE 1WGLA 1QZEA 2QQ8A 3LVWA 3GLFB 2ZTCA 3LMMA 2DXIA 3D8LA 5ITUA 5A2QS 3MK6A 3E46A 5KPTA 1SXJE 4NRVA 3HGIA 1QVRA 3T1YM 5DNYA 2JY6B 5EP1A 2CV1A 2CHVA 3RFWA 3QWLA 3QYBA 3LVVA 3CTWB 2VQFM 1N75A 3PVSA 3SARA 2JZ1A 4DV0M 5H37D 3C58A 4LCBA 1QZMA 3GLFA 1ZV1A 2JY5A 3I01M 5IZ7D 1R5LA 3B74A 4MGZE 4BLCA 4S12A 1TF0B 4ANRA 4UN2B 5EXTA 4M9ZA 3EIHA 3UGJA 1Q02A 2WSFF 4QHTA 2MROB 4PDGA 5KPZA 5JI3E 2CE7A 3KDSE 2O25A 1WHCA 3GRUA 2CHQA 3L29A 2C98A 1Q3BA 1IBLM 4XK8F 2L7HA 3KSJA 1VEJA 4II7A 4LJ9A 1IXZA 4CJ6A 2MR9A 3SHGB 3SHFA 4AKGA 2F5PA 1RU3A 4B3SM 3Q8XA 1J7KA 4MM3B 4EIWA 1L8QA 2F5OA 3J80S 2M60A 2LVQD 4IBFA 4LFAM 1I94M 2DAMA 1ORYB 4KT0F 2H1RA 3GLGB 1NJFA 3TWMA 5FTLA 4R71A 1K82A 4LF7M 2LWXA 4GKJM 2DHYA 1E9SA 1XMQM 1EIJA 3L26A 3VDUA 2KNVA 3PNYA 3GLFE 1IY0A 4FWGA 4JI8M 4TUWA 1Z6TA 2R65A 3U5ZB 2RGOA 4CISA 4JI5M 2I7NA 4I4LA 2V1CA 2KXEA 2EKFA 4PDIA 1G8PA 3AFHA 3IG8A 4JI4M 3W0LB 2CV2A 2LHGA 3U6QA 2FOIC 1G4AE 2RKOA 2DWZB 3GLHB 3K2LA 3M7GA 4G4OA 4LJAA 2LNHC 4M9XA 1K3WA 1MN3A 5FTNA 4L6V6 4IBCA 3FTEA 1XNRM 1MX0A 1Z5BA 2FH0A 4KODA 2VIIA 3VKGA 1KSFX 3E4RA 2N35A 1JR3D 2VDBB 4LJ4A 3CF6E 3ZQJA 1YSYA 1WXQA 4G4QA 3HHZA 2ZBKB 1QYRA 4DR4M 1C1KA 3DA1A 1Y8GA 2LVOC 1OJLA 4CHTB 3HKPA 2H5XA 2X49A 1NHGC 4B08A 1BVSA 1R6BX 3GPXA 4D80A 2I7PA 4XBOA 4MGKE 2CHGA 2CUZA 2QCUA 3HZJA 4REZA 2WSCF 3H4MA 4DV3M 2FE8A 4PT5A 2FFJA 1VDDA 4IBIA 1OKSA 3Q8GA 5ITRA 4DUYM 1L1ZA 1HNXM 3HU3A 3FUXA 3A46A 4LJ6A 1NV8A 3K9OA 3W67A 1X37A 4R3DA 4DV1M 4IBEA 3FE3A 3FUTA 3WHKA 2HHHM 1HNWM 4GEWA 2C99A 2LHCA 3U6OA 2VF8A 2F4VM 4GC5A 1IY2A 3EIEA 2C9OA 2UXCM 4B7HA 1GJTA 4MB7A 2HWJA 2DAEA 3K9PA 3J81S 1JQJC 1Z59A 2JXNA 4OU7A 5EJCA 4LGMA 2JNHA 3LQQA 1TDZA 3U6SA 2XLJA 2D7HA 1W5SA 2MGWA 3FRIA 3HHWA 2KDLA 4HL4A 1JB0F 1WR1B 4GH9A 2R6FA 3THGA 2XFTA 2XZFA 2L7IA 3HU2A 2LXEA 1J5EM 1GL7A 3CF0A 1Z5CA 4M0DA 1E94E 1OIPA 1J09A 4KLNA 3MJ5A 2Z3XA 2VF7A 3VK8A 4OW0A 2DZOB 1R4GA 3LQRA 4P17A 5LMUM 2QSFX 4DV7M 3GLGA 2DHRA 3FYDA 2BNKA 4WURA 1TH3A 3U6MA 4OVZA 1V33A 1PJJA 4RF0A 1VEGA 2D7GA 4LRTA 3TWLA 4JI6M 3SATA 4FW9A 3HWSA 1QAMA 2EO2A 1VG5A 2J7OA 3GLHE 2R4JA 2XZUA 2JP7A 1ZAEA 1D2NA 1QQWA 1PM5A 2QENA 2QHOB 2R18A 1K3XA 3CGWA 2DAKA 2DAGA 2YNMD 4DR1M 1MU5A 2JWSA 2CEAA 3T1HM 3T38A 2XF3A 5EP4A 1EE8A 4DUZM 3GRRA 2J7NA 4BBAA 2WZJA 2L6OA 3GO8A 3GRYA 4JI7M 4DR7M 2GNOA 3HJQA 3SAVA 2APLA 2P5TA 3FTFA 1QAQA 2RRUA 4GC9A 3J7BA 4G4NA 1TGUA 5C1BA 3GLGE 1DO0A 4LJ5A 4LZZA 1HNZM 3I51A 2KZUA 3J7AS 3NBIA 1AIPC 2KNAA 3SYLA 4JI3M 3W0FA 2UUBM 5ITYA 2DNAA 2W82A 4LGYA 4LF9M 1DGBA 4DR3M 2MJ5B 3BBZA 3VLFB 4X62M 3MHVC 2QZ4A 2Y0QA 3L28A 5EXPA 3K8ZA 2X8AA 1FJGM 3B7ZA 1OTRA 3GLHA 1XNQM 1QAOA 1ZMWA 1E32A 5FTMA 1ZMVA 4NXMM 2GQFA 3KSXA 2DWNA 1HJPA 2KW0A 3DOAA 1PGYA 2VQEM 1OIZA 1HQCA 2HAKA 1QUSA 1IY1A 1SXJD 2QBYA 2KNZA 2BWBA 3GP1A 3FYCA 1L2CA 2Y0TA 3LCVB 3IECA 4FCTA 3NWLA 3TWKA 3D8BA 2CRUA 3U61B 4DV5M 2DWLA 4K0KM 1G41A 3HJSA 2DAIA 5ITQA 2OOAA 1C7YA 2FNAA 4BB9A 2L4FA 4X66M 4GKKM 4L8RC 3VKHA 1VEKA 3JR4A 4FCVA 2KEBA 4IIWA 4Z6YA 3GQ3A 2G5GX 2ZAMA 4GRIA 4F1IA 4RKUF 2HL7A 3HX3A 4NOOB 4Q7JA 2L09A 4NL4H 4LJ8A 1OAIA 2ZANA 2BJVA 3AJIB 4B7GA 4Y28F 1GL6A 3FUVA 2L2DA 1MJGM 3M6AA 3UJNA 4L16A 3KFUG 1IM2A 5DFLA 1VQ1A 3GQ4A 2CV0A 3R9XB 3WHLA 4HEOA 4QOZC 4LFBM 1IBKM 4L78A 5GKNA 3FRHA 2R62A 1GABA 3V76A 3JR5A 2XH9A 4I81A 4DV2M 2Q2EB 2MH8A 2V6ZM 3FUUA 1DGHA 1T6OA 4AZFA 1R7RA 1NJGA 1NO1A 3PFIA 4IBKA 4CIZA 3R8FA 2Y21A 3QYEA 2BJWA 4GHLA 2UXBM 1OFIA 1TH2A 4OVZB 1V34A 1HT1E 2EUCA 2KRUA 2L4EA 2BWEA 3KOZE 3ZC7B 5BR8M 5L8RF 1FNNA 1PRBA 3RE8A 4A3VB 3GPYA 3GRVA 1L2DA 1NVMA 1SXJB 2Z8YM 2HCBA 1DV0A 3TE6A 1VDLA 2QNJA 2UXDM 2JUJA 1TDHA 2F5NA 2M5ZA 1NY6A 3FD9A 2EKKA 1G71A 5KPRA 3J2PB 4LJ7A 3AV0A 2OQ4A 4AW4A 2C5RA 4I5SA 2K6BA 5E26A 7CATA 4NC6A 4X65M 2K9DA 3U61A 1N36M 1PJTA 4GHAA 2UUCM 4AG5A 4PCZA 1GJSA 5EP3A 3FTCA 3KXEC 2DZNB 3AOGA 1IN4A 2X4AA 3UK6A 2V1UA 3BOSA 3GQ5A 1YLAA 1G3IA 4FWDA 3DFZA 4MGHA 3SFZA 3OTOM 2KRKA 4DV6M 2DVWB 3U6CA 4KHPM 3M0EA 2Z4SA 4JI2M 1N32M 1G59A 3IG5A 2DZLA 2B3TA 2K0BX 2QP9X 4IBDA 4G3OA 2DI0A 4GIPA 5DYIA 1GVNA 4D82A 3LCUA 1T3TA 3E9SA 2R44A 2WSEF 3SAUA 4B3TM 4RNAA 2ZM6M 2KHHA 2XSZD 4M0WA 1OFHA 5FTKA 3TPZA 3TQSA 4AKHA 3SC3A 3KOWE 2LTUA 5IWAM 1DGGA 4QHSA 3T6PA 2Z4RA 4I8OA 2OPFA 3W68A 3A45A 3SYKA 3U6LA 5F3WA 1R2ZA 1E9RA 4YY3M 1UFZA 2ERCA 1L1TA 3GPUA 1H6UA 2YR0A 2G3QA 4WP2A 3DZDA 3KP1E 2R0IA 1IFYA 2O01F 2JY7A 3T15A 1N77A 1IBMM 4ZPXA 3K92A 4JXJA 2C9CA 1QDTA 1HR0M 1EFUB 1LTMA 1YE9A 4QNMA 5KO3A 1D0MA 3B7NA 4AKIA 3GLIA 3KVWA 1NV9A 2O5RA 1LV7A 1QDRA 1I4WA 2FS1A 2YFQA 3VFDA 3SBJA 4FD2A 1N34M 2CFOA 3VDPA 3KS4A 2Z7JA 4NRWA 4IBGA 4LF4M 3F92A 3SAWA 4QNRA 1XWIA 1XC8A 1DO2A 3U60A 1ZQ9A 3MMPA 3SASA 4LF8M 1XMOM 3U6PA 3I04M 1SXJC
chains in the Genus database with same CATH topology
3RGSA 1NY5A 1L2BA 4JYAM 2LH0A 3J27B 4DR6M 1IN6A 4LF5M 4LG2A 3KOXE 5EQTA 2ZAOA 3ZCBB 1KFVA 1IXRC 4JI0M 2AHMA 4JI1M 3I4YA 2UU9M 4GITA 5FTJA 5IT9S 3JAMS 4MGYE 4QOSA 2F5QA 4M9SA 5FLXS 4P16A 5DYGA 3CF2A 2R4EA 1YUBA 3B9PA 4PD2A 2RGHA 1UM8A 4IBJA 4RF1A 1XHBA 5BPVA 1DGFA 4ITQA 2R46A 4D81A 2XEPA 4DV4M 3HU1A 3KW6A 4NSRA 4X64M 4JV5M 4G4RA 2EA0A 1S3SA 3FUWA 3UMMA 2F5SA 3U6EA 2R45A 3ILKA 2DWMA 5EXXA 3A98B 4OX9M 2UUAM 2D7EA 3UZUA 1KYIA 1GKIA 2C96A 1Z5AA 3KP0E 4CGYB 3FKEA 3VK7A 4YHHM 4B3RM 4FWHA 2K47A 3RGPA 2A5YB 3PNVA 4WW0A 1IQPA 2XGNA 4L15A 5ITXA 3A42A 2E5LM 1IN8A 4IJEA 1PJIA 4R7GA 3HHXA 4W5WA 1XXHA 4B7FA 1N33M 2NQ8C 4AI6A 5KQ8A 3QAUA 3GPPA 3SMPA 3L27A 1W5TA 3K1JA 1HT2E 4HLQA 4XGIA 4LZJA 5LMNM 1XXHB 3AOEA 2Y20A 4LY6A 4DR2M 2YQZA 1IXSB 5IREB 2KZSA 1GLNA 3HHYA 2XFSA 4FVMA 4LFCM 2XSZA 1JR3A 5EP2A 3L2AA 2QBYB 3AOEC 1QANA 5KQDA 5ITXE 3U5ZA 4IBBA 1N78A 3TL4X 2JA2A 3I4VA 4AQYM 1SXJA 3SMSA 4IJFA 4Z8XA 3FTDA 1NHWC 5C18A 2G8LA 5E6JA 4DR5M 4KO8A 4MGIE 3U60B 4L4UA 3KOYE 2KA6B 1R2YA 4LF6M 1IN7A 4FCWA 4JN6A 4AG6A 2HKJA 4MH0E 1Q39A 3AKZA 4GMQA 1NNUC 2QPAA 1DGHB 4LRSA 3GLIB 3KS8A 8CATA 5FSWA 4NXNM 3AL0C 5EXSA 3ZH9B 1Q3CA 1NSFA 3PXGA 3U6DA 5JI2E 1NNJA 4B3MM 1TH4A 4NSOB 1IN5A 3HJ8A 4G6ZA 5ITTA 1HQYE 3GLFB 2DXIA 3LVWA 3LMMA 3D8LA 5ITUA 5A2QS 3MK6A 5KPTA 1SXJE 4NRVA 3HGIA 1QVRA 3T1YM 5DNYA 5EP1A 2CV1A 2CHVA 3RFWA 3QWLA 3LVVA 3CTWB 2VQFM 1N75A 3PVSA 3SARA 4DV0M 5H37D 3C58A 4LCBA 1QZMA 3GLFA 5IZ7D 4MGZE 4BLCA 4S12A 5EXTA 4M9ZA 3EIHA 3UGJA 4QHTA 4PDGA 5KPZA 5JI3E 2CE7A 3KDSE 3GRUA 2CHQA 3L29A 2C98A 1Q3BA 1IBLM 2L7HA 3KSJA 4II7A 4LJ9A 1IXZA 3SHGB 3SHFA 4AKGA 2F5PA 4B3SM 3Q8XA 1J7KA 4MM3B 4EIWA 1L8QA 2F5OA 3J80S 2M60A 1I94M 4IBFA 4LFAM 1ORYB 2H1RA 3GLGB 1NJFA 3TWMA 5FTLA 1K82A 4LF7M 4GKJM 2LWXA 1XMQM 1E9SA 3L26A 3VDUA 3PNYA 4TUWA 1IY0A 4FWGA 4JI8M 1Z6TA 2R65A 3U5ZB 2RGOA 4CISA 4JI5M 2I7NA 4I4LA 2V1CA 2KXEA 4PDIA 1G8PA 3AFHA 3IG8A 4JI4M 3W0LB 2CV2A 3U6QA 2FOIC 1G4AE 2RKOA 2DWZB 3GLHB 3K2LA 3M7GA 4G4OA 4LJAA 2LNHC 4M9XA 1K3WA 5FTNA 4IBCA 3FTEA 1XNRM 1MX0A 1Z5BA 4KODA 2VIIA 3VKGA 1KSFX 3E4RA 1JR3D 4LJ4A 3CF6E 1YSYA 1WXQA 3HHZA 2ZBKB 1QYRA 4DR4M 1C1KA 3DA1A 1OJLA 4CHTB 3HKPA 2X49A 4B08A 1NHGC 1R6BX 3GPXA 4D80A 2I7PA 4XBOA 4MGKE 2CHGA 2CUZA 2QCUA 4REZA 3H4MA 4DV3M 2FE8A 4PT5A 2FFJA 1VDDA 4IBIA 4DUYM 1HNXM 5ITRA 1L1ZA 3HU3A 3FUXA 3A46A 4LJ6A 1X37A 4R3DA 4DV1M 4IBEA 3FUTA 3WHKA 2HHHM 1HNWM 2C99A 3U6OA 2F4VM 4GC5A 1IY2A 3EIEA 2C9OA 2UXCM 4B7HA 4MB7A 3J81S 1JQJC 1Z59A 4OU7A 5EJCA 4LGMA 3LQQA 1TDZA 3U6SA 2XLJA 2D7HA 1W5SA 3HHWA 4HL4A 4GH9A 3THGA 2XZFA 2XFTA 2L7IA 3HU2A 2LXEA 1J5EM 1GL7A 3CF0A 1Z5CA 4M0DA 1E94E 1J09A 4KLNA 3MJ5A 2Z3XA 3VK8A 4OW0A 2DZOB 3LQRA 5LMUM 4DV7M 3GLGA 2DHRA 3FYDA 2BNKA 4WURA 1TH3A 3U6MA 4OVZA 1PJJA 4RF0A 2D7GA 4LRTA 3TWLA 4JI6M 3SATA 4FW9A 3HWSA 1QAMA 2EO2A 2J7OA 2R4JA 2XZUA 1ZAEA 1D2NA 1QQWA 1PM5A 2QENA 1K3XA 2R18A 2YNMD 4DR1M 3T1HM 1MU5A 2CEAA 3T38A 2XF3A 5EP4A 1EE8A 4DUZM 3GRRA 2J7NA 4BBAA 3GO8A 2L6OA 3GRYA 4JI7M 4DR7M 3HJQA 3SAVA 2P5TA 3FTFA 1QAQA 4GC9A 3J7BA 4G4NA 1TGUA 5C1BA 1DO0A 4LJ5A 4LZZA 1HNZM 3I51A 2KZUA 3J7AS 3NBIA 3SYLA 4JI3M 3W0FA 2UUBM 5ITYA 4LGYA 2W82A 4LF9M 1DGBA 4DR3M 3VLFB 4X62M 3MHVC 2QZ4A 2Y0QA 3L28A 5EXPA 3K8ZA 2X8AA 1FJGM 3GLHA 1XNQM 1QAOA 1E32A 5FTMA 4NXMM 3KSXA 2DWNA 2KW0A 3DOAA 2VQEM 1HQCA 1IY1A 1SXJD 2QBYA 3GP1A 3FYCA 1L2CA 2Y0TA 4FCTA 3NWLA 3TWKA 3D8BA 3U61B 4DV5M 2DWLA 4K0KM 1G41A 3HJSA 5ITQA 2FNAA 4BB9A 4X66M 4GKKM 4L8RC 3VKHA 3JR4A 4FCVA 2KEBA 4IIWA 4Z6YA 3GQ3A 2G5GX 2ZAMA 4GRIA 2HL7A 4NOOB 2L09A 4NL4H 4LJ8A 2ZANA 2BJVA 3AJIB 4B7GA 1GL6A 3FUVA 3M6AA 3UJNA 4L16A 3KFUG 1IM2A 3GQ4A 2CV0A 3R9XB 3WHLA 4QOZC 4LFBM 1IBKM 4L78A 5GKNA 2R62A 3JR5A 2XH9A 4I81A 4DV2M 2Q2EB 3FUUA 2V6ZM 1DGHA 4AZFA 1R7RA 1NJGA 3PFIA 4IBKA 3R8FA 2Y21A 2BJWA 4GHLA 2UXBM 1OFIA 1TH2A 4OVZB 1HT1E 2EUCA 2KRUA 3KOZE 3ZC7B 5BR8M 1FNNA 3RE8A 4A3VB 3GPYA 3GRVA 1L2DA 1NVMA 1SXJB 2HCBA 3TE6A 2UXDM 1TDHA 2F5NA 2M5ZA 1NY6A 3FD9A 5KPRA 3J2PB 4LJ7A 3AV0A 2OQ4A 4AW4A 2C5RA 4I5SA 3L25A 5E26A 7CATA 4GHAA 4X65M 3U61A 1N36M 2UUCM 4AG5A 4PCZA 5EP3A 3FTCA 3KXEC 2DZNB 3AOGA 1IN4A 2X4AA 3UK6A 2V1UA 3BOSA 3GQ5A 1G3IA 4FWDA 3DFZA 4MGHA 3SFZA 3OTOM 2KRKA 4DV6M 2DVWB 3U6CA 4KHPM 3M0EA 2Z4SA 4JI2M 1N32M 1G59A 3IG5A 2QP9X 4IBDA 4GIPA 5DYIA 1GVNA 4D82A 1T3TA 3E9SA 3SAUA 4B3TM 4RNAA 2ZM6M 2XSZD 4M0WA 5FTKA 1OFHA 3TPZA 3TQSA 4AKHA 3SC3A 3KOWE 5IWAM 1DGGA 4QHSA 2OPFA 2Z4RA 4I8OA 3U6LA 5F3WA 3A45A 3SYKA 1R2ZA 1E9RA 4YY3M 2ERCA 1L1TA 3GPUA 1H6UA 2YR0A 3DZDA 3KP1E 3T15A 1IBMM 1N77A 4ZPXA 3K92A 4JXJA 2C9CA 1HR0M 4QNMA 4AKIA 1YE9A 5KO3A 3GLIA 3KVWA 2O5RA 1LV7A 2YFQA 1I4WA 3VFDA 3SBJA 4FD2A 1N34M 2CFOA 3VDPA 3KS4A 2Z7JA 4NRWA 4IBGA 4LF4M 3SAWA 4QNRA 1XWIA 1XC8A 1DO2A 3U60A 1ZQ9A 4LF8M 3SASA 1XMOM 3U6PA 4G4QA 1SXJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EO2 A; 
#chains in the Genus database with same CATH topology
 3RGS A;  1NY5 A;  2LVA A;  1L2B A;  1SG9 A;  4JYA M;  2LH0 A;  3J27 B;  2OO9 A;  4DR6 M;  1IN6 A;  4LF5 M;  4LG2 A;  3KOX E;  1AUA A;  5EQT A;  2ZAO A;  3ZCB B;  1KFV A;  1IXR C;  4JI0 M;  2AHM A;  3E21 A;  4JI1 M;  3I4Y A;  1WJ7 A;  2UU9 M;  3C3D A;  2JZ0 A;  4GIT A;  5FTJ A;  5IT9 S;  1D0K A;  3JAM S;  1QUT A;  4MGY E;  4QOS A;  2F5Q A;  4M9S A;  5FLX S;  4P16 A;  5DYG A;  3CF2 A;  2R4E A;  1YUB A;  3B9P A;  4PD2 A;  3GLI E;  2RGH A;  3C3E A;  1UM8 A;  4IBJ A;  2OOB A;  1XHB A;  4RF1 A;  5BPV A;  1DGF A;  4ITQ A;  1TTE A;  1PJS A;  2R46 A;  4D81 A;  2XEP A;  1P3Q Q;  4DV4 M;  3HU1 A;  3KW6 A;  4LF6 M;  4NSR A;  4X64 M;  4JV5 M;  4G4R A;  2EA0 A;  1S3S A;  3FUW A;  3UMM A;  2F5S A;  3U6E A;  2R45 A;  4F2L A;  3ILK A;  2DWM A;  5EXX A;  3A98 B;  4OX9 M;  2UUA M;  1GO5 A;  2D7E A;  3UZU A;  1A5T A;  1KYI A;  1GKI A;  2C96 A;  3L25 A;  2DEN A;  1Z5A A;  3KP0 E;  4CGY B;  3FKE A;  3VK7 A;  4YHH M;  3LW5 F;  4B3R M;  4FWH A;  2K47 A;  3RGP A;  2A5Y B;  3PNV A;  4WW0 A;  1IQP A;  2XGN A;  4L15 A;  5ITX A;  3A42 A;  2E5L M;  1IN8 A;  4IJE A;  1PJI A;  3B89 A;  4R7G A;  3HHX A;  4W5W A;  1XXH A;  4B7F A;  1N33 M;  2NQ8 C;  4AI6 A;  5KQ8 A;  3QAU A;  3GPP A;  3SMP A;  3K1J A;  1W5T A;  3L27 A;  1HT2 E;  3HY5 A;  4HLQ A;  4XGI A;  4LZJ A;  5LMN M;  1XXH B;  3AOE A;  2Y20 A;  2J5Y A;  4LY6 A;  1WGN A;  4DR2 M;  2EJS A;  2YQZ A;  1WIV A;  1IXS B;  5IRE B;  2LVP C;  2CP8 A;  2KZS A;  1GLN A;  3HHY A;  2XFS A;  2ZTD A;  4FVM A;  4LFC M;  2XSZ A;  1JR3 A;  1IXS A;  2LBC A;  2LVN C;  3IHP A;  3L2A A;  5EP2 A;  2DKL A;  2QBY B;  3AOE C;  1QAN A;  5KQD A;  5ITX E;  3U5Z A;  4IBB A;  1N78 A;  3TL4 X;  2JA2 A;  1XB2 B;  3I4V A;  4AQY M;  1SXJ A;  3SMS A;  4IJF A;  4Z8X A;  1XXH E;  3FTD A;  1NHW C;  5C18 A;  1OQY A;  2G8L A;  5E6J A;  1T43 A;  4DR5 M;  4KO8 A;  4MGI E;  1ZMU A;  3U60 B;  4L4U A;  3KOY E;  2KA6 B;  4DBG B;  1D0L A;  1IN7 A;  4FCW A;  4JN6 A;  1CUK A;  1R2Y A;  4AG6 A;  2HKJ A;  4MH0 E;  1Q39 A;  3AKZ A;  1PJQ A;  1NNU C;  2CWB A;  1DGH B;  2QPA A;  4GMQ A;  4LRS A;  3GLI B;  3KS8 A;  1F4I A;  1V92 A;  8CAT A;  5FSW A;  4NXN M;  1OAO C;  3C9P A;  3AL0 C;  5EXS A;  3ZH9 B;  1Q3C A;  1NSF A;  3PXG A;  3NBX X;  3U6D A;  5JI2 E;  1NNJ A;  3BXW A;  2JY8 A;  1TR8 A;  4B3M M;  3H4J A;  1JR3 E;  1TH4 A;  3B7Q A;  4NSO B;  1IN5 A;  3HJ8 A;  4G6Z A;  5ITT A;  1HQY E;  1WGL A;  1QZE A;  2QQ8 A;  3LVW A;  3GLF B;  2ZTC A;  3LMM A;  2DXI A;  3D8L A;  5ITU A;  5A2Q S;  3MK6 A;  3E46 A;  5KPT A;  1SXJ E;  4NRV A;  3HGI A;  1QVR A;  3T1Y M;  5DNY A;  2JY6 B;  5EP1 A;  2CV1 A;  2CHV A;  3RFW A;  3QWL A;  3QYB A;  3LVV A;  3CTW B;  2VQF M;  1N75 A;  3PVS A;  3SAR A;  2JZ1 A;  4DV0 M;  5H37 D;  3C58 A;  4LCB A;  1QZM A;  3GLF A;  1ZV1 A;  2JY5 A;  3I01 M;  5IZ7 D;  1R5L A;  3B74 A;  4MGZ E;  4BLC A;  4S12 A;  1TF0 B;  4ANR A;  4UN2 B;  5EXT A;  4M9Z A;  3EIH A;  3UGJ A;  1Q02 A;  2WSF F;  4QHT A;  2MRO B;  4PDG A;  5KPZ A;  5JI3 E;  2CE7 A;  3KDS E;  2O25 A;  1WHC A;  3GRU A;  2CHQ A;  3L29 A;  2C98 A;  1Q3B A;  1IBL M;  4XK8 F;  2L7H A;  3KSJ A;  1VEJ A;  4II7 A;  4LJ9 A;  1IXZ A;  4CJ6 A;  2MR9 A;  3SHG B;  3SHF A;  4AKG A;  2F5P A;  1RU3 A;  4B3S M;  3Q8X A;  1J7K A;  4MM3 B;  4EIW A;  1L8Q A;  2F5O A;  3J80 S;  2M60 A;  2LVQ D;  4IBF A;  4LFA M;  1I94 M;  2DAM A;  1ORY B;  4KT0 F;  2H1R A;  3GLG B;  1NJF A;  3TWM A;  5FTL A;  4R71 A;  1K82 A;  4LF7 M;  2LWX A;  4GKJ M;  2DHY A;  1E9S A;  1XMQ M;  1EIJ A;  3L26 A;  3VDU A;  2KNV A;  3PNY A;  3GLF E;  1IY0 A;  4FWG A;  4JI8 M;  4TUW A;  1Z6T A;  2R65 A;  3U5Z B;  2RGO A;  4CIS A;  4JI5 M;  2I7N A;  4I4L A;  2V1C A;  2KXE A;  2EKF A;  4PDI A;  1G8P A;  3AFH A;  3IG8 A;  4JI4 M;  3W0L B;  2CV2 A;  2LHG A;  3U6Q A;  2FOI C;  1G4A E;  2RKO A;  2DWZ B;  3GLH B;  3K2L A;  3M7G A;  4G4O A;  4LJA A;  2LNH C;  4M9X A;  1K3W A;  1MN3 A;  5FTN A;  4L6V 6;  4IBC A;  3FTE A;  1XNR M;  1MX0 A;  1Z5B A;  2FH0 A;  4KOD A;  2VII A;  3VKG A;  1KSF X;  3E4R A;  2N35 A;  1JR3 D;  2VDB B;  4LJ4 A;  3CF6 E;  3ZQJ A;  1YSY A;  1WXQ A;  4G4Q A;  3HHZ A;  2ZBK B;  1QYR A;  4DR4 M;  1C1K A;  3DA1 A;  1Y8G A;  2LVO C;  1OJL A;  4CHT B;  3HKP A;  2H5X A;  2X49 A;  1NHG C;  4B08 A;  1BVS A;  1R6B X;  3GPX A;  4D80 A;  2I7P A;  4XBO A;  4MGK E;  2CHG A;  2CUZ A;  2QCU A;  3HZJ A;  4REZ A;  2WSC F;  3H4M A;  4DV3 M;  2FE8 A;  4PT5 A;  2FFJ A;  1VDD A;  4IBI A;  1OKS A;  3Q8G A;  5ITR A;  4DUY M;  1L1Z A;  1HNX M;  3HU3 A;  3FUX A;  3A46 A;  4LJ6 A;  1NV8 A;  3K9O A;  3W67 A;  1X37 A;  4R3D A;  4DV1 M;  4IBE A;  3FE3 A;  3FUT A;  3WHK A;  2HHH M;  1HNW M;  4GEW A;  2C99 A;  2LHC A;  3U6O A;  2VF8 A;  2F4V M;  4GC5 A;  1IY2 A;  3EIE A;  2C9O A;  2UXC M;  4B7H A;  1GJT A;  4MB7 A;  2HWJ A;  2DAE A;  3K9P A;  3J81 S;  1JQJ C;  1Z59 A;  2JXN A;  4OU7 A;  5EJC A;  4LGM A;  2JNH A;  3LQQ A;  1TDZ A;  3U6S A;  2XLJ A;  2D7H A;  1W5S A;  2MGW A;  3FRI A;  3HHW A;  2KDL A;  4HL4 A;  1JB0 F;  1WR1 B;  4GH9 A;  2R6F A;  3THG A;  2XFT A;  2XZF A;  2L7I A;  3HU2 A;  2LXE A;  1J5E M;  1GL7 A;  3CF0 A;  1Z5C A;  4M0D A;  1E94 E;  1OIP A;  1J09 A;  4KLN A;  3MJ5 A;  2Z3X A;  2VF7 A;  3VK8 A;  4OW0 A;  2DZO B;  1R4G A;  3LQR A;  4P17 A;  5LMU M;  2QSF X;  4DV7 M;  3GLG A;  2DHR A;  3FYD A;  2BNK A;  4WUR A;  1TH3 A;  3U6M A;  4OVZ A;  1V33 A;  1PJJ A;  4RF0 A;  1VEG A;  2D7G A;  4LRT A;  3TWL A;  4JI6 M;  3SAT A;  4FW9 A;  3HWS A;  1QAM A;  2EO2 A;  1VG5 A;  2J7O A;  3GLH E;  2R4J A;  2XZU A;  2JP7 A;  1ZAE A;  1D2N A;  1QQW A;  1PM5 A;  2QEN A;  2QHO B;  2R18 A;  1K3X A;  3CGW A;  2DAK A;  2DAG A;  2YNM D;  4DR1 M;  1MU5 A;  2JWS A;  2CEA A;  3T1H M;  3T38 A;  2XF3 A;  5EP4 A;  1EE8 A;  4DUZ M;  3GRR A;  2J7N A;  4BBA A;  2WZJ A;  2L6O A;  3GO8 A;  3GRY A;  4JI7 M;  4DR7 M;  2GNO A;  3HJQ A;  3SAV A;  2APL A;  2P5T A;  3FTF A;  1QAQ A;  2RRU A;  4GC9 A;  3J7B A;  4G4N A;  1TGU A;  5C1B A;  3GLG E;  1DO0 A;  4LJ5 A;  4LZZ A;  1HNZ M;  3I51 A;  2KZU A;  3J7A S;  3NBI A;  1AIP C;  2KNA A;  3SYL A;  4JI3 M;  3W0F A;  2UUB M;  5ITY A;  2DNA A;  2W82 A;  4LGY A;  4LF9 M;  1DGB A;  4DR3 M;  2MJ5 B;  3BBZ A;  3VLF B;  4X62 M;  3MHV C;  2QZ4 A;  2Y0Q A;  3L28 A;  5EXP A;  3K8Z A;  2X8A A;  1FJG M;  3B7Z A;  1OTR A;  3GLH A;  1XNQ M;  1QAO A;  1ZMW A;  1E32 A;  5FTM A;  1ZMV A;  4NXM M;  2GQF A;  3KSX A;  2DWN A;  1HJP A;  2KW0 A;  3DOA A;  1PGY A;  2VQE M;  1OIZ A;  1HQC A;  2HAK A;  1QUS A;  1IY1 A;  1SXJ D;  2QBY A;  2KNZ A;  2BWB A;  3GP1 A;  3FYC A;  1L2C A;  2Y0T A;  3LCV B;  3IEC A;  4FCT A;  3NWL A;  3TWK A;  3D8B A;  2CRU A;  3U61 B;  4DV5 M;  2DWL A;  4K0K M;  1G41 A;  3HJS A;  2DAI A;  5ITQ A;  2OOA A;  1C7Y A;  2FNA A;  4BB9 A;  2L4F A;  4X66 M;  4GKK M;  4L8R C;  3VKH A;  1VEK A;  3JR4 A;  4FCV A;  2KEB A;  4IIW A;  4Z6Y A;  3GQ3 A;  2G5G X;  2ZAM A;  4GRI A;  4F1I A;  4RKU F;  2HL7 A;  3HX3 A;  4NOO B;  4Q7J A;  2L09 A;  4NL4 H;  4LJ8 A;  1OAI A;  2ZAN A;  2BJV A;  3AJI B;  4B7G A;  4Y28 F;  1GL6 A;  3FUV A;  2L2D A;  1MJG M;  3M6A A;  3UJN A;  4L16 A;  3KFU G;  1IM2 A;  5DFL A;  1VQ1 A;  3GQ4 A;  2CV0 A;  3R9X B;  3WHL A;  4HEO A;  4QOZ C;  4LFB M;  1IBK M;  4L78 A;  5GKN A;  3FRH A;  2R62 A;  1GAB A;  3V76 A;  3JR5 A;  2XH9 A;  4I81 A;  4DV2 M;  2Q2E B;  2MH8 A;  2V6Z M;  3FUU A;  1DGH A;  1T6O A;  4AZF A;  1R7R A;  1NJG A;  1NO1 A;  3PFI A;  4IBK A;  4CIZ A;  3R8F A;  2Y21 A;  3QYE A;  2BJW A;  4GHL A;  2UXB M;  1OFI A;  1TH2 A;  4OVZ B;  1V34 A;  1HT1 E;  2EUC A;  2KRU A;  2L4E A;  2BWE A;  3KOZ E;  3ZC7 B;  5BR8 M;  5L8R F;  1FNN A;  1PRB A;  3RE8 A;  4A3V B;  3GPY A;  3GRV A;  1L2D A;  1NVM A;  1SXJ B;  2Z8Y M;  2HCB A;  1DV0 A;  3TE6 A;  1VDL A;  2QNJ A;  2UXD M;  2JUJ A;  1TDH A;  2F5N A;  2M5Z A;  1NY6 A;  3FD9 A;  2EKK A;  1G71 A;  5KPR A;  3J2P B;  4LJ7 A;  3AV0 A;  2OQ4 A;  4AW4 A;  2C5R A;  4I5S A;  2K6B A;  5E26 A;  7CAT A;  4NC6 A;  4X65 M;  2K9D A;  3U61 A;  1N36 M;  1PJT A;  4GHA A;  2UUC M;  4AG5 A;  4PCZ A;  1GJS A;  5EP3 A;  3FTC A;  3KXE C;  2DZN B;  3AOG A;  1IN4 A;  2X4A A;  3UK6 A;  2V1U A;  3BOS A;  3GQ5 A;  1YLA A;  1G3I A;  4FWD A;  3DFZ A;  4MGH A;  3SFZ A;  3OTO M;  2KRK A;  4DV6 M;  2DVW B;  3U6C A;  4KHP M;  3M0E A;  2Z4S A;  4JI2 M;  1N32 M;  1G59 A;  3IG5 A;  2DZL A;  2B3T A;  2K0B X;  2QP9 X;  4IBD A;  4G3O A;  2DI0 A;  4GIP A;  5DYI A;  1GVN A;  4D82 A;  3LCU A;  1T3T A;  3E9S A;  2R44 A;  2WSE F;  3SAU A;  4B3T M;  4RNA A;  2ZM6 M;  2KHH A;  2XSZ D;  4M0W A;  1OFH A;  5FTK A;  3TPZ A;  3TQS A;  4AKH A;  3SC3 A;  3KOW E;  2LTU A;  5IWA M;  1DGG A;  4QHS A;  3T6P A;  2Z4R A;  4I8O A;  2OPF A;  3W68 A;  3A45 A;  3SYK A;  3U6L A;  5F3W A;  1R2Z A;  1E9R A;  4YY3 M;  1UFZ A;  2ERC A;  1L1T A;  3GPU A;  1H6U A;  2YR0 A;  2G3Q A;  4WP2 A;  3DZD A;  3KP1 E;  2R0I A;  1IFY A;  2O01 F;  2JY7 A;  3T15 A;  1N77 A;  1IBM M;  4ZPX A;  3K92 A;  4JXJ A;  2C9C A;  1QDT A;  1HR0 M;  1EFU B;  1LTM A;  1YE9 A;  4QNM A;  5KO3 A;  1D0M A;  3B7N A;  4AKI A;  3GLI A;  3KVW A;  1NV9 A;  2O5R A;  1LV7 A;  1QDR A;  1I4W A;  2FS1 A;  2YFQ A;  3VFD A;  3SBJ A;  4FD2 A;  1N34 M;  2CFO A;  3VDP A;  3KS4 A;  2Z7J A;  4NRW A;  4IBG A;  4LF4 M;  3F92 A;  3SAW A;  4QNR A;  1XWI A;  1XC8 A;  1DO2 A;  3U60 A;  1ZQ9 A;  3MMP A;  3SAS A;  4LF8 M;  1XMO M;  3U6P A;  3I04 M;  1SXJ C; 
#chains in the Genus database with same CATH homology
 3RGS A;  1NY5 A;  1L2B A;  4JYA M;  2LH0 A;  3J27 B;  4DR6 M;  1IN6 A;  4LF5 M;  4LG2 A;  3KOX E;  5EQT A;  2ZAO A;  3ZCB B;  1KFV A;  1IXR C;  4JI0 M;  2AHM A;  4JI1 M;  3I4Y A;  2UU9 M;  4GIT A;  5FTJ A;  5IT9 S;  3JAM S;  4MGY E;  4QOS A;  2F5Q A;  4M9S A;  5FLX S;  4P16 A;  5DYG A;  3CF2 A;  2R4E A;  1YUB A;  3B9P A;  4PD2 A;  2RGH A;  1UM8 A;  4IBJ A;  4RF1 A;  1XHB A;  5BPV A;  1DGF A;  4ITQ A;  2R46 A;  4D81 A;  2XEP A;  4DV4 M;  3HU1 A;  3KW6 A;  4NSR A;  4X64 M;  4JV5 M;  4G4R A;  2EA0 A;  1S3S A;  3FUW A;  3UMM A;  2F5S A;  3U6E A;  2R45 A;  3ILK A;  2DWM A;  5EXX A;  3A98 B;  4OX9 M;  2UUA M;  2D7E A;  3UZU A;  1KYI A;  1GKI A;  2C96 A;  1Z5A A;  3KP0 E;  4CGY B;  3FKE A;  3VK7 A;  4YHH M;  4B3R M;  4FWH A;  2K47 A;  3RGP A;  2A5Y B;  3PNV A;  4WW0 A;  1IQP A;  2XGN A;  4L15 A;  5ITX A;  3A42 A;  2E5L M;  1IN8 A;  4IJE A;  1PJI A;  4R7G A;  3HHX A;  4W5W A;  1XXH A;  4B7F A;  1N33 M;  2NQ8 C;  4AI6 A;  5KQ8 A;  3QAU A;  3GPP A;  3SMP A;  3L27 A;  1W5T A;  3K1J A;  1HT2 E;  4HLQ A;  4XGI A;  4LZJ A;  5LMN M;  1XXH B;  3AOE A;  2Y20 A;  4LY6 A;  4DR2 M;  2YQZ A;  1IXS B;  5IRE B;  2KZS A;  1GLN A;  3HHY A;  2XFS A;  4FVM A;  4LFC M;  2XSZ A;  1JR3 A;  5EP2 A;  3L2A A;  2QBY B;  3AOE C;  1QAN A;  5KQD A;  5ITX E;  3U5Z A;  4IBB A;  1N78 A;  3TL4 X;  2JA2 A;  3I4V A;  4AQY M;  1SXJ A;  3SMS A;  4IJF A;  4Z8X A;  3FTD A;  1NHW C;  5C18 A;  2G8L A;  5E6J A;  4DR5 M;  4KO8 A;  4MGI E;  3U60 B;  4L4U A;  3KOY E;  2KA6 B;  1R2Y A;  4LF6 M;  1IN7 A;  4FCW A;  4JN6 A;  4AG6 A;  2HKJ A;  4MH0 E;  1Q39 A;  3AKZ A;  4GMQ A;  1NNU C;  2QPA A;  1DGH B;  4LRS A;  3GLI B;  3KS8 A;  8CAT A;  5FSW A;  4NXN M;  3AL0 C;  5EXS A;  3ZH9 B;  1Q3C A;  1NSF A;  3PXG A;  3U6D A;  5JI2 E;  1NNJ A;  4B3M M;  1TH4 A;  4NSO B;  1IN5 A;  3HJ8 A;  4G6Z A;  5ITT A;  1HQY E;  3GLF B;  2DXI A;  3LVW A;  3LMM A;  3D8L A;  5ITU A;  5A2Q S;  3MK6 A;  5KPT A;  1SXJ E;  4NRV A;  3HGI A;  1QVR A;  3T1Y M;  5DNY A;  5EP1 A;  2CV1 A;  2CHV A;  3RFW A;  3QWL A;  3LVV A;  3CTW B;  2VQF M;  1N75 A;  3PVS A;  3SAR A;  4DV0 M;  5H37 D;  3C58 A;  4LCB A;  1QZM A;  3GLF A;  5IZ7 D;  4MGZ E;  4BLC A;  4S12 A;  5EXT A;  4M9Z A;  3EIH A;  3UGJ A;  4QHT A;  4PDG A;  5KPZ A;  5JI3 E;  2CE7 A;  3KDS E;  3GRU A;  2CHQ A;  3L29 A;  2C98 A;  1Q3B A;  1IBL M;  2L7H A;  3KSJ A;  4II7 A;  4LJ9 A;  1IXZ A;  3SHG B;  3SHF A;  4AKG A;  2F5P A;  4B3S M;  3Q8X A;  1J7K A;  4MM3 B;  4EIW A;  1L8Q A;  2F5O A;  3J80 S;  2M60 A;  1I94 M;  4IBF A;  4LFA M;  1ORY B;  2H1R A;  3GLG B;  1NJF A;  3TWM A;  5FTL A;  1K82 A;  4LF7 M;  4GKJ M;  2LWX A;  1XMQ M;  1E9S A;  3L26 A;  3VDU A;  3PNY A;  4TUW A;  1IY0 A;  4FWG A;  4JI8 M;  1Z6T A;  2R65 A;  3U5Z B;  2RGO A;  4CIS A;  4JI5 M;  2I7N A;  4I4L A;  2V1C A;  2KXE A;  4PDI A;  1G8P A;  3AFH A;  3IG8 A;  4JI4 M;  3W0L B;  2CV2 A;  3U6Q A;  2FOI C;  1G4A E;  2RKO A;  2DWZ B;  3GLH B;  3K2L A;  3M7G A;  4G4O A;  4LJA A;  2LNH C;  4M9X A;  1K3W A;  5FTN A;  4IBC A;  3FTE A;  1XNR M;  1MX0 A;  1Z5B A;  4KOD A;  2VII A;  3VKG A;  1KSF X;  3E4R A;  1JR3 D;  4LJ4 A;  3CF6 E;  1YSY A;  1WXQ A;  3HHZ A;  2ZBK B;  1QYR A;  4DR4 M;  1C1K A;  3DA1 A;  1OJL A;  4CHT B;  3HKP A;  2X49 A;  4B08 A;  1NHG C;  1R6B X;  3GPX A;  4D80 A;  2I7P A;  4XBO A;  4MGK E;  2CHG A;  2CUZ A;  2QCU A;  4REZ A;  3H4M A;  4DV3 M;  2FE8 A;  4PT5 A;  2FFJ A;  1VDD A;  4IBI A;  4DUY M;  1HNX M;  5ITR A;  1L1Z A;  3HU3 A;  3FUX A;  3A46 A;  4LJ6 A;  1X37 A;  4R3D A;  4DV1 M;  4IBE A;  3FUT A;  3WHK A;  2HHH M;  1HNW M;  2C99 A;  3U6O A;  2F4V M;  4GC5 A;  1IY2 A;  3EIE A;  2C9O A;  2UXC M;  4B7H A;  4MB7 A;  3J81 S;  1JQJ C;  1Z59 A;  4OU7 A;  5EJC A;  4LGM A;  3LQQ A;  1TDZ A;  3U6S A;  2XLJ A;  2D7H A;  1W5S A;  3HHW A;  4HL4 A;  4GH9 A;  3THG A;  2XZF A;  2XFT A;  2L7I A;  3HU2 A;  2LXE A;  1J5E M;  1GL7 A;  3CF0 A;  1Z5C A;  4M0D A;  1E94 E;  1J09 A;  4KLN A;  3MJ5 A;  2Z3X A;  3VK8 A;  4OW0 A;  2DZO B;  3LQR A;  5LMU M;  4DV7 M;  3GLG A;  2DHR A;  3FYD A;  2BNK A;  4WUR A;  1TH3 A;  3U6M A;  4OVZ A;  1PJJ A;  4RF0 A;  2D7G A;  4LRT A;  3TWL A;  4JI6 M;  3SAT A;  4FW9 A;  3HWS A;  1QAM A;  2EO2 A;  2J7O A;  2R4J A;  2XZU A;  1ZAE A;  1D2N A;  1QQW A;  1PM5 A;  2QEN A;  1K3X A;  2R18 A;  2YNM D;  4DR1 M;  3T1H M;  1MU5 A;  2CEA A;  3T38 A;  2XF3 A;  5EP4 A;  1EE8 A;  4DUZ M;  3GRR A;  2J7N A;  4BBA A;  3GO8 A;  2L6O A;  3GRY A;  4JI7 M;  4DR7 M;  3HJQ A;  3SAV A;  2P5T A;  3FTF A;  1QAQ A;  4GC9 A;  3J7B A;  4G4N A;  1TGU A;  5C1B A;  1DO0 A;  4LJ5 A;  4LZZ A;  1HNZ M;  3I51 A;  2KZU A;  3J7A S;  3NBI A;  3SYL A;  4JI3 M;  3W0F A;  2UUB M;  5ITY A;  4LGY A;  2W82 A;  4LF9 M;  1DGB A;  4DR3 M;  3VLF B;  4X62 M;  3MHV C;  2QZ4 A;  2Y0Q A;  3L28 A;  5EXP A;  3K8Z A;  2X8A A;  1FJG M;  3GLH A;  1XNQ M;  1QAO A;  1E32 A;  5FTM A;  4NXM M;  3KSX A;  2DWN A;  2KW0 A;  3DOA A;  2VQE M;  1HQC A;  1IY1 A;  1SXJ D;  2QBY A;  3GP1 A;  3FYC A;  1L2C A;  2Y0T A;  4FCT A;  3NWL A;  3TWK A;  3D8B A;  3U61 B;  4DV5 M;  2DWL A;  4K0K M;  1G41 A;  3HJS A;  5ITQ A;  2FNA A;  4BB9 A;  4X66 M;  4GKK M;  4L8R C;  3VKH A;  3JR4 A;  4FCV A;  2KEB A;  4IIW A;  4Z6Y A;  3GQ3 A;  2G5G X;  2ZAM A;  4GRI A;  2HL7 A;  4NOO B;  2L09 A;  4NL4 H;  4LJ8 A;  2ZAN A;  2BJV A;  3AJI B;  4B7G A;  1GL6 A;  3FUV A;  3M6A A;  3UJN A;  4L16 A;  3KFU G;  1IM2 A;  3GQ4 A;  2CV0 A;  3R9X B;  3WHL A;  4QOZ C;  4LFB M;  1IBK M;  4L78 A;  5GKN A;  2R62 A;  3JR5 A;  2XH9 A;  4I81 A;  4DV2 M;  2Q2E B;  3FUU A;  2V6Z M;  1DGH A;  4AZF A;  1R7R A;  1NJG A;  3PFI A;  4IBK A;  3R8F A;  2Y21 A;  2BJW A;  4GHL A;  2UXB M;  1OFI A;  1TH2 A;  4OVZ B;  1HT1 E;  2EUC A;  2KRU A;  3KOZ E;  3ZC7 B;  5BR8 M;  1FNN A;  3RE8 A;  4A3V B;  3GPY A;  3GRV A;  1L2D A;  1NVM A;  1SXJ B;  2HCB A;  3TE6 A;  2UXD M;  1TDH A;  2F5N A;  2M5Z A;  1NY6 A;  3FD9 A;  5KPR A;  3J2P B;  4LJ7 A;  3AV0 A;  2OQ4 A;  4AW4 A;  2C5R A;  4I5S A;  3L25 A;  5E26 A;  7CAT A;  4GHA A;  4X65 M;  3U61 A;  1N36 M;  2UUC M;  4AG5 A;  4PCZ A;  5EP3 A;  3FTC A;  3KXE C;  2DZN B;  3AOG A;  1IN4 A;  2X4A A;  3UK6 A;  2V1U A;  3BOS A;  3GQ5 A;  1G3I A;  4FWD A;  3DFZ A;  4MGH A;  3SFZ A;  3OTO M;  2KRK A;  4DV6 M;  2DVW B;  3U6C A;  4KHP M;  3M0E A;  2Z4S A;  4JI2 M;  1N32 M;  1G59 A;  3IG5 A;  2QP9 X;  4IBD A;  4GIP A;  5DYI A;  1GVN A;  4D82 A;  1T3T A;  3E9S A;  3SAU A;  4B3T M;  4RNA A;  2ZM6 M;  2XSZ D;  4M0W A;  5FTK A;  1OFH A;  3TPZ A;  3TQS A;  4AKH A;  3SC3 A;  3KOW E;  5IWA M;  1DGG A;  4QHS A;  2OPF A;  2Z4R A;  4I8O A;  3U6L A;  5F3W A;  3A45 A;  3SYK A;  1R2Z A;  1E9R A;  4YY3 M;  2ERC A;  1L1T A;  3GPU A;  1H6U A;  2YR0 A;  3DZD A;  3KP1 E;  3T15 A;  1IBM M;  1N77 A;  4ZPX A;  3K92 A;  4JXJ A;  2C9C A;  1HR0 M;  4QNM A;  4AKI A;  1YE9 A;  5KO3 A;  3GLI A;  3KVW A;  2O5R A;  1LV7 A;  2YFQ A;  1I4W A;  3VFD A;  3SBJ A;  4FD2 A;  1N34 M;  2CFO A;  3VDP A;  3KS4 A;  2Z7J A;  4NRW A;  4IBG A;  4LF4 M;  3SAW A;  4QNR A;  1XWI A;  1XC8 A;  1DO2 A;  3U60 A;  1ZQ9 A;  4LF8 M;  3SAS A;  1XMO M;  3U6P A;  4G4Q A;  1SXJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...