2EO2A

Solution structure of the insertion region (510-573) of fthfs domain from mouse methylenetetrahydrofolate dehydrogenase (nadp+ dependent) 1-like protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
71
structure length
71
Chain Sequence
GSSGSSGSTQTDKALYNRLVPLVNGVREFSEIQLSRLKKLGIHKTDPSTLTEEEVRKFARLNIDPATITWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the insertion region (510-573) of FTHFS domain from mouse methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like protein
rcsb
molecule keywords Adult male hypothalamus cDNA, RIKEN full-length enriched lib
molecule tags Oxidoreductase
source organism Mus musculus
total genus 7
structure length 71
sequence length 71
ec nomenclature ec 6.3.4.3: Formate--tetrahydrofolate ligase.
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.770 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2eo2A00
2EO2A
chains in the Genus database with same CATH superfamily
3DFZA 4LGYA 2UXBM 3U6EA 3VKGA 1GJTA 2BNKA 5KO3A 2JY7A 3WHKA 1NSFA 1YSYA 2EO2A 5ITQA 1L1ZA 4II7A 3GLGE 4R7GA 2QHOB 3DA1A 2DI0A 4KT0F 5FTLA 3ZCBB 2WSCF 4LRSA 4BBAA 1R5LA 1NNUC 3TWLA 4X65M 1NY6A 2DAMA 4L8RC 2VQFM 3PNYA 2FH0A 2H1RA 2HAKA 3F92A 3SMPA 4M9SA 1PJSA 1GVNA 2CWBA 3K92A 4FD2A 3DOAA 4QHSA 2L7IA 4GITA 4AG5A 1V92A 3SMSA 3B74A 4LGMA 3WHLA 3L2AA 4JI7M 2F5QA 3GLGA 1TR8A 4DR6M 4LJ4A 2WSEF 3AFHA 3U6LA 3CGWA 3FD9A 2C96A 4CGYB 1R6BX 2JZ1A 3KOYE 2LBCA 2FE8A 1QDTA 1T6OA 4Z8XA 4JI2M 3GQ5A 1QUSA 4G4OA 1S3SA 2N35A 4L78A 1HNZM 3U61B 3QYEA 1QZEA 2V6ZM 3R8FA 4IBIA 4JI5M 2JZ0A 4PDGA 3A42A 2XGNA 1FJGM 1Z6TA 4W5WA 2CHQA 3GO8A 3I4YA 4NSOB 4DV3M 2DAKA 5H37D 3U5ZB 1TDZA 3L28A 1G3IA 4LZZA 3U60A 1V33A 1UM8A 1NJGA 1QAMA 1EE8A 3U6PA 4RF1A 1FNNA 1L1TA 4FVMA 1JR3E 1ORYB 4LJAA 3C58A 3GRYA 4D81A 4IIWA 1ZMUA 3GP1A 1TH3A 1SXJB 3T6PA 2HCBA 3E9SA 3Q8GA 3U6CA 1T3TA 4Q7JA 1IY2A 2GNOA 4DUZM 1HR0M 2XEPA 3VDPA 4LF9M 3QAUA 5A2QS 3RFWA 3SAUA 2QBYB 5KQDA 5IWAM 1SXJE 3KSJA 4LFCM 3GRUA 1NHGC 3KS8A 3U5ZA 2BWEA 2D7HA 1JR3A 1SG9A 1WR1B 2RGOA 3B9PA 3W68A 1PJJA 2UXCM 5EXSA 2KRKA 2QPAA 1T43A 2ZAMA 3A98B 3LCVB 3UGJA 4LFBM 4FCVA 4JV5M 2XF3A 5KPRA 1MN3A 1OIPA 1EIJA 3LQQA 3FUXA 1XMOM 3JAMS 1SXJA 2KA6B 2L4EA 1V34A 1N78A 2Z3XA 1IN4A 3VFDA 2Y20A 3HHYA 2LVOC 1LTMA 2ZTCA 2CHVA 4OU7A 2KXEA 3J7BA 2I7PA 2K9DA 3SHGB 2F4VM 1GL7A 1K82A 2DENA 4LJ6A 2MROB 3J27B 1XNRM 1IN7A 1NV8A 1XXHE 2W82A 5IZ7D 4DR1M 4IBGA 3FYDA 1HT2E 4LF4M 1VQ1A 1NHWC 1TTEA 1Q3CA 4GMQA 4IBKA 4JI8M 4AKHA 2L6OA 2HWJA 5E6JA 3W0FA 4M9XA 1R2ZA 2G8LA 3SATA 2E5LM 4IJFA 1MJGM 4GC9A 4NXMM 3I4VA 3FTEA 3GPYA 1XXHA 7CATA 4IJEA 3T15A 2DAEA 3T38A 4X66M 3UMMA 5FLXS 4GHAA 1RU3A 5C18A 3IG5A 4DV2M 1QQWA 1VEGA 2FNAA 2QNJA 5IREB 2CV1A 1VG5A 1G71A 3KXEC 4REZA 5ITRA 3HZJA 2B3TA 4CJ6A 4IBCA 2O25A 1HQYE 3KDSE 1WIVA 4AZFA 1R4GA 1NNJA 1IN5A 1HT1E 2O01F 5ITTA 3KP1E 4FWHA 5EQTA 4QOSA 1ZMVA 1NY5A 3GQ3A 4DR3M 4M0DA 1I94M 4LF7M 2Q2EB 4FCWA 4M0WA 4UN2B 1PM5A 2LVAA 1A5TA 2EKFA 4RF0A 5EP3A 5DYGA 1D0KA 2JA2A 1GL6A 4LG2A 3ILKA 4LZJA 2R44A 5C1BA 2ZAOA 3HY5A 3FTFA 3M7GA 3U6SA 2JXNA 2R45A 2XZFA 3VKHA 5JI3E 4Z6YA 3HJ8A 4DUYM 4XBOA 3JR5A 2KEBA 3VDUA 4GIPA 3GQ4A 2Y0TA 4L16A 4G4NA 2BJVA 4FWGA 2DXIA 2DKLA 2DVWB 5GKNA 1G4AE 2QSFX 4MGIE 1XHBA 5KPZA 3KFUG 2RGHA 1R7RA 2LNHC 3FRIA 4LJ9A 4BLCA 2LTUA 1IBKM 1IY1A 3E4RA 1K3WA 2CHGA 2QCUA 2L4FA 2C9OA 1NVMA 1E9SA 2KNAA 3HHWA 1TH2A 1HNXM 2DHYA 2XH9A 4JI0M 3U60B 3HX3A 2Y21A 1QYRA 2LVPC 4OVZB 4R3DA 4D80A 3UZUA 5KPTA 1W5TA 4R71A 5EJCA 3ZH9B 4NRVA 2VIIA 2DWZB 2L7HA 3B7NA 1PJTA 1Z59A 3NBXX 1JB0F 3J81S 2K6BA 3FKEA 3IECA 2ERCA 4PD2A 3AV0A 4YY3M 1C7YA 3A46A 4B08A 3CF0A 2P5TA 4FCTA 1WXQA 2MR9A 2C9CA 2KRUA 2WSFF 3C3DA 1LV7A 3FTCA 3GLHB 2DWMA 3ZQJA 4G4QA 1I4WA 3AKZA 1Q02A 4OVZA 4B3TM 2FS1A 3HJSA 1J7KA 1GKIA 5FSWA 1IXZA 1Q3BA 4HL4A 2AHMA 1XMQM 2YNMD 1PJIA 3GLHE 1NJFA 5ITXE 1N34M 3FUVA 2K47A 3FTDA 4G4RA 2CEAA 1N77A 4X62M 1Q39A 1OKSA 1EFUB 1DGFA 2Z4SA 3SAVA 1N33M 2DAIA 4Y28F 5EXPA 2EA0A 2VF8A 1QUTA 2O5RA 2R46A 4IBEA 5F3WA 1VEKA 3QWLA 2CRUA 3KVWA 1KYIA 4IBDA 3GLHA 3GRVA 5ITXA 4DR2M 2QQ8A 2XSZD 1R2YA 3AOEA 4XGIA 4MGKE 2VDBB 4IBBA 1XC8A 1HJPA 4B7FA 3PVSA 3VLFB 1IXSA 3L29A 3C3EA 2CV2A 5DNYA 1OAOC 2MH8A 3TL4X 3JR4A 1TDHA 3NBIA 4JN6A 3J7AS 2A5YB 1XXHB 1IN8A 3SC3A 4HEOA 2Z4RA 1TGUA 3KW6A 2R4JA 3RE8A 4F2LA 3W0LB 4BB9A 1G8PA 2KDLA 4I4LA 3HU1A 5BPVA 3HU2A 3KOZE 2V1CA 1BVSA 2CUZA 4X64M 5JI2E 4B3MM 1G59A 2J7NA 4I8OA 2C99A 4NOOB 3ZC7B 2KNZA 2EUCA 4ITQA 1OQYA 1GLNA 2XFTA 2Y0QA 3BXWA 3SFZA 1YUBA 4QHTA 1OIZA 2LXEA 2X4AA 3GLIE 4K0KM 1VDLA 2BJWA 2ZBKB 3SYLA 3UK6A 3FUTA 1SXJC 3U6DA 1KSFX 2APLA 2RKOA 4LY6A 4IBJA 2KW0A 4AW4A 1PRBA 4TUWA 2OO9A 2X8AA 5LMNM 1HNWM 3EIEA 3MMPA 4F1IA 2UXDM 3MHVC 3MK6A 1GJSA 4A3VB 2R62A 3HJQA 3Q8XA 1ZV1A 2K0BX 2JY5A 4KODA 3GLIA 3A45A 1MU5A 2R6FA 4L6V6 3GRRA 2H5XA 3K9PA 4AG6A 2ZM6M 3HU3A 2DAGA 5FTNA 2KZUA 2DZLA 3C9PA 4B3RM 5BR8M 1DV0A 2J7OA 4D82A 4MM3B 4GHLA 4NRWA 1YE9A 1G41A 2F5OA 3CF6E 3H4JA 3L25A 1IBMM 5EXTA 2DZNB 3B7QA 2DWLA 1WJ7A 5FTMA 4WURA 1IQPA 2JY6B 3MJ5A 4FW9A 3RGPA 4LF6M 3VK7A 4I81A 1D0LA 4QNRA 5E26A 3HGIA 2UU9M 2MGWA 3I51A 1Y8GA 3BBZA 4AKGA 5L8RF 1YLAA 3PNVA 2HKJA 4KLNA 4NSRA 4QNMA 4RNAA 1UFZA 3GPXA 3FRHA 4YHHM 2LVQD 1C1KA 3TWMA 4I5SA 4PCZA 4DV7M 4RKUF 2F5SA 1N32M 2Z8YM 3DZDA 3V76A 2M5ZA 2UUAM 3FE3A 1PJQA 2L09A 4LJ8A 1HQCA 5FTKA 3E46A 4CISA 4JI6M 2HL7A 2WZJA 4JXJA 3SARA 1QZMA 4OX9M 4DR4M 2JP7A 3BOSA 3IG8A 4MH0E 2LVNC 4P17A 2UUCM 4AKIA 2DHRA 2MJ5B 4QOZC 1AUAA 4NXNM 1WHCA 4PT5A 1DGGA 1IM2A 4NC6A 1QVRA 2VF7A 4LRTA 4B7HA 4DV6M 1IN6A 1QAOA 4G3OA 2DWNA 1Z5CA 3U6OA 2LHCA 4MGYE 5EP2A 3VK8A 3J2PB 3LVWA 3SHFA 3D8LA 2XLJA 3SASA 1E94E 4MB7A 1DO0A 4DV1M 1XB2B 2R65A 4IBFA 1JQJC 2XFSA 1X37A 2OOBA 4LCBA 3KS4A 2CV0A 4GRIA 4DR5M 3TPZA 4AQYM 3K8ZA 1PGYA 3NWLA 4GKKM 5FTJA 4ZPXA 2UUBM 1D2NA 4MGZE 1IXSB 3H4MA 3J80S 5ITUA 2G5GX 2R0IA 2NQ8C 2KZSA 3LMMA 3RGSA 3D8BA 4KHPM 2JY8A 1TF0B 1DGHB 3PXGA 4CHTB 1VEJA 2KNVA 4B3SM 1N36M 2Z7JA 4WP2A 3I04M 4JI3M 4XK8F 4AI6A 2CFOA 1L2DA 5EP1A 5DYIA 1MX0A 4DV5M 5ITYA 3SYKA 2XSZA 4EIWA 3GPUA 3GLFB 1TH4A 3KOWE 3CTWB 3M0EA 2OPFA 2YR0A 2D7GA 1OJLA 4B7GA 2FOIC 3U6QA 2R4EA 2QZ4A 2EKKA 4WW0A 1KFVA 1NV9A 3FUUA 3TE6A 3GLFE 3W67A 1ZAEA 3FUWA 2DNAA 4P16A 5EXXA 4DV0M 2ZTDA 1DGHA 3AJIB 2I7NA 5KQ8A 1W5SA 1L2CA 3U61A 1H6UA 1QANA 1CUKA 3E21A 4DBGB 1P3QQ 2XZUA 3LVVA 2G3QA 3GLIB 3KOXE 1L8QA 2HHHM 3LCUA 4M9ZA 3AOEC 3HHXA 5DFLA 1OTRA 4JI1M 4GH9A 3GLFA 1E32A 2CE7A 1JR3D 4DR7M 1IXRC 1ZMWA 4OW0A 1QDRA 3U6MA 1Z5AA 4JI4M 2VQEM 1J5EM 1XNQM 2X49A 3SAWA 4HLQA 4LJ5A 1L2BA 1GABA 1IBLM 2C98A 5EP4A 1QAQA 1SXJD 1IFYA 3LQRA 3M6AA 3OTOM 4KO8A 2D7EA 4JYAM 2F5PA 2LH0A 3B89A 3GPPA 3QYBA 1IY0A 1ZQ9A 2QBYA 3R9XB 4GKJM 1DGBA 2GQFA 2YFQA 1XWIA 3PFIA 1K3XA 3IHPA 5LMUM 4LF5M 3L27A 4GC5A 1WGNA 2J5YA 1OFHA 3TQSA 4DV4M 1D0MA 2JWSA 8CATA 2DZOB 3THGA 4G6ZA 2FFJA 3K9OA 3LW5F 3B7ZA 3EIHA 3KSXA 4NL4H 3UJNA 3TWKA 2QP9X 4MGHA 2ZANA 3KP0E 4L15A 2L2DA 3SBJA 2LHGA 2RRUA 4GEWA 1E9RA 2V1UA 1WGLA 4ANRA 1Z5BA 1VDDA 2JUJA 2OOAA 1AIPC 3CF2A 5IT9S 1F4IA 2CP8A 2YQZA 1N75A 4LJ7A 2F5NA 3HKPA 4PDIA 1DO2A 3T1YM 4FWDA 1OFIA 2R18A 4S12A 3L26A 3HHZA 2EJSA 2OQ4A 2C5RA 4L4UA 1NO1A 3AOGA 1J09A 3AL0C 2KHHA 3K2LA 2JNHA 3T1HM 1OAIA 4LFAM 4LF8M 1GO5A 2M60A 3K1JA 3FYCA 2LWXA 3I01M 4CIZA 3HWSA 2QENA 3GLGB 2BWBA
chains in the Genus database with same CATH topology
3DFZA 4LGYA 2UXBM 3U6EA 3VKGA 2BNKA 5KO3A 3WHKA 1NSFA 1YSYA 2EO2A 5ITQA 1L1ZA 4II7A 4R7GA 3DA1A 5FTLA 3ZCBB 4LRSA 4BBAA 1NNUC 3TWLA 4X65M 1NY6A 4L8RC 2VQFM 3PNYA 2H1RA 3SMPA 4AZFA 4M9SA 4AG5A 1GVNA 3K92A 4X62M 4FD2A 3DOAA 4QHSA 2L7IA 4GITA 3SMSA 4LGMA 3WHLA 3L2AA 4JI7M 2F5QA 3GLGA 4DR6M 4LJ4A 3AFHA 3U6LA 3FD9A 2C96A 4CGYB 1R6BX 3KOYE 2FE8A 4Z8XA 4JI2M 3GQ5A 4G4OA 1S3SA 1HNZM 4L78A 3U61B 3R8FA 2V6ZM 4JI5M 4IBIA 4PDGA 3A42A 2XGNA 1FJGM 1Z6TA 4W5WA 2CHQA 3GO8A 3I4YA 4NSOB 4DV3M 3U5ZB 5H37D 1TDZA 3L28A 1G3IA 4LZZA 3U60A 1UM8A 1NJGA 1QAMA 1EE8A 3U6PA 4RF1A 1FNNA 1L1TA 4FVMA 1ORYB 4LJAA 3C58A 3GRYA 4D81A 4IIWA 3GP1A 1TH3A 1SXJB 2HCBA 3E9SA 3U6CA 1T3TA 1IY2A 4DUZM 1HR0M 2XEPA 3VDPA 3QAUA 5A2QS 3RFWA 3SAUA 2QBYB 5KQDA 5IWAM 1SXJE 3KSJA 4LFCM 3GRUA 1NHGC 3KS8A 3U5ZA 2D7HA 1JR3A 3B9PA 2RGOA 2UXCM 1PJJA 5EXSA 2KRKA 2QPAA 2ZAMA 3A98B 3UGJA 4LFBM 4FCVA 4JV5M 2XF3A 5KPRA 3LQQA 3FUXA 1XMOM 3JAMS 1SXJA 2KA6B 1N78A 2Z3XA 1IN4A 3VFDA 2Y20A 3HHYA 2CHVA 4OU7A 2KXEA 3J7BA 2I7PA 2F4VM 3SHGB 1GL7A 1K82A 4LJ6A 3J27B 1XNRM 1IN7A 2W82A 5IZ7D 4DR1M 4IBGA 3FYDA 1HT2E 4LF4M 1NHWC 1Q3CA 4GMQA 4IBKA 4JI8M 4AKHA 2L6OA 5E6JA 3W0FA 1R2ZA 4M9XA 2G8LA 3SATA 2E5LM 4IJFA 4GC9A 4NXMM 3I4VA 3FTEA 3GPYA 1XXHA 7CATA 4IJEA 3T15A 3T38A 4X66M 3UMMA 5FLXS 4GHAA 5C18A 3IG5A 4DV2M 1QQWA 2FNAA 5IREB 2CV1A 3KXEC 4REZA 5ITRA 4IBCA 1HQYE 3KDSE 1NNJA 1IN5A 1HT1E 5ITTA 3KP1E 4FWHA 5EQTA 4QOSA 3GQ3A 1NY5A 1I94M 4DR3M 4M0DA 4LF7M 4LF9M 2Q2EB 4FCWA 4M0WA 1PM5A 4RF0A 5EP3A 5DYGA 2JA2A 4LG2A 1GL6A 3ILKA 4LZJA 5C1BA 2ZAOA 3FTFA 3M7GA 3U6SA 2R45A 2XZFA 3VKHA 5JI3E 4Z6YA 3HJ8A 4DUYM 4XBOA 3JR5A 2KEBA 3VDUA 4GIPA 3GQ4A 2Y0TA 4L16A 4G4NA 2BJVA 4FWGA 2DXIA 2DVWB 5GKNA 1G4AE 4MGIE 1XHBA 5KPZA 3KFUG 2RGHA 1R7RA 2LNHC 4LJ9A 4BLCA 1IBKM 1IY1A 3E4RA 1K3WA 2CHGA 2QCUA 1HNXM 2C9OA 1NVMA 1E9SA 3HHWA 1TH2A 2XH9A 4JI0M 3U60B 2Y21A 1QYRA 4OVZB 4R3DA 4D80A 3UZUA 5KPTA 1W5TA 5EJCA 3ZH9B 4NRVA 2VIIA 2DWZB 2L7HA 1Z59A 3J81S 3FKEA 2ERCA 4PD2A 3AV0A 4YY3M 3A46A 4B08A 3CF0A 2P5TA 4FCTA 1WXQA 2C9CA 2KRUA 3FTCA 1LV7A 3GLHB 2DWMA 4G4QA 1I4WA 3AKZA 4OVZA 4B3TM 3HJSA 1J7KA 1GKIA 5FSWA 1IXZA 1Q3BA 4HL4A 2AHMA 1XMQM 2YNMD 1PJIA 1NJFA 5ITXE 1N34M 3FUVA 2K47A 3FTDA 4G4RA 2CEAA 1N77A 1Q39A 1DGFA 2Z4SA 3SAVA 1N33M 5EXPA 2EA0A 2O5RA 2R46A 5F3WA 4IBEA 3QWLA 3KVWA 1KYIA 4IBDA 3GLHA 3GRVA 5ITXA 4DR2M 2XSZD 1R2YA 3AOEA 4XGIA 4MGKE 4IBBA 1XC8A 4B7FA 3PVSA 3VLFB 3L29A 2CV2A 5DNYA 3TL4X 1TDHA 3NBIA 4JN6A 3J7AS 2A5YB 1XXHB 1IN8A 3SC3A 2Z4RA 1TGUA 3KW6A 2R4JA 3RE8A 3W0LB 4BB9A 1G8PA 4I4LA 3HU1A 5BPVA 3HU2A 3KOZE 2V1CA 2CUZA 4X64M 4B3MM 5JI2E 1G59A 2J7NA 4I8OA 2C99A 4NOOB 3ZC7B 2EUCA 4ITQA 1GLNA 2XFTA 2Y0QA 3SFZA 1YUBA 4QHTA 2LXEA 2X4AA 4K0KM 2BJWA 2ZBKB 3SYLA 3UK6A 3FUTA 1SXJC 3U6DA 1KSFX 2RKOA 4LY6A 4IBJA 2KW0A 4AW4A 4TUWA 2X8AA 5LMNM 1HNWM 3EIEA 2UXDM 3MHVC 3MK6A 4A3VB 2R62A 3HJQA 3Q8XA 4KODA 3GLIA 3A45A 1MU5A 3GRRA 4AG6A 2ZM6M 3HU3A 5FTNA 2KZUA 4B3RM 5BR8M 2J7OA 4D82A 4MM3B 4GHLA 4NRWA 1YE9A 1G41A 2F5OA 3CF6E 3L25A 1IBMM 5EXTA 2DZNB 2DWLA 5FTMA 4WURA 1IQPA 3MJ5A 4FW9A 3RGPA 4LF6M 3VK7A 4I81A 4QNRA 5E26A 2UU9M 3HGIA 3I51A 4AKGA 4KLNA 3PNVA 2HKJA 4NSRA 3JR4A 4QNMA 4RNAA 3GPXA 4YHHM 1C1KA 3TWMA 4I5SA 4PCZA 4DV7M 2F5SA 1N32M 3DZDA 2M5ZA 2UUAM 2L09A 4LJ8A 1HQCA 5FTKA 4CISA 4OX9M 4JI6M 2HL7A 4JXJA 3SARA 1QZMA 4DR4M 3BOSA 4MH0E 3IG8A 2UUCM 4AKIA 2DHRA 4QOZC 4NXNM 4PT5A 1DGGA 1IM2A 1QVRA 4LRTA 4B7HA 4DV6M 1IN6A 1QAOA 2DWNA 1Z5CA 3U6OA 4MGYE 5EP2A 3VK8A 3J2PB 3LVWA 3SHFA 3D8LA 2XLJA 3SASA 1E94E 4MB7A 1DO0A 4DV1M 2R65A 4IBFA 1JQJC 2XFSA 1X37A 4LCBA 3KS4A 2CV0A 4GRIA 4DR5M 3TPZA 4AQYM 3K8ZA 3NWLA 4GKKM 5FTJA 4ZPXA 2UUBM 1D2NA 4MGZE 1IXSB 3H4MA 3J80S 5ITUA 2G5GX 2NQ8C 2KZSA 3LMMA 3RGSA 3D8BA 4KHPM 1DGHB 3PXGA 4CHTB 4B3SM 1N36M 2Z7JA 4JI3M 4AI6A 2CFOA 1L2DA 5EP1A 5DYIA 1MX0A 4DV5M 5ITYA 3SYKA 2XSZA 4EIWA 3GPUA 3GLFB 1TH4A 3KOWE 3CTWB 3M0EA 2OPFA 2YR0A 2D7GA 1OJLA 4B7GA 2FOIC 3U6QA 2R4EA 2QZ4A 4WW0A 1KFVA 3FUUA 3TE6A 1ZAEA 3FUWA 4P16A 5EXXA 4DV0M 1DGHA 3AJIB 2I7NA 5KQ8A 1W5SA 1L2CA 3U61A 1H6UA 1QANA 2XZUA 3LVVA 3GLIB 3KOXE 1L8QA 2HHHM 4M9ZA 3AOEC 3HHXA 4JI1M 4GH9A 3GLFA 1E32A 2CE7A 1JR3D 4DR7M 1IXRC 4OW0A 3U6MA 1Z5AA 4JI4M 2VQEM 1J5EM 1XNQM 2X49A 3SAWA 4HLQA 4LJ5A 1L2BA 1IBLM 2C98A 5EP4A 1QAQA 1SXJD 3LQRA 3M6AA 3OTOM 4KO8A 2D7EA 4JYAM 2F5PA 2LH0A 3GPPA 1IY0A 1ZQ9A 2QBYA 3R9XB 4GKJM 1DGBA 2YFQA 1XWIA 3PFIA 1K3XA 5LMUM 4LF5M 3L27A 4GC5A 1OFHA 3TQSA 4DV4M 8CATA 2DZOB 3THGA 4G6ZA 2FFJA 3EIHA 3KSXA 4NL4H 3UJNA 3TWKA 2QP9X 4MGHA 2ZANA 3KP0E 4L15A 3SBJA 1E9RA 2V1UA 1Z5BA 1VDDA 3CF2A 5IT9S 2YQZA 1N75A 4LJ7A 2F5NA 3HKPA 4PDIA 1DO2A 3T1YM 4FWDA 1OFIA 2R18A 4S12A 3L26A 3HHZA 2OQ4A 2C5RA 4L4UA 3AOGA 1J09A 3AL0C 3K2LA 3T1HM 4LFAM 4LF8M 2M60A 3K1JA 3FYCA 2LWXA 3HWSA 2QENA 3GLGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EO2 A; 
#chains in the Genus database with same CATH topology
 3DFZ A;  4LGY A;  2UXB M;  3U6E A;  3VKG A;  1GJT A;  2BNK A;  5KO3 A;  2JY7 A;  3WHK A;  1NSF A;  1YSY A;  2EO2 A;  5ITQ A;  1L1Z A;  4II7 A;  3GLG E;  4R7G A;  2QHO B;  3DA1 A;  2DI0 A;  4KT0 F;  5FTL A;  3ZCB B;  2WSC F;  4LRS A;  4BBA A;  1R5L A;  1NNU C;  3TWL A;  4X65 M;  1NY6 A;  2DAM A;  4L8R C;  2VQF M;  3PNY A;  2FH0 A;  2H1R A;  2HAK A;  3F92 A;  3SMP A;  4M9S A;  1PJS A;  1GVN A;  2CWB A;  3K92 A;  4FD2 A;  3DOA A;  4QHS A;  2L7I A;  4GIT A;  4AG5 A;  1V92 A;  3SMS A;  3B74 A;  4LGM A;  3WHL A;  3L2A A;  4JI7 M;  2F5Q A;  3GLG A;  1TR8 A;  4DR6 M;  4LJ4 A;  2WSE F;  3AFH A;  3U6L A;  3CGW A;  3FD9 A;  2C96 A;  4CGY B;  1R6B X;  2JZ1 A;  3KOY E;  2LBC A;  2FE8 A;  1QDT A;  1T6O A;  4Z8X A;  4JI2 M;  3GQ5 A;  1QUS A;  4G4O A;  1S3S A;  2N35 A;  4L78 A;  1HNZ M;  3U61 B;  3QYE A;  1QZE A;  2V6Z M;  3R8F A;  4IBI A;  4JI5 M;  2JZ0 A;  4PDG A;  3A42 A;  2XGN A;  1FJG M;  1Z6T A;  4W5W A;  2CHQ A;  3GO8 A;  3I4Y A;  4NSO B;  4DV3 M;  2DAK A;  5H37 D;  3U5Z B;  1TDZ A;  3L28 A;  1G3I A;  4LZZ A;  3U60 A;  1V33 A;  1UM8 A;  1NJG A;  1QAM A;  1EE8 A;  3U6P A;  4RF1 A;  1FNN A;  1L1T A;  4FVM A;  1JR3 E;  1ORY B;  4LJA A;  3C58 A;  3GRY A;  4D81 A;  4IIW A;  1ZMU A;  3GP1 A;  1TH3 A;  1SXJ B;  3T6P A;  2HCB A;  3E9S A;  3Q8G A;  3U6C A;  1T3T A;  4Q7J A;  1IY2 A;  2GNO A;  4DUZ M;  1HR0 M;  2XEP A;  3VDP A;  4LF9 M;  3QAU A;  5A2Q S;  3RFW A;  3SAU A;  2QBY B;  5KQD A;  5IWA M;  1SXJ E;  3KSJ A;  4LFC M;  3GRU A;  1NHG C;  3KS8 A;  3U5Z A;  2BWE A;  2D7H A;  1JR3 A;  1SG9 A;  1WR1 B;  2RGO A;  3B9P A;  3W68 A;  1PJJ A;  2UXC M;  5EXS A;  2KRK A;  2QPA A;  1T43 A;  2ZAM A;  3A98 B;  3LCV B;  3UGJ A;  4LFB M;  4FCV A;  4JV5 M;  2XF3 A;  5KPR A;  1MN3 A;  1OIP A;  1EIJ A;  3LQQ A;  3FUX A;  1XMO M;  3JAM S;  1SXJ A;  2KA6 B;  2L4E A;  1V34 A;  1N78 A;  2Z3X A;  1IN4 A;  3VFD A;  2Y20 A;  3HHY A;  2LVO C;  1LTM A;  2ZTC A;  2CHV A;  4OU7 A;  2KXE A;  3J7B A;  2I7P A;  2K9D A;  3SHG B;  2F4V M;  1GL7 A;  1K82 A;  2DEN A;  4LJ6 A;  2MRO B;  3J27 B;  1XNR M;  1IN7 A;  1NV8 A;  1XXH E;  2W82 A;  5IZ7 D;  4DR1 M;  4IBG A;  3FYD A;  1HT2 E;  4LF4 M;  1VQ1 A;  1NHW C;  1TTE A;  1Q3C A;  4GMQ A;  4IBK A;  4JI8 M;  4AKH A;  2L6O A;  2HWJ A;  5E6J A;  3W0F A;  4M9X A;  1R2Z A;  2G8L A;  3SAT A;  2E5L M;  4IJF A;  1MJG M;  4GC9 A;  4NXM M;  3I4V A;  3FTE A;  3GPY A;  1XXH A;  7CAT A;  4IJE A;  3T15 A;  2DAE A;  3T38 A;  4X66 M;  3UMM A;  5FLX S;  4GHA A;  1RU3 A;  5C18 A;  3IG5 A;  4DV2 M;  1QQW A;  1VEG A;  2FNA A;  2QNJ A;  5IRE B;  2CV1 A;  1VG5 A;  1G71 A;  3KXE C;  4REZ A;  5ITR A;  3HZJ A;  2B3T A;  4CJ6 A;  4IBC A;  2O25 A;  1HQY E;  3KDS E;  1WIV A;  4AZF A;  1R4G A;  1NNJ A;  1IN5 A;  1HT1 E;  2O01 F;  5ITT A;  3KP1 E;  4FWH A;  5EQT A;  4QOS A;  1ZMV A;  1NY5 A;  3GQ3 A;  4DR3 M;  4M0D A;  1I94 M;  4LF7 M;  2Q2E B;  4FCW A;  4M0W A;  4UN2 B;  1PM5 A;  2LVA A;  1A5T A;  2EKF A;  4RF0 A;  5EP3 A;  5DYG A;  1D0K A;  2JA2 A;  1GL6 A;  4LG2 A;  3ILK A;  4LZJ A;  2R44 A;  5C1B A;  2ZAO A;  3HY5 A;  3FTF A;  3M7G A;  3U6S A;  2JXN A;  2R45 A;  2XZF A;  3VKH A;  5JI3 E;  4Z6Y A;  3HJ8 A;  4DUY M;  4XBO A;  3JR5 A;  2KEB A;  3VDU A;  4GIP A;  3GQ4 A;  2Y0T A;  4L16 A;  4G4N A;  2BJV A;  4FWG A;  2DXI A;  2DKL A;  2DVW B;  5GKN A;  1G4A E;  2QSF X;  4MGI E;  1XHB A;  5KPZ A;  3KFU G;  2RGH A;  1R7R A;  2LNH C;  3FRI A;  4LJ9 A;  4BLC A;  2LTU A;  1IBK M;  1IY1 A;  3E4R A;  1K3W A;  2CHG A;  2QCU A;  2L4F A;  2C9O A;  1NVM A;  1E9S A;  2KNA A;  3HHW A;  1TH2 A;  1HNX M;  2DHY A;  2XH9 A;  4JI0 M;  3U60 B;  3HX3 A;  2Y21 A;  1QYR A;  2LVP C;  4OVZ B;  4R3D A;  4D80 A;  3UZU A;  5KPT A;  1W5T A;  4R71 A;  5EJC A;  3ZH9 B;  4NRV A;  2VII A;  2DWZ B;  2L7H A;  3B7N A;  1PJT A;  1Z59 A;  3NBX X;  1JB0 F;  3J81 S;  2K6B A;  3FKE A;  3IEC A;  2ERC A;  4PD2 A;  3AV0 A;  4YY3 M;  1C7Y A;  3A46 A;  4B08 A;  3CF0 A;  2P5T A;  4FCT A;  1WXQ A;  2MR9 A;  2C9C A;  2KRU A;  2WSF F;  3C3D A;  1LV7 A;  3FTC A;  3GLH B;  2DWM A;  3ZQJ A;  4G4Q A;  1I4W A;  3AKZ A;  1Q02 A;  4OVZ A;  4B3T M;  2FS1 A;  3HJS A;  1J7K A;  1GKI A;  5FSW A;  1IXZ A;  1Q3B A;  4HL4 A;  2AHM A;  1XMQ M;  2YNM D;  1PJI A;  3GLH E;  1NJF A;  5ITX E;  1N34 M;  3FUV A;  2K47 A;  3FTD A;  4G4R A;  2CEA A;  1N77 A;  4X62 M;  1Q39 A;  1OKS A;  1EFU B;  1DGF A;  2Z4S A;  3SAV A;  1N33 M;  2DAI A;  4Y28 F;  5EXP A;  2EA0 A;  2VF8 A;  1QUT A;  2O5R A;  2R46 A;  4IBE A;  5F3W A;  1VEK A;  3QWL A;  2CRU A;  3KVW A;  1KYI A;  4IBD A;  3GLH A;  3GRV A;  5ITX A;  4DR2 M;  2QQ8 A;  2XSZ D;  1R2Y A;  3AOE A;  4XGI A;  4MGK E;  2VDB B;  4IBB A;  1XC8 A;  1HJP A;  4B7F A;  3PVS A;  3VLF B;  1IXS A;  3L29 A;  3C3E A;  2CV2 A;  5DNY A;  1OAO C;  2MH8 A;  3TL4 X;  3JR4 A;  1TDH A;  3NBI A;  4JN6 A;  3J7A S;  2A5Y B;  1XXH B;  1IN8 A;  3SC3 A;  4HEO A;  2Z4R A;  1TGU A;  3KW6 A;  2R4J A;  3RE8 A;  4F2L A;  3W0L B;  4BB9 A;  1G8P A;  2KDL A;  4I4L A;  3HU1 A;  5BPV A;  3HU2 A;  3KOZ E;  2V1C A;  1BVS A;  2CUZ A;  4X64 M;  5JI2 E;  4B3M M;  1G59 A;  2J7N A;  4I8O A;  2C99 A;  4NOO B;  3ZC7 B;  2KNZ A;  2EUC A;  4ITQ A;  1OQY A;  1GLN A;  2XFT A;  2Y0Q A;  3BXW A;  3SFZ A;  1YUB A;  4QHT A;  1OIZ A;  2LXE A;  2X4A A;  3GLI E;  4K0K M;  1VDL A;  2BJW A;  2ZBK B;  3SYL A;  3UK6 A;  3FUT A;  1SXJ C;  3U6D A;  1KSF X;  2APL A;  2RKO A;  4LY6 A;  4IBJ A;  2KW0 A;  4AW4 A;  1PRB A;  4TUW A;  2OO9 A;  2X8A A;  5LMN M;  1HNW M;  3EIE A;  3MMP A;  4F1I A;  2UXD M;  3MHV C;  3MK6 A;  1GJS A;  4A3V B;  2R62 A;  3HJQ A;  3Q8X A;  1ZV1 A;  2K0B X;  2JY5 A;  4KOD A;  3GLI A;  3A45 A;  1MU5 A;  2R6F A;  4L6V 6;  3GRR A;  2H5X A;  3K9P A;  4AG6 A;  2ZM6 M;  3HU3 A;  2DAG A;  5FTN A;  2KZU A;  2DZL A;  3C9P A;  4B3R M;  5BR8 M;  1DV0 A;  2J7O A;  4D82 A;  4MM3 B;  4GHL A;  4NRW A;  1YE9 A;  1G41 A;  2F5O A;  3CF6 E;  3H4J A;  3L25 A;  1IBM M;  5EXT A;  2DZN B;  3B7Q A;  2DWL A;  1WJ7 A;  5FTM A;  4WUR A;  1IQP A;  2JY6 B;  3MJ5 A;  4FW9 A;  3RGP A;  4LF6 M;  3VK7 A;  4I81 A;  1D0L A;  4QNR A;  5E26 A;  3HGI A;  2UU9 M;  2MGW A;  3I51 A;  1Y8G A;  3BBZ A;  4AKG A;  5L8R F;  1YLA A;  3PNV A;  2HKJ A;  4KLN A;  4NSR A;  4QNM A;  4RNA A;  1UFZ A;  3GPX A;  3FRH A;  4YHH M;  2LVQ D;  1C1K A;  3TWM A;  4I5S A;  4PCZ A;  4DV7 M;  4RKU F;  2F5S A;  1N32 M;  2Z8Y M;  3DZD A;  3V76 A;  2M5Z A;  2UUA M;  3FE3 A;  1PJQ A;  2L09 A;  4LJ8 A;  1HQC A;  5FTK A;  3E46 A;  4CIS A;  4JI6 M;  2HL7 A;  2WZJ A;  4JXJ A;  3SAR A;  1QZM A;  4OX9 M;  4DR4 M;  2JP7 A;  3BOS A;  3IG8 A;  4MH0 E;  2LVN C;  4P17 A;  2UUC M;  4AKI A;  2DHR A;  2MJ5 B;  4QOZ C;  1AUA A;  4NXN M;  1WHC A;  4PT5 A;  1DGG A;  1IM2 A;  4NC6 A;  1QVR A;  2VF7 A;  4LRT A;  4B7H A;  4DV6 M;  1IN6 A;  1QAO A;  4G3O A;  2DWN A;  1Z5C A;  3U6O A;  2LHC A;  4MGY E;  5EP2 A;  3VK8 A;  3J2P B;  3LVW A;  3SHF A;  3D8L A;  2XLJ A;  3SAS A;  1E94 E;  4MB7 A;  1DO0 A;  4DV1 M;  1XB2 B;  2R65 A;  4IBF A;  1JQJ C;  2XFS A;  1X37 A;  2OOB A;  4LCB A;  3KS4 A;  2CV0 A;  4GRI A;  4DR5 M;  3TPZ A;  4AQY M;  3K8Z A;  1PGY A;  3NWL A;  4GKK M;  5FTJ A;  4ZPX A;  2UUB M;  1D2N A;  4MGZ E;  1IXS B;  3H4M A;  3J80 S;  5ITU A;  2G5G X;  2R0I A;  2NQ8 C;  2KZS A;  3LMM A;  3RGS A;  3D8B A;  4KHP M;  2JY8 A;  1TF0 B;  1DGH B;  3PXG A;  4CHT B;  1VEJ A;  2KNV A;  4B3S M;  1N36 M;  2Z7J A;  4WP2 A;  3I04 M;  4JI3 M;  4XK8 F;  4AI6 A;  2CFO A;  1L2D A;  5EP1 A;  5DYI A;  1MX0 A;  4DV5 M;  5ITY A;  3SYK A;  2XSZ A;  4EIW A;  3GPU A;  3GLF B;  1TH4 A;  3KOW E;  3CTW B;  3M0E A;  2OPF A;  2YR0 A;  2D7G A;  1OJL A;  4B7G A;  2FOI C;  3U6Q A;  2R4E A;  2QZ4 A;  2EKK A;  4WW0 A;  1KFV A;  1NV9 A;  3FUU A;  3TE6 A;  3GLF E;  3W67 A;  1ZAE A;  3FUW A;  2DNA A;  4P16 A;  5EXX A;  4DV0 M;  2ZTD A;  1DGH A;  3AJI B;  2I7N A;  5KQ8 A;  1W5S A;  1L2C A;  3U61 A;  1H6U A;  1QAN A;  1CUK A;  3E21 A;  4DBG B;  1P3Q Q;  2XZU A;  3LVV A;  2G3Q A;  3GLI B;  3KOX E;  1L8Q A;  2HHH M;  3LCU A;  4M9Z A;  3AOE C;  3HHX A;  5DFL A;  1OTR A;  4JI1 M;  4GH9 A;  3GLF A;  1E32 A;  2CE7 A;  1JR3 D;  4DR7 M;  1IXR C;  1ZMW A;  4OW0 A;  1QDR A;  3U6M A;  1Z5A A;  4JI4 M;  2VQE M;  1J5E M;  1XNQ M;  2X49 A;  3SAW A;  4HLQ A;  4LJ5 A;  1L2B A;  1GAB A;  1IBL M;  2C98 A;  5EP4 A;  1QAQ A;  1SXJ D;  1IFY A;  3LQR A;  3M6A A;  3OTO M;  4KO8 A;  2D7E A;  4JYA M;  2F5P A;  2LH0 A;  3B89 A;  3GPP A;  3QYB A;  1IY0 A;  1ZQ9 A;  2QBY A;  3R9X B;  4GKJ M;  1DGB A;  2GQF A;  2YFQ A;  1XWI A;  3PFI A;  1K3X A;  3IHP A;  5LMU M;  4LF5 M;  3L27 A;  4GC5 A;  1WGN A;  2J5Y A;  1OFH A;  3TQS A;  4DV4 M;  1D0M A;  2JWS A;  8CAT A;  2DZO B;  3THG A;  4G6Z A;  2FFJ A;  3K9O A;  3LW5 F;  3B7Z A;  3EIH A;  3KSX A;  4NL4 H;  3UJN A;  3TWK A;  2QP9 X;  4MGH A;  2ZAN A;  3KP0 E;  4L15 A;  2L2D A;  3SBJ A;  2LHG A;  2RRU A;  4GEW A;  1E9R A;  2V1U A;  1WGL A;  4ANR A;  1Z5B A;  1VDD A;  2JUJ A;  2OOA A;  1AIP C;  3CF2 A;  5IT9 S;  1F4I A;  2CP8 A;  2YQZ A;  1N75 A;  4LJ7 A;  2F5N A;  3HKP A;  4PDI A;  1DO2 A;  3T1Y M;  4FWD A;  1OFI A;  2R18 A;  4S12 A;  3L26 A;  3HHZ A;  2EJS A;  2OQ4 A;  2C5R A;  4L4U A;  1NO1 A;  3AOG A;  1J09 A;  3AL0 C;  2KHH A;  3K2L A;  2JNH A;  3T1H M;  1OAI A;  4LFA M;  4LF8 M;  1GO5 A;  2M60 A;  3K1J A;  3FYC A;  2LWX A;  3I01 M;  4CIZ A;  3HWS A;  2QEN A;  3GLG B;  2BWB A; 
#chains in the Genus database with same CATH homology
 3DFZ A;  4LGY A;  2UXB M;  3U6E A;  3VKG A;  2BNK A;  5KO3 A;  3WHK A;  1NSF A;  1YSY A;  2EO2 A;  5ITQ A;  1L1Z A;  4II7 A;  4R7G A;  3DA1 A;  5FTL A;  3ZCB B;  4LRS A;  4BBA A;  1NNU C;  3TWL A;  4X65 M;  1NY6 A;  4L8R C;  2VQF M;  3PNY A;  2H1R A;  3SMP A;  4AZF A;  4M9S A;  4AG5 A;  1GVN A;  3K92 A;  4X62 M;  4FD2 A;  3DOA A;  4QHS A;  2L7I A;  4GIT A;  3SMS A;  4LGM A;  3WHL A;  3L2A A;  4JI7 M;  2F5Q A;  3GLG A;  4DR6 M;  4LJ4 A;  3AFH A;  3U6L A;  3FD9 A;  2C96 A;  4CGY B;  1R6B X;  3KOY E;  2FE8 A;  4Z8X A;  4JI2 M;  3GQ5 A;  4G4O A;  1S3S A;  1HNZ M;  4L78 A;  3U61 B;  3R8F A;  2V6Z M;  4JI5 M;  4IBI A;  4PDG A;  3A42 A;  2XGN A;  1FJG M;  1Z6T A;  4W5W A;  2CHQ A;  3GO8 A;  3I4Y A;  4NSO B;  4DV3 M;  3U5Z B;  5H37 D;  1TDZ A;  3L28 A;  1G3I A;  4LZZ A;  3U60 A;  1UM8 A;  1NJG A;  1QAM A;  1EE8 A;  3U6P A;  4RF1 A;  1FNN A;  1L1T A;  4FVM A;  1ORY B;  4LJA A;  3C58 A;  3GRY A;  4D81 A;  4IIW A;  3GP1 A;  1TH3 A;  1SXJ B;  2HCB A;  3E9S A;  3U6C A;  1T3T A;  1IY2 A;  4DUZ M;  1HR0 M;  2XEP A;  3VDP A;  3QAU A;  5A2Q S;  3RFW A;  3SAU A;  2QBY B;  5KQD A;  5IWA M;  1SXJ E;  3KSJ A;  4LFC M;  3GRU A;  1NHG C;  3KS8 A;  3U5Z A;  2D7H A;  1JR3 A;  3B9P A;  2RGO A;  2UXC M;  1PJJ A;  5EXS A;  2KRK A;  2QPA A;  2ZAM A;  3A98 B;  3UGJ A;  4LFB M;  4FCV A;  4JV5 M;  2XF3 A;  5KPR A;  3LQQ A;  3FUX A;  1XMO M;  3JAM S;  1SXJ A;  2KA6 B;  1N78 A;  2Z3X A;  1IN4 A;  3VFD A;  2Y20 A;  3HHY A;  2CHV A;  4OU7 A;  2KXE A;  3J7B A;  2I7P A;  2F4V M;  3SHG B;  1GL7 A;  1K82 A;  4LJ6 A;  3J27 B;  1XNR M;  1IN7 A;  2W82 A;  5IZ7 D;  4DR1 M;  4IBG A;  3FYD A;  1HT2 E;  4LF4 M;  1NHW C;  1Q3C A;  4GMQ A;  4IBK A;  4JI8 M;  4AKH A;  2L6O A;  5E6J A;  3W0F A;  1R2Z A;  4M9X A;  2G8L A;  3SAT A;  2E5L M;  4IJF A;  4GC9 A;  4NXM M;  3I4V A;  3FTE A;  3GPY A;  1XXH A;  7CAT A;  4IJE A;  3T15 A;  3T38 A;  4X66 M;  3UMM A;  5FLX S;  4GHA A;  5C18 A;  3IG5 A;  4DV2 M;  1QQW A;  2FNA A;  5IRE B;  2CV1 A;  3KXE C;  4REZ A;  5ITR A;  4IBC A;  1HQY E;  3KDS E;  1NNJ A;  1IN5 A;  1HT1 E;  5ITT A;  3KP1 E;  4FWH A;  5EQT A;  4QOS A;  3GQ3 A;  1NY5 A;  1I94 M;  4DR3 M;  4M0D A;  4LF7 M;  4LF9 M;  2Q2E B;  4FCW A;  4M0W A;  1PM5 A;  4RF0 A;  5EP3 A;  5DYG A;  2JA2 A;  4LG2 A;  1GL6 A;  3ILK A;  4LZJ A;  5C1B A;  2ZAO A;  3FTF A;  3M7G A;  3U6S A;  2R45 A;  2XZF A;  3VKH A;  5JI3 E;  4Z6Y A;  3HJ8 A;  4DUY M;  4XBO A;  3JR5 A;  2KEB A;  3VDU A;  4GIP A;  3GQ4 A;  2Y0T A;  4L16 A;  4G4N A;  2BJV A;  4FWG A;  2DXI A;  2DVW B;  5GKN A;  1G4A E;  4MGI E;  1XHB A;  5KPZ A;  3KFU G;  2RGH A;  1R7R A;  2LNH C;  4LJ9 A;  4BLC A;  1IBK M;  1IY1 A;  3E4R A;  1K3W A;  2CHG A;  2QCU A;  1HNX M;  2C9O A;  1NVM A;  1E9S A;  3HHW A;  1TH2 A;  2XH9 A;  4JI0 M;  3U60 B;  2Y21 A;  1QYR A;  4OVZ B;  4R3D A;  4D80 A;  3UZU A;  5KPT A;  1W5T A;  5EJC A;  3ZH9 B;  4NRV A;  2VII A;  2DWZ B;  2L7H A;  1Z59 A;  3J81 S;  3FKE A;  2ERC A;  4PD2 A;  3AV0 A;  4YY3 M;  3A46 A;  4B08 A;  3CF0 A;  2P5T A;  4FCT A;  1WXQ A;  2C9C A;  2KRU A;  3FTC A;  1LV7 A;  3GLH B;  2DWM A;  4G4Q A;  1I4W A;  3AKZ A;  4OVZ A;  4B3T M;  3HJS A;  1J7K A;  1GKI A;  5FSW A;  1IXZ A;  1Q3B A;  4HL4 A;  2AHM A;  1XMQ M;  2YNM D;  1PJI A;  1NJF A;  5ITX E;  1N34 M;  3FUV A;  2K47 A;  3FTD A;  4G4R A;  2CEA A;  1N77 A;  1Q39 A;  1DGF A;  2Z4S A;  3SAV A;  1N33 M;  5EXP A;  2EA0 A;  2O5R A;  2R46 A;  5F3W A;  4IBE A;  3QWL A;  3KVW A;  1KYI A;  4IBD A;  3GLH A;  3GRV A;  5ITX A;  4DR2 M;  2XSZ D;  1R2Y A;  3AOE A;  4XGI A;  4MGK E;  4IBB A;  1XC8 A;  4B7F A;  3PVS A;  3VLF B;  3L29 A;  2CV2 A;  5DNY A;  3TL4 X;  1TDH A;  3NBI A;  4JN6 A;  3J7A S;  2A5Y B;  1XXH B;  1IN8 A;  3SC3 A;  2Z4R A;  1TGU A;  3KW6 A;  2R4J A;  3RE8 A;  3W0L B;  4BB9 A;  1G8P A;  4I4L A;  3HU1 A;  5BPV A;  3HU2 A;  3KOZ E;  2V1C A;  2CUZ A;  4X64 M;  4B3M M;  5JI2 E;  1G59 A;  2J7N A;  4I8O A;  2C99 A;  4NOO B;  3ZC7 B;  2EUC A;  4ITQ A;  1GLN A;  2XFT A;  2Y0Q A;  3SFZ A;  1YUB A;  4QHT A;  2LXE A;  2X4A A;  4K0K M;  2BJW A;  2ZBK B;  3SYL A;  3UK6 A;  3FUT A;  1SXJ C;  3U6D A;  1KSF X;  2RKO A;  4LY6 A;  4IBJ A;  2KW0 A;  4AW4 A;  4TUW A;  2X8A A;  5LMN M;  1HNW M;  3EIE A;  2UXD M;  3MHV C;  3MK6 A;  4A3V B;  2R62 A;  3HJQ A;  3Q8X A;  4KOD A;  3GLI A;  3A45 A;  1MU5 A;  3GRR A;  4AG6 A;  2ZM6 M;  3HU3 A;  5FTN A;  2KZU A;  4B3R M;  5BR8 M;  2J7O A;  4D82 A;  4MM3 B;  4GHL A;  4NRW A;  1YE9 A;  1G41 A;  2F5O A;  3CF6 E;  3L25 A;  1IBM M;  5EXT A;  2DZN B;  2DWL A;  5FTM A;  4WUR A;  1IQP A;  3MJ5 A;  4FW9 A;  3RGP A;  4LF6 M;  3VK7 A;  4I81 A;  4QNR A;  5E26 A;  2UU9 M;  3HGI A;  3I51 A;  4AKG A;  4KLN A;  3PNV A;  2HKJ A;  4NSR A;  3JR4 A;  4QNM A;  4RNA A;  3GPX A;  4YHH M;  1C1K A;  3TWM A;  4I5S A;  4PCZ A;  4DV7 M;  2F5S A;  1N32 M;  3DZD A;  2M5Z A;  2UUA M;  2L09 A;  4LJ8 A;  1HQC A;  5FTK A;  4CIS A;  4OX9 M;  4JI6 M;  2HL7 A;  4JXJ A;  3SAR A;  1QZM A;  4DR4 M;  3BOS A;  4MH0 E;  3IG8 A;  2UUC M;  4AKI A;  2DHR A;  4QOZ C;  4NXN M;  4PT5 A;  1DGG A;  1IM2 A;  1QVR A;  4LRT A;  4B7H A;  4DV6 M;  1IN6 A;  1QAO A;  2DWN A;  1Z5C A;  3U6O A;  4MGY E;  5EP2 A;  3VK8 A;  3J2P B;  3LVW A;  3SHF A;  3D8L A;  2XLJ A;  3SAS A;  1E94 E;  4MB7 A;  1DO0 A;  4DV1 M;  2R65 A;  4IBF A;  1JQJ C;  2XFS A;  1X37 A;  4LCB A;  3KS4 A;  2CV0 A;  4GRI A;  4DR5 M;  3TPZ A;  4AQY M;  3K8Z A;  3NWL A;  4GKK M;  5FTJ A;  4ZPX A;  2UUB M;  1D2N A;  4MGZ E;  1IXS B;  3H4M A;  3J80 S;  5ITU A;  2G5G X;  2NQ8 C;  2KZS A;  3LMM A;  3RGS A;  3D8B A;  4KHP M;  1DGH B;  3PXG A;  4CHT B;  4B3S M;  1N36 M;  2Z7J A;  4JI3 M;  4AI6 A;  2CFO A;  1L2D A;  5EP1 A;  5DYI A;  1MX0 A;  4DV5 M;  5ITY A;  3SYK A;  2XSZ A;  4EIW A;  3GPU A;  3GLF B;  1TH4 A;  3KOW E;  3CTW B;  3M0E A;  2OPF A;  2YR0 A;  2D7G A;  1OJL A;  4B7G A;  2FOI C;  3U6Q A;  2R4E A;  2QZ4 A;  4WW0 A;  1KFV A;  3FUU A;  3TE6 A;  1ZAE A;  3FUW A;  4P16 A;  5EXX A;  4DV0 M;  1DGH A;  3AJI B;  2I7N A;  5KQ8 A;  1W5S A;  1L2C A;  3U61 A;  1H6U A;  1QAN A;  2XZU A;  3LVV A;  3GLI B;  3KOX E;  1L8Q A;  2HHH M;  4M9Z A;  3AOE C;  3HHX A;  4JI1 M;  4GH9 A;  3GLF A;  1E32 A;  2CE7 A;  1JR3 D;  4DR7 M;  1IXR C;  4OW0 A;  3U6M A;  1Z5A A;  4JI4 M;  2VQE M;  1J5E M;  1XNQ M;  2X49 A;  3SAW A;  4HLQ A;  4LJ5 A;  1L2B A;  1IBL M;  2C98 A;  5EP4 A;  1QAQ A;  1SXJ D;  3LQR A;  3M6A A;  3OTO M;  4KO8 A;  2D7E A;  4JYA M;  2F5P A;  2LH0 A;  3GPP A;  1IY0 A;  1ZQ9 A;  2QBY A;  3R9X B;  4GKJ M;  1DGB A;  2YFQ A;  1XWI A;  3PFI A;  1K3X A;  5LMU M;  4LF5 M;  3L27 A;  4GC5 A;  1OFH A;  3TQS A;  4DV4 M;  8CAT A;  2DZO B;  3THG A;  4G6Z A;  2FFJ A;  3EIH A;  3KSX A;  4NL4 H;  3UJN A;  3TWK A;  2QP9 X;  4MGH A;  2ZAN A;  3KP0 E;  4L15 A;  3SBJ A;  1E9R A;  2V1U A;  1Z5B A;  1VDD A;  3CF2 A;  5IT9 S;  2YQZ A;  1N75 A;  4LJ7 A;  2F5N A;  3HKP A;  4PDI A;  1DO2 A;  3T1Y M;  4FWD A;  1OFI A;  2R18 A;  4S12 A;  3L26 A;  3HHZ A;  2OQ4 A;  2C5R A;  4L4U A;  3AOG A;  1J09 A;  3AL0 C;  3K2L A;  3T1H M;  4LFA M;  4LF8 M;  2M60 A;  3K1J A;  3FYC A;  2LWX A;  3HWS A;  2QEN A;  3GLG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...