2EO2A

Solution structure of the insertion region (510-573) of fthfs domain from mouse methylenetetrahydrofolate dehydrogenase (nadp+ dependent) 1-like protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
71
structure length
71
Chain Sequence
b'GSSGSSGSTQTDKALYNRLVPLVNGVREFSEIQLSRLKKLGIHKTDPSTLTEEEVRKFARLNIDPATITWQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adult male hypothalamus cDNA, RIKEN full-length enriched lib
molecule tags Oxidoreductase
source organism Mus musculus
publication title Solution structure of the insertion region (510-573) of FTHFS domain from mouse methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like protein
rcsb
total genus 7
structure length 71
sequence length 71
ec nomenclature ec 6.3.4.3: Formate--tetrahydrofolate ligase.
pdb deposition date 2007-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.770 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2eo2A00
2EO2A
chains in the Genus database with same CATH superfamily
4FCVA 1XC8A 1N34M 1WXQA 3W0FA 2DHRA 1G8PA 1TH3A 3SAWA 3KOZE 3DOAA 4FCWA 1PM5A 2Z3XA 2EJSA 3Q8XA 5EXPA 4D80A 1L8QA 3GQ4A 2D7GA 4B7GA 3SHGB 3TPZA 4F2LA 2DWZB 3TL4X 1IXZA 3TWMA 5LMUM 4GMQA 3FD9A 4LJ8A 3L27A 5JI3E 4IBIA 1YLAA 3LQRA 5EP2A 1IXRC 3T15A 2W82A 2XFTA 8CATA 2CHGA 3DA1A 1MX0A 1NNUC 1S3SA 2XSZA 3PFIA 4IBJA 2I7NA 3GLIB 3T1YM 3U5ZA 4YHHM 2QQ8A 3HU3A 1IN4A 2R6FA 5DYGA 2B3TA 3OTOM 2CE7A 1IY2A 1E9SA 3RFWA 1HNZM 2DAKA 4AI6A 1R6BX 5KO3A 3SATA 4IBCA 3IG5A 2KDLA 1G71A 3FYDA 1TDZA 4JV5M 1DGFA 5F3WA 2R18A 2QBYB 3MJ5A 1DGHA 4LF9M 4LCBA 4DV5M 3H4MA 1ZMUA 1Q3BA 2FFJA 3GLFA 3SAUA 2V1CA 1FJGM 3D8LA 5E26A 1QUTA 2DWNA 3C3EA 4B08A 2KRUA 2UUCM 3QYBA 1IN8A 4AZFA 1XWIA 1V34A 2QSFX 4LF5M 3U6QA 1XXHA 1W5SA 1OAIA 1Z59A 1R5LA 1PJTA 2K47A 4MGYE 2XZFA 3FTDA 4D82A 4LG2A 4GC9A 2K0BX 5FTMA 2LXEA 1XMOM 3MK6A 4IBDA 2BWBA 4IBKA 2QENA 1OKSA 1QQWA 1Z6TA 2UUBM 1XXHB 2KXEA 3FUTA 5A2QS 1R2ZA 1N36M 2LVOC 2QHOB 2F5NA 1OQYA 4RF1A 4G4OA 4DV7M 3U60A 3LW5F 4M9SA 1CUKA 1NHWC 1XNQM 1IN7A 2RRUA 3VKHA 4M9XA 1HT2E 1JR3D 2FH0A 5KQ8A 2QCUA 2ZTCA 1K3XA 3LQQA 4Y28F 1N77A 3DZDA 1GVNA 4XBOA 4WURA 3GRRA 1GL6A 4L6V6 1QAOA 5JI2E 3M6AA 5EP3A 2CV2A 3I04M 4JI7M 2GNOA 3SYLA 2JZ0A 3KXEC 4IJEA 4G4RA 2ZANA 4LGYA 4B7FA 2X4AA 1NHGC 1Y8GA 5ITXE 2LBCA 3L2AA 1G59A 2QBYA 1L1TA 3U5ZB 3HHWA 2QP9X 1VDDA 2WSEF 4FW9A 5IWAM 1L2DA 2H5XA 2R62A 1E94E 3PVSA 5FTLA 1A5TA 2O25A 5C18A 2UXBM 1XXHE 1Z5BA 2A5YB 3JR5A 4A3VB 4M0DA 4D81A 1L2BA 2Y0QA 4I8OA 4NOOB 4AKHA 2VF7A 5FTNA 2DNAA 2JWSA 3THGA 5H37D 3GLHA 3U61A 4L4UA 4QHSA 4B3RM 2MGWA 2OOBA 4EIWA 4NRWA 4BB9A 2XZUA 4KHPM 1MJGM 2UUAM 1SXJC 2BJVA 3VKGA 4R71A 2E5LM 1HQYE 3FRHA 1SXJD 5KPTA 2DZLA 3GRVA 1NY6A 3GLGE 2I7PA 2JP7A 2WZJA 2ZAMA 3J2PB 3NBIA 4DR3M 4NXNM 1UFZA 3Q8GA 3SHFA 1OTRA 1G3IA 1R7RA 2CWBA 2JY5A 1NJGA 4MGZE 2VQEM 2LVQD 3J7AS 1C7YA 3V76A 1NO1A 4LY6A 5EXXA 2JY8A 3VDUA 2NQ8C 4Z8XA 5BR8M 1TH2A 5ITUA 4KO8A 3GLHB 2KEBA 2HWJA 4FD2A 4JI6M 4JI8M 3D8BA 4JXJA 3AFHA 2J7NA 1KSFX 1GJSA 5IT9S 1NJFA 1X37A 1SXJA 1HNXM 2L4FA 3RGPA 3U6EA 4DV3M 3FUWA 2MR9A 5EQTA 4CJ6A 3VLFB 2KRKA 4MH0E 4UN2B 5BPVA 3GO8A 4I5SA 3U6PA 4AQYM 4NXMM 3AKZA 2BJWA 4OVZA 3FUVA 3AL0C 2AHMA 1TGUA 2G5GX 4IIWA 4AG6A 3PNYA 2R44A 3B7NA 4BBAA 4LF8M 2J5YA 3GLGA 4L15A 1DGGA 4WW0A 2EUCA 1HNWM 1WHCA 1NVMA 4P17A 4DUZM 1XHBA 4RF0A 2Q2EB 4LJ7A 3U60B 3CF2A 2JUJA 2RGHA 3FUXA 5GKNA 2R4EA 4B7HA 3GQ3A 2BNKA 2L4EA 4BLCA 2Z4RA 3TE6A 2DVWB 4YY3M 4JI4M 2D7EA 3GQ5A 2UXDM 4NC6A 4LJ9A 4LFBM 1SXJB 2DENA 2LVAA 2FOIC 2LHGA 1K82A 2DZOB 3AV0A 4I81A 1JR3A 4IBFA 5ITRA 2BWEA 4PDGA 1G41A 2CFOA 3HY5A 3BOSA 1R2YA 3E4RA 2EO2A 4GC5A 1IM2A 1P3QQ 3GLGB 2CV0A 1Q3CA 1QDRA 4B3MM 1QANA 3IG8A 4FVMA 4MB7A 4PDIA 3JR4A 3FTEA 4LF6M 1IBKM 1MN3A 2WSCF 4L8RC 1Q02A 4QNMA 1VEKA 3TQSA 2XSZD 2HHHM 1JR3E 1IFYA 3B89A 4LZZA 4LF7M 2APLA 2ERCA 1IY0A 3KSJA 4Q7JA 2MH8A 1J5EM 3LCVB 3WHLA 1OJLA 2JY6B 3U6SA 1NSFA 3BBZA 3CF0A 5EXSA 4M9ZA 1QDTA 1Z5CA 3NWLA 1QUSA 1EE8A 4K0KM 4NSRA 3VDPA 3K9PA 1WJ7A 4LJ4A 2L2DA 3DFZA 1T3TA 3KOWE 4FWGA 3PXGA 1W5TA 3M7GA 4PT5A 4QOZC 1DGHB 2HCBA 4OX9M 1XNRM 2DI0A 2KHHA 1ZQ9A 2Y21A 1Z5AA 2J7OA 1TR8A 3B7ZA 4LRTA 3L26A 2YFQA 1HR0M 2DXIA 1NV9A 3EIHA 5ITXA 1NNJA 2DAIA 3J81S 1VEJA 2L6OA 5LMNM 3FTFA 4L16A 4DV6M 1XB2B 1IXSA 2CHVA 3ZH9B 2XH9A 4Z6YA 1F4IA 1ZAEA 4LFCM 3SMSA 3KS8A 1N32M 2F5SA 4DV0M 2RGOA 4LJ6A 3GPPA 4XGIA 3E21A 4LGMA 3VK7A 2CUZA 4KT0F 5ITYA 4ITQA 4DR1M 3SBJA 3J7BA 4GIPA 1GKIA 5FSWA 3IHPA 2VQFM 4DR7M 2CEAA 3K1JA 1NY5A 1E32A 2R0IA 3GPXA 3KOYE 4AKIA 1PJQA 3MMPA 5KPZA 2FE8A 4MM3B 2L7IA 3SMPA 4CHTB 4DV2M 1VDLA 5FTKA 3SYKA 3A46A 4DBGB 3HHZA 2CP8A 4KODA 4DR4M 3R8FA 4AG5A 2JNHA 4X64M 3KFUG 5FTJA 4JI5M 3U6MA 2XLJA 2X8AA 4DR5M 3F92A 2M5ZA 3MHVC 3ZC7B 1D2NA 4FCTA 4QOSA 4G4NA 4II7A 1TTEA 2Z4SA 5KPRA 5ITTA 3T1HM 4JI0M 3HZJA 4G3OA 3GP1A 2KNVA 1FNNA 2LH0A 4LZJA 4OU7A 2C96A 1ZV1A 2XEPA 3AJIB 3AOGA 3LCUA 4GHLA 1EIJA 3HU1A 3KP1E 1GL7A 2C99A 2R45A 1L1ZA 1RU3A 2LVNC 3KOXE 1E9RA 4IBGA 2Y20A 4DV4M 3A45A 4GKJM 1WGLA 4R7GA 1UM8A 1MU5A 2MJ5B 1V92A 4KLNA 4HEOA 1DV0A 1R4GA 3A98B 1PGYA 4X62M 1IBLM 1T6OA 2UU9M 3ZCBB 3QAUA 3I51A 1D0MA 1TH4A 2O5RA 1V33A 3ILKA 4GHAA 4DR6M 1XMQM 1N33M 3K8ZA 1D0LA 3CF6E 3L28A 3NBXX 4X66M 4DUYM 1YSYA 2F5PA 3UJNA 4TUWA 2HAKA 3FTCA 1QZMA 2FNAA 1KFVA 3W0LB 1JB0F 3HKPA 4RNAA 2XFSA 3U6CA 2R65A 1AIPC 3SASA 2F5OA 3SARA 2GQFA 2C9OA 2Y0TA 4OVZB 2CHQA 2QPAA 3UK6A 1VEGA 1IQPA 1G4AE 2H1RA 3SC3A 3B7QA 3FUUA 2LHCA 2DZNB 2UXCM 3FKEA 3KDSE 2G3QA 2G8LA 2LVPC 2CRUA 3LVWA 3QYEA 1T43A 1JQJC 4QHTA 5DYIA 4FWDA 2Z8YM 4LRSA 4MGHA 2Z7JA 3GPYA 1QAMA 4GH9A 1DO2A 4CGYB 1PJJA 1ORYB 4LJAA 2O01F 4W5WA 5E6JA 2R46A 3SFZA 1VG5A 2OPFA 3IECA 5ITQA 1ZMVA 4HL4A 4IJFA 2K6BA 3UZUA 2QNJA 3W68A 3JAMS 4PCZA 3B74A 1YUBA 3HHYA 1AUAA 7CATA 2OQ4A 3GPUA 4LF4M 2WSFF 4P16A 3HJSA 3I01M 3HU2A 2XGNA 3PNVA 1PJIA 1DGBA 2ZAOA 4HLQA 4AKGA 2LNHC 1PRBA 3GLHE 3VFDA 5IREB 2ZM6M 4JN6A 1J09A 4NSOB 2OOAA 3W67A 2DKLA 1IXSB 1OFIA 2XF3A 3E46A 3QWLA 2VF8A 2X49A 1I4WA 2KNAA 4DV1M 3HWSA 3U6OA 1KYIA 3A42A 3K92A 3BXWA 1WIVA 4NL4H 4XK8F 4G4QA 1GABA 2RKOA 2DHYA 2JZ1A 3KW6A 3T38A 3HJQA 3GLIA 3KVWA 4I4LA 2R4JA 4NRVA 2P5TA 3RE8A 5FLXS 4JI3M 4GITA 3EIEA 2KZSA 2C5RA 2EKKA 2DAEA 2KW0A 1HJPA 3B9PA 1LV7A 3L25A 4GRIA 1IY1A 3TWLA 3SAVA 1NV8A 1EFUB 2JXNA 3E9SA 2FS1A 4B3SM 3KP0E 4G6ZA 4M0WA 1PJSA 2QZ4A 2V6ZM 3FRIA 4AW4A 3C3DA 4R3DA 1N75A 1OAOC 4ANRA 3TWKA 3HJ8A 2LWXA 4QNRA 1DO0A 3U6DA 2MROB 3C9PA 4PD2A 3U61B 2DWLA 1GO5A 4DR2M 2D7HA 4OW0A 2C9CA 2ZBKB 4JYAM 3HX3A 2EKFA 2HKJA 2YR0A 1GLNA 3K9OA 3UGJA 1HQCA 1WR1B 4GKKM 3FE3A 1OIZA 1YE9A 2LTUA 1GJTA 2VIIA 1TF0B 3HHXA 3L29A 4L78A 4IBBA 3KSXA 2EA0A 2HL7A 3LMMA 4WP2A 3T6PA 4IBEA 3K2LA 4GEWA 3ZQJA 3GLIE 2VDBB 5EP4A 3M0EA 3J80S 1HT1E 3CTWB 2JY7A 3FYCA 3GRYA 1I94M 3LVVA 1Q39A 2L09A 2KZUA 2V1UA 5C1BA 1C1KA 2KNZA 3AOEA 2F5QA 3CGWA 5EP1A 1QYRA 3KS4A 4REZA 4LFAM 1TDHA 2N35A 4LJ5A 1OFHA 3RGSA 5EXTA 4RKUF 4CIZA 5L8RF 2DAGA 3UMMA 1WGNA 4MGKE 4JI2M 1D0KA 2OO9A 3C58A 1SG9A 2YNMD 1BVSA 5DFLA 4F1IA 2KA6B 4FWHA 2DAMA 5EJCA 1VQ1A 2F4VM 4S12A 1OIPA 5DNYA 2M60A 1N78A 1IBMM 5IZ7D 1QAQA 1QZEA 2DWMA 4JI1M 3WHKA 3J27B 3I4YA 3GLFE 3R9XB 4X65M 3H4JA 4MGIE 3I4VA 1LTMA 2K9DA 4CISA 1K3WA 5KQDA 2CV1A 3GLFB 4ZPXA 3HGIA 3VK8A 2ZTDA 1QVRA 1H6UA 2L7HA 2YQZA 1ZMWA 3GRUA 4B3TM 1L2CA 1IN6A 3U6LA 2JA2A 3AOEC 1J7KA 1IN5A 1SXJE 2C98A
chains in the Genus database with same CATH topology
4FCVA 1XC8A 1N34M 1WXQA 3W0FA 2DHRA 1G8PA 1TH3A 3SAWA 3KOZE 3DOAA 4FCWA 1PM5A 2Z3XA 3Q8XA 5EXPA 4D80A 1L8QA 3GQ4A 2D7GA 4B7GA 3SHGB 3TPZA 2DWZB 3TL4X 1IXZA 3TWMA 5LMUM 4GMQA 3FD9A 4LJ8A 3L27A 5JI3E 4IBIA 3LQRA 5EP2A 1IXRC 2W82A 2XFTA 8CATA 2CHGA 3DA1A 1MX0A 1NNUC 1S3SA 2XSZA 3PFIA 4IBJA 2I7NA 3GLIB 3T1YM 3U5ZA 4YHHM 3HU3A 1IN4A 5DYGA 3OTOM 2CE7A 1IY2A 1E9SA 3RFWA 1HNZM 4AI6A 1R6BX 5KO3A 3SATA 4IBCA 3IG5A 4JV5M 3FYDA 1TDZA 1DGFA 5F3WA 2R18A 2QBYB 3MJ5A 1DGHA 4LF9M 4LCBA 4DV5M 3H4MA 1Q3BA 2FFJA 3GLFA 3SAUA 2V1CA 1FJGM 3D8LA 5E26A 2DWNA 4B08A 2KRUA 2UUCM 1IN8A 4AZFA 1XWIA 4LF5M 3U6QA 1XXHA 1W5SA 1Z59A 4MGYE 2XZFA 2K47A 3FTDA 4D82A 4LG2A 4GC9A 5FTMA 2LXEA 1XMOM 3MK6A 4IBDA 4IBKA 2QENA 1QQWA 1Z6TA 2UUBM 1XXHB 2KXEA 3FUTA 5A2QS 1R2ZA 1N36M 2F5NA 4RF1A 4G4OA 4DV7M 3U60A 4M9SA 1NHWC 1XNQM 1IN7A 3VKHA 4M9XA 1HT2E 1JR3D 5KQ8A 2QCUA 1K3XA 3LQQA 1N77A 3DZDA 1GVNA 4XBOA 4WURA 3GRRA 1GL6A 5JI2E 1QAOA 3M6AA 5EP3A 2CV2A 4JI7M 3SYLA 3KXEC 4IJEA 4G4RA 2ZANA 4LGYA 4B7FA 2X4AA 1NHGC 5ITXE 2QBYA 3L2AA 1G59A 1L1TA 3U5ZB 3HHWA 2QP9X 1VDDA 4FW9A 5IWAM 1L2DA 1E94E 2R62A 3PVSA 5FTLA 5C18A 2UXBM 1Z5BA 2A5YB 3JR5A 4A3VB 4M0DA 4D81A 1L2BA 2Y0QA 4I8OA 4NOOB 4AKHA 5FTNA 5H37D 3THGA 3GLHA 3U61A 4L4UA 4QHSA 4B3RM 4NRWA 4EIWA 4BB9A 2XZUA 4KHPM 2UUAM 1SXJC 2BJVA 3VKGA 2E5LM 1HQYE 1SXJD 5KPTA 3GRVA 1NY6A 2I7PA 2ZAMA 3J2PB 3NBIA 4DR3M 4NXNM 3SHFA 1G3IA 1R7RA 1NJGA 4MGZE 2VQEM 3J7AS 4LY6A 5EXXA 3VDUA 2NQ8C 4Z8XA 5BR8M 1TH2A 5ITUA 4KO8A 3GLHB 2KEBA 4FD2A 4JI6M 4JI8M 3D8BA 4JXJA 3AFHA 2J7NA 1KSFX 5IT9S 1NJFA 1X37A 1SXJA 1HNXM 3RGPA 3U6EA 4DV3M 3FUWA 5EQTA 3VLFB 2KRKA 4MH0E 5BPVA 3GO8A 4I5SA 3U6PA 4AQYM 4NXMM 3AKZA 2BJWA 4OVZA 3FUVA 3AL0C 2AHMA 1TGUA 2G5GX 4IIWA 4AG6A 3PNYA 4BBAA 4LF8M 3GLGA 4L15A 1DGGA 4WW0A 2EUCA 1HNWM 1NVMA 4DUZM 1XHBA 4RF0A 2Q2EB 4LJ7A 3U60B 3CF2A 2RGHA 3FUXA 5GKNA 2R4EA 4B7HA 3GQ3A 2BNKA 4BLCA 2Z4RA 3TE6A 2DVWB 4YY3M 4JI4M 2D7EA 3GQ5A 2UXDM 4LFBM 4LJ9A 1SXJB 1K82A 2FOIC 2DZOB 3AV0A 4I81A 1JR3A 4IBFA 5ITRA 4PDGA 1G41A 2CFOA 3BOSA 1R2YA 3E4RA 2EO2A 4GC5A 1IM2A 3GLGB 2CV0A 1Q3CA 4B3MM 1QANA 3IG8A 4FVMA 4MB7A 4PDIA 3JR4A 3FTEA 4LF6M 1IBKM 4L8RC 4QNMA 3TQSA 2XSZD 2HHHM 4LZZA 4LF7M 2ERCA 1IY0A 3KSJA 1J5EM 3WHLA 1OJLA 3U6SA 1NSFA 3CF0A 5EXSA 4M9ZA 1Z5CA 3NWLA 1EE8A 4K0KM 4NSRA 3VDPA 4LJ4A 3DFZA 1T3TA 3KOWE 4FWGA 3PXGA 1W5TA 3M7GA 4PT5A 4QOZC 1DGHB 2HCBA 4OX9M 1XNRM 2Y21A 1ZQ9A 2J7OA 1Z5AA 3L26A 4LRTA 1HR0M 2DXIA 2YFQA 3EIHA 5ITXA 1NNJA 3J81S 3FTFA 5LMNM 2L6OA 4L16A 4DV6M 2CHVA 3ZH9B 2XH9A 4Z6YA 1ZAEA 4LFCM 3SMSA 3KS8A 1N32M 2F5SA 4DV0M 2RGOA 4LJ6A 3GPPA 4XGIA 4LGMA 3VK7A 2CUZA 5ITYA 4ITQA 4DR1M 3SBJA 3J7BA 4GIPA 1GKIA 5FSWA 2VQFM 4DR7M 2CEAA 3K1JA 1NY5A 1E32A 3GPXA 3KOYE 4AKIA 5KPZA 2FE8A 4MM3B 2L7IA 3SMPA 4CHTB 4DV2M 3SYKA 5FTKA 3A46A 3HHZA 4KODA 4DR4M 3R8FA 4AG5A 4X64M 3KFUG 5FTJA 4JI5M 3U6MA 2XLJA 2X8AA 4DR5M 3MHVC 2M5ZA 3ZC7B 1D2NA 4FCTA 4QOSA 4G4NA 4II7A 2Z4SA 5KPRA 5ITTA 3T1HM 4JI0M 3GP1A 1FNNA 2LH0A 4LZJA 4OU7A 2C96A 2XEPA 3AJIB 3AOGA 4GHLA 3HU1A 3KP1E 1GL7A 2C99A 2R45A 1L1ZA 4IBGA 3KOXE 1E9RA 2Y20A 4DV4M 3A45A 4GKJM 4R7GA 1UM8A 1MU5A 4KLNA 3A98B 4X62M 1IBLM 2UU9M 3ZCBB 3QAUA 3I51A 1TH4A 4GHAA 2O5RA 4DR6M 3ILKA 1N33M 1XMQM 3K8ZA 3L28A 3CF6E 4DUYM 2F5PA 4X66M 4TUWA 1YSYA 3UJNA 3FTCA 1QZMA 2FNAA 1KFVA 3W0LB 3HKPA 4RNAA 2XFSA 3U6CA 2R65A 3SASA 2F5OA 3SARA 2C9OA 2Y0TA 4OVZB 2CHQA 2QPAA 3UK6A 1IQPA 1G4AE 2H1RA 3SC3A 3FUUA 2DZNB 2UXCM 3FKEA 3KDSE 2G8LA 4QHTA 3LVWA 3T15A 5DYIA 1JQJC 4FWDA 4LRSA 4MGHA 2Z7JA 3GPYA 1QAMA 4GH9A 1DO2A 4CGYB 1PJJA 1ORYB 4LJAA 4W5WA 5E6JA 2R46A 3SFZA 2OPFA 5ITQA 4IJFA 4HL4A 3UZUA 3JAMS 4PCZA 1YUBA 3HHYA 7CATA 2OQ4A 3GPUA 4LF4M 4P16A 3HJSA 3HU2A 2XGNA 3PNVA 1PJIA 1DGBA 2ZAOA 4HLQA 4AKGA 2LNHC 3VFDA 5IREB 2ZM6M 4JN6A 1J09A 4NSOB 1IXSB 1OFIA 2XF3A 3QWLA 2X49A 1I4WA 3U6OA 4DV1M 3HWSA 1KYIA 3A42A 3K92A 4NL4H 4G4QA 2RKOA 3T38A 3KW6A 3HJQA 3GLIA 3KVWA 4I4LA 2R4JA 4NRVA 2P5TA 3RE8A 5FLXS 4JI3M 4GITA 3EIEA 2KZSA 2C5RA 2KW0A 3B9PA 1LV7A 3L25A 4GRIA 1IY1A 3TWLA 3SAVA 4B3SM 3E9SA 3KP0E 4G6ZA 4M0WA 2QZ4A 2V6ZM 4AW4A 4R3DA 1N75A 3TWKA 3HJ8A 2LWXA 4QNRA 1DO0A 3U6DA 4PD2A 3U61B 2DWLA 4DR2M 2D7HA 4OW0A 2C9CA 2ZBKB 4JYAM 2HKJA 2YR0A 1GLNA 3UGJA 1HQCA 4GKKM 1YE9A 2VIIA 3HHXA 3L29A 4L78A 4IBBA 3KSXA 2EA0A 2HL7A 3LMMA 4IBEA 3K2LA 5EP4A 3M0EA 3J80S 1HT1E 3CTWB 3FYCA 3GRYA 1I94M 3LVVA 1Q39A 2L09A 2KZUA 2V1UA 5C1BA 1C1KA 3AOEA 2F5QA 5EP1A 1QYRA 3KS4A 4REZA 4LFAM 1TDHA 4LJ5A 1OFHA 3RGSA 5EXTA 3UMMA 4MGKE 4JI2M 3C58A 2YNMD 2KA6B 4FWHA 5EJCA 2F4VM 4S12A 5DNYA 2M60A 1N78A 1IBMM 5IZ7D 1QAQA 2DWMA 4JI1M 3WHKA 3J27B 3I4YA 3R9XB 4X65M 4MGIE 3I4VA 4CISA 1K3WA 5KQDA 2CV1A 3GLFB 4ZPXA 3HGIA 3VK8A 1QVRA 1H6UA 2L7HA 2YQZA 3GRUA 4B3TM 1L2CA 1IN6A 3U6LA 2JA2A 3AOEC 1J7KA 1IN5A 1SXJE 2C98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EO2 A; 
#chains in the Genus database with same CATH topology
 4FCV A;  1XC8 A;  1N34 M;  1WXQ A;  3W0F A;  2DHR A;  1G8P A;  1TH3 A;  3SAW A;  3KOZ E;  3DOA A;  4FCW A;  1PM5 A;  2Z3X A;  2EJS A;  3Q8X A;  5EXP A;  4D80 A;  1L8Q A;  3GQ4 A;  2D7G A;  4B7G A;  3SHG B;  3TPZ A;  4F2L A;  2DWZ B;  3TL4 X;  1IXZ A;  3TWM A;  5LMU M;  4GMQ A;  3FD9 A;  4LJ8 A;  3L27 A;  5JI3 E;  4IBI A;  1YLA A;  3LQR A;  5EP2 A;  1IXR C;  3T15 A;  2W82 A;  2XFT A;  8CAT A;  2CHG A;  3DA1 A;  1MX0 A;  1NNU C;  1S3S A;  2XSZ A;  3PFI A;  4IBJ A;  2I7N A;  3GLI B;  3T1Y M;  3U5Z A;  4YHH M;  2QQ8 A;  3HU3 A;  1IN4 A;  2R6F A;  5DYG A;  2B3T A;  3OTO M;  2CE7 A;  1IY2 A;  1E9S A;  3RFW A;  1HNZ M;  2DAK A;  4AI6 A;  1R6B X;  5KO3 A;  3SAT A;  4IBC A;  3IG5 A;  2KDL A;  1G71 A;  3FYD A;  1TDZ A;  4JV5 M;  1DGF A;  5F3W A;  2R18 A;  2QBY B;  3MJ5 A;  1DGH A;  4LF9 M;  4LCB A;  4DV5 M;  3H4M A;  1ZMU A;  1Q3B A;  2FFJ A;  3GLF A;  3SAU A;  2V1C A;  1FJG M;  3D8L A;  5E26 A;  1QUT A;  2DWN A;  3C3E A;  4B08 A;  2KRU A;  2UUC M;  3QYB A;  1IN8 A;  4AZF A;  1XWI A;  1V34 A;  2QSF X;  4LF5 M;  3U6Q A;  1XXH A;  1W5S A;  1OAI A;  1Z59 A;  1R5L A;  1PJT A;  2K47 A;  4MGY E;  2XZF A;  3FTD A;  4D82 A;  4LG2 A;  4GC9 A;  2K0B X;  5FTM A;  2LXE A;  1XMO M;  3MK6 A;  4IBD A;  2BWB A;  4IBK A;  2QEN A;  1OKS A;  1QQW A;  1Z6T A;  2UUB M;  1XXH B;  2KXE A;  3FUT A;  5A2Q S;  1R2Z A;  1N36 M;  2LVO C;  2QHO B;  2F5N A;  1OQY A;  4RF1 A;  4G4O A;  4DV7 M;  3U60 A;  3LW5 F;  4M9S A;  1CUK A;  1NHW C;  1XNQ M;  1IN7 A;  2RRU A;  3VKH A;  4M9X A;  1HT2 E;  1JR3 D;  2FH0 A;  5KQ8 A;  2QCU A;  2ZTC A;  1K3X A;  3LQQ A;  4Y28 F;  1N77 A;  3DZD A;  1GVN A;  4XBO A;  4WUR A;  3GRR A;  1GL6 A;  4L6V 6;  1QAO A;  5JI2 E;  3M6A A;  5EP3 A;  2CV2 A;  3I04 M;  4JI7 M;  2GNO A;  3SYL A;  2JZ0 A;  3KXE C;  4IJE A;  4G4R A;  2ZAN A;  4LGY A;  4B7F A;  2X4A A;  1NHG C;  1Y8G A;  5ITX E;  2LBC A;  3L2A A;  1G59 A;  2QBY A;  1L1T A;  3U5Z B;  3HHW A;  2QP9 X;  1VDD A;  2WSE F;  4FW9 A;  5IWA M;  1L2D A;  2H5X A;  2R62 A;  1E94 E;  3PVS A;  5FTL A;  1A5T A;  2O25 A;  5C18 A;  2UXB M;  1XXH E;  1Z5B A;  2A5Y B;  3JR5 A;  4A3V B;  4M0D A;  4D81 A;  1L2B A;  2Y0Q A;  4I8O A;  4NOO B;  4AKH A;  2VF7 A;  5FTN A;  2DNA A;  2JWS A;  3THG A;  5H37 D;  3GLH A;  3U61 A;  4L4U A;  4QHS A;  4B3R M;  2MGW A;  2OOB A;  4EIW A;  4NRW A;  4BB9 A;  2XZU A;  4KHP M;  1MJG M;  2UUA M;  1SXJ C;  2BJV A;  3VKG A;  4R71 A;  2E5L M;  1HQY E;  3FRH A;  1SXJ D;  5KPT A;  2DZL A;  3GRV A;  1NY6 A;  3GLG E;  2I7P A;  2JP7 A;  2WZJ A;  2ZAM A;  3J2P B;  3NBI A;  4DR3 M;  4NXN M;  1UFZ A;  3Q8G A;  3SHF A;  1OTR A;  1G3I A;  1R7R A;  2CWB A;  2JY5 A;  1NJG A;  4MGZ E;  2VQE M;  2LVQ D;  3J7A S;  1C7Y A;  3V76 A;  1NO1 A;  4LY6 A;  5EXX A;  2JY8 A;  3VDU A;  2NQ8 C;  4Z8X A;  5BR8 M;  1TH2 A;  5ITU A;  4KO8 A;  3GLH B;  2KEB A;  2HWJ A;  4FD2 A;  4JI6 M;  4JI8 M;  3D8B A;  4JXJ A;  3AFH A;  2J7N A;  1KSF X;  1GJS A;  5IT9 S;  1NJF A;  1X37 A;  1SXJ A;  1HNX M;  2L4F A;  3RGP A;  3U6E A;  4DV3 M;  3FUW A;  2MR9 A;  5EQT A;  4CJ6 A;  3VLF B;  2KRK A;  4MH0 E;  4UN2 B;  5BPV A;  3GO8 A;  4I5S A;  3U6P A;  4AQY M;  4NXM M;  3AKZ A;  2BJW A;  4OVZ A;  3FUV A;  3AL0 C;  2AHM A;  1TGU A;  2G5G X;  4IIW A;  4AG6 A;  3PNY A;  2R44 A;  3B7N A;  4BBA A;  4LF8 M;  2J5Y A;  3GLG A;  4L15 A;  1DGG A;  4WW0 A;  2EUC A;  1HNW M;  1WHC A;  1NVM A;  4P17 A;  4DUZ M;  1XHB A;  4RF0 A;  2Q2E B;  4LJ7 A;  3U60 B;  3CF2 A;  2JUJ A;  2RGH A;  3FUX A;  5GKN A;  2R4E A;  4B7H A;  3GQ3 A;  2BNK A;  2L4E A;  4BLC A;  2Z4R A;  3TE6 A;  2DVW B;  4YY3 M;  4JI4 M;  2D7E A;  3GQ5 A;  2UXD M;  4NC6 A;  4LJ9 A;  4LFB M;  1SXJ B;  2DEN A;  2LVA A;  2FOI C;  2LHG A;  1K82 A;  2DZO B;  3AV0 A;  4I81 A;  1JR3 A;  4IBF A;  5ITR A;  2BWE A;  4PDG A;  1G41 A;  2CFO A;  3HY5 A;  3BOS A;  1R2Y A;  3E4R A;  2EO2 A;  4GC5 A;  1IM2 A;  1P3Q Q;  3GLG B;  2CV0 A;  1Q3C A;  1QDR A;  4B3M M;  1QAN A;  3IG8 A;  4FVM A;  4MB7 A;  4PDI A;  3JR4 A;  3FTE A;  4LF6 M;  1IBK M;  1MN3 A;  2WSC F;  4L8R C;  1Q02 A;  4QNM A;  1VEK A;  3TQS A;  2XSZ D;  2HHH M;  1JR3 E;  1IFY A;  3B89 A;  4LZZ A;  4LF7 M;  2APL A;  2ERC A;  1IY0 A;  3KSJ A;  4Q7J A;  2MH8 A;  1J5E M;  3LCV B;  3WHL A;  1OJL A;  2JY6 B;  3U6S A;  1NSF A;  3BBZ A;  3CF0 A;  5EXS A;  4M9Z A;  1QDT A;  1Z5C A;  3NWL A;  1QUS A;  1EE8 A;  4K0K M;  4NSR A;  3VDP A;  3K9P A;  1WJ7 A;  4LJ4 A;  2L2D A;  3DFZ A;  1T3T A;  3KOW E;  4FWG A;  3PXG A;  1W5T A;  3M7G A;  4PT5 A;  4QOZ C;  1DGH B;  2HCB A;  4OX9 M;  1XNR M;  2DI0 A;  2KHH A;  1ZQ9 A;  2Y21 A;  1Z5A A;  2J7O A;  1TR8 A;  3B7Z A;  4LRT A;  3L26 A;  2YFQ A;  1HR0 M;  2DXI A;  1NV9 A;  3EIH A;  5ITX A;  1NNJ A;  2DAI A;  3J81 S;  1VEJ A;  2L6O A;  5LMN M;  3FTF A;  4L16 A;  4DV6 M;  1XB2 B;  1IXS A;  2CHV A;  3ZH9 B;  2XH9 A;  4Z6Y A;  1F4I A;  1ZAE A;  4LFC M;  3SMS A;  3KS8 A;  1N32 M;  2F5S A;  4DV0 M;  2RGO A;  4LJ6 A;  3GPP A;  4XGI A;  3E21 A;  4LGM A;  3VK7 A;  2CUZ A;  4KT0 F;  5ITY A;  4ITQ A;  4DR1 M;  3SBJ A;  3J7B A;  4GIP A;  1GKI A;  5FSW A;  3IHP A;  2VQF M;  4DR7 M;  2CEA A;  3K1J A;  1NY5 A;  1E32 A;  2R0I A;  3GPX A;  3KOY E;  4AKI A;  1PJQ A;  3MMP A;  5KPZ A;  2FE8 A;  4MM3 B;  2L7I A;  3SMP A;  4CHT B;  4DV2 M;  1VDL A;  5FTK A;  3SYK A;  3A46 A;  4DBG B;  3HHZ A;  2CP8 A;  4KOD A;  4DR4 M;  3R8F A;  4AG5 A;  2JNH A;  4X64 M;  3KFU G;  5FTJ A;  4JI5 M;  3U6M A;  2XLJ A;  2X8A A;  4DR5 M;  3F92 A;  2M5Z A;  3MHV C;  3ZC7 B;  1D2N A;  4FCT A;  4QOS A;  4G4N A;  4II7 A;  1TTE A;  2Z4S A;  5KPR A;  5ITT A;  3T1H M;  4JI0 M;  3HZJ A;  4G3O A;  3GP1 A;  2KNV A;  1FNN A;  2LH0 A;  4LZJ A;  4OU7 A;  2C96 A;  1ZV1 A;  2XEP A;  3AJI B;  3AOG A;  3LCU A;  4GHL A;  1EIJ A;  3HU1 A;  3KP1 E;  1GL7 A;  2C99 A;  2R45 A;  1L1Z A;  1RU3 A;  2LVN C;  3KOX E;  1E9R A;  4IBG A;  2Y20 A;  4DV4 M;  3A45 A;  4GKJ M;  1WGL A;  4R7G A;  1UM8 A;  1MU5 A;  2MJ5 B;  1V92 A;  4KLN A;  4HEO A;  1DV0 A;  1R4G A;  3A98 B;  1PGY A;  4X62 M;  1IBL M;  1T6O A;  2UU9 M;  3ZCB B;  3QAU A;  3I51 A;  1D0M A;  1TH4 A;  2O5R A;  1V33 A;  3ILK A;  4GHA A;  4DR6 M;  1XMQ M;  1N33 M;  3K8Z A;  1D0L A;  3CF6 E;  3L28 A;  3NBX X;  4X66 M;  4DUY M;  1YSY A;  2F5P A;  3UJN A;  4TUW A;  2HAK A;  3FTC A;  1QZM A;  2FNA A;  1KFV A;  3W0L B;  1JB0 F;  3HKP A;  4RNA A;  2XFS A;  3U6C A;  2R65 A;  1AIP C;  3SAS A;  2F5O A;  3SAR A;  2GQF A;  2C9O A;  2Y0T A;  4OVZ B;  2CHQ A;  2QPA A;  3UK6 A;  1VEG A;  1IQP A;  1G4A E;  2H1R A;  3SC3 A;  3B7Q A;  3FUU A;  2LHC A;  2DZN B;  2UXC M;  3FKE A;  3KDS E;  2G3Q A;  2G8L A;  2LVP C;  2CRU A;  3LVW A;  3QYE A;  1T43 A;  1JQJ C;  4QHT A;  5DYI A;  4FWD A;  2Z8Y M;  4LRS A;  4MGH A;  2Z7J A;  3GPY A;  1QAM A;  4GH9 A;  1DO2 A;  4CGY B;  1PJJ A;  1ORY B;  4LJA A;  2O01 F;  4W5W A;  5E6J A;  2R46 A;  3SFZ A;  1VG5 A;  2OPF A;  3IEC A;  5ITQ A;  1ZMV A;  4HL4 A;  4IJF A;  2K6B A;  3UZU A;  2QNJ A;  3W68 A;  3JAM S;  4PCZ A;  3B74 A;  1YUB A;  3HHY A;  1AUA A;  7CAT A;  2OQ4 A;  3GPU A;  4LF4 M;  2WSF F;  4P16 A;  3HJS A;  3I01 M;  3HU2 A;  2XGN A;  3PNV A;  1PJI A;  1DGB A;  2ZAO A;  4HLQ A;  4AKG A;  2LNH C;  1PRB A;  3GLH E;  3VFD A;  5IRE B;  2ZM6 M;  4JN6 A;  1J09 A;  4NSO B;  2OOA A;  3W67 A;  2DKL A;  1IXS B;  1OFI A;  2XF3 A;  3E46 A;  3QWL A;  2VF8 A;  2X49 A;  1I4W A;  2KNA A;  4DV1 M;  3HWS A;  3U6O A;  1KYI A;  3A42 A;  3K92 A;  3BXW A;  1WIV A;  4NL4 H;  4XK8 F;  4G4Q A;  1GAB A;  2RKO A;  2DHY A;  2JZ1 A;  3KW6 A;  3T38 A;  3HJQ A;  3GLI A;  3KVW A;  4I4L A;  2R4J A;  4NRV A;  2P5T A;  3RE8 A;  5FLX S;  4JI3 M;  4GIT A;  3EIE A;  2KZS A;  2C5R A;  2EKK A;  2DAE A;  2KW0 A;  1HJP A;  3B9P A;  1LV7 A;  3L25 A;  4GRI A;  1IY1 A;  3TWL A;  3SAV A;  1NV8 A;  1EFU B;  2JXN A;  3E9S A;  2FS1 A;  4B3S M;  3KP0 E;  4G6Z A;  4M0W A;  1PJS A;  2QZ4 A;  2V6Z M;  3FRI A;  4AW4 A;  3C3D A;  4R3D A;  1N75 A;  1OAO C;  4ANR A;  3TWK A;  3HJ8 A;  2LWX A;  4QNR A;  1DO0 A;  3U6D A;  2MRO B;  3C9P A;  4PD2 A;  3U61 B;  2DWL A;  1GO5 A;  4DR2 M;  2D7H A;  4OW0 A;  2C9C A;  2ZBK B;  4JYA M;  3HX3 A;  2EKF A;  2HKJ A;  2YR0 A;  1GLN A;  3K9O A;  3UGJ A;  1HQC A;  1WR1 B;  4GKK M;  3FE3 A;  1OIZ A;  1YE9 A;  2LTU A;  1GJT A;  2VII A;  1TF0 B;  3HHX A;  3L29 A;  4L78 A;  4IBB A;  3KSX A;  2EA0 A;  2HL7 A;  3LMM A;  4WP2 A;  3T6P A;  4IBE A;  3K2L A;  4GEW A;  3ZQJ A;  3GLI E;  2VDB B;  5EP4 A;  3M0E A;  3J80 S;  1HT1 E;  3CTW B;  2JY7 A;  3FYC A;  3GRY A;  1I94 M;  3LVV A;  1Q39 A;  2L09 A;  2KZU A;  2V1U A;  5C1B A;  1C1K A;  2KNZ A;  3AOE A;  2F5Q A;  3CGW A;  5EP1 A;  1QYR A;  3KS4 A;  4REZ A;  4LFA M;  1TDH A;  2N35 A;  4LJ5 A;  1OFH A;  3RGS A;  5EXT A;  4RKU F;  4CIZ A;  5L8R F;  2DAG A;  3UMM A;  1WGN A;  4MGK E;  4JI2 M;  1D0K A;  2OO9 A;  3C58 A;  1SG9 A;  2YNM D;  1BVS A;  5DFL A;  4F1I A;  2KA6 B;  4FWH A;  2DAM A;  5EJC A;  1VQ1 A;  2F4V M;  4S12 A;  1OIP A;  5DNY A;  2M60 A;  1N78 A;  1IBM M;  5IZ7 D;  1QAQ A;  1QZE A;  2DWM A;  4JI1 M;  3WHK A;  3J27 B;  3I4Y A;  3GLF E;  3R9X B;  4X65 M;  3H4J A;  4MGI E;  3I4V A;  1LTM A;  2K9D A;  4CIS A;  1K3W A;  5KQD A;  2CV1 A;  3GLF B;  4ZPX A;  3HGI A;  3VK8 A;  2ZTD A;  1QVR A;  1H6U A;  2L7H A;  2YQZ A;  1ZMW A;  3GRU A;  4B3T M;  1L2C A;  1IN6 A;  3U6L A;  2JA2 A;  3AOE C;  1J7K A;  1IN5 A;  1SXJ E;  2C98 A; 
#chains in the Genus database with same CATH homology
 4FCV A;  1XC8 A;  1N34 M;  1WXQ A;  3W0F A;  2DHR A;  1G8P A;  1TH3 A;  3SAW A;  3KOZ E;  3DOA A;  4FCW A;  1PM5 A;  2Z3X A;  3Q8X A;  5EXP A;  4D80 A;  1L8Q A;  3GQ4 A;  2D7G A;  4B7G A;  3SHG B;  3TPZ A;  2DWZ B;  3TL4 X;  1IXZ A;  3TWM A;  5LMU M;  4GMQ A;  3FD9 A;  4LJ8 A;  3L27 A;  5JI3 E;  4IBI A;  3LQR A;  5EP2 A;  1IXR C;  2W82 A;  2XFT A;  8CAT A;  2CHG A;  3DA1 A;  1MX0 A;  1NNU C;  1S3S A;  2XSZ A;  3PFI A;  4IBJ A;  2I7N A;  3GLI B;  3T1Y M;  3U5Z A;  4YHH M;  3HU3 A;  1IN4 A;  5DYG A;  3OTO M;  2CE7 A;  1IY2 A;  1E9S A;  3RFW A;  1HNZ M;  4AI6 A;  1R6B X;  5KO3 A;  3SAT A;  4IBC A;  3IG5 A;  4JV5 M;  3FYD A;  1TDZ A;  1DGF A;  5F3W A;  2R18 A;  2QBY B;  3MJ5 A;  1DGH A;  4LF9 M;  4LCB A;  4DV5 M;  3H4M A;  1Q3B A;  2FFJ A;  3GLF A;  3SAU A;  2V1C A;  1FJG M;  3D8L A;  5E26 A;  2DWN A;  4B08 A;  2KRU A;  2UUC M;  1IN8 A;  4AZF A;  1XWI A;  4LF5 M;  3U6Q A;  1XXH A;  1W5S A;  1Z59 A;  4MGY E;  2XZF A;  2K47 A;  3FTD A;  4D82 A;  4LG2 A;  4GC9 A;  5FTM A;  2LXE A;  1XMO M;  3MK6 A;  4IBD A;  4IBK A;  2QEN A;  1QQW A;  1Z6T A;  2UUB M;  1XXH B;  2KXE A;  3FUT A;  5A2Q S;  1R2Z A;  1N36 M;  2F5N A;  4RF1 A;  4G4O A;  4DV7 M;  3U60 A;  4M9S A;  1NHW C;  1XNQ M;  1IN7 A;  3VKH A;  4M9X A;  1HT2 E;  1JR3 D;  5KQ8 A;  2QCU A;  1K3X A;  3LQQ A;  1N77 A;  3DZD A;  1GVN A;  4XBO A;  4WUR A;  3GRR A;  1GL6 A;  5JI2 E;  1QAO A;  3M6A A;  5EP3 A;  2CV2 A;  4JI7 M;  3SYL A;  3KXE C;  4IJE A;  4G4R A;  2ZAN A;  4LGY A;  4B7F A;  2X4A A;  1NHG C;  5ITX E;  2QBY A;  3L2A A;  1G59 A;  1L1T A;  3U5Z B;  3HHW A;  2QP9 X;  1VDD A;  4FW9 A;  5IWA M;  1L2D A;  1E94 E;  2R62 A;  3PVS A;  5FTL A;  5C18 A;  2UXB M;  1Z5B A;  2A5Y B;  3JR5 A;  4A3V B;  4M0D A;  4D81 A;  1L2B A;  2Y0Q A;  4I8O A;  4NOO B;  4AKH A;  5FTN A;  5H37 D;  3THG A;  3GLH A;  3U61 A;  4L4U A;  4QHS A;  4B3R M;  4NRW A;  4EIW A;  4BB9 A;  2XZU A;  4KHP M;  2UUA M;  1SXJ C;  2BJV A;  3VKG A;  2E5L M;  1HQY E;  1SXJ D;  5KPT A;  3GRV A;  1NY6 A;  2I7P A;  2ZAM A;  3J2P B;  3NBI A;  4DR3 M;  4NXN M;  3SHF A;  1G3I A;  1R7R A;  1NJG A;  4MGZ E;  2VQE M;  3J7A S;  4LY6 A;  5EXX A;  3VDU A;  2NQ8 C;  4Z8X A;  5BR8 M;  1TH2 A;  5ITU A;  4KO8 A;  3GLH B;  2KEB A;  4FD2 A;  4JI6 M;  4JI8 M;  3D8B A;  4JXJ A;  3AFH A;  2J7N A;  1KSF X;  5IT9 S;  1NJF A;  1X37 A;  1SXJ A;  1HNX M;  3RGP A;  3U6E A;  4DV3 M;  3FUW A;  5EQT A;  3VLF B;  2KRK A;  4MH0 E;  5BPV A;  3GO8 A;  4I5S A;  3U6P A;  4AQY M;  4NXM M;  3AKZ A;  2BJW A;  4OVZ A;  3FUV A;  3AL0 C;  2AHM A;  1TGU A;  2G5G X;  4IIW A;  4AG6 A;  3PNY A;  4BBA A;  4LF8 M;  3GLG A;  4L15 A;  1DGG A;  4WW0 A;  2EUC A;  1HNW M;  1NVM A;  4DUZ M;  1XHB A;  4RF0 A;  2Q2E B;  4LJ7 A;  3U60 B;  3CF2 A;  2RGH A;  3FUX A;  5GKN A;  2R4E A;  4B7H A;  3GQ3 A;  2BNK A;  4BLC A;  2Z4R A;  3TE6 A;  2DVW B;  4YY3 M;  4JI4 M;  2D7E A;  3GQ5 A;  2UXD M;  4LFB M;  4LJ9 A;  1SXJ B;  1K82 A;  2FOI C;  2DZO B;  3AV0 A;  4I81 A;  1JR3 A;  4IBF A;  5ITR A;  4PDG A;  1G41 A;  2CFO A;  3BOS A;  1R2Y A;  3E4R A;  2EO2 A;  4GC5 A;  1IM2 A;  3GLG B;  2CV0 A;  1Q3C A;  4B3M M;  1QAN A;  3IG8 A;  4FVM A;  4MB7 A;  4PDI A;  3JR4 A;  3FTE A;  4LF6 M;  1IBK M;  4L8R C;  4QNM A;  3TQS A;  2XSZ D;  2HHH M;  4LZZ A;  4LF7 M;  2ERC A;  1IY0 A;  3KSJ A;  1J5E M;  3WHL A;  1OJL A;  3U6S A;  1NSF A;  3CF0 A;  5EXS A;  4M9Z A;  1Z5C A;  3NWL A;  1EE8 A;  4K0K M;  4NSR A;  3VDP A;  4LJ4 A;  3DFZ A;  1T3T A;  3KOW E;  4FWG A;  3PXG A;  1W5T A;  3M7G A;  4PT5 A;  4QOZ C;  1DGH B;  2HCB A;  4OX9 M;  1XNR M;  2Y21 A;  1ZQ9 A;  2J7O A;  1Z5A A;  3L26 A;  4LRT A;  1HR0 M;  2DXI A;  2YFQ A;  3EIH A;  5ITX A;  1NNJ A;  3J81 S;  3FTF A;  5LMN M;  2L6O A;  4L16 A;  4DV6 M;  2CHV A;  3ZH9 B;  2XH9 A;  4Z6Y A;  1ZAE A;  4LFC M;  3SMS A;  3KS8 A;  1N32 M;  2F5S A;  4DV0 M;  2RGO A;  4LJ6 A;  3GPP A;  4XGI A;  4LGM A;  3VK7 A;  2CUZ A;  5ITY A;  4ITQ A;  4DR1 M;  3SBJ A;  3J7B A;  4GIP A;  1GKI A;  5FSW A;  2VQF M;  4DR7 M;  2CEA A;  3K1J A;  1NY5 A;  1E32 A;  3GPX A;  3KOY E;  4AKI A;  5KPZ A;  2FE8 A;  4MM3 B;  2L7I A;  3SMP A;  4CHT B;  4DV2 M;  3SYK A;  5FTK A;  3A46 A;  3HHZ A;  4KOD A;  4DR4 M;  3R8F A;  4AG5 A;  4X64 M;  3KFU G;  5FTJ A;  4JI5 M;  3U6M A;  2XLJ A;  2X8A A;  4DR5 M;  3MHV C;  2M5Z A;  3ZC7 B;  1D2N A;  4FCT A;  4QOS A;  4G4N A;  4II7 A;  2Z4S A;  5KPR A;  5ITT A;  3T1H M;  4JI0 M;  3GP1 A;  1FNN A;  2LH0 A;  4LZJ A;  4OU7 A;  2C96 A;  2XEP A;  3AJI B;  3AOG A;  4GHL A;  3HU1 A;  3KP1 E;  1GL7 A;  2C99 A;  2R45 A;  1L1Z A;  4IBG A;  3KOX E;  1E9R A;  2Y20 A;  4DV4 M;  3A45 A;  4GKJ M;  4R7G A;  1UM8 A;  1MU5 A;  4KLN A;  3A98 B;  4X62 M;  1IBL M;  2UU9 M;  3ZCB B;  3QAU A;  3I51 A;  1TH4 A;  4GHA A;  2O5R A;  4DR6 M;  3ILK A;  1N33 M;  1XMQ M;  3K8Z A;  3L28 A;  3CF6 E;  4DUY M;  2F5P A;  4X66 M;  4TUW A;  1YSY A;  3UJN A;  3FTC A;  1QZM A;  2FNA A;  1KFV A;  3W0L B;  3HKP A;  4RNA A;  2XFS A;  3U6C A;  2R65 A;  3SAS A;  2F5O A;  3SAR A;  2C9O A;  2Y0T A;  4OVZ B;  2CHQ A;  2QPA A;  3UK6 A;  1IQP A;  1G4A E;  2H1R A;  3SC3 A;  3FUU A;  2DZN B;  2UXC M;  3FKE A;  3KDS E;  2G8L A;  4QHT A;  3LVW A;  3T15 A;  5DYI A;  1JQJ C;  4FWD A;  4LRS A;  4MGH A;  2Z7J A;  3GPY A;  1QAM A;  4GH9 A;  1DO2 A;  4CGY B;  1PJJ A;  1ORY B;  4LJA A;  4W5W A;  5E6J A;  2R46 A;  3SFZ A;  2OPF A;  5ITQ A;  4IJF A;  4HL4 A;  3UZU A;  3JAM S;  4PCZ A;  1YUB A;  3HHY A;  7CAT A;  2OQ4 A;  3GPU A;  4LF4 M;  4P16 A;  3HJS A;  3HU2 A;  2XGN A;  3PNV A;  1PJI A;  1DGB A;  2ZAO A;  4HLQ A;  4AKG A;  2LNH C;  3VFD A;  5IRE B;  2ZM6 M;  4JN6 A;  1J09 A;  4NSO B;  1IXS B;  1OFI A;  2XF3 A;  3QWL A;  2X49 A;  1I4W A;  3U6O A;  4DV1 M;  3HWS A;  1KYI A;  3A42 A;  3K92 A;  4NL4 H;  4G4Q A;  2RKO A;  3T38 A;  3KW6 A;  3HJQ A;  3GLI A;  3KVW A;  4I4L A;  2R4J A;  4NRV A;  2P5T A;  3RE8 A;  5FLX S;  4JI3 M;  4GIT A;  3EIE A;  2KZS A;  2C5R A;  2KW0 A;  3B9P A;  1LV7 A;  3L25 A;  4GRI A;  1IY1 A;  3TWL A;  3SAV A;  4B3S M;  3E9S A;  3KP0 E;  4G6Z A;  4M0W A;  2QZ4 A;  2V6Z M;  4AW4 A;  4R3D A;  1N75 A;  3TWK A;  3HJ8 A;  2LWX A;  4QNR A;  1DO0 A;  3U6D A;  4PD2 A;  3U61 B;  2DWL A;  4DR2 M;  2D7H A;  4OW0 A;  2C9C A;  2ZBK B;  4JYA M;  2HKJ A;  2YR0 A;  1GLN A;  3UGJ A;  1HQC A;  4GKK M;  1YE9 A;  2VII A;  3HHX A;  3L29 A;  4L78 A;  4IBB A;  3KSX A;  2EA0 A;  2HL7 A;  3LMM A;  4IBE A;  3K2L A;  5EP4 A;  3M0E A;  3J80 S;  1HT1 E;  3CTW B;  3FYC A;  3GRY A;  1I94 M;  3LVV A;  1Q39 A;  2L09 A;  2KZU A;  2V1U A;  5C1B A;  1C1K A;  3AOE A;  2F5Q A;  5EP1 A;  1QYR A;  3KS4 A;  4REZ A;  4LFA M;  1TDH A;  4LJ5 A;  1OFH A;  3RGS A;  5EXT A;  3UMM A;  4MGK E;  4JI2 M;  3C58 A;  2YNM D;  2KA6 B;  4FWH A;  5EJC A;  2F4V M;  4S12 A;  5DNY A;  2M60 A;  1N78 A;  1IBM M;  5IZ7 D;  1QAQ A;  2DWM A;  4JI1 M;  3WHK A;  3J27 B;  3I4Y A;  3R9X B;  4X65 M;  4MGI E;  3I4V A;  4CIS A;  1K3W A;  5KQD A;  2CV1 A;  3GLF B;  4ZPX A;  3HGI A;  3VK8 A;  1QVR A;  1H6U A;  2L7H A;  2YQZ A;  3GRU A;  4B3T M;  1L2C A;  1IN6 A;  3U6L A;  2JA2 A;  3AOE C;  1J7K A;  1IN5 A;  1SXJ E;  2C98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...