2EOIA

Solution structure of the c2h2 type zinc finger (region 329-359) of human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
b'GSSGSSGEKLHECSECRKTFSFHSQLVIHQRIHTGENPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 329-359) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoiA01
1NCSA 2A25A 1BBOA 5KL5A 2RPCA 2EM0A 2EM4A 2EMHA 1KJKA 3M99B 2YTEA 1TF3A 4R2AA 1P47A 2EM6A 2EOEA 2EM8A 4R2SA 1YSAC 2EOZA 2YSOA 5KL3A 1RMDA 2EMGA 2WCC3 2YTOA 4X9JA 2YU8A 1Z1BA 1TN9A 1MEYC 2EPZA 2YSPA 2YRMA 1F2IG 1ZR9A 2EPCA 2YTPA 2ENHA 5KL4A 2JP9A 2LO3A 2JPAA 2GLIA 1X6FA 2EN6A 2EOIA 1A1KA 1A1FA 2EM3A 5KL2A 2LCEA 2WBSA 1TF6A 4R2PA 3EPKA 2EL6A 2D9HA 1X3CA 1JK1A 2LT7A 2EN3A 2DLQA 2EOOA 2EL5A 2YTFA 2EN8A 2EN1A 4R2CA 5KL6A 3EPLA 2EMKA 2YRHA 2EOSA 2EMLA 2EOMA 1ZAAC 2EM9A 1X6EA 2YTNA 2LVHA 2EPRA 4WSGA 2CSHA 2EN2A 1YUIA 2EMWA 1BB8A 2NABA 2WBTA 1X5WA 4R2DA 2EM5A 2EMBA 2PRTA 2EORA 2DRPA 2EOHA 1UN6B 2VRDA 1A1JA 4F2JC 4F6NA 2EQ0A 2EOJA 1G2FC 2EMXA 2MKDA 2EPAA 2ELYA 2J7JA 1WJPA 2MDGA 1YUJA 2EMYA 2EP3A 2EN7A 2LV2A 4M9VC 2DMIA 2EMIA 2I13A 2ELZA 1G2DC 2HGHA 2EMFA 3MHHC 4IJDA 4GZNC 2ADRA 2EPXA 2WBUA 1ZU1A 2EJ4A 3MHSC 1UBDC 3VHTB 1AAYA 4R2QA 2EQ1A 1X6HA 3UK3C 4FK5C 4F6MA 5KL7A 2EPPA 2BB8A 2EOFA 1DGCA 4R2RA 2EM2A 2YTDA 2EMCA 2EOYA 4R2EA 2YRKA 2EMAA 3EPJA 1A1GA 2CT1A 2EMZA 3EPHA 2EL4A 1A1LA 2EOXA 2M9AA 2YTIA 1JK2A 1A1IA 1LLMC 2ENCA 2EQ3A 2YTJA 2YTGA 2RSIA 2EN4A 2ENAA 2YU5A 2YTQA 2DLKA 2EM7A 1B69A 2DGCA 2GHFA 1A1HA 2R1FA 2EE8A 2CTDA 2EOQA 2E72A 2EPUA 2MKNA 4IS1C
chains in the Genus database with same CATH superfamily
1NCSA 2B7VA 2DMYA 1BBOA 1GQEA 1DQ3A 2EM0A 1XMOE 4BC9A 2M7QA 4NXME 5A6JA 2YSOA 4GKJE 4DV0E 3VK6A 4X9JA 2YU8A 3BBGA 2E1MA 4NHRA 2WZOA 3MSWA 3LLHA 4DV7E 2ENHA 5KL4A 1YYOA 4X65E 2JP9A 3TQMA 3T1HE 4BCAA 1EKZA 3HTXA 1X6FA 2V83A 2ODRC 4JI4E 2WBSA 2M4IA 2LT7A 2EN3A 4JV5E 1GTKA 1N3GA 4DV2E 2EOOA 2EL5A 2G7HA 2YTFA 2F8BA 1UHZA 2YZTA 2UUCE 5FLXC 2UUAE 3FIGA 1XNQE 4B3ME 2LVHA 2GPIA 1YUIA 2EMWA 2JR1A 2UUBE 2NABA 3JTZA 4R2DA 2EMBA 1UN6B 4F9AB 2YPNA 3J81C 3J7Yp 4JI5E 1O0WA 5A6AA 5LLQA 3IWBA 4HTGA 2L92A 2J7JA 4WX9A 2EPMX 4DV6E 2B3TB 2ELZA 1RC7A 1XNRE 2EWLA 2JWOA 4O4KA 2N3GA 2V88A 1IQSA 2B7TA 5AE3A 2K4VA 2EPKX 1N33E 2LUPB 1UBDC 3VHTB 1FJGE 4R03A 3UK3C 2DB2A 3KZYA 1L4SA 4F6MA 4WYQB 1YFHA 2BB8A 2EMCA 5AC5A 4R2EA 1ZBQA 2JVAA 2M1SA 2YTIA 1WXRA 4LF7E 5A6BA 2ENCA 4ZYGA 5ADZA 2CPNA 2EN4A 2RQLA 4BHCA 2EZ6A 1XMQE 3BGHA 2HC5A 2K7IA 2LJHA 2UXDE 4DV4E 4I8OA 4BC7A 2L2KB 2F4VE 2RPCA 4LF8E 1KJKA 3M99B 4LU9A 2UXCE 2L6MA 3J7AG 2EM6A 1PDAA 2EM8A 2V8QB 1YSAC 2EPOA 1J5EE 3ADIA 2DIXA 1RMDA 1Z1BA 1BBGA 1ZBTA 2EPZA 2L8TA 1WHQA 1SFEA 1ZR9A 3KWRA 2N3HA 2EPNA 2LO3A 2JPAA 2GLIA 4ZYHA 1NEIA 2IHR1 5LL6R 5KL2A 2KONA 2D9HA 4MLQA 5LMNE 2DLQA 3RMPA 1QU6A 2EN1A 4R2CA 1HR0E 2EMKA 3IWCA 2EOSA 2EMLA 2EOMA 1ZAAC 3BIDA 4LFCE 1HNZE 4DV5E 2RSMA 3C6MA 4ZYEA 1WHNA 1BB8A 1X5WA 1EH7A 3AV0A 2EORA 1EH8A 1I94E 2FV4B 4O24A 4F2JC 2VE7C 2EQ0A 4DR2E 2MKDA 3L00A 2EPAA 5A6KA 2V85A 4DUYE 2LV2A 4X64E 3OTOE 2DMIA 4DMIA 2L3JA 2I13A 1UILA 2HGHA 4B3SE 1IQOA 2EMFA 2LRSA 4IJDA 2ADRA 1T4NA 4GEQB 2ZM6E 4R8OA 1YPNA 4J8ZA 1AAYA 4R2QA 3LMLA 4LTYA 2YWQA 3DJWA 3KZZA 2NUFA 2EOFA 4P7DA 4R2RA 2EM2A 2YTDA 1A1GA 2YRKA 3EPJA 4DUZE 3THNA 2EL4A 1A1IA 4JI3E 3AUZA 4NXNE 3QG5C 1LLMC 1J26A 4ZYDA 4DR4E 4KHPE 2JXPA 2YTGA 1DI2A 2RSIA 3JAMC 2KHXA 2YU5A 2DLKA 1YYWA 2MDRA 2DGCA 2GHFA 1A1HA 2CTDA 5IWAE 4M2ZA 2EPUA 5IXMB 4YHHE 2MC5A 5KL5A 4WXDA 4LF5E 2EPLX 2B9DA 3K6QA 2EM4A 2FGGA 2EMHA 2YTEA 2EOEA 2EOZA 2RTXA 5KL3A 2EMGA 1PKPA 5AE2A 1F2IG 2FTXB 2EPCA 2YTPA 4L8NA 2LTRA 5AC4A 3F6GA 2LMZA 3HPZA 4L5NC 4KWYA 2V87A 1A1FA 5A69A 5IT9C 1YZ9A 2BBGA 1TF6A 3HPSA 3EPKA 4GKKE 1X3CA 2YT4A 4BS9A 3BF2A 4JI1E 4DKKA 1STUA 4TUIA 2L3CA 5KL6A 3EPLA 2YRHA 2EM9A 1X6EA 4X8WA 4TUGA 2EPRA 2VQFE 2CSHA 4M0VA 2UU9E 2WBTA 5A2QC 3ADGA 2EM5A 4KZSA 4OOGC 5AASA 2PRTA 1HNXE 2DRPA 4WPYA 1N34E 2UXBE 2EOJA 2EMXA 2LJUA 2JOBA 1WJPA 2HJJA 4JI0E 2EMIA 2DSYA 3IWDA 4LF6E 1N32E 3JU0A 2EPXA 1ZU1A 2L2MA 2EQ1A 3OMLA 5DNYA 5KL7A 2NUEA 4X66E 4JI7E 1DGCA 2EOYA 1T38A 3ADJA 2EMZA 3EPHA 2NA2A 1T4LB 1QNTA 2EOXA 1FKAE 4DR3E 5T6JA 5A6BD 2I9IA 4NZVA 1RQ0A 2L33A 3F6HA 2ENAA 2YTQA 2EM7A 3C4BA 1WRJA 1X47A 1IBKE 2R1FA 2EE8A 3VYXA 4WSPA 2MKNA 1N36E 4B3TE 2A25A 1PJQA 2VF1A 4DR5E 2H36X 4BMJA 3VYYA 2R76A 3P1XA 1TF3A 4R2AA 1P47A 4F54A 4R2SA 3J80C 5IV8B 2WCC3 2YTOA 4DR7E 1TN9A 1KYQA 1MEYC 2YSPA 2YRMA 1T39A 1SR9A 2RS7A 4P78A 4LF9E 4WFTA 4F9CB 2LBSB 3C4TA 4DR1E 4LFBE 2EN6A 2EOIA 1A1KA 5F3WA 1HNWE 2EM3A 2LCEA 4JI6E 4R2PA 4LFAE 2EL6A 4B3RE 1JK1A 2KOUA 2V89A 2EN8A 4HEIA 4Q28A 3ECRA 5CFFE 3ZOQB 1T4OA 2YTNA 1PJTA 4RH8A 2HHHE 4WSGA 2EN2A 4K0KE 5TSEA 4O5GA 3H09A 4DR6E 2EOHA 2V86A 2VRDA 3EQ1A 4WXCA 1A1JA 4DV3E 4F6NA 1G2FC 2Q8UA 2N8XA 3HQ1A 4LF4E 2LUQA 2ELYA 2E5LE 2MDGA 2RS6A 1YUJA 2EMYA 2EP3A 4JI8E 2EN7A 4JYAE 2JY9A 1IBLE 4M9VC 1YYKA 2ODRD 5LMUE 4DV1E 1G2DC 4BBYA 4Q35B 2LE2A 3MHHC 4GZNC 1GZ6A 1IBME 1PJSA 1X49A 4M30A 4OX9E 2WBUA 2EJ4A 3MHSC 1MGTA 2JOXA 2MC6A 1X6HA 1AH5A 4MLVA 4FK5C 4RHBB 2EPPA 4F9BB 2EMAA 2CT1A 4O43A 3HXLA 3T1YE 3ADLA 5BR8E 2M9AA 1A1LA 2VQEE 1JK2A 1IMUA 2NUGA 2EQ3A 3THOB 2YTJA 4YY3E 2L2NA 2LTSA 5AE1A 2JYAA 3DF6A 4X62E 1X48A 1B69A 4JI2E 2EOQA 2E72A 4AQYE 1EH6A 4N4RB 3C6KA 4BHBA 4IS1C
chains in the Genus database with same CATH topology
1NCSA 2A25A 1BBOA 5KL5A 2RPCA 2EM0A 2EM4A 2EMHA 1KJKA 3M99B 2YTEA 1TF3A 4R2AA 1P47A 2EM6A 2EOEA 2EM8A 4R2SA 1YSAC 2EOZA 2YSOA 5KL3A 1RMDA 2EMGA 2WCC3 2YTOA 4X9JA 2YU8A 1Z1BA 1TN9A 1MEYC 2EPZA 2YSPA 2YRMA 1F2IG 1ZR9A 2EPCA 2YTPA 2ENHA 5KL4A 2JP9A 2LO3A 2JPAA 2GLIA 1X6FA 2EN6A 2EOIA 1A1KA 1A1FA 2EM3A 5KL2A 2LCEA 2WBSA 1TF6A 4R2PA 3EPKA 2EL6A 2D9HA 1X3CA 1JK1A 2LT7A 2EN3A 2DLQA 2EOOA 2EL5A 2YTFA 2EN8A 2EN1A 4R2CA 5KL6A 3EPLA 2EMKA 2YRHA 2EOSA 2EMLA 2EOMA 1ZAAC 2EM9A 1X6EA 2YTNA 2LVHA 2EPRA 4WSGA 2CSHA 2EN2A 1YUIA 2EMWA 1BB8A 2NABA 2WBTA 1X5WA 4R2DA 2EM5A 2EMBA 2PRTA 2EORA 2DRPA 2EOHA 1UN6B 2VRDA 1A1JA 4F2JC 4F6NA 2EQ0A 2EOJA 1G2FC 2EMXA 2MKDA 2EPAA 2ELYA 2J7JA 1WJPA 2MDGA 1YUJA 2EMYA 2EP3A 2EN7A 2LV2A 4M9VC 2DMIA 2EMIA 2I13A 2ELZA 1G2DC 2HGHA 2EMFA 3MHHC 4IJDA 4GZNC 2ADRA 2EPXA 2WBUA 1ZU1A 2EJ4A 3MHSC 1UBDC 3VHTB 1AAYA 4R2QA 2EQ1A 1X6HA 3UK3C 4FK5C 4F6MA 5KL7A 2EPPA 2BB8A 2EOFA 1DGCA 4R2RA 2EM2A 2YTDA 2EMCA 2EOYA 4R2EA 2YRKA 2EMAA 3EPJA 1A1GA 2CT1A 2EMZA 3EPHA 2EL4A 1A1LA 2EOXA 2M9AA 2YTIA 1JK2A 1A1IA 1LLMC 2ENCA 2EQ3A 2YTJA 2YTGA 2RSIA 2EN4A 2ENAA 2YU5A 2YTQA 2DLKA 2EM7A 1B69A 2DGCA 2GHFA 1A1HA 2R1FA 2EE8A 2CTDA 2EOQA 2E72A 2EPUA 2MKNA 4IS1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NCS A;  2A25 A;  1BBO A;  5KL5 A;  2RPC A;  2EM0 A;  2EM4 A;  2EMH A;  1KJK A;  3M99 B;  2YTE A;  1TF3 A;  4R2A A;  1P47 A;  2EM6 A;  2EOE A;  2EM8 A;  4R2S A;  1YSA C;  2EOZ A;  2YSO A;  5KL3 A;  1RMD A;  2EMG A;  2WCC 3;  2YTO A;  4X9J A;  2YU8 A;  1Z1B A;  1TN9 A;  1MEY C;  2EPZ A;  2YSP A;  2YRM A;  1F2I G;  1ZR9 A;  2EPC A;  2YTP A;  2ENH A;  5KL4 A;  2JP9 A;  2LO3 A;  2JPA A;  2GLI A;  1X6F A;  2EN6 A;  2EOI A;  1A1K A;  1A1F A;  2EM3 A;  5KL2 A;  2LCE A;  2WBS A;  1TF6 A;  4R2P A;  3EPK A;  2EL6 A;  2D9H A;  1X3C A;  1JK1 A;  2LT7 A;  2EN3 A;  2DLQ A;  2EOO A;  2EL5 A;  2YTF A;  2EN8 A;  2EN1 A;  4R2C A;  5KL6 A;  3EPL A;  2EMK A;  2YRH A;  2EOS A;  2EML A;  2EOM A;  1ZAA C;  2EM9 A;  1X6E A;  2YTN A;  2LVH A;  2EPR A;  4WSG A;  2CSH A;  2EN2 A;  1YUI A;  2EMW A;  1BB8 A;  2NAB A;  2WBT A;  1X5W A;  4R2D A;  2EM5 A;  2EMB A;  2PRT A;  2EOR A;  2DRP A;  2EOH A;  1UN6 B;  2VRD A;  1A1J A;  4F2J C;  4F6N A;  2EQ0 A;  2EOJ A;  1G2F C;  2EMX A;  2MKD A;  2EPA A;  2ELY A;  2J7J A;  1WJP A;  2MDG A;  1YUJ A;  2EMY A;  2EP3 A;  2EN7 A;  2LV2 A;  4M9V C;  2DMI A;  2EMI A;  2I13 A;  2ELZ A;  1G2D C;  2HGH A;  2EMF A;  3MHH C;  4IJD A;  4GZN C;  2ADR A;  2EPX A;  2WBU A;  1ZU1 A;  2EJ4 A;  3MHS C;  1UBD C;  3VHT B;  1AAY A;  4R2Q A;  2EQ1 A;  1X6H A;  3UK3 C;  4FK5 C;  4F6M A;  5KL7 A;  2EPP A;  2BB8 A;  2EOF A;  1DGC A;  4R2R A;  2EM2 A;  2YTD A;  2EMC A;  2EOY A;  4R2E A;  2YRK A;  2EMA A;  3EPJ A;  1A1G A;  2CT1 A;  2EMZ A;  3EPH A;  2EL4 A;  1A1L A;  2EOX A;  2M9A A;  2YTI A;  1JK2 A;  1A1I A;  1LLM C;  2ENC A;  2EQ3 A;  2YTJ A;  2YTG A;  2RSI A;  2EN4 A;  2ENA A;  2YU5 A;  2YTQ A;  2DLK A;  2EM7 A;  1B69 A;  2DGC A;  2GHF A;  1A1H A;  2R1F A;  2EE8 A;  2CTD A;  2EOQ A;  2E72 A;  2EPU A;  2MKN A;  4IS1 C; 
#chains in the Genus database with same CATH topology
 1NCS A;  2B7V A;  2DMY A;  1BBO A;  1GQE A;  1DQ3 A;  2EM0 A;  1XMO E;  4BC9 A;  2M7Q A;  4NXM E;  5A6J A;  2YSO A;  4GKJ E;  4DV0 E;  3VK6 A;  4X9J A;  2YU8 A;  3BBG A;  2E1M A;  4NHR A;  2WZO A;  3MSW A;  3LLH A;  4DV7 E;  2ENH A;  5KL4 A;  1YYO A;  4X65 E;  2JP9 A;  3TQM A;  3T1H E;  4BCA A;  1EKZ A;  3HTX A;  1X6F A;  2V83 A;  2ODR C;  4JI4 E;  2WBS A;  2M4I A;  2LT7 A;  2EN3 A;  4JV5 E;  1GTK A;  1N3G A;  4DV2 E;  2EOO A;  2EL5 A;  2G7H A;  2YTF A;  2F8B A;  1UHZ A;  2YZT A;  2UUC E;  5FLX C;  2UUA E;  3FIG A;  1XNQ E;  4B3M E;  2LVH A;  2GPI A;  1YUI A;  2EMW A;  2JR1 A;  2UUB E;  2NAB A;  3JTZ A;  4R2D A;  2EMB A;  1UN6 B;  4F9A B;  2YPN A;  3J81 C;  3J7Y p;  4JI5 E;  1O0W A;  5A6A A;  5LLQ A;  3IWB A;  4HTG A;  2L92 A;  2J7J A;  4WX9 A;  2EPM X;  4DV6 E;  2B3T B;  2ELZ A;  1RC7 A;  1XNR E;  2EWL A;  2JWO A;  4O4K A;  2N3G A;  2V88 A;  1IQS A;  2B7T A;  5AE3 A;  2K4V A;  2EPK X;  1N33 E;  2LUP B;  1UBD C;  3VHT B;  1FJG E;  4R03 A;  3UK3 C;  2DB2 A;  3KZY A;  1L4S A;  4F6M A;  4WYQ B;  1YFH A;  2BB8 A;  2EMC A;  5AC5 A;  4R2E A;  1ZBQ A;  2JVA A;  2M1S A;  2YTI A;  1WXR A;  4LF7 E;  5A6B A;  2ENC A;  4ZYG A;  5ADZ A;  2CPN A;  2EN4 A;  2RQL A;  4BHC A;  2EZ6 A;  1XMQ E;  3BGH A;  2HC5 A;  2K7I A;  2LJH A;  2UXD E;  4DV4 E;  4I8O A;  4BC7 A;  2L2K B;  2F4V E;  2RPC A;  4LF8 E;  1KJK A;  3M99 B;  4LU9 A;  2UXC E;  2L6M A;  3J7A G;  2EM6 A;  1PDA A;  2EM8 A;  2V8Q B;  1YSA C;  2EPO A;  1J5E E;  3ADI A;  2DIX A;  1RMD A;  1Z1B A;  1BBG A;  1ZBT A;  2EPZ A;  2L8T A;  1WHQ A;  1SFE A;  1ZR9 A;  3KWR A;  2N3H A;  2EPN A;  2LO3 A;  2JPA A;  2GLI A;  4ZYH A;  1NEI A;  2IHR 1;  5LL6 R;  5KL2 A;  2KON A;  2D9H A;  4MLQ A;  5LMN E;  2DLQ A;  3RMP A;  1QU6 A;  2EN1 A;  4R2C A;  1HR0 E;  2EMK A;  3IWC A;  2EOS A;  2EML A;  2EOM A;  1ZAA C;  3BID A;  4LFC E;  1HNZ E;  4DV5 E;  2RSM A;  3C6M A;  4ZYE A;  1WHN A;  1BB8 A;  1X5W A;  1EH7 A;  3AV0 A;  2EOR A;  1EH8 A;  1I94 E;  2FV4 B;  4O24 A;  4F2J C;  2VE7 C;  2EQ0 A;  4DR2 E;  2MKD A;  3L00 A;  2EPA A;  5A6K A;  2V85 A;  4DUY E;  2LV2 A;  4X64 E;  3OTO E;  2DMI A;  4DMI A;  2L3J A;  2I13 A;  1UIL A;  2HGH A;  4B3S E;  1IQO A;  2EMF A;  2LRS A;  4IJD A;  2ADR A;  1T4N A;  4GEQ B;  2ZM6 E;  4R8O A;  1YPN A;  4J8Z A;  1AAY A;  4R2Q A;  3LML A;  4LTY A;  2YWQ A;  3DJW A;  3KZZ A;  2NUF A;  2EOF A;  4P7D A;  4R2R A;  2EM2 A;  2YTD A;  1A1G A;  2YRK A;  3EPJ A;  4DUZ E;  3THN A;  2EL4 A;  1A1I A;  4JI3 E;  3AUZ A;  4NXN E;  3QG5 C;  1LLM C;  1J26 A;  4ZYD A;  4DR4 E;  4KHP E;  2JXP A;  2YTG A;  1DI2 A;  2RSI A;  3JAM C;  2KHX A;  2YU5 A;  2DLK A;  1YYW A;  2MDR A;  2DGC A;  2GHF A;  1A1H A;  2CTD A;  5IWA E;  4M2Z A;  2EPU A;  5IXM B;  4YHH E;  2MC5 A;  5KL5 A;  4WXD A;  4LF5 E;  2EPL X;  2B9D A;  3K6Q A;  2EM4 A;  2FGG A;  2EMH A;  2YTE A;  2EOE A;  2EOZ A;  2RTX A;  5KL3 A;  2EMG A;  1PKP A;  5AE2 A;  1F2I G;  2FTX B;  2EPC A;  2YTP A;  4L8N A;  2LTR A;  5AC4 A;  3F6G A;  2LMZ A;  3HPZ A;  4L5N C;  4KWY A;  2V87 A;  1A1F A;  5A69 A;  5IT9 C;  1YZ9 A;  2BBG A;  1TF6 A;  3HPS A;  3EPK A;  4GKK E;  1X3C A;  2YT4 A;  4BS9 A;  3BF2 A;  4JI1 E;  4DKK A;  1STU A;  4TUI A;  2L3C A;  5KL6 A;  3EPL A;  2YRH A;  2EM9 A;  1X6E A;  4X8W A;  4TUG A;  2EPR A;  2VQF E;  2CSH A;  4M0V A;  2UU9 E;  2WBT A;  5A2Q C;  3ADG A;  2EM5 A;  4KZS A;  4OOG C;  5AAS A;  2PRT A;  1HNX E;  2DRP A;  4WPY A;  1N34 E;  2UXB E;  2EOJ A;  2EMX A;  2LJU A;  2JOB A;  1WJP A;  2HJJ A;  4JI0 E;  2EMI A;  2DSY A;  3IWD A;  4LF6 E;  1N32 E;  3JU0 A;  2EPX A;  1ZU1 A;  2L2M A;  2EQ1 A;  3OML A;  5DNY A;  5KL7 A;  2NUE A;  4X66 E;  4JI7 E;  1DGC A;  2EOY A;  1T38 A;  3ADJ A;  2EMZ A;  3EPH A;  2NA2 A;  1T4L B;  1QNT A;  2EOX A;  1FKA E;  4DR3 E;  5T6J A;  5A6B D;  2I9I A;  4NZV A;  1RQ0 A;  2L33 A;  3F6H A;  2ENA A;  2YTQ A;  2EM7 A;  3C4B A;  1WRJ A;  1X47 A;  1IBK E;  2R1F A;  2EE8 A;  3VYX A;  4WSP A;  2MKN A;  1N36 E;  4B3T E;  2A25 A;  1PJQ A;  2VF1 A;  4DR5 E;  2H36 X;  4BMJ A;  3VYY A;  2R76 A;  3P1X A;  1TF3 A;  4R2A A;  1P47 A;  4F54 A;  4R2S A;  3J80 C;  5IV8 B;  2WCC 3;  2YTO A;  4DR7 E;  1TN9 A;  1KYQ A;  1MEY C;  2YSP A;  2YRM A;  1T39 A;  1SR9 A;  2RS7 A;  4P78 A;  4LF9 E;  4WFT A;  4F9C B;  2LBS B;  3C4T A;  4DR1 E;  4LFB E;  2EN6 A;  2EOI A;  1A1K A;  5F3W A;  1HNW E;  2EM3 A;  2LCE A;  4JI6 E;  4R2P A;  4LFA E;  2EL6 A;  4B3R E;  1JK1 A;  2KOU A;  2V89 A;  2EN8 A;  4HEI A;  4Q28 A;  3ECR A;  5CFF E;  3ZOQ B;  1T4O A;  2YTN A;  1PJT A;  4RH8 A;  2HHH E;  4WSG A;  2EN2 A;  4K0K E;  5TSE A;  4O5G A;  3H09 A;  4DR6 E;  2EOH A;  2V86 A;  2VRD A;  3EQ1 A;  4WXC A;  1A1J A;  4DV3 E;  4F6N A;  1G2F C;  2Q8U A;  2N8X A;  3HQ1 A;  4LF4 E;  2LUQ A;  2ELY A;  2E5L E;  2MDG A;  2RS6 A;  1YUJ A;  2EMY A;  2EP3 A;  4JI8 E;  2EN7 A;  4JYA E;  2JY9 A;  1IBL E;  4M9V C;  1YYK A;  2ODR D;  5LMU E;  4DV1 E;  1G2D C;  4BBY A;  4Q35 B;  2LE2 A;  3MHH C;  4GZN C;  1GZ6 A;  1IBM E;  1PJS A;  1X49 A;  4M30 A;  4OX9 E;  2WBU A;  2EJ4 A;  3MHS C;  1MGT A;  2JOX A;  2MC6 A;  1X6H A;  1AH5 A;  4MLV A;  4FK5 C;  4RHB B;  2EPP A;  4F9B B;  2EMA A;  2CT1 A;  4O43 A;  3HXL A;  3T1Y E;  3ADL A;  5BR8 E;  2M9A A;  1A1L A;  2VQE E;  1JK2 A;  1IMU A;  2NUG A;  2EQ3 A;  3THO B;  2YTJ A;  4YY3 E;  2L2N A;  2LTS A;  5AE1 A;  2JYA A;  3DF6 A;  4X62 E;  1X48 A;  1B69 A;  4JI2 E;  2EOQ A;  2E72 A;  4AQY E;  1EH6 A;  4N4R B;  3C6K A;  4BHB A;  4IS1 C; 
#chains in the Genus database with same CATH homology
 1NCS A;  2A25 A;  1BBO A;  5KL5 A;  2RPC A;  2EM0 A;  2EM4 A;  2EMH A;  1KJK A;  3M99 B;  2YTE A;  1TF3 A;  4R2A A;  1P47 A;  2EM6 A;  2EOE A;  2EM8 A;  4R2S A;  1YSA C;  2EOZ A;  2YSO A;  5KL3 A;  1RMD A;  2EMG A;  2WCC 3;  2YTO A;  4X9J A;  2YU8 A;  1Z1B A;  1TN9 A;  1MEY C;  2EPZ A;  2YSP A;  2YRM A;  1F2I G;  1ZR9 A;  2EPC A;  2YTP A;  2ENH A;  5KL4 A;  2JP9 A;  2LO3 A;  2JPA A;  2GLI A;  1X6F A;  2EN6 A;  2EOI A;  1A1K A;  1A1F A;  2EM3 A;  5KL2 A;  2LCE A;  2WBS A;  1TF6 A;  4R2P A;  3EPK A;  2EL6 A;  2D9H A;  1X3C A;  1JK1 A;  2LT7 A;  2EN3 A;  2DLQ A;  2EOO A;  2EL5 A;  2YTF A;  2EN8 A;  2EN1 A;  4R2C A;  5KL6 A;  3EPL A;  2EMK A;  2YRH A;  2EOS A;  2EML A;  2EOM A;  1ZAA C;  2EM9 A;  1X6E A;  2YTN A;  2LVH A;  2EPR A;  4WSG A;  2CSH A;  2EN2 A;  1YUI A;  2EMW A;  1BB8 A;  2NAB A;  2WBT A;  1X5W A;  4R2D A;  2EM5 A;  2EMB A;  2PRT A;  2EOR A;  2DRP A;  2EOH A;  1UN6 B;  2VRD A;  1A1J A;  4F2J C;  4F6N A;  2EQ0 A;  2EOJ A;  1G2F C;  2EMX A;  2MKD A;  2EPA A;  2ELY A;  2J7J A;  1WJP A;  2MDG A;  1YUJ A;  2EMY A;  2EP3 A;  2EN7 A;  2LV2 A;  4M9V C;  2DMI A;  2EMI A;  2I13 A;  2ELZ A;  1G2D C;  2HGH A;  2EMF A;  3MHH C;  4IJD A;  4GZN C;  2ADR A;  2EPX A;  2WBU A;  1ZU1 A;  2EJ4 A;  3MHS C;  1UBD C;  3VHT B;  1AAY A;  4R2Q A;  2EQ1 A;  1X6H A;  3UK3 C;  4FK5 C;  4F6M A;  5KL7 A;  2EPP A;  2BB8 A;  2EOF A;  1DGC A;  4R2R A;  2EM2 A;  2YTD A;  2EMC A;  2EOY A;  4R2E A;  2YRK A;  2EMA A;  3EPJ A;  1A1G A;  2CT1 A;  2EMZ A;  3EPH A;  2EL4 A;  1A1L A;  2EOX A;  2M9A A;  2YTI A;  1JK2 A;  1A1I A;  1LLM C;  2ENC A;  2EQ3 A;  2YTJ A;  2YTG A;  2RSI A;  2EN4 A;  2ENA A;  2YU5 A;  2YTQ A;  2DLK A;  2EM7 A;  1B69 A;  2DGC A;  2GHF A;  1A1H A;  2R1F A;  2EE8 A;  2CTD A;  2EOQ A;  2E72 A;  2EPU A;  2MKN A;  4IS1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...