2EOIA

Solution structure of the c2h2 type zinc finger (region 329-359) of human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
GSSGSSGEKLHECSECRKTFSFHSQLVIHQRIHTGENPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 329-359) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 268
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoiA01
2A25A 5KL5A 4X9JA 1MEYC 2R1FA 5KL3A 2EMBA 2EM2A 2J7JA 2EM4A 2EM9A 4R2AA 2YRMA 4IS1C 2EMHA 1TF6A 2ENHA 4R2DA 2EOIA 1WJPA 1ZU1A 2EMIA 1X6FA 2EN6A 2LCEA 2EM0A 2EN1A 2EMZA 2YTJA 2EOEA 2YSPA 2E72A 2ENCA 3EPLA 1A1GA 5KL2A 2WBSA 4R2CA 1LLMC 2DMIA 2HGHA 2WBTA 4GZNC 1TN9A 2EOYA 1JK2A 2EM8A 4F6MA 2WCC3 2EE8A 2EQ0A 2EORA 2LT7A 2MKDA 2LO3A 4M9VC 1UBDC 2EQ1A 5KL7A 2EOQA 2D9HA 3UK3C 2WBUA 2YRKA 4IJDA 1A1IA 1B69A 1RMDA 2EL6A 2MDGA 3M99B 4R2EA 1Z1BA 2I13A 2EPXA 1YUJA 2JPAA 2EPPA 2YTNA 2EMWA 2YRHA 2CT1A 1F2IG 2EMAA 4FK5C 1X5WA 2EOMA 2M9AA 2DLKA 3VHTB 2EMYA 2NABA 2EM6A 2EN2A 2EP3A 2YU8A 1TF3A 1A1KA 2EJ4A 2EMCA 2ELYA 1JK1A 2EOJA 1BBOA 2EM3A 2ENAA 2EOSA 2EN8A 4R2PA 2CSHA 2DLQA 4F2JC 2EN7A 1A1LA 2YTIA 2CTDA 4R2RA 1YSAC 1YUIA 2RPCA 1A1JA 3EPJA 2DRPA 2EPRA 2EPAA 1BB8A 2YTFA 3EPKA 1NCSA 2EOHA 3MHSC 1X6HA 3MHHC 2EN3A 1G2FC 2JP9A 3EPHA 1KJKA 2PRTA 2GLIA 2EPCA 4R2SA 2EQ3A 1G2DC 2BB8A 1A1FA 2LVHA 2EMGA 2YSOA 4R2QA 2YU5A 2EPUA 1P47A 4F6NA 2EOXA 2VRDA 2YTQA 2YTDA 5KL4A 2EMXA 2MKNA 2EPZA 2ELZA 1ZR9A 1DGCA 2EM7A 2GHFA 2YTPA 2YTOA 5KL6A 1A1HA 1ZAAC 2RSIA 2YTGA 2LV2A 2DGCA 2ADRA 2EM5A 2EN4A 2EOZA 2YTEA 1UN6B 2EOFA 2EMKA 2EL5A 1X6EA 2EOOA 4WSGA 1X3CA 1AAYA 2EMLA 2EL4A 2EMFA
chains in the Genus database with same CATH superfamily
2EZ6A 1WRJA 2F4VE 5FLXC 5A6KA 2EM2A 2UU9E 2J7JA 4R2AA 3IWDA 1WXRA 4BBYA 4IS1C 1J5EE 4LFBE 1TF6A 2NUGA 4WX9A 2JWOA 1IQOA 3HXLA 1WJPA 4ZYHA 3JTZA 3BIDA 1L4SA 4OX9E 2EN1A 2E72A 2ENCA 3ADJA 3MSWA 2LTRA 1GTKA 4R2CA 1LLMC 3QG5C 2HGHA 2WBTA 2DMYA 3LLHA 2EORA 4WXCA 2V87A 3BGHA 2MC5A 2N8XA 5LMUE 2YRKA 4IJDA 2L3JA 5AE3A 4F9CB 4R2EA 2I13A 3FIGA 4LF8E 1YUJA 4DR4E 2UUBE 4DV4E 2YTNA 3JAMC 2EMAA 2KOUA 2EOMA 4JI8E 4WPYA 4AQYE 4Q28A 3C4TA 1IBME 2ZM6E 1TF3A 2EJ4A 2ELYA 2H36X 2EOJA 3H09A 4LF4E 2EM3A 1BBOA 1YYWA 1WHQA 2EN7A 2JVAA 2LUPB 4R2RA 4GEQB 4MLQA 2YZTA 2EPRA 2EPAA 1BB8A 4BHCA 3EPKA 5T6JA 3MHSC 4RH8A 3RMPA 4BHBA 5DNYA 3AUZA 2EPCA 2JYAA 2BB8A 3DJWA 1NEIA 4NHRA 2LVHA 2L2NA 2YU5A 2LTSA 4KHPE 2VRDA 4Q35B 4J8ZA 2EMXA 4HTGA 1YYKA 4WXDA 2EM7A 1FKAE 1ZAAC 5KL6A 1A1HA 1UHZA 1DQ3A 4DUZE 4ZYDA 4M2ZA 3IWBA 2EOZA 2YTEA 1UILA 2EMKA 2EOFA 2EL5A 2F8BA 4OOGC 4X66E 1X6EA 1X3CA 2V89A 2RQLA 4O24A 2EMLA 4LFCE 1XNQE 4JI0E 2EMFA 1IQSA 2A25A 4JYAE 1MEYC 4B3ME 2E5LE 2NUEA 4M0VA 2EMBA 3OMLA 5IT9C 4P78A 2EM4A 2RS7A 2EMHA 4ZYGA 5LMNE 2ENHA 2V8QB 5A2QC 2HC5A 5IV8B 1YZ9A 2EOIA 2GPIA 1ZU1A 4JI6E 2EN6A 2EM0A 5IWAE 2EOEA 2DIXA 2YSPA 4B3SE 4O4KA 4KZSA 1I94E 4BC9A 2DMIA 5A6JA 2MDRA 3C4BA 1TN9A 2EOYA 1JK2A 3TQMA 2NUFA 2EE8A 1BBGA 2EQ0A 2LT7A 5ADZA 2LO3A 4M9VC 1STUA 4WSPA 5AE2A 4GKJE 2B3TB 5KL7A 2D9HA 1QNTA 2FGGA 1T38A 5A6BD 1A1IA 1EH6A 2EL6A 2MDGA 2L33A 4X64E 2EPPA 2EMWA 2YRHA 2YT4A 2CT1A 3THOB 1F2IG 4DMIA 2DLKA 3VHTB 2NABA 1N33E 3F6GA 2EM6A 4DKKA 4RHBB 1O0WA 2EMCA 1J26A 2EPOA 2EOSA 5IXMB 2EN8A 4F9AB 3ADLA 2UUCE 1T4OA 2CTDA 4YY3E 1YSAC 1YPNA 3K6QA 2IHR1 3ADIA 5AC4A 4P7DA 2YTFA 2FV4B 2EPLX 3MHHC 1G2FC 2EN3A 2FTXB 3C6KA 4L5NC 2JP9A 5TSEA 1IMUA 1IBLE 1KJKA 2HHHE 4DV7E 2L3CA 2YSOA 1N36E 2YTQA 1ZBTA 2JY9A 2ELZA 2NA2A 4L8NA 4JI7E 1PDAA 2GHFA 4DV1E 2RSIA 4MLVA 4DR7E 3ZOQB 2N3GA 2DGCA 2K7IA 1ZBQA 4TUIA 3OTOE 3C6MA 1EKZA 4M30A 2EOOA 2EWLA 3HPZA 1RC7A 1AAYA 2LBSB 2EL4A 5KL5A 4DUYE 4JI4E 4LF9E 1N32E 4BS9A 2WZOA 5CFFE 2BBGA 3J80C 2EM9A 4HEIA 2YRMA 2V88A 1WHNA 2VE7C 3AV0A 1KYQA 2EPKX 2V85A 2EMIA 2LCEA 4R03A 1HNZE 4DR1E 2JOXA 4JV5E 2YTJA 3ADGA 3EPLA 1A1GA 4ZYEA 2WBSA 3ECRA 4GZNC 2EM8A 5A69A 4R8OA 4WFTA 2V83A 2MKDA 4X8WA 2EOQA 2UXCE 5F3WA 1B69A 1RMDA 4NXNE 2HJJA 2DSYA 1X5WA 2LJHA 1PKPA 2LUQA 1X48A 3LMLA 2VQFE 2M1SA 4LFAE 2EN2A 2YU8A 4JI2E 1A1KA 2B9DA 1T39A 2YPNA 5A6BA 2ENAA 4R2PA 4JI3E 4NXME 4N4RB 1YUIA 2RPCA 4B3RE 3JU0A 4LU9A 2DRPA 4DR5E 1NCSA 2EOHA 1X6HA 3EPHA 2UXDE 2PRTA 3HPSA 2GLIA 4BCAA 2L2KB 4R2SA 1YYOA 1A1FA 1HNXE 2I9IA 1P47A 4WYQB 3J81C 1YFHA 5KL4A 4F9BB 4LF7E 1QU6A 2YWQA 5AC5A 4LTYA 2MC6A 3L00A 3T1YE 2YTOA 2YTGA 2JOBA 3KZYA 1GQEA 2ODRC 2KHXA 5LLQA 1UN6B 2Q8UA 5BR8E 2L92A 4BMJA 1PJQA 2UUAE 2DB2A 1XMOE 2JXPA 2VQEE 1X49A 5A6AA 4X9JA 4DR6E 4B3TE 2R1FA 3P1XA 5KL3A 1XNRE 2JR1A 2VF1A 4DR3E 3J7Yp 1N3GA 4GKKE 2L2MA 4R2DA 2RSMA 4TUGA 1FJGE 3HQ1A 3VK6A 1X6FA 2B7TA 3BF2A 2B7VA 2EMZA 2LE2A 2R76A 1HNWE 4KWYA 1MGTA 1EH7A 2LMZA 3F6HA 4DV2E 3THNA 5KL2A 4YHHE 2EPMX 1PJTA 1XMQE 4F6MA 2WCC3 4O5GA 4DV3E 2UXBE 4JI1E 2EPNA 1UBDC 2EQ1A 5AE1A 3UK3C 2WBUA 4I8OA 3M99B 4DV6E 4F54A 1Z1BA 4NZVA 2EPXA 2JPAA 2L6MA 4BC7A 3EQ1A 1T4NA 4FK5C 4K0KE 3J7AG 1EH8A 3IWCA 2M9AA 1RQ0A 2EMYA 2M7QA 1N34E 1T4LB 2EP3A 1JK1A 4JI5E 1IBKE 2CPNA 1DI2A 4DR2E 2CSHA 2DLQA 2E1MA 4F2JC 4DV5E 2LJUA 1A1LA 2YTIA 4X62E 1A1JA 3EPJA 2RTXA 1SFEA 2K4VA 1SR9A 1HR0E 1AH5A 2EQ3A 1G2DC 2V86A 4DV0E 4X65E 1X47A 2EMGA 2M4IA 4R2QA 2L8TA 3KZZA 2EPUA 4O43A 2ODRD 4F6NA 2EOXA 5LL6R 3VYXA 2YTDA 3HTXA 2MKNA 2EPZA 2RS6A 3T1HE 1ZR9A 5AASA 1DGCA 2LRSA 2YTPA 1PJSA 2LV2A 2N3HA 3KWRA 4LF5E 2G7HA 3VYYA 2ADRA 2EM5A 2EN4A 2KONA 4WSGA 3DF6A 4LF6E 3BBGA 1GZ6A
chains in the Genus database with same CATH topology
2A25A 5KL5A 4X9JA 1MEYC 2R1FA 5KL3A 2EMBA 2EM2A 2J7JA 2EM4A 2EM9A 4R2AA 2YRMA 4IS1C 2EMHA 1TF6A 2ENHA 4R2DA 2EOIA 1WJPA 1ZU1A 2EMIA 1X6FA 2EN6A 2LCEA 2EM0A 2EN1A 2EMZA 2YTJA 2EOEA 2YSPA 2E72A 2ENCA 3EPLA 1A1GA 5KL2A 2WBSA 4R2CA 1LLMC 2DMIA 2HGHA 2WBTA 4GZNC 1TN9A 2EOYA 1JK2A 2EM8A 4F6MA 2WCC3 2EE8A 2EQ0A 2EORA 2LT7A 2MKDA 2LO3A 4M9VC 1UBDC 2EQ1A 5KL7A 2EOQA 2D9HA 3UK3C 2WBUA 2YRKA 4IJDA 1A1IA 1B69A 1RMDA 2EL6A 2MDGA 3M99B 4R2EA 1Z1BA 2I13A 2EPXA 1YUJA 2JPAA 2EPPA 2YTNA 2EMWA 2YRHA 2CT1A 1F2IG 2EMAA 4FK5C 1X5WA 2EOMA 2M9AA 2DLKA 3VHTB 2EMYA 2NABA 2EM6A 2EN2A 2EP3A 2YU8A 1TF3A 1A1KA 2EJ4A 2EMCA 2ELYA 1JK1A 2EOJA 1BBOA 2EM3A 2ENAA 2EOSA 2EN8A 4R2PA 2CSHA 2DLQA 4F2JC 2EN7A 1A1LA 2YTIA 2CTDA 4R2RA 1YSAC 1YUIA 2RPCA 1A1JA 3EPJA 2DRPA 2EPRA 2EPAA 1BB8A 2YTFA 3EPKA 1NCSA 2EOHA 3MHSC 1X6HA 3MHHC 2EN3A 1G2FC 2JP9A 3EPHA 1KJKA 2PRTA 2GLIA 2EPCA 4R2SA 2EQ3A 1G2DC 2BB8A 1A1FA 2LVHA 2EMGA 2YSOA 4R2QA 2YU5A 2EPUA 1P47A 4F6NA 2EOXA 2VRDA 2YTQA 2YTDA 5KL4A 2EMXA 2MKNA 2EPZA 2ELZA 1ZR9A 1DGCA 2EM7A 2GHFA 2YTPA 2YTOA 5KL6A 1A1HA 1ZAAC 2RSIA 2YTGA 2LV2A 2DGCA 2ADRA 2EM5A 2EN4A 2EOZA 2YTEA 1UN6B 2EOFA 2EMKA 2EL5A 1X6EA 2EOOA 4WSGA 1X3CA 1AAYA 2EMLA 2EL4A 2EMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A25 A;  5KL5 A;  4X9J A;  1MEY C;  2R1F A;  5KL3 A;  2EMB A;  2EM2 A;  2J7J A;  2EM4 A;  2EM9 A;  4R2A A;  2YRM A;  4IS1 C;  2EMH A;  1TF6 A;  2ENH A;  4R2D A;  2EOI A;  1WJP A;  1ZU1 A;  2EMI A;  1X6F A;  2EN6 A;  2LCE A;  2EM0 A;  2EN1 A;  2EMZ A;  2YTJ A;  2EOE A;  2YSP A;  2E72 A;  2ENC A;  3EPL A;  1A1G A;  5KL2 A;  2WBS A;  4R2C A;  1LLM C;  2DMI A;  2HGH A;  2WBT A;  4GZN C;  1TN9 A;  2EOY A;  1JK2 A;  2EM8 A;  4F6M A;  2WCC 3;  2EE8 A;  2EQ0 A;  2EOR A;  2LT7 A;  2MKD A;  2LO3 A;  4M9V C;  1UBD C;  2EQ1 A;  5KL7 A;  2EOQ A;  2D9H A;  3UK3 C;  2WBU A;  2YRK A;  4IJD A;  1A1I A;  1B69 A;  1RMD A;  2EL6 A;  2MDG A;  3M99 B;  4R2E A;  1Z1B A;  2I13 A;  2EPX A;  1YUJ A;  2JPA A;  2EPP A;  2YTN A;  2EMW A;  2YRH A;  2CT1 A;  1F2I G;  2EMA A;  4FK5 C;  1X5W A;  2EOM A;  2M9A A;  2DLK A;  3VHT B;  2EMY A;  2NAB A;  2EM6 A;  2EN2 A;  2EP3 A;  2YU8 A;  1TF3 A;  1A1K A;  2EJ4 A;  2EMC A;  2ELY A;  1JK1 A;  2EOJ A;  1BBO A;  2EM3 A;  2ENA A;  2EOS A;  2EN8 A;  4R2P A;  2CSH A;  2DLQ A;  4F2J C;  2EN7 A;  1A1L A;  2YTI A;  2CTD A;  4R2R A;  1YSA C;  1YUI A;  2RPC A;  1A1J A;  3EPJ A;  2DRP A;  2EPR A;  2EPA A;  1BB8 A;  2YTF A;  3EPK A;  1NCS A;  2EOH A;  3MHS C;  1X6H A;  3MHH C;  2EN3 A;  1G2F C;  2JP9 A;  3EPH A;  1KJK A;  2PRT A;  2GLI A;  2EPC A;  4R2S A;  2EQ3 A;  1G2D C;  2BB8 A;  1A1F A;  2LVH A;  2EMG A;  2YSO A;  4R2Q A;  2YU5 A;  2EPU A;  1P47 A;  4F6N A;  2EOX A;  2VRD A;  2YTQ A;  2YTD A;  5KL4 A;  2EMX A;  2MKN A;  2EPZ A;  2ELZ A;  1ZR9 A;  1DGC A;  2EM7 A;  2GHF A;  2YTP A;  2YTO A;  5KL6 A;  1A1H A;  1ZAA C;  2RSI A;  2YTG A;  2LV2 A;  2DGC A;  2ADR A;  2EM5 A;  2EN4 A;  2EOZ A;  2YTE A;  1UN6 B;  2EOF A;  2EMK A;  2EL5 A;  1X6E A;  2EOO A;  4WSG A;  1X3C A;  1AAY A;  2EML A;  2EL4 A;  2EMF A; 
#chains in the Genus database with same CATH topology
 2EZ6 A;  1WRJ A;  2F4V E;  5FLX C;  5A6K A;  2EM2 A;  2UU9 E;  2J7J A;  4R2A A;  3IWD A;  1WXR A;  4BBY A;  4IS1 C;  1J5E E;  4LFB E;  1TF6 A;  2NUG A;  4WX9 A;  2JWO A;  1IQO A;  3HXL A;  1WJP A;  4ZYH A;  3JTZ A;  3BID A;  1L4S A;  4OX9 E;  2EN1 A;  2E72 A;  2ENC A;  3ADJ A;  3MSW A;  2LTR A;  1GTK A;  4R2C A;  1LLM C;  3QG5 C;  2HGH A;  2WBT A;  2DMY A;  3LLH A;  2EOR A;  4WXC A;  2V87 A;  3BGH A;  2MC5 A;  2N8X A;  5LMU E;  2YRK A;  4IJD A;  2L3J A;  5AE3 A;  4F9C B;  4R2E A;  2I13 A;  3FIG A;  4LF8 E;  1YUJ A;  4DR4 E;  2UUB E;  4DV4 E;  2YTN A;  3JAM C;  2EMA A;  2KOU A;  2EOM A;  4JI8 E;  4WPY A;  4AQY E;  4Q28 A;  3C4T A;  1IBM E;  2ZM6 E;  1TF3 A;  2EJ4 A;  2ELY A;  2H36 X;  2EOJ A;  3H09 A;  4LF4 E;  2EM3 A;  1BBO A;  1YYW A;  1WHQ A;  2EN7 A;  2JVA A;  2LUP B;  4R2R A;  4GEQ B;  4MLQ A;  2YZT A;  2EPR A;  2EPA A;  1BB8 A;  4BHC A;  3EPK A;  5T6J A;  3MHS C;  4RH8 A;  3RMP A;  4BHB A;  5DNY A;  3AUZ A;  2EPC A;  2JYA A;  2BB8 A;  3DJW A;  1NEI A;  4NHR A;  2LVH A;  2L2N A;  2YU5 A;  2LTS A;  4KHP E;  2VRD A;  4Q35 B;  4J8Z A;  2EMX A;  4HTG A;  1YYK A;  4WXD A;  2EM7 A;  1FKA E;  1ZAA C;  5KL6 A;  1A1H A;  1UHZ A;  1DQ3 A;  4DUZ E;  4ZYD A;  4M2Z A;  3IWB A;  2EOZ A;  2YTE A;  1UIL A;  2EMK A;  2EOF A;  2EL5 A;  2F8B A;  4OOG C;  4X66 E;  1X6E A;  1X3C A;  2V89 A;  2RQL A;  4O24 A;  2EML A;  4LFC E;  1XNQ E;  4JI0 E;  2EMF A;  1IQS A;  2A25 A;  4JYA E;  1MEY C;  4B3M E;  2E5L E;  2NUE A;  4M0V A;  2EMB A;  3OML A;  5IT9 C;  4P78 A;  2EM4 A;  2RS7 A;  2EMH A;  4ZYG A;  5LMN E;  2ENH A;  2V8Q B;  5A2Q C;  2HC5 A;  5IV8 B;  1YZ9 A;  2EOI A;  2GPI A;  1ZU1 A;  4JI6 E;  2EN6 A;  2EM0 A;  5IWA E;  2EOE A;  2DIX A;  2YSP A;  4B3S E;  4O4K A;  4KZS A;  1I94 E;  4BC9 A;  2DMI A;  5A6J A;  2MDR A;  3C4B A;  1TN9 A;  2EOY A;  1JK2 A;  3TQM A;  2NUF A;  2EE8 A;  1BBG A;  2EQ0 A;  2LT7 A;  5ADZ A;  2LO3 A;  4M9V C;  1STU A;  4WSP A;  5AE2 A;  4GKJ E;  2B3T B;  5KL7 A;  2D9H A;  1QNT A;  2FGG A;  1T38 A;  5A6B D;  1A1I A;  1EH6 A;  2EL6 A;  2MDG A;  2L33 A;  4X64 E;  2EPP A;  2EMW A;  2YRH A;  2YT4 A;  2CT1 A;  3THO B;  1F2I G;  4DMI A;  2DLK A;  3VHT B;  2NAB A;  1N33 E;  3F6G A;  2EM6 A;  4DKK A;  4RHB B;  1O0W A;  2EMC A;  1J26 A;  2EPO A;  2EOS A;  5IXM B;  2EN8 A;  4F9A B;  3ADL A;  2UUC E;  1T4O A;  2CTD A;  4YY3 E;  1YSA C;  1YPN A;  3K6Q A;  2IHR 1;  3ADI A;  5AC4 A;  4P7D A;  2YTF A;  2FV4 B;  2EPL X;  3MHH C;  1G2F C;  2EN3 A;  2FTX B;  3C6K A;  4L5N C;  2JP9 A;  5TSE A;  1IMU A;  1IBL E;  1KJK A;  2HHH E;  4DV7 E;  2L3C A;  2YSO A;  1N36 E;  2YTQ A;  1ZBT A;  2JY9 A;  2ELZ A;  2NA2 A;  4L8N A;  4JI7 E;  1PDA A;  2GHF A;  4DV1 E;  2RSI A;  4MLV A;  4DR7 E;  3ZOQ B;  2N3G A;  2DGC A;  2K7I A;  1ZBQ A;  4TUI A;  3OTO E;  3C6M A;  1EKZ A;  4M30 A;  2EOO A;  2EWL A;  3HPZ A;  1RC7 A;  1AAY A;  2LBS B;  2EL4 A;  5KL5 A;  4DUY E;  4JI4 E;  4LF9 E;  1N32 E;  4BS9 A;  2WZO A;  5CFF E;  2BBG A;  3J80 C;  2EM9 A;  4HEI A;  2YRM A;  2V88 A;  1WHN A;  2VE7 C;  3AV0 A;  1KYQ A;  2EPK X;  2V85 A;  2EMI A;  2LCE A;  4R03 A;  1HNZ E;  4DR1 E;  2JOX A;  4JV5 E;  2YTJ A;  3ADG A;  3EPL A;  1A1G A;  4ZYE A;  2WBS A;  3ECR A;  4GZN C;  2EM8 A;  5A69 A;  4R8O A;  4WFT A;  2V83 A;  2MKD A;  4X8W A;  2EOQ A;  2UXC E;  5F3W A;  1B69 A;  1RMD A;  4NXN E;  2HJJ A;  2DSY A;  1X5W A;  2LJH A;  1PKP A;  2LUQ A;  1X48 A;  3LML A;  2VQF E;  2M1S A;  4LFA E;  2EN2 A;  2YU8 A;  4JI2 E;  1A1K A;  2B9D A;  1T39 A;  2YPN A;  5A6B A;  2ENA A;  4R2P A;  4JI3 E;  4NXM E;  4N4R B;  1YUI A;  2RPC A;  4B3R E;  3JU0 A;  4LU9 A;  2DRP A;  4DR5 E;  1NCS A;  2EOH A;  1X6H A;  3EPH A;  2UXD E;  2PRT A;  3HPS A;  2GLI A;  4BCA A;  2L2K B;  4R2S A;  1YYO A;  1A1F A;  1HNX E;  2I9I A;  1P47 A;  4WYQ B;  3J81 C;  1YFH A;  5KL4 A;  4F9B B;  4LF7 E;  1QU6 A;  2YWQ A;  5AC5 A;  4LTY A;  2MC6 A;  3L00 A;  3T1Y E;  2YTO A;  2YTG A;  2JOB A;  3KZY A;  1GQE A;  2ODR C;  2KHX A;  5LLQ A;  1UN6 B;  2Q8U A;  5BR8 E;  2L92 A;  4BMJ A;  1PJQ A;  2UUA E;  2DB2 A;  1XMO E;  2JXP A;  2VQE E;  1X49 A;  5A6A A;  4X9J A;  4DR6 E;  4B3T E;  2R1F A;  3P1X A;  5KL3 A;  1XNR E;  2JR1 A;  2VF1 A;  4DR3 E;  3J7Y p;  1N3G A;  4GKK E;  2L2M A;  4R2D A;  2RSM A;  4TUG A;  1FJG E;  3HQ1 A;  3VK6 A;  1X6F A;  2B7T A;  3BF2 A;  2B7V A;  2EMZ A;  2LE2 A;  2R76 A;  1HNW E;  4KWY A;  1MGT A;  1EH7 A;  2LMZ A;  3F6H A;  4DV2 E;  3THN A;  5KL2 A;  4YHH E;  2EPM X;  1PJT A;  1XMQ E;  4F6M A;  2WCC 3;  4O5G A;  4DV3 E;  2UXB E;  4JI1 E;  2EPN A;  1UBD C;  2EQ1 A;  5AE1 A;  3UK3 C;  2WBU A;  4I8O A;  3M99 B;  4DV6 E;  4F54 A;  1Z1B A;  4NZV A;  2EPX A;  2JPA A;  2L6M A;  4BC7 A;  3EQ1 A;  1T4N A;  4FK5 C;  4K0K E;  3J7A G;  1EH8 A;  3IWC A;  2M9A A;  1RQ0 A;  2EMY A;  2M7Q A;  1N34 E;  1T4L B;  2EP3 A;  1JK1 A;  4JI5 E;  1IBK E;  2CPN A;  1DI2 A;  4DR2 E;  2CSH A;  2DLQ A;  2E1M A;  4F2J C;  4DV5 E;  2LJU A;  1A1L A;  2YTI A;  4X62 E;  1A1J A;  3EPJ A;  2RTX A;  1SFE A;  2K4V A;  1SR9 A;  1HR0 E;  1AH5 A;  2EQ3 A;  1G2D C;  2V86 A;  4DV0 E;  4X65 E;  1X47 A;  2EMG A;  2M4I A;  4R2Q A;  2L8T A;  3KZZ A;  2EPU A;  4O43 A;  2ODR D;  4F6N A;  2EOX A;  5LL6 R;  3VYX A;  2YTD A;  3HTX A;  2MKN A;  2EPZ A;  2RS6 A;  3T1H E;  1ZR9 A;  5AAS A;  1DGC A;  2LRS A;  2YTP A;  1PJS A;  2LV2 A;  2N3H A;  3KWR A;  4LF5 E;  2G7H A;  3VYY A;  2ADR A;  2EM5 A;  2EN4 A;  2KON A;  4WSG A;  3DF6 A;  4LF6 E;  3BBG A;  1GZ6 A; 
#chains in the Genus database with same CATH homology
 2A25 A;  5KL5 A;  4X9J A;  1MEY C;  2R1F A;  5KL3 A;  2EMB A;  2EM2 A;  2J7J A;  2EM4 A;  2EM9 A;  4R2A A;  2YRM A;  4IS1 C;  2EMH A;  1TF6 A;  2ENH A;  4R2D A;  2EOI A;  1WJP A;  1ZU1 A;  2EMI A;  1X6F A;  2EN6 A;  2LCE A;  2EM0 A;  2EN1 A;  2EMZ A;  2YTJ A;  2EOE A;  2YSP A;  2E72 A;  2ENC A;  3EPL A;  1A1G A;  5KL2 A;  2WBS A;  4R2C A;  1LLM C;  2DMI A;  2HGH A;  2WBT A;  4GZN C;  1TN9 A;  2EOY A;  1JK2 A;  2EM8 A;  4F6M A;  2WCC 3;  2EE8 A;  2EQ0 A;  2EOR A;  2LT7 A;  2MKD A;  2LO3 A;  4M9V C;  1UBD C;  2EQ1 A;  5KL7 A;  2EOQ A;  2D9H A;  3UK3 C;  2WBU A;  2YRK A;  4IJD A;  1A1I A;  1B69 A;  1RMD A;  2EL6 A;  2MDG A;  3M99 B;  4R2E A;  1Z1B A;  2I13 A;  2EPX A;  1YUJ A;  2JPA A;  2EPP A;  2YTN A;  2EMW A;  2YRH A;  2CT1 A;  1F2I G;  2EMA A;  4FK5 C;  1X5W A;  2EOM A;  2M9A A;  2DLK A;  3VHT B;  2EMY A;  2NAB A;  2EM6 A;  2EN2 A;  2EP3 A;  2YU8 A;  1TF3 A;  1A1K A;  2EJ4 A;  2EMC A;  2ELY A;  1JK1 A;  2EOJ A;  1BBO A;  2EM3 A;  2ENA A;  2EOS A;  2EN8 A;  4R2P A;  2CSH A;  2DLQ A;  4F2J C;  2EN7 A;  1A1L A;  2YTI A;  2CTD A;  4R2R A;  1YSA C;  1YUI A;  2RPC A;  1A1J A;  3EPJ A;  2DRP A;  2EPR A;  2EPA A;  1BB8 A;  2YTF A;  3EPK A;  1NCS A;  2EOH A;  3MHS C;  1X6H A;  3MHH C;  2EN3 A;  1G2F C;  2JP9 A;  3EPH A;  1KJK A;  2PRT A;  2GLI A;  2EPC A;  4R2S A;  2EQ3 A;  1G2D C;  2BB8 A;  1A1F A;  2LVH A;  2EMG A;  2YSO A;  4R2Q A;  2YU5 A;  2EPU A;  1P47 A;  4F6N A;  2EOX A;  2VRD A;  2YTQ A;  2YTD A;  5KL4 A;  2EMX A;  2MKN A;  2EPZ A;  2ELZ A;  1ZR9 A;  1DGC A;  2EM7 A;  2GHF A;  2YTP A;  2YTO A;  5KL6 A;  1A1H A;  1ZAA C;  2RSI A;  2YTG A;  2LV2 A;  2DGC A;  2ADR A;  2EM5 A;  2EN4 A;  2EOZ A;  2YTE A;  1UN6 B;  2EOF A;  2EMK A;  2EL5 A;  1X6E A;  2EOO A;  4WSG A;  1X3C A;  1AAY A;  2EML A;  2EL4 A;  2EMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...