2EOIA

Solution structure of the c2h2 type zinc finger (region 329-359) of human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
GSSGSSGEKLHECSECRKTFSFHSQLVIHQRIHTGENPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 329-359) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoiA01
5KL3A 3VHTB 2VRDA 2EPXA 2EM6A 1X5WA 2E72A 2EMFA 2EN4A 1DGCA 2LT7A 2ENCA 2EMXA 4R2DA 3UK3C 1X6FA 2GHFA 5KL7A 2DRPA 4GZNC 2EN6A 2I13A 2EL5A 2MKDA 1WJPA 1G2DC 1X6HA 2EOHA 2DLQA 2YSPA 2YTEA 1AAYA 1UBDC 2YSOA 3EPLA 2EOFA 2EQ3A 2EMYA 5KL2A 2DGCA 2CTDA 2EMLA 2HGHA 2EOXA 2EPZA 1A1IA 2EN7A 4R2PA 1TF3A 2EN3A 1BB8A 3M99B 4IS1C 2EQ1A 2EOOA 2A25A 4F6NA 4R2EA 2LO3A 2EL6A 2EM8A 2EPUA 2WCC3 2YU5A 1ZR9A 2ELZA 2WBUA 1KJKA 2M9AA 4R2SA 4M9VC 2ENAA 4F2JC 1A1FA 1UN6B 2EQ0A 1G2FC 2YTIA 2YU8A 2D9HA 2EOQA 1JK2A 1ZAAC 2ADRA 5KL5A 2EMIA 2EOSA 3MHHC 2RSIA 1A1JA 2YTQA 2ELYA 2EMHA 2EMWA 2EM5A 2CT1A 2EOMA 1A1KA 3EPHA 2WBTA 2EN2A 2EMBA 4R2AA 2EN8A 2GLIA 2LCEA 2EM3A 2EM0A 2ENHA 2LVHA 1P47A 2J7JA 2EP3A 2EOEA 2EMGA 2YTGA 2EPCA 4FK5C 4X9JA 1LLMC 1F2IG 2EOIA 5KL4A 2EOJA 4R2QA 4R2RA 5KL6A 2EN1A 2EM9A 2YTDA 1ZU1A 2EM2A 2DLKA 2EOZA 1X6EA 2EM4A 2EPAA 2CSHA 1X3CA 1A1GA 1YSAC 1BBOA 4F6MA 2YTPA 2YRKA 2LV2A 2JP9A 1YUJA 2EPRA 1B69A 3EPKA 2EMCA 2BB8A 2R1FA 2EPPA 1YUIA 1TF6A 4WSGA 2YTFA 4R2CA 2EMAA 2NABA 2EM7A 2EOYA 3EPJA 1JK1A 2YRMA 2EORA 2RPCA 1RMDA 2EMKA 1NCSA 2YTJA 2MKNA 2EJ4A 2MDGA 2EMZA 3MHSC 2YRHA 2DMIA 4IJDA 2WBSA 1TN9A 2JPAA 2YTOA 2EE8A 2EL4A 1A1HA 2YTNA 1Z1BA 2PRTA 1A1LA 1MEYC
chains in the Genus database with same CATH superfamily
5KL3A 4DV0E 4LFCE 2VRDA 1IQOA 2EPXA 1X5WA 2MC5A 1DGCA 5A2QC 4R2DA 3UK3C 2DRPA 1UHZA 3BGHA 4GZNC 2I13A 4DR6E 2MKDA 1EH6A 2YSPA 2YTEA 4L8NA 4LTYA 3EPLA 3K6QA 5AC4A 5A6JA 1GQEA 2EOXA 2R76A 2RTXA 4NHRA 1WRJA 2A25A 1N34E 5ADZA 2V85A 4R2EA 4JI5E 4O4KA 2WCC3 2ELZA 1N36E 4BCAA 2JWOA 4YHHE 2M4IA 1A1FA 3HPZA 2EOQA 2EOSA 1A1JA 1IBLE 2L2NA 1IBME 4BS9A 4DKKA 4DUZE 2EN2A 4WXCA 2LCEA 2G7HA 4J8ZA 2LVHA 2EOEA 2EMGA 2YTGA 1AH5A 2LRSA 4GKKE 4DV4E 1GZ6A 2MC6A 2ODRD 2CSHA 1X3CA 1A1GA 1PJSA 1YSAC 4WYQB 4ZYGA 2YTPA 1X48A 1FJGE 1SFEA 2M1SA 2JP9A 2VF1A 3EPKA 3IWBA 5AE3A 5T6JA 3BIDA 4DR7E 1PJTA 2HJJA 2L33A 2NUGA 2EM7A 2EOYA 1YYKA 1X47A 3P1XA 3THNA 2MDRA 2EMKA 4BHBA 3VK6A 4F9CB 2DIXA 2UXDE 4R03A 1HR0E 2EL4A 2DSYA 2L2KB 2YZTA 1MEYC 1N32E 1YPNA 5IT9C 3L00A 2JR1A 2YPNA 4NXNE 2F8BA 4BC9A 1EH7A 2LT7A 3RMPA 4ZYDA 2B7TA 2V88A 2H36X 2EPMX 2EN6A 2K7IA 2EL5A 2Q8UA 1WJPA 1YYWA 1YZ9A 5A6AA 2LBSB 2UUAE 1HNWE 5LL6R 5KL2A 4B3ME 2EPZA 4KWYA 2UUBE 1GTKA 4R2PA 3THOB 4JI4E 2K4VA 4DR3E 3IWDA 4HEIA 2EM8A 4KZSA 2EPUA 2HHHE 4TUGA 1KJKA 5DNYA 4JI3E 2FTXB 2DMYA 2KHXA 5F3WA 4M9VC 2YTIA 2YU8A 4BMJA 2D9HA 1JK2A 2UXBE 1T4OA 5KL5A 2EMIA 3MHHC 2RSIA 2YTQA 3DJWA 5A69A 1UILA 4M30A 4GKJE 2CT1A 3AUZA 2EOMA 3KZZA 1A1KA 5IXMB 2WBTA 2EMBA 3BBGA 4R2AA 2L2MA 2GLIA 4B3SE 4MLVA 3J80C 2L3CA 4JV5E 4X9JA 4FK5C 4BBYA 1F2IG 1N3GA 2EOJA 2LUQA 3C6KA 2NUEA 2EM9A 4DV3E 4LF6E 4B3TE 2DLKA 4X66E 4X64E 4JI6E 1BBOA 1KYQA 4F6MA 1HNXE 2LTSA 2UUCE 1YUJA 2EPRA 1B69A 2UU9E 3ZOQB 2EPPA 2RSMA 2B3TB 3C4BA 4AQYE 1TF6A 4LF5E 1O0WA 2YTFA 4KHPE 4NXME 2EMAA 2JYAA 4BHCA 2NUFA 5AE1A 2KONA 4HTGA 3C4TA 3H09A 1RMDA 2V87A 1NCSA 3KWRA 2MKNA 2N8XA 2MDGA 2WBSA 3MHSC 1TN9A 2DMIA 4IJDA 2N3HA 4LFBE 2YTOA 1A1HA 1MGTA 1Z1BA 4RHBB 3C6MA 2CPNA 1IBKE 1T38A 4X65E 2V8QB 5AC5A 4DV5E 3QG5C 1STUA 2EN4A 3HQ1A 2ENCA 2VE7C 1X6FA 5KL7A 4ZYHA 3LLHA 4WXDA 1G2DC 2EOHA 1WHQA 2DLQA 4WSPA 3BF2A 1J26A 2JOXA 1PJQA 2YSOA 2CTDA 2HGHA 1RQ0A 3FIGA 2LJUA 1A1IA 2EN7A 2EPLX 3JAMC 4WFTA 3EQ1A 3JU0A 1BB8A 2EQ1A 1L4SA 4JI7E 1SR9A 2JVAA 4JI0E 3TQMA 4F6NA 3VYXA 4YY3E 2WZOA 2LO3A 4LFAE 1ZR9A 2WBUA 4DR5E 4R2SA 1X49A 2ODRC 2ENAA 3F6HA 4I8OA 4O24A 4K0KE 2FV4B 1ZAAC 4DV1E 2NA2A 2IHR1 3F6GA 5LMUE 5A6BD 1WXRA 2JOBA 5A6KA 3DF6A 5LMNE 2L3JA 2JY9A 4F9AB 2LE2A 2B7VA 5IV8B 2ENHA 2EM0A 4O43A 2FGGA 1P47A 4RH8A 2J7JA 4GEQB 2EP3A 2YWQA 4P78A 2E1MA 3ADJA 2EPKX 5KL4A 3KZYA 4R2QA 2YTDA 4Q28A 2EOZA 5BR8E 1X6EA 3HXLA 1IMUA 3IWCA 2LV2A 2LUPB 5LLQA 1J5EE 4LF7E 2F4VE 4DUYE 4Q35B 2L6MA 2EMCA 2BB8A 1XNRE 1HNZE 2M7QA 4F9BB 2BBGA 2LTRA 4L5NC 4M2ZA 4MLQA 3EPJA 1JK1A 4JI8E 2EORA 1FKAE 4JI1E 2RPCA 2RS7A 1QU6A 1XNQE 2EMZA 2EZ6A 2L92A 2V86A 5CFFE 1WHNA 4DR4E 1A1LA 3J7AG 3HTXA 3VHTB 2B9DA 3T1HE 2EM6A 2E72A 2EMFA 1BBGA 2EPNA 4OOGC 2EMXA 4BC7A 2HC5A 2GHFA 2RS6A 1YFHA 3HPSA 3J7Yp 1X6HA 5A6BA 2N3GA 1AAYA 1UBDC 1DI2A 1T4NA 2EOFA 2EQ3A 2EMYA 2I9IA 2DGCA 2EMLA 3ECRA 1ZBTA 1PDAA 2DB2A 2EWLA 2EN3A 1TF3A 3M99B 3VYYA 4IS1C 2EOOA 2YT4A 2E5LE 4TUIA 4X62E 5AASA 3ADIA 2KOUA 2V89A 2EL6A 2YU5A 5FLXC 3LMLA 1XMQE 2RQLA 3OMLA 2M9AA 4DMIA 4F2JC 1UN6B 2LJHA 4OX9E 2EQ0A 1G2FC 3ADLA 2L8TA 2GPIA 3MSWA 2ADRA 1YYOA 2ELYA 4DR2E 2EMHA 4P7DA 2EMWA 2EM5A 4DV2E 3EPHA 4DV7E 1IQSA 5TSEA 2VQFE 2V83A 1I94E 5IWAE 2EN8A 3JTZA 1PKPA 2JXPA 4F54A 2EM3A 3OTOE 1RC7A 3AV0A 4JYAE 4LF4E 4N4RB 2EPCA 1LLMC 4X8WA 2EOIA 4R2RA 5KL6A 2EN1A 1N33E 1ZU1A 1ZBQA 4WX9A 2EM2A 3T1YE 1DQ3A 2LMZA 2EM4A 1QNTA 4R8OA 2EPAA 2YRKA 1T4LB 4DR1E 4LU9A 4DV6E 4LF9E 4WPYA 2R1FA 2VQEE 2UXCE 4NZVA 1NEIA 1YUIA 4WSGA 2EPOA 1EH8A 4R2CA 2NABA 1T39A 2YRMA 2ZM6E 4LF8E 1XMOE 2YTJA 2EJ4A 4B3RE 2JPAA 2YRHA 4ZYEA 4M0VA 4JI2E 3J81C 2EE8A 2YTNA 2PRTA 3ADGA 1EKZA 4O5GA 5AE2A
chains in the Genus database with same CATH topology
5KL3A 3VHTB 2VRDA 2EPXA 2EM6A 1X5WA 2E72A 2EMFA 2EN4A 1DGCA 2LT7A 2ENCA 2EMXA 4R2DA 3UK3C 1X6FA 2GHFA 5KL7A 2DRPA 4GZNC 2EN6A 2I13A 2EL5A 2MKDA 1WJPA 1G2DC 1X6HA 2EOHA 2DLQA 2YSPA 2YTEA 1AAYA 1UBDC 2YSOA 3EPLA 2EOFA 2EQ3A 2EMYA 5KL2A 2DGCA 2CTDA 2EMLA 2HGHA 2EOXA 2EPZA 1A1IA 2EN7A 4R2PA 1TF3A 2EN3A 1BB8A 3M99B 4IS1C 2EQ1A 2EOOA 2A25A 4F6NA 4R2EA 2LO3A 2EL6A 2EM8A 2EPUA 2WCC3 2YU5A 1ZR9A 2ELZA 2WBUA 1KJKA 2M9AA 4R2SA 4M9VC 2ENAA 4F2JC 1A1FA 1UN6B 2EQ0A 1G2FC 2YTIA 2YU8A 2D9HA 2EOQA 1JK2A 1ZAAC 2ADRA 5KL5A 2EMIA 2EOSA 3MHHC 2RSIA 1A1JA 2YTQA 2ELYA 2EMHA 2EMWA 2EM5A 2CT1A 2EOMA 1A1KA 3EPHA 2WBTA 2EN2A 2EMBA 4R2AA 2EN8A 2GLIA 2LCEA 2EM3A 2EM0A 2ENHA 2LVHA 1P47A 2J7JA 2EP3A 2EOEA 2EMGA 2YTGA 2EPCA 4FK5C 4X9JA 1LLMC 1F2IG 2EOIA 5KL4A 2EOJA 4R2QA 4R2RA 5KL6A 2EN1A 2EM9A 2YTDA 1ZU1A 2EM2A 2DLKA 2EOZA 1X6EA 2EM4A 2EPAA 2CSHA 1X3CA 1A1GA 1YSAC 1BBOA 4F6MA 2YTPA 2YRKA 2LV2A 2JP9A 1YUJA 2EPRA 1B69A 3EPKA 2EMCA 2BB8A 2R1FA 2EPPA 1YUIA 1TF6A 4WSGA 2YTFA 4R2CA 2EMAA 2NABA 2EM7A 2EOYA 3EPJA 1JK1A 2YRMA 2EORA 2RPCA 1RMDA 2EMKA 1NCSA 2YTJA 2MKNA 2EJ4A 2MDGA 2EMZA 3MHSC 2YRHA 2DMIA 4IJDA 2WBSA 1TN9A 2JPAA 2YTOA 2EE8A 2EL4A 1A1HA 2YTNA 1Z1BA 2PRTA 1A1LA 1MEYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KL3 A;  3VHT B;  2VRD A;  2EPX A;  2EM6 A;  1X5W A;  2E72 A;  2EMF A;  2EN4 A;  1DGC A;  2LT7 A;  2ENC A;  2EMX A;  4R2D A;  3UK3 C;  1X6F A;  2GHF A;  5KL7 A;  2DRP A;  4GZN C;  2EN6 A;  2I13 A;  2EL5 A;  2MKD A;  1WJP A;  1G2D C;  1X6H A;  2EOH A;  2DLQ A;  2YSP A;  2YTE A;  1AAY A;  1UBD C;  2YSO A;  3EPL A;  2EOF A;  2EQ3 A;  2EMY A;  5KL2 A;  2DGC A;  2CTD A;  2EML A;  2HGH A;  2EOX A;  2EPZ A;  1A1I A;  2EN7 A;  4R2P A;  1TF3 A;  2EN3 A;  1BB8 A;  3M99 B;  4IS1 C;  2EQ1 A;  2EOO A;  2A25 A;  4F6N A;  4R2E A;  2LO3 A;  2EL6 A;  2EM8 A;  2EPU A;  2WCC 3;  2YU5 A;  1ZR9 A;  2ELZ A;  2WBU A;  1KJK A;  2M9A A;  4R2S A;  4M9V C;  2ENA A;  4F2J C;  1A1F A;  1UN6 B;  2EQ0 A;  1G2F C;  2YTI A;  2YU8 A;  2D9H A;  2EOQ A;  1JK2 A;  1ZAA C;  2ADR A;  5KL5 A;  2EMI A;  2EOS A;  3MHH C;  2RSI A;  1A1J A;  2YTQ A;  2ELY A;  2EMH A;  2EMW A;  2EM5 A;  2CT1 A;  2EOM A;  1A1K A;  3EPH A;  2WBT A;  2EN2 A;  2EMB A;  4R2A A;  2EN8 A;  2GLI A;  2LCE A;  2EM3 A;  2EM0 A;  2ENH A;  2LVH A;  1P47 A;  2J7J A;  2EP3 A;  2EOE A;  2EMG A;  2YTG A;  2EPC A;  4FK5 C;  4X9J A;  1LLM C;  1F2I G;  2EOI A;  5KL4 A;  2EOJ A;  4R2Q A;  4R2R A;  5KL6 A;  2EN1 A;  2EM9 A;  2YTD A;  1ZU1 A;  2EM2 A;  2DLK A;  2EOZ A;  1X6E A;  2EM4 A;  2EPA A;  2CSH A;  1X3C A;  1A1G A;  1YSA C;  1BBO A;  4F6M A;  2YTP A;  2YRK A;  2LV2 A;  2JP9 A;  1YUJ A;  2EPR A;  1B69 A;  3EPK A;  2EMC A;  2BB8 A;  2R1F A;  2EPP A;  1YUI A;  1TF6 A;  4WSG A;  2YTF A;  4R2C A;  2EMA A;  2NAB A;  2EM7 A;  2EOY A;  3EPJ A;  1JK1 A;  2YRM A;  2EOR A;  2RPC A;  1RMD A;  2EMK A;  1NCS A;  2YTJ A;  2MKN A;  2EJ4 A;  2MDG A;  2EMZ A;  3MHS C;  2YRH A;  2DMI A;  4IJD A;  2WBS A;  1TN9 A;  2JPA A;  2YTO A;  2EE8 A;  2EL4 A;  1A1H A;  2YTN A;  1Z1B A;  2PRT A;  1A1L A;  1MEY C; 
#chains in the Genus database with same CATH topology
 5KL3 A;  4DV0 E;  4LFC E;  2VRD A;  1IQO A;  2EPX A;  1X5W A;  2MC5 A;  1DGC A;  5A2Q C;  4R2D A;  3UK3 C;  2DRP A;  1UHZ A;  3BGH A;  4GZN C;  2I13 A;  4DR6 E;  2MKD A;  1EH6 A;  2YSP A;  2YTE A;  4L8N A;  4LTY A;  3EPL A;  3K6Q A;  5AC4 A;  5A6J A;  1GQE A;  2EOX A;  2R76 A;  2RTX A;  4NHR A;  1WRJ A;  2A25 A;  1N34 E;  5ADZ A;  2V85 A;  4R2E A;  4JI5 E;  4O4K A;  2WCC 3;  2ELZ A;  1N36 E;  4BCA A;  2JWO A;  4YHH E;  2M4I A;  1A1F A;  3HPZ A;  2EOQ A;  2EOS A;  1A1J A;  1IBL E;  2L2N A;  1IBM E;  4BS9 A;  4DKK A;  4DUZ E;  2EN2 A;  4WXC A;  2LCE A;  2G7H A;  4J8Z A;  2LVH A;  2EOE A;  2EMG A;  2YTG A;  1AH5 A;  2LRS A;  4GKK E;  4DV4 E;  1GZ6 A;  2MC6 A;  2ODR D;  2CSH A;  1X3C A;  1A1G A;  1PJS A;  1YSA C;  4WYQ B;  4ZYG A;  2YTP A;  1X48 A;  1FJG E;  1SFE A;  2M1S A;  2JP9 A;  2VF1 A;  3EPK A;  3IWB A;  5AE3 A;  5T6J A;  3BID A;  4DR7 E;  1PJT A;  2HJJ A;  2L33 A;  2NUG A;  2EM7 A;  2EOY A;  1YYK A;  1X47 A;  3P1X A;  3THN A;  2MDR A;  2EMK A;  4BHB A;  3VK6 A;  4F9C B;  2DIX A;  2UXD E;  4R03 A;  1HR0 E;  2EL4 A;  2DSY A;  2L2K B;  2YZT A;  1MEY C;  1N32 E;  1YPN A;  5IT9 C;  3L00 A;  2JR1 A;  2YPN A;  4NXN E;  2F8B A;  4BC9 A;  1EH7 A;  2LT7 A;  3RMP A;  4ZYD A;  2B7T A;  2V88 A;  2H36 X;  2EPM X;  2EN6 A;  2K7I A;  2EL5 A;  2Q8U A;  1WJP A;  1YYW A;  1YZ9 A;  5A6A A;  2LBS B;  2UUA E;  1HNW E;  5LL6 R;  5KL2 A;  4B3M E;  2EPZ A;  4KWY A;  2UUB E;  1GTK A;  4R2P A;  3THO B;  4JI4 E;  2K4V A;  4DR3 E;  3IWD A;  4HEI A;  2EM8 A;  4KZS A;  2EPU A;  2HHH E;  4TUG A;  1KJK A;  5DNY A;  4JI3 E;  2FTX B;  2DMY A;  2KHX A;  5F3W A;  4M9V C;  2YTI A;  2YU8 A;  4BMJ A;  2D9H A;  1JK2 A;  2UXB E;  1T4O A;  5KL5 A;  2EMI A;  3MHH C;  2RSI A;  2YTQ A;  3DJW A;  5A69 A;  1UIL A;  4M30 A;  4GKJ E;  2CT1 A;  3AUZ A;  2EOM A;  3KZZ A;  1A1K A;  5IXM B;  2WBT A;  2EMB A;  3BBG A;  4R2A A;  2L2M A;  2GLI A;  4B3S E;  4MLV A;  3J80 C;  2L3C A;  4JV5 E;  4X9J A;  4FK5 C;  4BBY A;  1F2I G;  1N3G A;  2EOJ A;  2LUQ A;  3C6K A;  2NUE A;  2EM9 A;  4DV3 E;  4LF6 E;  4B3T E;  2DLK A;  4X66 E;  4X64 E;  4JI6 E;  1BBO A;  1KYQ A;  4F6M A;  1HNX E;  2LTS A;  2UUC E;  1YUJ A;  2EPR A;  1B69 A;  2UU9 E;  3ZOQ B;  2EPP A;  2RSM A;  2B3T B;  3C4B A;  4AQY E;  1TF6 A;  4LF5 E;  1O0W A;  2YTF A;  4KHP E;  4NXM E;  2EMA A;  2JYA A;  4BHC A;  2NUF A;  5AE1 A;  2KON A;  4HTG A;  3C4T A;  3H09 A;  1RMD A;  2V87 A;  1NCS A;  3KWR A;  2MKN A;  2N8X A;  2MDG A;  2WBS A;  3MHS C;  1TN9 A;  2DMI A;  4IJD A;  2N3H A;  4LFB E;  2YTO A;  1A1H A;  1MGT A;  1Z1B A;  4RHB B;  3C6M A;  2CPN A;  1IBK E;  1T38 A;  4X65 E;  2V8Q B;  5AC5 A;  4DV5 E;  3QG5 C;  1STU A;  2EN4 A;  3HQ1 A;  2ENC A;  2VE7 C;  1X6F A;  5KL7 A;  4ZYH A;  3LLH A;  4WXD A;  1G2D C;  2EOH A;  1WHQ A;  2DLQ A;  4WSP A;  3BF2 A;  1J26 A;  2JOX A;  1PJQ A;  2YSO A;  2CTD A;  2HGH A;  1RQ0 A;  3FIG A;  2LJU A;  1A1I A;  2EN7 A;  2EPL X;  3JAM C;  4WFT A;  3EQ1 A;  3JU0 A;  1BB8 A;  2EQ1 A;  1L4S A;  4JI7 E;  1SR9 A;  2JVA A;  4JI0 E;  3TQM A;  4F6N A;  3VYX A;  4YY3 E;  2WZO A;  2LO3 A;  4LFA E;  1ZR9 A;  2WBU A;  4DR5 E;  4R2S A;  1X49 A;  2ODR C;  2ENA A;  3F6H A;  4I8O A;  4O24 A;  4K0K E;  2FV4 B;  1ZAA C;  4DV1 E;  2NA2 A;  2IHR 1;  3F6G A;  5LMU E;  5A6B D;  1WXR A;  2JOB A;  5A6K A;  3DF6 A;  5LMN E;  2L3J A;  2JY9 A;  4F9A B;  2LE2 A;  2B7V A;  5IV8 B;  2ENH A;  2EM0 A;  4O43 A;  2FGG A;  1P47 A;  4RH8 A;  2J7J A;  4GEQ B;  2EP3 A;  2YWQ A;  4P78 A;  2E1M A;  3ADJ A;  2EPK X;  5KL4 A;  3KZY A;  4R2Q A;  2YTD A;  4Q28 A;  2EOZ A;  5BR8 E;  1X6E A;  3HXL A;  1IMU A;  3IWC A;  2LV2 A;  2LUP B;  5LLQ A;  1J5E E;  4LF7 E;  2F4V E;  4DUY E;  4Q35 B;  2L6M A;  2EMC A;  2BB8 A;  1XNR E;  1HNZ E;  2M7Q A;  4F9B B;  2BBG A;  2LTR A;  4L5N C;  4M2Z A;  4MLQ A;  3EPJ A;  1JK1 A;  4JI8 E;  2EOR A;  1FKA E;  4JI1 E;  2RPC A;  2RS7 A;  1QU6 A;  1XNQ E;  2EMZ A;  2EZ6 A;  2L92 A;  2V86 A;  5CFF E;  1WHN A;  4DR4 E;  1A1L A;  3J7A G;  3HTX A;  3VHT B;  2B9D A;  3T1H E;  2EM6 A;  2E72 A;  2EMF A;  1BBG A;  2EPN A;  4OOG C;  2EMX A;  4BC7 A;  2HC5 A;  2GHF A;  2RS6 A;  1YFH A;  3HPS A;  3J7Y p;  1X6H A;  5A6B A;  2N3G A;  1AAY A;  1UBD C;  1DI2 A;  1T4N A;  2EOF A;  2EQ3 A;  2EMY A;  2I9I A;  2DGC A;  2EML A;  3ECR A;  1ZBT A;  1PDA A;  2DB2 A;  2EWL A;  2EN3 A;  1TF3 A;  3M99 B;  3VYY A;  4IS1 C;  2EOO A;  2YT4 A;  2E5L E;  4TUI A;  4X62 E;  5AAS A;  3ADI A;  2KOU A;  2V89 A;  2EL6 A;  2YU5 A;  5FLX C;  3LML A;  1XMQ E;  2RQL A;  3OML A;  2M9A A;  4DMI A;  4F2J C;  1UN6 B;  2LJH A;  4OX9 E;  2EQ0 A;  1G2F C;  3ADL A;  2L8T A;  2GPI A;  3MSW A;  2ADR A;  1YYO A;  2ELY A;  4DR2 E;  2EMH A;  4P7D A;  2EMW A;  2EM5 A;  4DV2 E;  3EPH A;  4DV7 E;  1IQS A;  5TSE A;  2VQF E;  2V83 A;  1I94 E;  5IWA E;  2EN8 A;  3JTZ A;  1PKP A;  2JXP A;  4F54 A;  2EM3 A;  3OTO E;  1RC7 A;  3AV0 A;  4JYA E;  4LF4 E;  4N4R B;  2EPC A;  1LLM C;  4X8W A;  2EOI A;  4R2R A;  5KL6 A;  2EN1 A;  1N33 E;  1ZU1 A;  1ZBQ A;  4WX9 A;  2EM2 A;  3T1Y E;  1DQ3 A;  2LMZ A;  2EM4 A;  1QNT A;  4R8O A;  2EPA A;  2YRK A;  1T4L B;  4DR1 E;  4LU9 A;  4DV6 E;  4LF9 E;  4WPY A;  2R1F A;  2VQE E;  2UXC E;  4NZV A;  1NEI A;  1YUI A;  4WSG A;  2EPO A;  1EH8 A;  4R2C A;  2NAB A;  1T39 A;  2YRM A;  2ZM6 E;  4LF8 E;  1XMO E;  2YTJ A;  2EJ4 A;  4B3R E;  2JPA A;  2YRH A;  4ZYE A;  4M0V A;  4JI2 E;  3J81 C;  2EE8 A;  2YTN A;  2PRT A;  3ADG A;  1EKZ A;  4O5G A;  5AE2 A; 
#chains in the Genus database with same CATH homology
 5KL3 A;  3VHT B;  2VRD A;  2EPX A;  2EM6 A;  1X5W A;  2E72 A;  2EMF A;  2EN4 A;  1DGC A;  2LT7 A;  2ENC A;  2EMX A;  4R2D A;  3UK3 C;  1X6F A;  2GHF A;  5KL7 A;  2DRP A;  4GZN C;  2EN6 A;  2I13 A;  2EL5 A;  2MKD A;  1WJP A;  1G2D C;  1X6H A;  2EOH A;  2DLQ A;  2YSP A;  2YTE A;  1AAY A;  1UBD C;  2YSO A;  3EPL A;  2EOF A;  2EQ3 A;  2EMY A;  5KL2 A;  2DGC A;  2CTD A;  2EML A;  2HGH A;  2EOX A;  2EPZ A;  1A1I A;  2EN7 A;  4R2P A;  1TF3 A;  2EN3 A;  1BB8 A;  3M99 B;  4IS1 C;  2EQ1 A;  2EOO A;  2A25 A;  4F6N A;  4R2E A;  2LO3 A;  2EL6 A;  2EM8 A;  2EPU A;  2WCC 3;  2YU5 A;  1ZR9 A;  2ELZ A;  2WBU A;  1KJK A;  2M9A A;  4R2S A;  4M9V C;  2ENA A;  4F2J C;  1A1F A;  1UN6 B;  2EQ0 A;  1G2F C;  2YTI A;  2YU8 A;  2D9H A;  2EOQ A;  1JK2 A;  1ZAA C;  2ADR A;  5KL5 A;  2EMI A;  2EOS A;  3MHH C;  2RSI A;  1A1J A;  2YTQ A;  2ELY A;  2EMH A;  2EMW A;  2EM5 A;  2CT1 A;  2EOM A;  1A1K A;  3EPH A;  2WBT A;  2EN2 A;  2EMB A;  4R2A A;  2EN8 A;  2GLI A;  2LCE A;  2EM3 A;  2EM0 A;  2ENH A;  2LVH A;  1P47 A;  2J7J A;  2EP3 A;  2EOE A;  2EMG A;  2YTG A;  2EPC A;  4FK5 C;  4X9J A;  1LLM C;  1F2I G;  2EOI A;  5KL4 A;  2EOJ A;  4R2Q A;  4R2R A;  5KL6 A;  2EN1 A;  2EM9 A;  2YTD A;  1ZU1 A;  2EM2 A;  2DLK A;  2EOZ A;  1X6E A;  2EM4 A;  2EPA A;  2CSH A;  1X3C A;  1A1G A;  1YSA C;  1BBO A;  4F6M A;  2YTP A;  2YRK A;  2LV2 A;  2JP9 A;  1YUJ A;  2EPR A;  1B69 A;  3EPK A;  2EMC A;  2BB8 A;  2R1F A;  2EPP A;  1YUI A;  1TF6 A;  4WSG A;  2YTF A;  4R2C A;  2EMA A;  2NAB A;  2EM7 A;  2EOY A;  3EPJ A;  1JK1 A;  2YRM A;  2EOR A;  2RPC A;  1RMD A;  2EMK A;  1NCS A;  2YTJ A;  2MKN A;  2EJ4 A;  2MDG A;  2EMZ A;  3MHS C;  2YRH A;  2DMI A;  4IJD A;  2WBS A;  1TN9 A;  2JPA A;  2YTO A;  2EE8 A;  2EL4 A;  1A1H A;  2YTN A;  1Z1B A;  2PRT A;  1A1L A;  1MEY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...