2EOIA

Solution structure of the c2h2 type zinc finger (region 329-359) of human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
GSSGSSGEKLHECSECRKTFSFHSQLVIHQRIHTGENPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 268
publication title Solution structure of the C2H2 type zinc finger (region 329-359) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoiA01
2EMXA 2WBTA 2MDGA 2EL6A 2LT7A 2BB8A 1X5WA 2EN6A 2EPXA 3EPKA 3EPJA 4IJDA 2YTOA 2EOQA 2EMBA 2WBSA 2EM4A 4FK5C 4GZNC 2A25A 2YSOA 2R1FA 2EMHA 2YTQA 1AAYA 2RSIA 2EM3A 1JK1A 1YUJA 3UK3C 1A1GA 1MEYC 2ENCA 1JK2A 2EOIA 2YTIA 2EM7A 2NABA 2DRPA 2YTFA 2DLQA 2EOFA 2EOJA 1A1KA 2GLIA 1F2IG 3VHTB 2YTNA 2I13A 4R2SA 3M99B 2EN4A 2EM2A 2D9HA 2LVHA 4F6NA 1G2DC 4X9JA 2EMFA 2LO3A 2EN8A 2EPUA 2EMAA 2EMZA 2YSPA 1YUIA 2DMIA 1LLMC 2EPAA 2EN1A 4F6MA 2WBUA 1Z1BA 1KJKA 2EE8A 5KL2A 2JP9A 2EPZA 4R2DA 1X6EA 2EM8A 2EN2A 2DLKA 2EOOA 2YRHA 1TF6A 2EOSA 2EPPA 3EPHA 4R2PA 2EP3A 2JPAA 2CTDA 2EOXA 3MHSC 4F2JC 2EQ1A 2YRKA 2YTPA 2YU5A 2EL4A 2DGCA 2CSHA 1WJPA 1X6FA 1ZU1A 1A1FA 1P47A 2ENHA 2ENAA 2EMWA 2EM0A 2EPCA 1RMDA 1B69A 4WSGA 2YTGA 2M9AA 2MKNA 2EN7A 5KL4A 2ELYA 1BBOA 1NCSA 2E72A 2MKDA 2YRMA 1UBDC 1DGCA 1ZAAC 2HGHA 4R2QA 2LCEA 2EOEA 1TN9A 1YSAC 1A1LA 2WCC3 2VRDA 2EL5A 2YTEA 4R2RA 1A1JA 2EN3A 1G2FC 4M9VC 2EM9A 1X6HA 2EMGA 2YTDA 2EOZA 4R2AA 2RPCA 5KL5A 5KL3A 4R2EA 1A1IA 2YTJA 2EOYA 2EM5A 2EMLA 2EPRA 1BB8A 3EPLA 4R2CA 4IS1C 2PRTA 2EMCA 2EORA 5KL6A 1A1HA 2CT1A 2GHFA 2ELZA 2EMKA 2EJ4A 2EOHA 2J7JA 2EM6A 1X3CA 2YU8A 2EOMA 2EQ0A 3MHHC 5KL7A 1ZR9A 2EQ3A 2ADRA 2EMIA 1TF3A 1UN6B 2LV2A 2EMYA
chains in the Genus database with same CATH superfamily
2V89A 2M7QA 1I94E 2L33A 2EL6A 2LT7A 1T39A 4L5NC 1PDAA 2NUGA 2F8BA 3BF2A 2EOQA 2YSOA 2R1FA 4K0KE 4DV7E 1MGTA 2UU9E 1FKAE 1WHQA 4M30A 2LUPB 3JTZA 4ZYHA 4GEQB 1FJGE 5LMNE 1A1KA 1F2IG 3RMPA 1SFEA 4R2SA 2EN4A 4F6NA 4DV1E 2EN8A 2EPUA 2EMAA 2EMZA 2YSPA 1IBKE 1EH7A 4WXCA 1LLMC 1YPNA 4DV4E 2CPNA 2JYAA 4JI1E 3ADIA 1HNXE 1ZBTA 4JI4E 3VYYA 2WBUA 4JI0E 2EE8A 2JP9A 4DR3E 3EQ1A 1TF6A 2UXCE 4DR5E 5LLQA 2EPPA 2KONA 4LF4E 4F54A 3C4TA 2EPOA 3THNA 4BHCA 4JV5E 1GQEA 2YRKA 2FTXB 2L92A 1AH5A 2EL4A 4F9CB 2KOUA 2JWOA 1ZU1A 3L00A 5KL4A 3C4BA 4I8OA 2RSMA 1HNWE 4BMJA 2YRMA 4O24A 1ZAAC 1DQ3A 2B9DA 4DR6E 1PJQA 2EN3A 4DV5E 4R2EA 2F4VE 2YTJA 1XNQE 4TUIA 2EMLA 3BGHA 1BB8A 3VK6A 2EORA 5AE2A 3J7AG 4WSPA 2EPMX 4LF9E 1A1HA 2GHFA 1HNZE 4BHBA 2EM6A 2EQ0A 1PKPA 5KL7A 4Q28A 4DR7E 1IQOA 3J80C 1TF3A 1WRJA 2L3JA 3F6HA 1T4NA 4DUYE 2VQFE 2EPNA 4WXDA 2BB8A 4MLQA 4X64E 2RQLA 4NZVA 2EN6A 2EPXA 2LJUA 3TQMA 4IJDA 3EPKA 2YTOA 1L4SA 4JI5E 2EMBA 2G7HA 4LFBE 2A25A 2YWQA 2YTQA 5DNYA 2RSIA 3HPZA 3OTOE 2H36X 2M1SA 1JK1A 1A1GA 5AC4A 1MEYC 4NHRA 3AV0A 2EOIA 3KZYA 2EM7A 2DRPA 1ZBQA 5CFFE 3JAMC 3ZOQB 2GLIA 1N3GA 3VHTB 1T4LB 2R76A 3M99B 4HTGA 2LVHA 4JI7E 4HEIA 3OMLA 4X66E 2EMFA 4X9JA 2M4IA 2LO3A 4JI8E 4O4KA 1YUIA 2EPAA 3ADGA 2FGGA 2NA2A 2L3CA 3H09A 1KJKA 1YYKA 2EPZA 3VYXA 2I9IA 1X6EA 2EOOA 5LL6R 2FV4B 4DV2E 2EOSA 5A69A 4KHPE 3EPHA 2EOXA 2LRSA 1IMUA 3MHSC 4BC9A 1J26A 2V88A 5A6KA 2YU5A 1T38A 2DGCA 4J8ZA 5TSEA 1IQSA 4NXME 1A1FA 4WFTA 3AUZA 2EMWA 2EM0A 3J7Yp 1RMDA 2DMYA 2M9AA 2ODRC 2N3GA 2MKNA 5AC5A 1X49A 1XNRE 1BBOA 4N4RB 4MLVA 3THOB 4JI6E 1HR0E 1UBDC 2IHR1 1DGCA 2HGHA 2KHXA 2LCEA 1XMOE 1TN9A 1DI2A 2WCC3 2YTEA 1G2FC 1A1JA 2DIXA 2EM9A 1X6HA 2EMGA 2L8TA 1X48A 4GKJE 5IV8B 5KL3A 1RC7A 4X8WA 1A1IA 1GZ6A 2LMZA 4DUZE 2UUAE 4IS1C 4DR4E 2EMCA 4DKKA 2NUEA 2VF1A 4JI2E 2EOHA 2EJ4A 4F9BB 1X3CA 3MHHC 4Q35B 5A2QC 2VE7C 3IWCA 4ZYGA 5A6JA 2UUCE 2EZ6A 2UXBE 1X5WA 3FIGA 3K6QA 4L8NA 2V86A 4KZSA 2WBSA 2EM4A 4B3SE 4LF7E 2EMHA 2MC6A 4WPYA 1AAYA 3DJWA 1YUJA 3UK3C 5A6BD 2UXDE 4BC7A 2L2MA 2LUQA 2ENCA 2EPKX 1JK2A 2YTIA 1STUA 1SR9A 2NABA 2EOJA 4X62E 2JY9A 2I13A 2D9HA 1G2DC 4DV3E 4LF5E 5LMUE 2DMIA 2B7TA 3DF6A 3QG5C 1X47A 2EN1A 3IWDA 3BIDA 4F6MA 1Z1BA 3ADLA 2JOXA 1YFHA 4LF8E 4LFCE 4YHHE 2YPNA 4BCAA 4R2PA 2EP3A 2CTDA 2V83A 3ECRA 2HJJA 4BBYA 3KWRA 2YTPA 3F6GA 2K4VA 3T1HE 2JXPA 2LTRA 5IT9C 2MDRA 2VQEE 2B3TB 1P47A 2ENHA 2JOBA 2HC5A 2K7IA 2EPCA 4R8OA 1B69A 2YTGA 4NXNE 5IXMB 3ADJA 4DR1E 1IBLE 3J81C 1GTKA 2ELYA 2RTXA 4O43A 2E72A 2RS6A 5IWAE 4R2QA 5AASA 2EOEA 4X65E 2E5LE 2L6MA 2VRDA 2EL5A 4LFAE 4DV0E 4M9VC 4R2AA 2YTDA 4DMIA 5A6AA 4GKKE 2DB2A 3BBGA 1UILA 2EOYA 2EM5A 1PJTA 3EPLA 4R2CA 4F9AB 5KL6A 3LMLA 5F3WA 3IWBA 2CT1A 2ELZA 2YU8A 4BS9A 4ZYDA 2EOMA 1ZR9A 2EQ3A 2ADRA 2EPLX 5FLXC 2LBSB 2EWLA 5AE1A 1UN6B 2EMYA 4ZYEA 4WX9A 2RS7A 1QU6A 2EMXA 2WBTA 1RQ0A 4JYAE 2MDGA 2MC5A 4LU9A 4M0VA 3EPJA 4P78A 4M2ZA 4FK5C 4GZNC 1XMQE 4OX9E 1NEIA 2WZOA 2EM3A 5A6BA 3T1YE 4JI3E 1EH6A 4DV6E 1J5EE 2YTFA 2DLQA 2LJHA 5ADZA 2EOFA 4O5GA 2YTNA 2NUFA 2EM2A 4LTYA 1T4OA 3P1XA 2ODRD 2N8XA 4LF6E 4R03A 2YT4A 1N34E 3JU0A 3HQ1A 2Q8UA 2LE2A 2LTSA 5KL2A 4B3TE 4R2DA 4RHBB 2EM8A 2V8QB 2EN2A 2DLKA 2YRHA 1WXRA 1PJSA 2JR1A 1WHNA 4B3ME 2B7VA 4TUGA 3HTXA 1YYOA 2JPAA 3LLHA 3C6MA 4F2JC 2EQ1A 2HHHE 2DSYA 2CSHA 1WJPA 5T6JA 1KYQA 1X6FA 4AQYE 1YZ9A 1EH8A 2ENAA 3MSWA 5AE3A 1N36E 4YY3E 4WSGA 1UHZA 2EN7A 2YZTA 2L2NA 1QNTA 1O0WA 1NCSA 2V87A 1YYWA 2MKDA 1EKZA 3HXLA 3KZZA 1YSAC 1A1LA 2E1MA 3HPSA 2BBGA 4R2RA 2JVAA 2N3HA 4DR2E 2EOZA 2RPCA 5KL5A 2ZM6E 2GPIA 5BR8E 1BBGA 4B3RE 2EPRA 4OOGC 4WYQB 2UUBE 2PRTA 4P7DA 2J7JA 1IBME 2EMKA 4RH8A 1N32E 1N33E 2V85A 4KWYA 3C6KA 2EMIA 2L2KB 2LV2A
chains in the Genus database with same CATH topology
2EMXA 2WBTA 2MDGA 2EL6A 2LT7A 2BB8A 1X5WA 2EN6A 2EPXA 3EPKA 3EPJA 4IJDA 2YTOA 2EOQA 2EMBA 2WBSA 2EM4A 4FK5C 4GZNC 2A25A 2YSOA 2R1FA 2EMHA 2YTQA 1AAYA 2RSIA 2EM3A 1JK1A 1YUJA 3UK3C 1A1GA 1MEYC 2ENCA 1JK2A 2EOIA 2YTIA 2EM7A 2NABA 2DRPA 2YTFA 2DLQA 2EOFA 2EOJA 1A1KA 2GLIA 1F2IG 3VHTB 2YTNA 2I13A 4R2SA 3M99B 2EN4A 2EM2A 2D9HA 2LVHA 4F6NA 1G2DC 4X9JA 2EMFA 2LO3A 2EN8A 2EPUA 2EMAA 2EMZA 2YSPA 1YUIA 2DMIA 1LLMC 2EPAA 2EN1A 4F6MA 2WBUA 1Z1BA 1KJKA 2EE8A 5KL2A 2JP9A 2EPZA 4R2DA 1X6EA 2EM8A 2EN2A 2DLKA 2EOOA 2YRHA 1TF6A 2EOSA 2EPPA 3EPHA 4R2PA 2EP3A 2JPAA 2CTDA 2EOXA 3MHSC 4F2JC 2EQ1A 2YRKA 2YTPA 2YU5A 2EL4A 2DGCA 2CSHA 1WJPA 1X6FA 1ZU1A 1A1FA 1P47A 2ENHA 2ENAA 2EMWA 2EM0A 2EPCA 1RMDA 1B69A 4WSGA 2YTGA 2M9AA 2MKNA 2EN7A 5KL4A 2ELYA 1BBOA 1NCSA 2E72A 2MKDA 2YRMA 1UBDC 1DGCA 1ZAAC 2HGHA 4R2QA 2LCEA 2EOEA 1TN9A 1YSAC 1A1LA 2WCC3 2VRDA 2EL5A 2YTEA 4R2RA 1A1JA 2EN3A 1G2FC 4M9VC 2EM9A 1X6HA 2EMGA 2YTDA 2EOZA 4R2AA 2RPCA 5KL5A 5KL3A 4R2EA 1A1IA 2YTJA 2EOYA 2EM5A 2EMLA 2EPRA 1BB8A 3EPLA 4R2CA 4IS1C 2PRTA 2EMCA 2EORA 5KL6A 1A1HA 2CT1A 2GHFA 2ELZA 2EMKA 2EJ4A 2EOHA 2J7JA 2EM6A 1X3CA 2YU8A 2EOMA 2EQ0A 3MHHC 5KL7A 1ZR9A 2EQ3A 2ADRA 2EMIA 1TF3A 1UN6B 2LV2A 2EMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMX A;  2WBT A;  2MDG A;  2EL6 A;  2LT7 A;  2BB8 A;  1X5W A;  2EN6 A;  2EPX A;  3EPK A;  3EPJ A;  4IJD A;  2YTO A;  2EOQ A;  2EMB A;  2WBS A;  2EM4 A;  4FK5 C;  4GZN C;  2A25 A;  2YSO A;  2R1F A;  2EMH A;  2YTQ A;  1AAY A;  2RSI A;  2EM3 A;  1JK1 A;  1YUJ A;  3UK3 C;  1A1G A;  1MEY C;  2ENC A;  1JK2 A;  2EOI A;  2YTI A;  2EM7 A;  2NAB A;  2DRP A;  2YTF A;  2DLQ A;  2EOF A;  2EOJ A;  1A1K A;  2GLI A;  1F2I G;  3VHT B;  2YTN A;  2I13 A;  4R2S A;  3M99 B;  2EN4 A;  2EM2 A;  2D9H A;  2LVH A;  4F6N A;  1G2D C;  4X9J A;  2EMF A;  2LO3 A;  2EN8 A;  2EPU A;  2EMA A;  2EMZ A;  2YSP A;  1YUI A;  2DMI A;  1LLM C;  2EPA A;  2EN1 A;  4F6M A;  2WBU A;  1Z1B A;  1KJK A;  2EE8 A;  5KL2 A;  2JP9 A;  2EPZ A;  4R2D A;  1X6E A;  2EM8 A;  2EN2 A;  2DLK A;  2EOO A;  2YRH A;  1TF6 A;  2EOS A;  2EPP A;  3EPH A;  4R2P A;  2EP3 A;  2JPA A;  2CTD A;  2EOX A;  3MHS C;  4F2J C;  2EQ1 A;  2YRK A;  2YTP A;  2YU5 A;  2EL4 A;  2DGC A;  2CSH A;  1WJP A;  1X6F A;  1ZU1 A;  1A1F A;  1P47 A;  2ENH A;  2ENA A;  2EMW A;  2EM0 A;  2EPC A;  1RMD A;  1B69 A;  4WSG A;  2YTG A;  2M9A A;  2MKN A;  2EN7 A;  5KL4 A;  2ELY A;  1BBO A;  1NCS A;  2E72 A;  2MKD A;  2YRM A;  1UBD C;  1DGC A;  1ZAA C;  2HGH A;  4R2Q A;  2LCE A;  2EOE A;  1TN9 A;  1YSA C;  1A1L A;  2WCC 3;  2VRD A;  2EL5 A;  2YTE A;  4R2R A;  1A1J A;  2EN3 A;  1G2F C;  4M9V C;  2EM9 A;  1X6H A;  2EMG A;  2YTD A;  2EOZ A;  4R2A A;  2RPC A;  5KL5 A;  5KL3 A;  4R2E A;  1A1I A;  2YTJ A;  2EOY A;  2EM5 A;  2EML A;  2EPR A;  1BB8 A;  3EPL A;  4R2C A;  4IS1 C;  2PRT A;  2EMC A;  2EOR A;  5KL6 A;  1A1H A;  2CT1 A;  2GHF A;  2ELZ A;  2EMK A;  2EJ4 A;  2EOH A;  2J7J A;  2EM6 A;  1X3C A;  2YU8 A;  2EOM A;  2EQ0 A;  3MHH C;  5KL7 A;  1ZR9 A;  2EQ3 A;  2ADR A;  2EMI A;  1TF3 A;  1UN6 B;  2LV2 A;  2EMY A; 
#chains in the Genus database with same CATH topology
 2V89 A;  2M7Q A;  1I94 E;  2L33 A;  2EL6 A;  2LT7 A;  1T39 A;  4L5N C;  1PDA A;  2NUG A;  2F8B A;  3BF2 A;  2EOQ A;  2YSO A;  2R1F A;  4K0K E;  4DV7 E;  1MGT A;  2UU9 E;  1FKA E;  1WHQ A;  4M30 A;  2LUP B;  3JTZ A;  4ZYH A;  4GEQ B;  1FJG E;  5LMN E;  1A1K A;  1F2I G;  3RMP A;  1SFE A;  4R2S A;  2EN4 A;  4F6N A;  4DV1 E;  2EN8 A;  2EPU A;  2EMA A;  2EMZ A;  2YSP A;  1IBK E;  1EH7 A;  4WXC A;  1LLM C;  1YPN A;  4DV4 E;  2CPN A;  2JYA A;  4JI1 E;  3ADI A;  1HNX E;  1ZBT A;  4JI4 E;  3VYY A;  2WBU A;  4JI0 E;  2EE8 A;  2JP9 A;  4DR3 E;  3EQ1 A;  1TF6 A;  2UXC E;  4DR5 E;  5LLQ A;  2EPP A;  2KON A;  4LF4 E;  4F54 A;  3C4T A;  2EPO A;  3THN A;  4BHC A;  4JV5 E;  1GQE A;  2YRK A;  2FTX B;  2L92 A;  1AH5 A;  2EL4 A;  4F9C B;  2KOU A;  2JWO A;  1ZU1 A;  3L00 A;  5KL4 A;  3C4B A;  4I8O A;  2RSM A;  1HNW E;  4BMJ A;  2YRM A;  4O24 A;  1ZAA C;  1DQ3 A;  2B9D A;  4DR6 E;  1PJQ A;  2EN3 A;  4DV5 E;  4R2E A;  2F4V E;  2YTJ A;  1XNQ E;  4TUI A;  2EML A;  3BGH A;  1BB8 A;  3VK6 A;  2EOR A;  5AE2 A;  3J7A G;  4WSP A;  2EPM X;  4LF9 E;  1A1H A;  2GHF A;  1HNZ E;  4BHB A;  2EM6 A;  2EQ0 A;  1PKP A;  5KL7 A;  4Q28 A;  4DR7 E;  1IQO A;  3J80 C;  1TF3 A;  1WRJ A;  2L3J A;  3F6H A;  1T4N A;  4DUY E;  2VQF E;  2EPN A;  4WXD A;  2BB8 A;  4MLQ A;  4X64 E;  2RQL A;  4NZV A;  2EN6 A;  2EPX A;  2LJU A;  3TQM A;  4IJD A;  3EPK A;  2YTO A;  1L4S A;  4JI5 E;  2EMB A;  2G7H A;  4LFB E;  2A25 A;  2YWQ A;  2YTQ A;  5DNY A;  2RSI A;  3HPZ A;  3OTO E;  2H36 X;  2M1S A;  1JK1 A;  1A1G A;  5AC4 A;  1MEY C;  4NHR A;  3AV0 A;  2EOI A;  3KZY A;  2EM7 A;  2DRP A;  1ZBQ A;  5CFF E;  3JAM C;  3ZOQ B;  2GLI A;  1N3G A;  3VHT B;  1T4L B;  2R76 A;  3M99 B;  4HTG A;  2LVH A;  4JI7 E;  4HEI A;  3OML A;  4X66 E;  2EMF A;  4X9J A;  2M4I A;  2LO3 A;  4JI8 E;  4O4K A;  1YUI A;  2EPA A;  3ADG A;  2FGG A;  2NA2 A;  2L3C A;  3H09 A;  1KJK A;  1YYK A;  2EPZ A;  3VYX A;  2I9I A;  1X6E A;  2EOO A;  5LL6 R;  2FV4 B;  4DV2 E;  2EOS A;  5A69 A;  4KHP E;  3EPH A;  2EOX A;  2LRS A;  1IMU A;  3MHS C;  4BC9 A;  1J26 A;  2V88 A;  5A6K A;  2YU5 A;  1T38 A;  2DGC A;  4J8Z A;  5TSE A;  1IQS A;  4NXM E;  1A1F A;  4WFT A;  3AUZ A;  2EMW A;  2EM0 A;  3J7Y p;  1RMD A;  2DMY A;  2M9A A;  2ODR C;  2N3G A;  2MKN A;  5AC5 A;  1X49 A;  1XNR E;  1BBO A;  4N4R B;  4MLV A;  3THO B;  4JI6 E;  1HR0 E;  1UBD C;  2IHR 1;  1DGC A;  2HGH A;  2KHX A;  2LCE A;  1XMO E;  1TN9 A;  1DI2 A;  2WCC 3;  2YTE A;  1G2F C;  1A1J A;  2DIX A;  2EM9 A;  1X6H A;  2EMG A;  2L8T A;  1X48 A;  4GKJ E;  5IV8 B;  5KL3 A;  1RC7 A;  4X8W A;  1A1I A;  1GZ6 A;  2LMZ A;  4DUZ E;  2UUA E;  4IS1 C;  4DR4 E;  2EMC A;  4DKK A;  2NUE A;  2VF1 A;  4JI2 E;  2EOH A;  2EJ4 A;  4F9B B;  1X3C A;  3MHH C;  4Q35 B;  5A2Q C;  2VE7 C;  3IWC A;  4ZYG A;  5A6J A;  2UUC E;  2EZ6 A;  2UXB E;  1X5W A;  3FIG A;  3K6Q A;  4L8N A;  2V86 A;  4KZS A;  2WBS A;  2EM4 A;  4B3S E;  4LF7 E;  2EMH A;  2MC6 A;  4WPY A;  1AAY A;  3DJW A;  1YUJ A;  3UK3 C;  5A6B D;  2UXD E;  4BC7 A;  2L2M A;  2LUQ A;  2ENC A;  2EPK X;  1JK2 A;  2YTI A;  1STU A;  1SR9 A;  2NAB A;  2EOJ A;  4X62 E;  2JY9 A;  2I13 A;  2D9H A;  1G2D C;  4DV3 E;  4LF5 E;  5LMU E;  2DMI A;  2B7T A;  3DF6 A;  3QG5 C;  1X47 A;  2EN1 A;  3IWD A;  3BID A;  4F6M A;  1Z1B A;  3ADL A;  2JOX A;  1YFH A;  4LF8 E;  4LFC E;  4YHH E;  2YPN A;  4BCA A;  4R2P A;  2EP3 A;  2CTD A;  2V83 A;  3ECR A;  2HJJ A;  4BBY A;  3KWR A;  2YTP A;  3F6G A;  2K4V A;  3T1H E;  2JXP A;  2LTR A;  5IT9 C;  2MDR A;  2VQE E;  2B3T B;  1P47 A;  2ENH A;  2JOB A;  2HC5 A;  2K7I A;  2EPC A;  4R8O A;  1B69 A;  2YTG A;  4NXN E;  5IXM B;  3ADJ A;  4DR1 E;  1IBL E;  3J81 C;  1GTK A;  2ELY A;  2RTX A;  4O43 A;  2E72 A;  2RS6 A;  5IWA E;  4R2Q A;  5AAS A;  2EOE A;  4X65 E;  2E5L E;  2L6M A;  2VRD A;  2EL5 A;  4LFA E;  4DV0 E;  4M9V C;  4R2A A;  2YTD A;  4DMI A;  5A6A A;  4GKK E;  2DB2 A;  3BBG A;  1UIL A;  2EOY A;  2EM5 A;  1PJT A;  3EPL A;  4R2C A;  4F9A B;  5KL6 A;  3LML A;  5F3W A;  3IWB A;  2CT1 A;  2ELZ A;  2YU8 A;  4BS9 A;  4ZYD A;  2EOM A;  1ZR9 A;  2EQ3 A;  2ADR A;  2EPL X;  5FLX C;  2LBS B;  2EWL A;  5AE1 A;  1UN6 B;  2EMY A;  4ZYE A;  4WX9 A;  2RS7 A;  1QU6 A;  2EMX A;  2WBT A;  1RQ0 A;  4JYA E;  2MDG A;  2MC5 A;  4LU9 A;  4M0V A;  3EPJ A;  4P78 A;  4M2Z A;  4FK5 C;  4GZN C;  1XMQ E;  4OX9 E;  1NEI A;  2WZO A;  2EM3 A;  5A6B A;  3T1Y E;  4JI3 E;  1EH6 A;  4DV6 E;  1J5E E;  2YTF A;  2DLQ A;  2LJH A;  5ADZ A;  2EOF A;  4O5G A;  2YTN A;  2NUF A;  2EM2 A;  4LTY A;  1T4O A;  3P1X A;  2ODR D;  2N8X A;  4LF6 E;  4R03 A;  2YT4 A;  1N34 E;  3JU0 A;  3HQ1 A;  2Q8U A;  2LE2 A;  2LTS A;  5KL2 A;  4B3T E;  4R2D A;  4RHB B;  2EM8 A;  2V8Q B;  2EN2 A;  2DLK A;  2YRH A;  1WXR A;  1PJS A;  2JR1 A;  1WHN A;  4B3M E;  2B7V A;  4TUG A;  3HTX A;  1YYO A;  2JPA A;  3LLH A;  3C6M A;  4F2J C;  2EQ1 A;  2HHH E;  2DSY A;  2CSH A;  1WJP A;  5T6J A;  1KYQ A;  1X6F A;  4AQY E;  1YZ9 A;  1EH8 A;  2ENA A;  3MSW A;  5AE3 A;  1N36 E;  4YY3 E;  4WSG A;  1UHZ A;  2EN7 A;  2YZT A;  2L2N A;  1QNT A;  1O0W A;  1NCS A;  2V87 A;  1YYW A;  2MKD A;  1EKZ A;  3HXL A;  3KZZ A;  1YSA C;  1A1L A;  2E1M A;  3HPS A;  2BBG A;  4R2R A;  2JVA A;  2N3H A;  4DR2 E;  2EOZ A;  2RPC A;  5KL5 A;  2ZM6 E;  2GPI A;  5BR8 E;  1BBG A;  4B3R E;  2EPR A;  4OOG C;  4WYQ B;  2UUB E;  2PRT A;  4P7D A;  2J7J A;  1IBM E;  2EMK A;  4RH8 A;  1N32 E;  1N33 E;  2V85 A;  4KWY A;  3C6K A;  2EMI A;  2L2K B;  2LV2 A; 
#chains in the Genus database with same CATH homology
 2EMX A;  2WBT A;  2MDG A;  2EL6 A;  2LT7 A;  2BB8 A;  1X5W A;  2EN6 A;  2EPX A;  3EPK A;  3EPJ A;  4IJD A;  2YTO A;  2EOQ A;  2EMB A;  2WBS A;  2EM4 A;  4FK5 C;  4GZN C;  2A25 A;  2YSO A;  2R1F A;  2EMH A;  2YTQ A;  1AAY A;  2RSI A;  2EM3 A;  1JK1 A;  1YUJ A;  3UK3 C;  1A1G A;  1MEY C;  2ENC A;  1JK2 A;  2EOI A;  2YTI A;  2EM7 A;  2NAB A;  2DRP A;  2YTF A;  2DLQ A;  2EOF A;  2EOJ A;  1A1K A;  2GLI A;  1F2I G;  3VHT B;  2YTN A;  2I13 A;  4R2S A;  3M99 B;  2EN4 A;  2EM2 A;  2D9H A;  2LVH A;  4F6N A;  1G2D C;  4X9J A;  2EMF A;  2LO3 A;  2EN8 A;  2EPU A;  2EMA A;  2EMZ A;  2YSP A;  1YUI A;  2DMI A;  1LLM C;  2EPA A;  2EN1 A;  4F6M A;  2WBU A;  1Z1B A;  1KJK A;  2EE8 A;  5KL2 A;  2JP9 A;  2EPZ A;  4R2D A;  1X6E A;  2EM8 A;  2EN2 A;  2DLK A;  2EOO A;  2YRH A;  1TF6 A;  2EOS A;  2EPP A;  3EPH A;  4R2P A;  2EP3 A;  2JPA A;  2CTD A;  2EOX A;  3MHS C;  4F2J C;  2EQ1 A;  2YRK A;  2YTP A;  2YU5 A;  2EL4 A;  2DGC A;  2CSH A;  1WJP A;  1X6F A;  1ZU1 A;  1A1F A;  1P47 A;  2ENH A;  2ENA A;  2EMW A;  2EM0 A;  2EPC A;  1RMD A;  1B69 A;  4WSG A;  2YTG A;  2M9A A;  2MKN A;  2EN7 A;  5KL4 A;  2ELY A;  1BBO A;  1NCS A;  2E72 A;  2MKD A;  2YRM A;  1UBD C;  1DGC A;  1ZAA C;  2HGH A;  4R2Q A;  2LCE A;  2EOE A;  1TN9 A;  1YSA C;  1A1L A;  2WCC 3;  2VRD A;  2EL5 A;  2YTE A;  4R2R A;  1A1J A;  2EN3 A;  1G2F C;  4M9V C;  2EM9 A;  1X6H A;  2EMG A;  2YTD A;  2EOZ A;  4R2A A;  2RPC A;  5KL5 A;  5KL3 A;  4R2E A;  1A1I A;  2YTJ A;  2EOY A;  2EM5 A;  2EML A;  2EPR A;  1BB8 A;  3EPL A;  4R2C A;  4IS1 C;  2PRT A;  2EMC A;  2EOR A;  5KL6 A;  1A1H A;  2CT1 A;  2GHF A;  2ELZ A;  2EMK A;  2EJ4 A;  2EOH A;  2J7J A;  2EM6 A;  1X3C A;  2YU8 A;  2EOM A;  2EQ0 A;  3MHH C;  5KL7 A;  1ZR9 A;  2EQ3 A;  2ADR A;  2EMI A;  1TF3 A;  1UN6 B;  2LV2 A;  2EMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...