2EOIA

Solution structure of the c2h2 type zinc finger (region 329-359) of human zinc finger protein 268
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
GSSGSSGEKLHECSECRKTFSFHSQLVIHQRIHTGENPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C2H2 type zinc finger (region 329-359) of human Zinc finger protein 268
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 268
total genus 6
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2eoiA01
3EPJA 1ZAAC 2EN7A 4IJDA 2GLIA 3VHTB 1G2FC 4R2RA 2ENAA 1ZU1A 2EMYA 2EMAA 2EJ4A 2YTQA 3EPHA 2EOMA 2EOZA 3EPLA 2EMLA 2EN2A 2HGHA 2I13A 2EN8A 2CSHA 2EM7A 2VRDA 2MKDA 1UN6B 2EOEA 2YRHA 2YTFA 2PRTA 2DRPA 2NABA 1A1LA 2YTEA 1A1KA 1A1GA 1JK1A 4R2AA 2ENCA 2EMFA 2EM9A 4IS1C 2EM6A 1MEYC 2EPUA 2EOOA 4FK5C 2EMHA 2YTIA 2WCC3 4F2JC 2LO3A 4R2SA 4F6NA 3UK3C 2DGCA 2EMXA 1NCSA 2EMKA 1A1JA 2EPPA 1TF6A 2LCEA 2DLKA 2EMZA 1YSAC 2DLQA 1AAYA 1YUIA 1A1FA 1X6FA 2YSPA 2YRMA 1A1HA 2LT7A 1TF3A 2LVHA 2EN4A 2RPCA 2EORA 1F2IG 3M99B 2LV2A 1LLMC 1YUJA 4R2CA 2A25A 2BB8A 3MHHC 2D9HA 1WJPA 2YU5A 2YTGA 2YTNA 1X3CA 2EQ1A 2EN6A 2EOHA 1TN9A 1DGCA 4X9JA 4R2QA 2EMBA 2YTJA 2ELZA 2EMWA 2EPZA 2EOIA 2WBSA 1G2DC 2EL5A 2EOQA 2YU8A 4GZNC 5KL2A 2EN3A 4WSGA 2YTDA 2E72A 2EMGA 2MKNA 2EMIA 2ADRA 2JPAA 2EPCA 5KL7A 3MHSC 2YTPA 5KL5A 2EP3A 2WBUA 1B69A 1P47A 1RMDA 1ZR9A 2EM3A 2YSOA 2J7JA 4R2PA 4M9VC 1Z1BA 1UBDC 1JK2A 2EOYA 2EM2A 2EOFA 2JP9A 2EL6A 2EMCA 2EOXA 1KJKA 2RSIA 1X6EA 2R1FA 2DMIA 3EPKA 2EM4A 2EM0A 2EN1A 4R2EA 2EPRA 2EQ0A 2EM8A 1X6HA 2YRKA 2GHFA 2EPXA 1A1IA 2EQ3A 2EPAA 2ENHA 2EOJA 2CT1A 1BB8A 2CTDA 5KL4A 4F6MA 2MDGA 4R2DA 2YTOA 2EM5A 2WBTA 2EL4A 5KL6A 5KL3A 1BBOA 1X5WA 2EOSA 2M9AA 2ELYA 2EE8A
chains in the Genus database with same CATH superfamily
1ZAAC 4LFCE 2GLIA 3VHTB 2ENAA 1ZU1A 2EMYA 4LF8E 3ZOQB 2EOZA 4GKKE 2M7QA 3LMLA 3FIGA 1X48A 1UN6B 5IT9C 2NUGA 1ZBQA 2DRPA 4NXME 4R03A 2NABA 2VE7C 5DNYA 5IV8B 3QG5C 4LU9A 4R2AA 2EMFA 4IS1C 4DV5E 3P1XA 2YTIA 2EZ6A 3EQ1A 4WFTA 4F54A 2EMXA 2EPLX 5AE1A 4M2ZA 1TF6A 2GPIA 4BC9A 2NUEA 2IHR1 1YSAC 3BGHA 2DLQA 2JYAA 3THNA 1YUIA 4DMIA 2UXBE 1A1HA 4LF6E 2LVHA 3ECRA 4J8ZA 1YUJA 2V86A 5F3WA 1N32E 2EQ1A 3C6MA 1YYWA 4WPYA 2FV4B 2LJUA 2UUCE 4R2QA 2EMBA 4X65E 2WBSA 2EOIA 1IBLE 5IXMB 2DB2A 5KL2A 4M0VA 4DV0E 4BCAA 2V83A 1STUA 2L2NA 4YHHE 4DKKA 1YPNA 2YTPA 1RMDA 1ZR9A 2YSOA 2J7JA 2LBSB 4M9VC 1HNXE 1QU6A 4GEQB 1YZ9A 4P7DA 5AASA 2YPNA 2EL6A 1KJKA 1X6EA 2R1FA 2DMIA 4DR2E 4NHRA 1EKZA 3TQMA 2EQ0A 2CPNA 5FLXC 1SR9A 3OMLA 2JXPA 2GHFA 2EPXA 2YRKA 3MSWA 2L8TA 2EQ3A 2V8QB 1KYQA 2CTDA 2L3JA 4K0KE 5KL4A 3C4BA 4NZVA 4P78A 3THOB 1N34E 5AE3A 2WBTA 5ADZA 4M30A 4JI8E 4WX9A 3J80C 2EPNA 2ELYA 2YZTA 3F6GA 1J5EE 3IWBA 1WXRA 4DUZE 3EPJA 2NA2A 5A6JA 2I9IA 4DV4E 2JWOA 4R2RA 2VF1A 2EMAA 5IWAE 2ZM6E 2EJ4A 2DMYA 3JU0A 3EPLA 2EN2A 2CSHA 3JAMC 3J7AG 1X47A 2EOEA 4O43A 4O5GA 2PRTA 1A1LA 4LF9E 3IWDA 2JY9A 4JI6E 1A1KA 2ENCA 2EM6A 2EMHA 2WCC3 3BF2A 1EH7A 1J26A 4F9BB 4JI5E 1NCSA 3HPZA 3J7Yp 4TUIA 1A1JA 1PJSA 2MC5A 4JI7E 2LCEA 4RH8A 2JOBA 1A1FA 4LTYA 2RSMA 2LT7A 3T1HE 1DQ3A 2RPCA 2DIXA 2V89A 4JI1E 1F2IG 1XMOE 4KWYA 1YYOA 1NEIA 2L3CA 4R2CA 1WHNA 2A25A 2BB8A 1WJPA 1PDAA 5A2QC 2EN6A 4I8OA 2EOHA 3C4TA 1TN9A 4X9JA 1RC7A 1T4LB 2EL5A 2EOQA 2H36X 2LTRA 4JI0E 4RHBB 4WSGA 2YTDA 2LE2A 2E72A 1QNTA 2MKNA 4KZSA 4DV3E 5A6BA 2HC5A 5KL5A 2UXDE 2EP3A 4DR6E 1IBKE 1B69A 2JOXA 3AV0A 2VQFE 4R2PA 1GZ6A 4ZYEA 1Z1BA 1UBDC 4ZYDA 2N8XA 2JP9A 3K6QA 3VYXA 2R76A 2RSIA 3ADLA 2EPMX 3T1YE 1IQSA 2EPKX 2EN1A 4JI2E 4R8OA 2EPAA 2RS6A 2EOJA 1BB8A 4HTGA 2WZOA 2MDGA 4X66E 4BBYA 2VQEE 5CFFE 1L4SA 2YTOA 2EM5A 4B3TE 4ZYGA 2K7IA 2LTSA 3L00A 4BC7A 1PJTA 2EOSA 5A6BD 1ZBTA 4WXCA 3ADGA 4DR5E 1DI2A 2KOUA 2EN7A 2YWQA 4IJDA 1IQOA 3HXLA 1T38A 4DV2E 2YTQA 2YT4A 1HR0E 2HJJA 4DR3E 2I13A 2HGHA 3HTXA 2EM7A 2VRDA 1MGTA 2MKDA 4N4RB 4DUYE 2YTEA 2N3HA 3JTZA 4DV1E 4GKJE 1N33E 5LL6R 1JK1A 2KHXA 1MEYC 2L33A 2ODRC 2LO3A 2UU9E 2M4IA 3UK3C 1IBME 2DGCA 1T39A 1XNQE 1XMQE 2MDRA 1EH8A 1AAYA 1HNWE 3ADIA 1TF3A 2EN4A 4HEIA 5A6AA 2EORA 2L6MA 2LV2A 3H09A 3M99B 4BHCA 1BBGA 2B9DA 2D9HA 2YU5A 2YTNA 1YFHA 4DV7E 3RMPA 1X3CA 4Q28A 4WSPA 2L2MA 1G2DC 4X64E 2ELZA 2EMWA 2EPZA 4OOGC 2G7HA 4MLQA 4Q35B 4GZNC 2V85A 2EPOA 2HHHE 2UUAE 2EMGA 2E1MA 4L8NA 2JPAA 4JV5E 3MHSC 1P47A 2EM3A 4WXDA 4DR4E 4F9AB 2EOYA 2EM2A 1RQ0A 2EOXA 4BS9A 2LUPB 1PKPA 3VK6A 1WHQA 1GQEA 3EPKA 4L5NC 4JYAE 2UXCE 4R2EA 3J81C 4AQYE 1A1IA 2ENHA 5TSEA 4BMJA 5LMNE 3KZZA 5LMUE 4R2DA 2LMZA 2EL4A 2V87A 3ADJA 2M1SA 3KWRA 2ODRD 1N36E 4JI4E 5KL3A 1BBOA 1X5WA 1HNZE 4DR1E 1YYKA 2M9AA 5A6KA 1FKAE 4X8WA 2EE8A 4LF7E 4JI3E 4ZYHA 3OTOE 4X62E 1X49A 5T6JA 1G2FC 1IMUA 1T4OA 3EPHA 2EOMA 4LFAE 1AH5A 2K4VA 4O4KA 2EMLA 4B3RE 2L2KB 2EN8A 1SFEA 5AE2A 2FTXB 2YRHA 2YTFA 4DR7E 3LLHA 2V88A 1A1GA 4WYQB 4LF5E 2EM9A 5AC5A 2EPUA 2EOOA 4FK5C 4F2JC 4F6NA 2RTXA 5LLQA 4R2SA 1UHZA 2L92A 5BR8E 2EMKA 4MLVA 2EPPA 2KONA 1EH6A 5A69A 2DLKA 2EMZA 1O0WA 1X6FA 2YSPA 2YRMA 4F9CB 2JVAA 1LLMC 3MHHC 2F8BA 2FGGA 2NUFA 2YTGA 2EWLA 3BBGA 2Q8UA 3DJWA 3KZYA 4NXNE 1DGCA 2YTJA 4KHPE 3IWCA 2YU8A 3DF6A 1I94E 2EN3A 1UILA 2EMIA 2ADRA 1XNRE 2EPCA 5KL7A 2LUQA 2WBUA 1N3GA 2MC6A 1T4NA 1JK2A 2EOFA 2EMCA 3C6KA 2N3GA 2BBGA 2F4VE 4O24A 2EM4A 2EM0A 1FJGE 2EPRA 2EM8A 4YY3E 1X6HA 2B7TA 3AUZA 2JR1A 4TUGA 3HPSA 2CT1A 3F6HA 2B3TB 4F6MA 2LJHA 4LFBE 4DV6E 2B7VA 4LF4E 4BHBA 2RQLA 4OX9E 1WRJA 5KL6A 1PJQA 2LRSA 5AC4A 3BIDA 2E5LE 1GTKA 4B3ME 3VYYA 2RS7A 3HQ1A 2UUBE 2DSYA 4B3SE
chains in the Genus database with same CATH topology
3EPJA 1ZAAC 2EN7A 4IJDA 2GLIA 3VHTB 1G2FC 4R2RA 2ENAA 1ZU1A 2EMYA 2EMAA 2EJ4A 2YTQA 3EPHA 2EOMA 2EOZA 3EPLA 2EMLA 2EN2A 2HGHA 2I13A 2EN8A 2CSHA 2EM7A 2VRDA 2MKDA 1UN6B 2EOEA 2YRHA 2YTFA 2PRTA 2DRPA 2NABA 1A1LA 2YTEA 1A1KA 1A1GA 1JK1A 4R2AA 2ENCA 2EMFA 2EM9A 4IS1C 2EM6A 1MEYC 2EPUA 2EOOA 4FK5C 2EMHA 2YTIA 2WCC3 4F2JC 2LO3A 4R2SA 4F6NA 3UK3C 2DGCA 2EMXA 1NCSA 2EMKA 1A1JA 2EPPA 1TF6A 2LCEA 2DLKA 2EMZA 1YSAC 2DLQA 1AAYA 1YUIA 1A1FA 1X6FA 2YSPA 2YRMA 1A1HA 2LT7A 1TF3A 2LVHA 2EN4A 2RPCA 2EORA 1F2IG 3M99B 2LV2A 1LLMC 1YUJA 4R2CA 2A25A 2BB8A 3MHHC 2D9HA 1WJPA 2YU5A 2YTGA 2YTNA 1X3CA 2EQ1A 2EN6A 2EOHA 1TN9A 1DGCA 4X9JA 4R2QA 2EMBA 2YTJA 2ELZA 2EMWA 2EPZA 2EOIA 2WBSA 1G2DC 2EL5A 2EOQA 2YU8A 4GZNC 5KL2A 2EN3A 4WSGA 2YTDA 2E72A 2EMGA 2MKNA 2EMIA 2ADRA 2JPAA 2EPCA 5KL7A 3MHSC 2YTPA 5KL5A 2EP3A 2WBUA 1B69A 1P47A 1RMDA 1ZR9A 2EM3A 2YSOA 2J7JA 4R2PA 4M9VC 1Z1BA 1UBDC 1JK2A 2EOYA 2EM2A 2EOFA 2JP9A 2EL6A 2EMCA 2EOXA 1KJKA 2RSIA 1X6EA 2R1FA 2DMIA 3EPKA 2EM4A 2EM0A 2EN1A 4R2EA 2EPRA 2EQ0A 2EM8A 1X6HA 2YRKA 2GHFA 2EPXA 1A1IA 2EQ3A 2EPAA 2ENHA 2EOJA 2CT1A 1BB8A 2CTDA 5KL4A 4F6MA 2MDGA 4R2DA 2YTOA 2EM5A 2WBTA 2EL4A 5KL6A 5KL3A 1BBOA 1X5WA 2EOSA 2M9AA 2ELYA 2EE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPJ A;  1ZAA C;  2EN7 A;  4IJD A;  2GLI A;  3VHT B;  1G2F C;  4R2R A;  2ENA A;  1ZU1 A;  2EMY A;  2EMA A;  2EJ4 A;  2YTQ A;  3EPH A;  2EOM A;  2EOZ A;  3EPL A;  2EML A;  2EN2 A;  2HGH A;  2I13 A;  2EN8 A;  2CSH A;  2EM7 A;  2VRD A;  2MKD A;  1UN6 B;  2EOE A;  2YRH A;  2YTF A;  2PRT A;  2DRP A;  2NAB A;  1A1L A;  2YTE A;  1A1K A;  1A1G A;  1JK1 A;  4R2A A;  2ENC A;  2EMF A;  2EM9 A;  4IS1 C;  2EM6 A;  1MEY C;  2EPU A;  2EOO A;  4FK5 C;  2EMH A;  2YTI A;  2WCC 3;  4F2J C;  2LO3 A;  4R2S A;  4F6N A;  3UK3 C;  2DGC A;  2EMX A;  1NCS A;  2EMK A;  1A1J A;  2EPP A;  1TF6 A;  2LCE A;  2DLK A;  2EMZ A;  1YSA C;  2DLQ A;  1AAY A;  1YUI A;  1A1F A;  1X6F A;  2YSP A;  2YRM A;  1A1H A;  2LT7 A;  1TF3 A;  2LVH A;  2EN4 A;  2RPC A;  2EOR A;  1F2I G;  3M99 B;  2LV2 A;  1LLM C;  1YUJ A;  4R2C A;  2A25 A;  2BB8 A;  3MHH C;  2D9H A;  1WJP A;  2YU5 A;  2YTG A;  2YTN A;  1X3C A;  2EQ1 A;  2EN6 A;  2EOH A;  1TN9 A;  1DGC A;  4X9J A;  4R2Q A;  2EMB A;  2YTJ A;  2ELZ A;  2EMW A;  2EPZ A;  2EOI A;  2WBS A;  1G2D C;  2EL5 A;  2EOQ A;  2YU8 A;  4GZN C;  5KL2 A;  2EN3 A;  4WSG A;  2YTD A;  2E72 A;  2EMG A;  2MKN A;  2EMI A;  2ADR A;  2JPA A;  2EPC A;  5KL7 A;  3MHS C;  2YTP A;  5KL5 A;  2EP3 A;  2WBU A;  1B69 A;  1P47 A;  1RMD A;  1ZR9 A;  2EM3 A;  2YSO A;  2J7J A;  4R2P A;  4M9V C;  1Z1B A;  1UBD C;  1JK2 A;  2EOY A;  2EM2 A;  2EOF A;  2JP9 A;  2EL6 A;  2EMC A;  2EOX A;  1KJK A;  2RSI A;  1X6E A;  2R1F A;  2DMI A;  3EPK A;  2EM4 A;  2EM0 A;  2EN1 A;  4R2E A;  2EPR A;  2EQ0 A;  2EM8 A;  1X6H A;  2YRK A;  2GHF A;  2EPX A;  1A1I A;  2EQ3 A;  2EPA A;  2ENH A;  2EOJ A;  2CT1 A;  1BB8 A;  2CTD A;  5KL4 A;  4F6M A;  2MDG A;  4R2D A;  2YTO A;  2EM5 A;  2WBT A;  2EL4 A;  5KL6 A;  5KL3 A;  1BBO A;  1X5W A;  2EOS A;  2M9A A;  2ELY A;  2EE8 A; 
#chains in the Genus database with same CATH topology
 1ZAA C;  4LFC E;  2GLI A;  3VHT B;  2ENA A;  1ZU1 A;  2EMY A;  4LF8 E;  3ZOQ B;  2EOZ A;  4GKK E;  2M7Q A;  3LML A;  3FIG A;  1X48 A;  1UN6 B;  5IT9 C;  2NUG A;  1ZBQ A;  2DRP A;  4NXM E;  4R03 A;  2NAB A;  2VE7 C;  5DNY A;  5IV8 B;  3QG5 C;  4LU9 A;  4R2A A;  2EMF A;  4IS1 C;  4DV5 E;  3P1X A;  2YTI A;  2EZ6 A;  3EQ1 A;  4WFT A;  4F54 A;  2EMX A;  2EPL X;  5AE1 A;  4M2Z A;  1TF6 A;  2GPI A;  4BC9 A;  2NUE A;  2IHR 1;  1YSA C;  3BGH A;  2DLQ A;  2JYA A;  3THN A;  1YUI A;  4DMI A;  2UXB E;  1A1H A;  4LF6 E;  2LVH A;  3ECR A;  4J8Z A;  1YUJ A;  2V86 A;  5F3W A;  1N32 E;  2EQ1 A;  3C6M A;  1YYW A;  4WPY A;  2FV4 B;  2LJU A;  2UUC E;  4R2Q A;  2EMB A;  4X65 E;  2WBS A;  2EOI A;  1IBL E;  5IXM B;  2DB2 A;  5KL2 A;  4M0V A;  4DV0 E;  4BCA A;  2V83 A;  1STU A;  2L2N A;  4YHH E;  4DKK A;  1YPN A;  2YTP A;  1RMD A;  1ZR9 A;  2YSO A;  2J7J A;  2LBS B;  4M9V C;  1HNX E;  1QU6 A;  4GEQ B;  1YZ9 A;  4P7D A;  5AAS A;  2YPN A;  2EL6 A;  1KJK A;  1X6E A;  2R1F A;  2DMI A;  4DR2 E;  4NHR A;  1EKZ A;  3TQM A;  2EQ0 A;  2CPN A;  5FLX C;  1SR9 A;  3OML A;  2JXP A;  2GHF A;  2EPX A;  2YRK A;  3MSW A;  2L8T A;  2EQ3 A;  2V8Q B;  1KYQ A;  2CTD A;  2L3J A;  4K0K E;  5KL4 A;  3C4B A;  4NZV A;  4P78 A;  3THO B;  1N34 E;  5AE3 A;  2WBT A;  5ADZ A;  4M30 A;  4JI8 E;  4WX9 A;  3J80 C;  2EPN A;  2ELY A;  2YZT A;  3F6G A;  1J5E E;  3IWB A;  1WXR A;  4DUZ E;  3EPJ A;  2NA2 A;  5A6J A;  2I9I A;  4DV4 E;  2JWO A;  4R2R A;  2VF1 A;  2EMA A;  5IWA E;  2ZM6 E;  2EJ4 A;  2DMY A;  3JU0 A;  3EPL A;  2EN2 A;  2CSH A;  3JAM C;  3J7A G;  1X47 A;  2EOE A;  4O43 A;  4O5G A;  2PRT A;  1A1L A;  4LF9 E;  3IWD A;  2JY9 A;  4JI6 E;  1A1K A;  2ENC A;  2EM6 A;  2EMH A;  2WCC 3;  3BF2 A;  1EH7 A;  1J26 A;  4F9B B;  4JI5 E;  1NCS A;  3HPZ A;  3J7Y p;  4TUI A;  1A1J A;  1PJS A;  2MC5 A;  4JI7 E;  2LCE A;  4RH8 A;  2JOB A;  1A1F A;  4LTY A;  2RSM A;  2LT7 A;  3T1H E;  1DQ3 A;  2RPC A;  2DIX A;  2V89 A;  4JI1 E;  1F2I G;  1XMO E;  4KWY A;  1YYO A;  1NEI A;  2L3C A;  4R2C A;  1WHN A;  2A25 A;  2BB8 A;  1WJP A;  1PDA A;  5A2Q C;  2EN6 A;  4I8O A;  2EOH A;  3C4T A;  1TN9 A;  4X9J A;  1RC7 A;  1T4L B;  2EL5 A;  2EOQ A;  2H36 X;  2LTR A;  4JI0 E;  4RHB B;  4WSG A;  2YTD A;  2LE2 A;  2E72 A;  1QNT A;  2MKN A;  4KZS A;  4DV3 E;  5A6B A;  2HC5 A;  5KL5 A;  2UXD E;  2EP3 A;  4DR6 E;  1IBK E;  1B69 A;  2JOX A;  3AV0 A;  2VQF E;  4R2P A;  1GZ6 A;  4ZYE A;  1Z1B A;  1UBD C;  4ZYD A;  2N8X A;  2JP9 A;  3K6Q A;  3VYX A;  2R76 A;  2RSI A;  3ADL A;  2EPM X;  3T1Y E;  1IQS A;  2EPK X;  2EN1 A;  4JI2 E;  4R8O A;  2EPA A;  2RS6 A;  2EOJ A;  1BB8 A;  4HTG A;  2WZO A;  2MDG A;  4X66 E;  4BBY A;  2VQE E;  5CFF E;  1L4S A;  2YTO A;  2EM5 A;  4B3T E;  4ZYG A;  2K7I A;  2LTS A;  3L00 A;  4BC7 A;  1PJT A;  2EOS A;  5A6B D;  1ZBT A;  4WXC A;  3ADG A;  4DR5 E;  1DI2 A;  2KOU A;  2EN7 A;  2YWQ A;  4IJD A;  1IQO A;  3HXL A;  1T38 A;  4DV2 E;  2YTQ A;  2YT4 A;  1HR0 E;  2HJJ A;  4DR3 E;  2I13 A;  2HGH A;  3HTX A;  2EM7 A;  2VRD A;  1MGT A;  2MKD A;  4N4R B;  4DUY E;  2YTE A;  2N3H A;  3JTZ A;  4DV1 E;  4GKJ E;  1N33 E;  5LL6 R;  1JK1 A;  2KHX A;  1MEY C;  2L33 A;  2ODR C;  2LO3 A;  2UU9 E;  2M4I A;  3UK3 C;  1IBM E;  2DGC A;  1T39 A;  1XNQ E;  1XMQ E;  2MDR A;  1EH8 A;  1AAY A;  1HNW E;  3ADI A;  1TF3 A;  2EN4 A;  4HEI A;  5A6A A;  2EOR A;  2L6M A;  2LV2 A;  3H09 A;  3M99 B;  4BHC A;  1BBG A;  2B9D A;  2D9H A;  2YU5 A;  2YTN A;  1YFH A;  4DV7 E;  3RMP A;  1X3C A;  4Q28 A;  4WSP A;  2L2M A;  1G2D C;  4X64 E;  2ELZ A;  2EMW A;  2EPZ A;  4OOG C;  2G7H A;  4MLQ A;  4Q35 B;  4GZN C;  2V85 A;  2EPO A;  2HHH E;  2UUA E;  2EMG A;  2E1M A;  4L8N A;  2JPA A;  4JV5 E;  3MHS C;  1P47 A;  2EM3 A;  4WXD A;  4DR4 E;  4F9A B;  2EOY A;  2EM2 A;  1RQ0 A;  2EOX A;  4BS9 A;  2LUP B;  1PKP A;  3VK6 A;  1WHQ A;  1GQE A;  3EPK A;  4L5N C;  4JYA E;  2UXC E;  4R2E A;  3J81 C;  4AQY E;  1A1I A;  2ENH A;  5TSE A;  4BMJ A;  5LMN E;  3KZZ A;  5LMU E;  4R2D A;  2LMZ A;  2EL4 A;  2V87 A;  3ADJ A;  2M1S A;  3KWR A;  2ODR D;  1N36 E;  4JI4 E;  5KL3 A;  1BBO A;  1X5W A;  1HNZ E;  4DR1 E;  1YYK A;  2M9A A;  5A6K A;  1FKA E;  4X8W A;  2EE8 A;  4LF7 E;  4JI3 E;  4ZYH A;  3OTO E;  4X62 E;  1X49 A;  5T6J A;  1G2F C;  1IMU A;  1T4O A;  3EPH A;  2EOM A;  4LFA E;  1AH5 A;  2K4V A;  4O4K A;  2EML A;  4B3R E;  2L2K B;  2EN8 A;  1SFE A;  5AE2 A;  2FTX B;  2YRH A;  2YTF A;  4DR7 E;  3LLH A;  2V88 A;  1A1G A;  4WYQ B;  4LF5 E;  2EM9 A;  5AC5 A;  2EPU A;  2EOO A;  4FK5 C;  4F2J C;  4F6N A;  2RTX A;  5LLQ A;  4R2S A;  1UHZ A;  2L92 A;  5BR8 E;  2EMK A;  4MLV A;  2EPP A;  2KON A;  1EH6 A;  5A69 A;  2DLK A;  2EMZ A;  1O0W A;  1X6F A;  2YSP A;  2YRM A;  4F9C B;  2JVA A;  1LLM C;  3MHH C;  2F8B A;  2FGG A;  2NUF A;  2YTG A;  2EWL A;  3BBG A;  2Q8U A;  3DJW A;  3KZY A;  4NXN E;  1DGC A;  2YTJ A;  4KHP E;  3IWC A;  2YU8 A;  3DF6 A;  1I94 E;  2EN3 A;  1UIL A;  2EMI A;  2ADR A;  1XNR E;  2EPC A;  5KL7 A;  2LUQ A;  2WBU A;  1N3G A;  2MC6 A;  1T4N A;  1JK2 A;  2EOF A;  2EMC A;  3C6K A;  2N3G A;  2BBG A;  2F4V E;  4O24 A;  2EM4 A;  2EM0 A;  1FJG E;  2EPR A;  2EM8 A;  4YY3 E;  1X6H A;  2B7T A;  3AUZ A;  2JR1 A;  4TUG A;  3HPS A;  2CT1 A;  3F6H A;  2B3T B;  4F6M A;  2LJH A;  4LFB E;  4DV6 E;  2B7V A;  4LF4 E;  4BHB A;  2RQL A;  4OX9 E;  1WRJ A;  5KL6 A;  1PJQ A;  2LRS A;  5AC4 A;  3BID A;  2E5L E;  1GTK A;  4B3M E;  3VYY A;  2RS7 A;  3HQ1 A;  2UUB E;  2DSY A;  4B3S E; 
#chains in the Genus database with same CATH homology
 3EPJ A;  1ZAA C;  2EN7 A;  4IJD A;  2GLI A;  3VHT B;  1G2F C;  4R2R A;  2ENA A;  1ZU1 A;  2EMY A;  2EMA A;  2EJ4 A;  2YTQ A;  3EPH A;  2EOM A;  2EOZ A;  3EPL A;  2EML A;  2EN2 A;  2HGH A;  2I13 A;  2EN8 A;  2CSH A;  2EM7 A;  2VRD A;  2MKD A;  1UN6 B;  2EOE A;  2YRH A;  2YTF A;  2PRT A;  2DRP A;  2NAB A;  1A1L A;  2YTE A;  1A1K A;  1A1G A;  1JK1 A;  4R2A A;  2ENC A;  2EMF A;  2EM9 A;  4IS1 C;  2EM6 A;  1MEY C;  2EPU A;  2EOO A;  4FK5 C;  2EMH A;  2YTI A;  2WCC 3;  4F2J C;  2LO3 A;  4R2S A;  4F6N A;  3UK3 C;  2DGC A;  2EMX A;  1NCS A;  2EMK A;  1A1J A;  2EPP A;  1TF6 A;  2LCE A;  2DLK A;  2EMZ A;  1YSA C;  2DLQ A;  1AAY A;  1YUI A;  1A1F A;  1X6F A;  2YSP A;  2YRM A;  1A1H A;  2LT7 A;  1TF3 A;  2LVH A;  2EN4 A;  2RPC A;  2EOR A;  1F2I G;  3M99 B;  2LV2 A;  1LLM C;  1YUJ A;  4R2C A;  2A25 A;  2BB8 A;  3MHH C;  2D9H A;  1WJP A;  2YU5 A;  2YTG A;  2YTN A;  1X3C A;  2EQ1 A;  2EN6 A;  2EOH A;  1TN9 A;  1DGC A;  4X9J A;  4R2Q A;  2EMB A;  2YTJ A;  2ELZ A;  2EMW A;  2EPZ A;  2EOI A;  2WBS A;  1G2D C;  2EL5 A;  2EOQ A;  2YU8 A;  4GZN C;  5KL2 A;  2EN3 A;  4WSG A;  2YTD A;  2E72 A;  2EMG A;  2MKN A;  2EMI A;  2ADR A;  2JPA A;  2EPC A;  5KL7 A;  3MHS C;  2YTP A;  5KL5 A;  2EP3 A;  2WBU A;  1B69 A;  1P47 A;  1RMD A;  1ZR9 A;  2EM3 A;  2YSO A;  2J7J A;  4R2P A;  4M9V C;  1Z1B A;  1UBD C;  1JK2 A;  2EOY A;  2EM2 A;  2EOF A;  2JP9 A;  2EL6 A;  2EMC A;  2EOX A;  1KJK A;  2RSI A;  1X6E A;  2R1F A;  2DMI A;  3EPK A;  2EM4 A;  2EM0 A;  2EN1 A;  4R2E A;  2EPR A;  2EQ0 A;  2EM8 A;  1X6H A;  2YRK A;  2GHF A;  2EPX A;  1A1I A;  2EQ3 A;  2EPA A;  2ENH A;  2EOJ A;  2CT1 A;  1BB8 A;  2CTD A;  5KL4 A;  4F6M A;  2MDG A;  4R2D A;  2YTO A;  2EM5 A;  2WBT A;  2EL4 A;  5KL6 A;  5KL3 A;  1BBO A;  1X5W A;  2EOS A;  2M9A A;  2ELY A;  2EE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...