2EPAA

Solution structure of the first and second zf-c2h2 domains from human krueppel-like factor 10
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
72
structure length
72
Chain Sequence
GSSGSSGPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the first and second zf-C2H2 domains from human Krueppel-like factor 10
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Krueppel-like factor 10
total genus 9
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epaA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epaA01
2CTDA 5KL7A 2ENHA 1JK1A 2EL6A 2EN8A 4R2SA 2EPUA 4F6NA 2LV2A 1TF3A 2ENCA 4GZNC 1X5WA 1ZAAC 1X6FA 1G2FC 1BB8A 1AAYA 2NABA 1P47A 2EOZA 1ZR9A 2EM3A 3EPHA 1G2DC 2EPCA 2ADRA 4F2JC 2EN2A 2DLKA 2EMCA 4R2CA 2DRPA 1KJKA 2EMYA 2LCEA 2EN3A 2EPRA 2EM8A 2EQ1A 1A1JA 2YRHA 4R2AA 1JK2A 1A1GA 1F2IG 2EMAA 2EMIA 2EL4A 2EM4A 2EPAA 1Z1BA 1UBDC 2YTNA 2DLQA 2EPPA 2YSOA 4X9JA 2EOSA 1YUJA 2CT1A 4R2PA 2EN6A 2J7JA 2EOYA 1X6EA 2GHFA 2EM6A 1BBOA 1MEYC 3EPKA 2EOHA 2EJ4A 1A1LA 2DGCA 2EN7A 2E72A 1WJPA 2EOIA 2YTOA 5KL3A 1B69A 2WCC3 3MHSC 1YUIA 2EMXA 2WBTA 4WSGA 2LO3A 3VHTB 2EPXA 2EMWA 2ELZA 5KL2A 2GLIA 3M99B 2EOFA 2WBSA 2D9HA 2YTFA 2ENAA 2YTJA 1TN9A 2MKDA 2YU8A 2EN1A 2MKNA 1UN6B 2YSPA 1X6HA 2JPAA 2EP3A 2EM7A 2DMIA 2RPCA 4FK5C 1X3CA 2EM5A 3UK3C 4M9VC 2EM9A 2PRTA 2EMGA 2CSHA 2LVHA 2YU5A 1A1KA 5KL4A 4R2QA 2YTPA 2JP9A 1YSAC 2YRKA 4R2DA 4IJDA 2EE8A 4R2RA 1LLMC 2EOEA 2EOJA 2R1FA 2EOMA 2YTGA 4F6MA 2EM2A 2ELYA 1A1HA 2EMHA 2EN4A 2YTIA 2A25A 2BB8A 3EPLA 2RSIA 2M9AA 2EPZA 2EOXA 2VRDA 2YTDA 2I13A 2EMFA 2HGHA 2EQ3A 2YTQA 2WBUA 2EMBA 1A1FA 2EOOA 1A1IA 5KL6A 1DGCA 5KL5A 2EOQA 2YTEA 2YRMA 3EPJA 1RMDA 2EMZA 2EMLA 3MHHC 2LT7A 2EL5A 2EM0A 2MDGA 2EMKA 2EQ0A 4R2EA 1NCSA 4IS1C 1TF6A 1ZU1A 2EORA
chains in the Genus database with same CATH superfamily
5KL7A 2ENHA 3VYXA 1TF3A 2LV2A 1X5WA 1ZAAC 2FTXB 4LFBE 2KOUA 4LF4E 2YPNA 2EM3A 3EPHA 2MC5A 2MC6A 1YYOA 1UHZA 5A2QC 4DMIA 2M4IA 2EMYA 2LCEA 5FLXC 2L8TA 4ZYEA 4LF8E 1JK2A 2EMIA 2EL4A 3ADJA 5A6BA 2EPNA 2V8QB 4R03A 4DR7E 1FKAE 2EPPA 4YHHE 2KHXA 4BBYA 3DJWA 3AUZA 4B3TE 3J80C 1X6EA 2GHFA 4WX9A 1BBOA 4BHBA 1MEYC 2EJ4A 2BBGA 2EN7A 1UILA 1YYKA 2HC5A 4F9CB 2WCC3 4M30A 1YYWA 2EOFA 2EPKX 2WBSA 4DR6E 2ENAA 1HNWE 2N3HA 4RHBB 4X62E 3TQMA 3IWCA 2MKNA 5LMNE 2DMIA 2DIXA 1EH7A 1X3CA 2EM5A 5A69A 1IBLE 2PRTA 2EMGA 2LVHA 3DF6A 2I9IA 1L4SA 2YTPA 2UXCE 5AE1A 2R1FA 2EOMA 2YTGA 4DKKA 2NUEA 2FV4B 3BGHA 4WSPA 2EMHA 4LF6E 2EZ6A 3HPSA 2YTIA 2LUQA 1T39A 1RQ0A 4M0VA 4JI5E 2VQFE 2L3JA 3ADIA 1J26A 2B7VA 4J8ZA 2I13A 2EQ3A 2YTQA 1SR9A 3J7Yp 3F6HA 2UUAE 2M1SA 5KL5A 2UUBE 2UXDE 3HXLA 3HQ1A 2EMLA 4JI6E 5IXMB 1N33E 2LJHA 5BR8E 2F8BA 1NCSA 2L3CA 3HTXA 1ZU1A 2CTDA 1PKPA 4JI3E 1JK1A 4R2SA 2EPUA 4DV3E 4OOGC 4F6NA 2ENCA 2JVAA 3AV0A 4GZNC 2JOXA 4NXNE 4X8WA 1BB8A 1AAYA 1P47A 3C6KA 4O4KA 1ZR9A 1G2DC 4WPYA 2ADRA 4BS9A 2DLKA 4R2CA 2JXPA 2EPRA 2EM8A 1A1JA 1XMQE 1A1GA 2EM4A 2VQEE 2VF1A 1WHNA 2DLQA 2EOSA 4P78A 4R2PA 2L2KB 2L92A 2EOYA 1YPNA 5AE2A 4ZYHA 4F9AB 4GEQB 4JI1E 2EM6A 3IWDA 1YZ9A 3EPKA 1I94E 1A1LA 2H36X 4MLQA 1WJPA 2YTOA 4Q35B 5DNYA 3MHSC 1IBKE 1YUIA 2EPOA 2NA2A 4L8NA 4WSGA 2LO3A 5LL6R 2JWOA 2EMWA 4Q28A 2ELZA 2GLIA 3M99B 3F6GA 2YTFA 5A6AA 3IWBA 2EN1A 2RQLA 1UN6B 2EP3A 2EM7A 4B3SE 4FK5C 3EQ1A 2DB2A 4LTYA 2EPMX 4M9VC 2YU5A 2ZM6E 2JY9A 4ZYDA 2UUCE 3KZYA 4JI0E 4R2QA 2HHHE 3LMLA 4HTGA 1YSAC 4X65E 2IHR1 1IBME 1IQSA 4R2DA 4IJDA 2EE8A 3THNA 1GTKA 2EOJA 2EM2A 4F54A 3KWRA 4KZSA 1GQEA 2A25A 5IT9C 1T4OA 4MLVA 4N4RB 4WXCA 2M9AA 4WXDA 2CPNA 1J5EE 4JYAE 2VRDA 2E5LE 1PJSA 2YWQA 1MGTA 1A1FA 4I8OA 1A1IA 3T1HE 2RSMA 5A6BD 2YTEA 1HNXE 1RMDA 4BCAA 2LTSA 2K4VA 2LT7A 2EWLA 2MDRA 5AC5A 3P1XA 2L33A 1T38A 2F4VE 4GKJE 4ZYGA 2V88A 3T1YE 4DV0E 2ODRC 3L00A 4YY3E 1N34E 2LBSB 1GZ6A 3VYYA 5T6JA 4DR4E 2B3TB 1WRJA 1X49A 1G2FC 4B3ME 5A6KA 2EOZA 4X66E 1SFEA 2EN2A 2EMCA 4BC7A 4DUYE 4DR5E 1XNRE 1KJKA 1QU6A 1PDAA 2LTRA 3LLHA 2YRHA 1PJQA 4B3RE 1ZBQA 2EMAA 1F2IG 2EPAA 2YZTA 1O0WA 1Z1BA 2RS7A 2YTNA 2UU9E 2YSOA 4X9JA 3FIGA 4O43A 2L2MA 2CT1A 2EN6A 2J7JA 3C4TA 3C4BA 2WZOA 1WXRA 2B9DA 2DGCA 2E72A 2LUPB 4BMJA 2WBTA 4NZVA 3VHTB 2EPXA 2N8XA 1KYQA 4NHRA 2Q8UA 3K6QA 2MKDA 2YU8A 5TSEA 2YSPA 1X6HA 2RPCA 2L2NA 4JI2E 3UK3C 5IWAE 4JI4E 2CSHA 1A1KA 4RH8A 1N36E 5KL4A 4DV7E 4P7DA 4DV5E 2JR1A 4OX9E 3RMPA 1DQ3A 2YRKA 1ZBTA 2V83A 3BF2A 2V87A 4DV4E 1EH6A 4LF5E 2EOEA 2NUFA 1EKZA 4F6MA 4GKKE 4X64E 2ELYA 2V89A 1A1HA 3THOB 2HJJA 2DSYA 2EN4A 3EPLA 3QG5C 2RSIA 3OTOE 2UXBE 3OMLA 2GPIA 2N3GA 2L6MA 1DGCA 2B7TA 5IV8B 2EOQA 1XMOE 5AE3A 4F9BB 2M7QA 3J81C 2JYAA 3MHHC 2EL5A 5CFFE 2R76A 2LRSA 2MDGA 4R2EA 4LF9E 4IS1C 3JAMC 1RC7A 2V85A 2EORA 2EM9A 4R8OA 3ECRA 4KWYA 2EL6A 2EN8A 2G7HA 4LFAE 2LMZA 5ADZA 3ZOQB 1X6FA 4DV2E 3C6MA 2NABA 2YT4A 3JTZA 2EPCA 3MSWA 4F2JC 2LE2A 4JI8E 2DRPA 4L5NC 2EN3A 2EQ1A 3J7AG 4R2AA 4WFTA 1HR0E 4JV5E 4LF7E 3H09A 1IQOA 1UBDC 4TUIA 5A6JA 1YUJA 1QNTA 1AH5A 4DR2E 2EOHA 2RTXA 4K0KE 1T4LB 1XNQE 2E1MA 5LLQA 2EOIA 5KL3A 1B69A 2NUGA 3HPZA 2EMXA 4O5GA 4DUZE 4DR1E 5KL2A 3BBGA 4BC9A 1EH8A 2D9HA 2DMYA 1BBGA 2YTJA 1TN9A 3JU0A 2V86A 4BHCA 3VK6A 2JOBA 2JPAA 3BIDA 2RS6A 1T4NA 2FGGA 4DV1E 2K7IA 1WHQA 1FJGE 4DR3E 4LU9A 5AC4A 2JP9A 4LFCE 4R2RA 4WYQB 1LLMC 4AQYE 1X48A 1X47A 4O24A 2KONA 4JI7E 5LMUE 3ADGA 1YFHA 3KZZA 1N3GA 2VE7C 2BB8A 4TUGA 1HNZE 2EPZA 2EPLX 5F3WA 2EOXA 1DI2A 2YTDA 1PJTA 1NEIA 4M2ZA 3ADLA 1STUA 2EMFA 2HGHA 4DV6E 2LJUA 2WBUA 2EMBA 1IMUA 2EOOA 1N32E 4HEIA 5KL6A 4KHPE 2YRMA 2ODRD 3EPJA 2EMZA 4NXME 2EM0A 2EMKA 2EQ0A 1TF6A 5AASA
chains in the Genus database with same CATH topology
2CTDA 5KL7A 2ENHA 1JK1A 2EL6A 2EN8A 4R2SA 2EPUA 4F6NA 2LV2A 1TF3A 2ENCA 4GZNC 1X5WA 1ZAAC 1X6FA 1G2FC 1BB8A 1AAYA 2NABA 1P47A 2EOZA 1ZR9A 2EM3A 3EPHA 1G2DC 2EPCA 2ADRA 4F2JC 2EN2A 2DLKA 2EMCA 4R2CA 2DRPA 1KJKA 2EMYA 2LCEA 2EN3A 2EPRA 2EM8A 2EQ1A 1A1JA 2YRHA 4R2AA 1JK2A 1A1GA 1F2IG 2EMAA 2EMIA 2EL4A 2EM4A 2EPAA 1Z1BA 1UBDC 2YTNA 2DLQA 2EPPA 2YSOA 4X9JA 2EOSA 1YUJA 2CT1A 4R2PA 2EN6A 2J7JA 2EOYA 1X6EA 2GHFA 2EM6A 1BBOA 1MEYC 3EPKA 2EOHA 2EJ4A 1A1LA 2DGCA 2EN7A 2E72A 1WJPA 2EOIA 2YTOA 5KL3A 1B69A 2WCC3 3MHSC 1YUIA 2EMXA 2WBTA 4WSGA 2LO3A 3VHTB 2EPXA 2EMWA 2ELZA 5KL2A 2GLIA 3M99B 2EOFA 2WBSA 2D9HA 2YTFA 2ENAA 2YTJA 1TN9A 2MKDA 2YU8A 2EN1A 2MKNA 1UN6B 2YSPA 1X6HA 2JPAA 2EP3A 2EM7A 2DMIA 2RPCA 4FK5C 1X3CA 2EM5A 3UK3C 4M9VC 2EM9A 2PRTA 2EMGA 2CSHA 2LVHA 2YU5A 1A1KA 5KL4A 4R2QA 2YTPA 2JP9A 1YSAC 2YRKA 4R2DA 4IJDA 2EE8A 4R2RA 1LLMC 2EOEA 2EOJA 2R1FA 2EOMA 2YTGA 4F6MA 2EM2A 2ELYA 1A1HA 2EMHA 2EN4A 2YTIA 2A25A 2BB8A 3EPLA 2RSIA 2M9AA 2EPZA 2EOXA 2VRDA 2YTDA 2I13A 2EMFA 2HGHA 2EQ3A 2YTQA 2WBUA 2EMBA 1A1FA 2EOOA 1A1IA 5KL6A 1DGCA 5KL5A 2EOQA 2YTEA 2YRMA 3EPJA 1RMDA 2EMZA 2EMLA 3MHHC 2LT7A 2EL5A 2EM0A 2MDGA 2EMKA 2EQ0A 4R2EA 1NCSA 4IS1C 1TF6A 1ZU1A 2EORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTD A;  5KL7 A;  2ENH A;  1JK1 A;  2EL6 A;  2EN8 A;  4R2S A;  2EPU A;  4F6N A;  2LV2 A;  1TF3 A;  2ENC A;  4GZN C;  1X5W A;  1ZAA C;  1X6F A;  1G2F C;  1BB8 A;  1AAY A;  2NAB A;  1P47 A;  2EOZ A;  1ZR9 A;  2EM3 A;  3EPH A;  1G2D C;  2EPC A;  2ADR A;  4F2J C;  2EN2 A;  2DLK A;  2EMC A;  4R2C A;  2DRP A;  1KJK A;  2EMY A;  2LCE A;  2EN3 A;  2EPR A;  2EM8 A;  2EQ1 A;  1A1J A;  2YRH A;  4R2A A;  1JK2 A;  1A1G A;  1F2I G;  2EMA A;  2EMI A;  2EL4 A;  2EM4 A;  2EPA A;  1Z1B A;  1UBD C;  2YTN A;  2DLQ A;  2EPP A;  2YSO A;  4X9J A;  2EOS A;  1YUJ A;  2CT1 A;  4R2P A;  2EN6 A;  2J7J A;  2EOY A;  1X6E A;  2GHF A;  2EM6 A;  1BBO A;  1MEY C;  3EPK A;  2EOH A;  2EJ4 A;  1A1L A;  2DGC A;  2EN7 A;  2E72 A;  1WJP A;  2EOI A;  2YTO A;  5KL3 A;  1B69 A;  2WCC 3;  3MHS C;  1YUI A;  2EMX A;  2WBT A;  4WSG A;  2LO3 A;  3VHT B;  2EPX A;  2EMW A;  2ELZ A;  5KL2 A;  2GLI A;  3M99 B;  2EOF A;  2WBS A;  2D9H A;  2YTF A;  2ENA A;  2YTJ A;  1TN9 A;  2MKD A;  2YU8 A;  2EN1 A;  2MKN A;  1UN6 B;  2YSP A;  1X6H A;  2JPA A;  2EP3 A;  2EM7 A;  2DMI A;  2RPC A;  4FK5 C;  1X3C A;  2EM5 A;  3UK3 C;  4M9V C;  2EM9 A;  2PRT A;  2EMG A;  2CSH A;  2LVH A;  2YU5 A;  1A1K A;  5KL4 A;  4R2Q A;  2YTP A;  2JP9 A;  1YSA C;  2YRK A;  4R2D A;  4IJD A;  2EE8 A;  4R2R A;  1LLM C;  2EOE A;  2EOJ A;  2R1F A;  2EOM A;  2YTG A;  4F6M A;  2EM2 A;  2ELY A;  1A1H A;  2EMH A;  2EN4 A;  2YTI A;  2A25 A;  2BB8 A;  3EPL A;  2RSI A;  2M9A A;  2EPZ A;  2EOX A;  2VRD A;  2YTD A;  2I13 A;  2EMF A;  2HGH A;  2EQ3 A;  2YTQ A;  2WBU A;  2EMB A;  1A1F A;  2EOO A;  1A1I A;  5KL6 A;  1DGC A;  5KL5 A;  2EOQ A;  2YTE A;  2YRM A;  3EPJ A;  1RMD A;  2EMZ A;  2EML A;  3MHH C;  2LT7 A;  2EL5 A;  2EM0 A;  2MDG A;  2EMK A;  2EQ0 A;  4R2E A;  1NCS A;  4IS1 C;  1TF6 A;  1ZU1 A;  2EOR A; 
#chains in the Genus database with same CATH topology
 5KL7 A;  2ENH A;  3VYX A;  1TF3 A;  2LV2 A;  1X5W A;  1ZAA C;  2FTX B;  4LFB E;  2KOU A;  4LF4 E;  2YPN A;  2EM3 A;  3EPH A;  2MC5 A;  2MC6 A;  1YYO A;  1UHZ A;  5A2Q C;  4DMI A;  2M4I A;  2EMY A;  2LCE A;  5FLX C;  2L8T A;  4ZYE A;  4LF8 E;  1JK2 A;  2EMI A;  2EL4 A;  3ADJ A;  5A6B A;  2EPN A;  2V8Q B;  4R03 A;  4DR7 E;  1FKA E;  2EPP A;  4YHH E;  2KHX A;  4BBY A;  3DJW A;  3AUZ A;  4B3T E;  3J80 C;  1X6E A;  2GHF A;  4WX9 A;  1BBO A;  4BHB A;  1MEY C;  2EJ4 A;  2BBG A;  2EN7 A;  1UIL A;  1YYK A;  2HC5 A;  4F9C B;  2WCC 3;  4M30 A;  1YYW A;  2EOF A;  2EPK X;  2WBS A;  4DR6 E;  2ENA A;  1HNW E;  2N3H A;  4RHB B;  4X62 E;  3TQM A;  3IWC A;  2MKN A;  5LMN E;  2DMI A;  2DIX A;  1EH7 A;  1X3C A;  2EM5 A;  5A69 A;  1IBL E;  2PRT A;  2EMG A;  2LVH A;  3DF6 A;  2I9I A;  1L4S A;  2YTP A;  2UXC E;  5AE1 A;  2R1F A;  2EOM A;  2YTG A;  4DKK A;  2NUE A;  2FV4 B;  3BGH A;  4WSP A;  2EMH A;  4LF6 E;  2EZ6 A;  3HPS A;  2YTI A;  2LUQ A;  1T39 A;  1RQ0 A;  4M0V A;  4JI5 E;  2VQF E;  2L3J A;  3ADI A;  1J26 A;  2B7V A;  4J8Z A;  2I13 A;  2EQ3 A;  2YTQ A;  1SR9 A;  3J7Y p;  3F6H A;  2UUA E;  2M1S A;  5KL5 A;  2UUB E;  2UXD E;  3HXL A;  3HQ1 A;  2EML A;  4JI6 E;  5IXM B;  1N33 E;  2LJH A;  5BR8 E;  2F8B A;  1NCS A;  2L3C A;  3HTX A;  1ZU1 A;  2CTD A;  1PKP A;  4JI3 E;  1JK1 A;  4R2S A;  2EPU A;  4DV3 E;  4OOG C;  4F6N A;  2ENC A;  2JVA A;  3AV0 A;  4GZN C;  2JOX A;  4NXN E;  4X8W A;  1BB8 A;  1AAY A;  1P47 A;  3C6K A;  4O4K A;  1ZR9 A;  1G2D C;  4WPY A;  2ADR A;  4BS9 A;  2DLK A;  4R2C A;  2JXP A;  2EPR A;  2EM8 A;  1A1J A;  1XMQ E;  1A1G A;  2EM4 A;  2VQE E;  2VF1 A;  1WHN A;  2DLQ A;  2EOS A;  4P78 A;  4R2P A;  2L2K B;  2L92 A;  2EOY A;  1YPN A;  5AE2 A;  4ZYH A;  4F9A B;  4GEQ B;  4JI1 E;  2EM6 A;  3IWD A;  1YZ9 A;  3EPK A;  1I94 E;  1A1L A;  2H36 X;  4MLQ A;  1WJP A;  2YTO A;  4Q35 B;  5DNY A;  3MHS C;  1IBK E;  1YUI A;  2EPO A;  2NA2 A;  4L8N A;  4WSG A;  2LO3 A;  5LL6 R;  2JWO A;  2EMW A;  4Q28 A;  2ELZ A;  2GLI A;  3M99 B;  3F6G A;  2YTF A;  5A6A A;  3IWB A;  2EN1 A;  2RQL A;  1UN6 B;  2EP3 A;  2EM7 A;  4B3S E;  4FK5 C;  3EQ1 A;  2DB2 A;  4LTY A;  2EPM X;  4M9V C;  2YU5 A;  2ZM6 E;  2JY9 A;  4ZYD A;  2UUC E;  3KZY A;  4JI0 E;  4R2Q A;  2HHH E;  3LML A;  4HTG A;  1YSA C;  4X65 E;  2IHR 1;  1IBM E;  1IQS A;  4R2D A;  4IJD A;  2EE8 A;  3THN A;  1GTK A;  2EOJ A;  2EM2 A;  4F54 A;  3KWR A;  4KZS A;  1GQE A;  2A25 A;  5IT9 C;  1T4O A;  4MLV A;  4N4R B;  4WXC A;  2M9A A;  4WXD A;  2CPN A;  1J5E E;  4JYA E;  2VRD A;  2E5L E;  1PJS A;  2YWQ A;  1MGT A;  1A1F A;  4I8O A;  1A1I A;  3T1H E;  2RSM A;  5A6B D;  2YTE A;  1HNX E;  1RMD A;  4BCA A;  2LTS A;  2K4V A;  2LT7 A;  2EWL A;  2MDR A;  5AC5 A;  3P1X A;  2L33 A;  1T38 A;  2F4V E;  4GKJ E;  4ZYG A;  2V88 A;  3T1Y E;  4DV0 E;  2ODR C;  3L00 A;  4YY3 E;  1N34 E;  2LBS B;  1GZ6 A;  3VYY A;  5T6J A;  4DR4 E;  2B3T B;  1WRJ A;  1X49 A;  1G2F C;  4B3M E;  5A6K A;  2EOZ A;  4X66 E;  1SFE A;  2EN2 A;  2EMC A;  4BC7 A;  4DUY E;  4DR5 E;  1XNR E;  1KJK A;  1QU6 A;  1PDA A;  2LTR A;  3LLH A;  2YRH A;  1PJQ A;  4B3R E;  1ZBQ A;  2EMA A;  1F2I G;  2EPA A;  2YZT A;  1O0W A;  1Z1B A;  2RS7 A;  2YTN A;  2UU9 E;  2YSO A;  4X9J A;  3FIG A;  4O43 A;  2L2M A;  2CT1 A;  2EN6 A;  2J7J A;  3C4T A;  3C4B A;  2WZO A;  1WXR A;  2B9D A;  2DGC A;  2E72 A;  2LUP B;  4BMJ A;  2WBT A;  4NZV A;  3VHT B;  2EPX A;  2N8X A;  1KYQ A;  4NHR A;  2Q8U A;  3K6Q A;  2MKD A;  2YU8 A;  5TSE A;  2YSP A;  1X6H A;  2RPC A;  2L2N A;  4JI2 E;  3UK3 C;  5IWA E;  4JI4 E;  2CSH A;  1A1K A;  4RH8 A;  1N36 E;  5KL4 A;  4DV7 E;  4P7D A;  4DV5 E;  2JR1 A;  4OX9 E;  3RMP A;  1DQ3 A;  2YRK A;  1ZBT A;  2V83 A;  3BF2 A;  2V87 A;  4DV4 E;  1EH6 A;  4LF5 E;  2EOE A;  2NUF A;  1EKZ A;  4F6M A;  4GKK E;  4X64 E;  2ELY A;  2V89 A;  1A1H A;  3THO B;  2HJJ A;  2DSY A;  2EN4 A;  3EPL A;  3QG5 C;  2RSI A;  3OTO E;  2UXB E;  3OML A;  2GPI A;  2N3G A;  2L6M A;  1DGC A;  2B7T A;  5IV8 B;  2EOQ A;  1XMO E;  5AE3 A;  4F9B B;  2M7Q A;  3J81 C;  2JYA A;  3MHH C;  2EL5 A;  5CFF E;  2R76 A;  2LRS A;  2MDG A;  4R2E A;  4LF9 E;  4IS1 C;  3JAM C;  1RC7 A;  2V85 A;  2EOR A;  2EM9 A;  4R8O A;  3ECR A;  4KWY A;  2EL6 A;  2EN8 A;  2G7H A;  4LFA E;  2LMZ A;  5ADZ A;  3ZOQ B;  1X6F A;  4DV2 E;  3C6M A;  2NAB A;  2YT4 A;  3JTZ A;  2EPC A;  3MSW A;  4F2J C;  2LE2 A;  4JI8 E;  2DRP A;  4L5N C;  2EN3 A;  2EQ1 A;  3J7A G;  4R2A A;  4WFT A;  1HR0 E;  4JV5 E;  4LF7 E;  3H09 A;  1IQO A;  1UBD C;  4TUI A;  5A6J A;  1YUJ A;  1QNT A;  1AH5 A;  4DR2 E;  2EOH A;  2RTX A;  4K0K E;  1T4L B;  1XNQ E;  2E1M A;  5LLQ A;  2EOI A;  5KL3 A;  1B69 A;  2NUG A;  3HPZ A;  2EMX A;  4O5G A;  4DUZ E;  4DR1 E;  5KL2 A;  3BBG A;  4BC9 A;  1EH8 A;  2D9H A;  2DMY A;  1BBG A;  2YTJ A;  1TN9 A;  3JU0 A;  2V86 A;  4BHC A;  3VK6 A;  2JOB A;  2JPA A;  3BID A;  2RS6 A;  1T4N A;  2FGG A;  4DV1 E;  2K7I A;  1WHQ A;  1FJG E;  4DR3 E;  4LU9 A;  5AC4 A;  2JP9 A;  4LFC E;  4R2R A;  4WYQ B;  1LLM C;  4AQY E;  1X48 A;  1X47 A;  4O24 A;  2KON A;  4JI7 E;  5LMU E;  3ADG A;  1YFH A;  3KZZ A;  1N3G A;  2VE7 C;  2BB8 A;  4TUG A;  1HNZ E;  2EPZ A;  2EPL X;  5F3W A;  2EOX A;  1DI2 A;  2YTD A;  1PJT A;  1NEI A;  4M2Z A;  3ADL A;  1STU A;  2EMF A;  2HGH A;  4DV6 E;  2LJU A;  2WBU A;  2EMB A;  1IMU A;  2EOO A;  1N32 E;  4HEI A;  5KL6 A;  4KHP E;  2YRM A;  2ODR D;  3EPJ A;  2EMZ A;  4NXM E;  2EM0 A;  2EMK A;  2EQ0 A;  1TF6 A;  5AAS A; 
#chains in the Genus database with same CATH homology
 2CTD A;  5KL7 A;  2ENH A;  1JK1 A;  2EL6 A;  2EN8 A;  4R2S A;  2EPU A;  4F6N A;  2LV2 A;  1TF3 A;  2ENC A;  4GZN C;  1X5W A;  1ZAA C;  1X6F A;  1G2F C;  1BB8 A;  1AAY A;  2NAB A;  1P47 A;  2EOZ A;  1ZR9 A;  2EM3 A;  3EPH A;  1G2D C;  2EPC A;  2ADR A;  4F2J C;  2EN2 A;  2DLK A;  2EMC A;  4R2C A;  2DRP A;  1KJK A;  2EMY A;  2LCE A;  2EN3 A;  2EPR A;  2EM8 A;  2EQ1 A;  1A1J A;  2YRH A;  4R2A A;  1JK2 A;  1A1G A;  1F2I G;  2EMA A;  2EMI A;  2EL4 A;  2EM4 A;  2EPA A;  1Z1B A;  1UBD C;  2YTN A;  2DLQ A;  2EPP A;  2YSO A;  4X9J A;  2EOS A;  1YUJ A;  2CT1 A;  4R2P A;  2EN6 A;  2J7J A;  2EOY A;  1X6E A;  2GHF A;  2EM6 A;  1BBO A;  1MEY C;  3EPK A;  2EOH A;  2EJ4 A;  1A1L A;  2DGC A;  2EN7 A;  2E72 A;  1WJP A;  2EOI A;  2YTO A;  5KL3 A;  1B69 A;  2WCC 3;  3MHS C;  1YUI A;  2EMX A;  2WBT A;  4WSG A;  2LO3 A;  3VHT B;  2EPX A;  2EMW A;  2ELZ A;  5KL2 A;  2GLI A;  3M99 B;  2EOF A;  2WBS A;  2D9H A;  2YTF A;  2ENA A;  2YTJ A;  1TN9 A;  2MKD A;  2YU8 A;  2EN1 A;  2MKN A;  1UN6 B;  2YSP A;  1X6H A;  2JPA A;  2EP3 A;  2EM7 A;  2DMI A;  2RPC A;  4FK5 C;  1X3C A;  2EM5 A;  3UK3 C;  4M9V C;  2EM9 A;  2PRT A;  2EMG A;  2CSH A;  2LVH A;  2YU5 A;  1A1K A;  5KL4 A;  4R2Q A;  2YTP A;  2JP9 A;  1YSA C;  2YRK A;  4R2D A;  4IJD A;  2EE8 A;  4R2R A;  1LLM C;  2EOE A;  2EOJ A;  2R1F A;  2EOM A;  2YTG A;  4F6M A;  2EM2 A;  2ELY A;  1A1H A;  2EMH A;  2EN4 A;  2YTI A;  2A25 A;  2BB8 A;  3EPL A;  2RSI A;  2M9A A;  2EPZ A;  2EOX A;  2VRD A;  2YTD A;  2I13 A;  2EMF A;  2HGH A;  2EQ3 A;  2YTQ A;  2WBU A;  2EMB A;  1A1F A;  2EOO A;  1A1I A;  5KL6 A;  1DGC A;  5KL5 A;  2EOQ A;  2YTE A;  2YRM A;  3EPJ A;  1RMD A;  2EMZ A;  2EML A;  3MHH C;  2LT7 A;  2EL5 A;  2EM0 A;  2MDG A;  2EMK A;  2EQ0 A;  4R2E A;  1NCS A;  4IS1 C;  1TF6 A;  1ZU1 A;  2EOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...