2EPAA

Solution structure of the first and second zf-c2h2 domains from human krueppel-like factor 10
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
72
structure length
72
Chain Sequence
b'GSSGSSGPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Krueppel-like factor 10
publication title Solution structure of the first and second zf-C2H2 domains from human Krueppel-like factor 10
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epaA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epaA01
2EQ0A 1UN6B 2EMCA 2EQ1A 2NABA 2YSPA 4IS1C 3VHTB 4GZNC 2EMLA 2EN3A 2YRKA 3EPJA 2MDGA 2EOSA 2I13A 2GHFA 2E72A 1P47A 2EJ4A 2YTIA 2EN7A 2DLQA 4R2DA 2RPCA 2EOJA 5KL7A 2LVHA 4R2SA 2EN2A 2EPZA 2EM8A 1ZAAC 1YUJA 2EOQA 1A1GA 3EPHA 2ENCA 2LCEA 1X5WA 3EPLA 2JP9A 2YTOA 1BB8A 4R2QA 2A25A 3M99B 2YU5A 2EL4A 2CSHA 2YTNA 2RSIA 1YSAC 1BBOA 2EMGA 2JPAA 4FK5C 2MKNA 2R1FA 2ADRA 4X9JA 1JK1A 1MEYC 1X6HA 1RMDA 2EN1A 1G2DC 2YSOA 2EM9A 2EMZA 4R2EA 2EOHA 1A1FA 2M9AA 4F6MA 1F2IG 2ELZA 1DGCA 1ZR9A 4R2AA 2EM4A 2EMKA 2EPRA 1TF3A 2EPPA 2WCC3 2DGCA 2ENHA 2EP3A 2EORA 1A1JA 2MKDA 1G2FC 1X6EA 3EPKA 1LLMC 2LV2A 2CTDA 2YTPA 2J7JA 4F2JC 1A1KA 2EN8A 2PRTA 2EL5A 2EPCA 2HGHA 4M9VC 2EL6A 1JK2A 2EMIA 2DMIA 2DLKA 1A1HA 1A1IA 2DRPA 5KL2A 2EOOA 2EOYA 1NCSA 1WJPA 4R2CA 2EOZA 2EM6A 4WSGA 2EPAA 2YTJA 2ENAA 2LO3A 2CT1A 2EN6A 2EOXA 2YRHA 3MHHC 2YTDA 2ELYA 4R2RA 2WBSA 1UBDC 1AAYA 2EMXA 2EM3A 2EMHA 2EOIA 2EOMA 1KJKA 2EMAA 2YTEA 1TN9A 1X3CA 2EOFA 2EMWA 2WBUA 2BB8A 2EPUA 1B69A 2EE8A 2EQ3A 5KL3A 2EMBA 2EM2A 2EPXA 1Z1BA 2EM7A 2LT7A 2YTQA 2EMFA 1YUIA 2VRDA 2YRMA 3UK3C 2EMYA 2YU8A 4R2PA 2YTFA 2GLIA 2EN4A 5KL6A 3MHSC 1ZU1A 1A1LA 2EM0A 2WBTA 2D9HA 2YTGA 1TF6A 4F6NA 1X6FA 5KL4A 2EOEA 2EM5A 5KL5A 4IJDA
chains in the Genus database with same CATH superfamily
2F4VE 5IT9C 2EMLA 3VYXA 1HR0E 2YRKA 3THOB 2M4IA 5A6KA 4LFAE 2MDGA 2UXBE 4L8NA 2I13A 2E72A 3J7Yp 1T4NA 2YTIA 2MC6A 1IMUA 5KL7A 2LVHA 3IWDA 4HEIA 4O24A 2EPZA 1YUJA 4DV4E 3C6MA 1SFEA 2L2KB 2ZM6E 2F8BA 2VQFE 5T6JA 4F9AB 2EL4A 4TUIA 1EH7A 1QNTA 3L00A 2EMGA 2Q8UA 4KWYA 2G7HA 4JI5E 4LF5E 1X6HA 4JI7E 2L33A 4KZSA 2JOXA 1A1FA 2M9AA 2DSYA 2LE2A 1ZR9A 2EM4A 2DGCA 1G2FC 1FJGE 1J26A 5LMUE 2H36X 3MSWA 4OX9E 3HQ1A 2UU9E 4BHBA 2YTPA 4LF7E 2UUBE 2JR1A 2GPIA 4F2JC 1A1KA 2EN8A 4HTGA 2V8QB 1YYOA 4M9VC 4DV3E 2N3HA 2EL6A 4X66E 4DR5E 1WXRA 3KZZA 5AE1A 1PKPA 2EOZA 4WSGA 4B3ME 4JV5E 2CT1A 3EQ1A 4MLVA 3DJWA 5IV8B 1GZ6A 1EH8A 2YTDA 3HPZA 5AE3A 1RC7A 1DI2A 3VK6A 4GEQB 2WBSA 5AC4A 2EM3A 1AH5A 2B3TB 4Q28A 2NUFA 1PJQA 1FKAE 2EOFA 2RSMA 1B69A 4YY3E 2EMBA 1XNRE 2YTQA 2EMFA 3OMLA 1N36E 5FLXC 4LFBE 2M7QA 3F6GA 5LMNE 3BGHA 3LLHA 3DF6A 1EH6A 4BC7A 2EOEA 2EM5A 2N3GA 2L3JA 1IQOA 2EQ0A 2V83A 2L92A 2EMCA 2EQ1A 1IBLE 1IBKE 3VHTB 2HHHE 5A6AA 4GZNC 2MC5A 2EN3A 5AASA 3BIDA 4WXCA 4B3TE 3KWRA 3FIGA 4BBYA 2DLQA 4R2DA 4J8ZA 2EWLA 2RPCA 4LU9A 2EOQA 1A1GA 3EPHA 2LCEA 1I94E 4R2QA 2A25A 4BS9A 2YTNA 1BBOA 2YWQA 4NXNE 2UXCE 2MKNA 1UILA 2UXDE 3ADIA 2JY9A 4DR4E 3HPSA 1HNXE 4M30A 2EM9A 2EMZA 2YZTA 4F6MA 1F2IG 4DUZE 3OTOE 2L3CA 1GTKA 4DV6E 4R2AA 3JU0A 2EMKA 2EPRA 5DNYA 1T4OA 1ZBTA 3QG5C 2EP3A 2EORA 3H09A 2LMZA 2LV2A 3AV0A 4BCAA 2KONA 2ODRD 4F9CB 4DV1E 2BBGA 2PRTA 2DLKA 2NA2A 4GKKE 4KHPE 1NCSA 4JI2E 1WJPA 4R2CA 4B3RE 2NUEA 2EM6A 2HC5A 5AE2A 1BBGA 2DIXA 2MDRA 2ELYA 1XMQE 5A6BD 1XMOE 2EMHA 2LJUA 4Q35B 4LF8E 4BC9A 1X3CA 2IHR1 2VE7C 5LL6R 5A69A 1Z1BA 2EM7A 2V86A 2LT7A 2L2NA 5AC5A 4DR2E 4WX9A 2EMYA 3T1HE 2YTFA 2V88A 1YPNA 1YZ9A 2B7TA 4DUYE 1ZU1A 4M0VA 1IBME 4YHHE 1TF6A 2EPKX 4TUGA 1L4SA 3IWCA 2V89A 4LF4E 2L2MA 4X8WA 4IS1C 2YSPA 3F6HA 1N34E 2YPNA 2LJHA 3AUZA 3T1YE 2EZ6A 3EPJA 1T38A 3JTZA 2EPNA 2EOSA 4O43A 1X48A 2GHFA 4P78A 2EJ4A 2EN7A 4ZYDA 1RQ0A 4R2SA 2EN2A 4DR1E 2RS6A 4LFCE 1ZAAC 2JOBA 4JI0E 2LUQA 1MGTA 3EPLA 2JP9A 4DV5E 3K6QA 2YTOA 1BB8A 2UUCE 2YU5A 1GQEA 3P1XA 4BHCA 5F3WA 2VF1A 5BR8E 2JYAA 2JPAA 3ZOQB 4X64E 2EPLX 4FK5C 4K0KE 2R1FA 2ADRA 1JK1A 1WRJA 1MEYC 3ECRA 3TQMA 5A6JA 2EN1A 2YSOA 2K7IA 1ZBQA 3IWBA 2EOHA 4DV2E 4LTYA 1DGCA 2FTXB 1HNWE 1TF3A 1WHNA 1NEIA 2HJJA 1WHQA 2KHXA 4AQYE 2MKDA 1YYKA 2RTXA 2R76A 4ZYGA 5A6BA 2E1MA 2LRSA 2J7JA 3THNA 4F54A 1KYQA 1N3GA 4JI4E 1N32E 2EL5A 2EPCA 3ADJA 1EKZA 1JK2A 4R8OA 2EMIA 4JI1E 2DMIA 1A1HA 3BF2A 3J7AG 5KL2A 2EOYA 4M2ZA 4LF6E 2EPAA 2YTJA 4JYAE 4RH8A 2ENAA 2EN6A 2VQEE 2EOXA 3MHHC 4I8OA 4R2RA 2KOUA 2EMXA 4WFTA 4X65E 2EOIA 2EOMA 1AAYA 3C4BA 1TN9A 2EMWA 2B7VA 2WBUA 2EPUA 4DV7E 2EE8A 4WYQB 2N8XA 2DB2A 2EM2A 2EPXA 2FGGA 4DKKA 2RS7A 2FV4B 2VRDA 2YT4A 2YRMA 2NUGA 4R2PA 3KZYA 3ADLA 2K4VA 1A1LA 2JXPA 1PJTA 2YTGA 2DMYA 1X6FA 4NHRA 4O5GA 4JI6E 4IJDA 1UN6B 3J81C 2NABA 4LF9E 3BBGA 5LLQA 4O4KA 4ZYEA 5IWAE 3HXLA 4L5NC 4B3SE 4NXME 5ADZA 2L8TA 4P7DA 1P47A 4WXDA 1IQSA 1O0WA 1T4LB 5CFFE 2EOJA 4WPYA 1HNZE 1DQ3A 2EM8A 2ENCA 3VYYA 1X5WA 3M99B 3ADGA 2CSHA 4DR3E 2RSIA 1YSAC 2EPOA 4N4RB 3C6KA 4X9JA 5A2QC 1J5EE 1RMDA 2CPNA 1G2DC 2JVAA 4R2EA 2LTRA 4JI3E 2ELZA 5IXMB 3HTXA 1STUA 2EPPA 1PJSA 3RMPA 2WCC3 2ENHA 2E5LE 1A1JA 1X6EA 3EPKA 2LTSA 1LLMC 2CTDA 4DR7E 4RHBB 4F9BB 1T39A 1YYWA 2LUPB 2V85A 3J80C 2EPMX 1N33E 2HGHA 1XNQE 4DMIA 2UUAE 1QU6A 4BMJA 2L6MA 1A1IA 2DRPA 4R03A 2EOOA 4NZVA 2LO3A 1SR9A 2WZOA 1X49A 2YRHA 2RQLA 1UBDC 4X62E 4ZYHA 1KJKA 4GKJE 2EMAA 2M1SA 2YTEA 4MLQA 1UHZA 2BB8A 2EQ3A 5KL3A 2LBSB 2ODRC 1X47A 3C4TA 1YFHA 2JWOA 1YUIA 3JAMC 2GLIA 3UK3C 2YU8A 2EN4A 4WSPA 5KL6A 3MHSC 2EM0A 2I9IA 2V87A 2WBTA 2D9HA 4DV0E 3LMLA 4F6NA 4JI8E 5KL4A 1PDAA 2B9DA 4OOGC 5KL5A 4DR6E 5TSEA
chains in the Genus database with same CATH topology
2EQ0A 1UN6B 2EMCA 2EQ1A 2NABA 2YSPA 4IS1C 3VHTB 4GZNC 2EMLA 2EN3A 2YRKA 3EPJA 2MDGA 2EOSA 2I13A 2GHFA 2E72A 1P47A 2EJ4A 2YTIA 2EN7A 2DLQA 4R2DA 2RPCA 2EOJA 5KL7A 2LVHA 4R2SA 2EN2A 2EPZA 2EM8A 1ZAAC 1YUJA 2EOQA 1A1GA 3EPHA 2ENCA 2LCEA 1X5WA 3EPLA 2JP9A 2YTOA 1BB8A 4R2QA 2A25A 3M99B 2YU5A 2EL4A 2CSHA 2YTNA 2RSIA 1YSAC 1BBOA 2EMGA 2JPAA 4FK5C 2MKNA 2R1FA 2ADRA 4X9JA 1JK1A 1MEYC 1X6HA 1RMDA 2EN1A 1G2DC 2YSOA 2EM9A 2EMZA 4R2EA 2EOHA 1A1FA 2M9AA 4F6MA 1F2IG 2ELZA 1DGCA 1ZR9A 4R2AA 2EM4A 2EMKA 2EPRA 1TF3A 2EPPA 2WCC3 2DGCA 2ENHA 2EP3A 2EORA 1A1JA 2MKDA 1G2FC 1X6EA 3EPKA 1LLMC 2LV2A 2CTDA 2YTPA 2J7JA 4F2JC 1A1KA 2EN8A 2PRTA 2EL5A 2EPCA 2HGHA 4M9VC 2EL6A 1JK2A 2EMIA 2DMIA 2DLKA 1A1HA 1A1IA 2DRPA 5KL2A 2EOOA 2EOYA 1NCSA 1WJPA 4R2CA 2EOZA 2EM6A 4WSGA 2EPAA 2YTJA 2ENAA 2LO3A 2CT1A 2EN6A 2EOXA 2YRHA 3MHHC 2YTDA 2ELYA 4R2RA 2WBSA 1UBDC 1AAYA 2EMXA 2EM3A 2EMHA 2EOIA 2EOMA 1KJKA 2EMAA 2YTEA 1TN9A 1X3CA 2EOFA 2EMWA 2WBUA 2BB8A 2EPUA 1B69A 2EE8A 2EQ3A 5KL3A 2EMBA 2EM2A 2EPXA 1Z1BA 2EM7A 2LT7A 2YTQA 2EMFA 1YUIA 2VRDA 2YRMA 3UK3C 2EMYA 2YU8A 4R2PA 2YTFA 2GLIA 2EN4A 5KL6A 3MHSC 1ZU1A 1A1LA 2EM0A 2WBTA 2D9HA 2YTGA 1TF6A 4F6NA 1X6FA 5KL4A 2EOEA 2EM5A 5KL5A 4IJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQ0 A;  1UN6 B;  2EMC A;  2EQ1 A;  2NAB A;  2YSP A;  4IS1 C;  3VHT B;  4GZN C;  2EML A;  2EN3 A;  2YRK A;  3EPJ A;  2MDG A;  2EOS A;  2I13 A;  2GHF A;  2E72 A;  1P47 A;  2EJ4 A;  2YTI A;  2EN7 A;  2DLQ A;  4R2D A;  2RPC A;  2EOJ A;  5KL7 A;  2LVH A;  4R2S A;  2EN2 A;  2EPZ A;  2EM8 A;  1ZAA C;  1YUJ A;  2EOQ A;  1A1G A;  3EPH A;  2ENC A;  2LCE A;  1X5W A;  3EPL A;  2JP9 A;  2YTO A;  1BB8 A;  4R2Q A;  2A25 A;  3M99 B;  2YU5 A;  2EL4 A;  2CSH A;  2YTN A;  2RSI A;  1YSA C;  1BBO A;  2EMG A;  2JPA A;  4FK5 C;  2MKN A;  2R1F A;  2ADR A;  4X9J A;  1JK1 A;  1MEY C;  1X6H A;  1RMD A;  2EN1 A;  1G2D C;  2YSO A;  2EM9 A;  2EMZ A;  4R2E A;  2EOH A;  1A1F A;  2M9A A;  4F6M A;  1F2I G;  2ELZ A;  1DGC A;  1ZR9 A;  4R2A A;  2EM4 A;  2EMK A;  2EPR A;  1TF3 A;  2EPP A;  2WCC 3;  2DGC A;  2ENH A;  2EP3 A;  2EOR A;  1A1J A;  2MKD A;  1G2F C;  1X6E A;  3EPK A;  1LLM C;  2LV2 A;  2CTD A;  2YTP A;  2J7J A;  4F2J C;  1A1K A;  2EN8 A;  2PRT A;  2EL5 A;  2EPC A;  2HGH A;  4M9V C;  2EL6 A;  1JK2 A;  2EMI A;  2DMI A;  2DLK A;  1A1H A;  1A1I A;  2DRP A;  5KL2 A;  2EOO A;  2EOY A;  1NCS A;  1WJP A;  4R2C A;  2EOZ A;  2EM6 A;  4WSG A;  2EPA A;  2YTJ A;  2ENA A;  2LO3 A;  2CT1 A;  2EN6 A;  2EOX A;  2YRH A;  3MHH C;  2YTD A;  2ELY A;  4R2R A;  2WBS A;  1UBD C;  1AAY A;  2EMX A;  2EM3 A;  2EMH A;  2EOI A;  2EOM A;  1KJK A;  2EMA A;  2YTE A;  1TN9 A;  1X3C A;  2EOF A;  2EMW A;  2WBU A;  2BB8 A;  2EPU A;  1B69 A;  2EE8 A;  2EQ3 A;  5KL3 A;  2EMB A;  2EM2 A;  2EPX A;  1Z1B A;  2EM7 A;  2LT7 A;  2YTQ A;  2EMF A;  1YUI A;  2VRD A;  2YRM A;  3UK3 C;  2EMY A;  2YU8 A;  4R2P A;  2YTF A;  2GLI A;  2EN4 A;  5KL6 A;  3MHS C;  1ZU1 A;  1A1L A;  2EM0 A;  2WBT A;  2D9H A;  2YTG A;  1TF6 A;  4F6N A;  1X6F A;  5KL4 A;  2EOE A;  2EM5 A;  5KL5 A;  4IJD A; 
#chains in the Genus database with same CATH topology
 2F4V E;  5IT9 C;  2EML A;  3VYX A;  1HR0 E;  2YRK A;  3THO B;  2M4I A;  5A6K A;  4LFA E;  2MDG A;  2UXB E;  4L8N A;  2I13 A;  2E72 A;  3J7Y p;  1T4N A;  2YTI A;  2MC6 A;  1IMU A;  5KL7 A;  2LVH A;  3IWD A;  4HEI A;  4O24 A;  2EPZ A;  1YUJ A;  4DV4 E;  3C6M A;  1SFE A;  2L2K B;  2ZM6 E;  2F8B A;  2VQF E;  5T6J A;  4F9A B;  2EL4 A;  4TUI A;  1EH7 A;  1QNT A;  3L00 A;  2EMG A;  2Q8U A;  4KWY A;  2G7H A;  4JI5 E;  4LF5 E;  1X6H A;  4JI7 E;  2L33 A;  4KZS A;  2JOX A;  1A1F A;  2M9A A;  2DSY A;  2LE2 A;  1ZR9 A;  2EM4 A;  2DGC A;  1G2F C;  1FJG E;  1J26 A;  5LMU E;  2H36 X;  3MSW A;  4OX9 E;  3HQ1 A;  2UU9 E;  4BHB A;  2YTP A;  4LF7 E;  2UUB E;  2JR1 A;  2GPI A;  4F2J C;  1A1K A;  2EN8 A;  4HTG A;  2V8Q B;  1YYO A;  4M9V C;  4DV3 E;  2N3H A;  2EL6 A;  4X66 E;  4DR5 E;  1WXR A;  3KZZ A;  5AE1 A;  1PKP A;  2EOZ A;  4WSG A;  4B3M E;  4JV5 E;  2CT1 A;  3EQ1 A;  4MLV A;  3DJW A;  5IV8 B;  1GZ6 A;  1EH8 A;  2YTD A;  3HPZ A;  5AE3 A;  1RC7 A;  1DI2 A;  3VK6 A;  4GEQ B;  2WBS A;  5AC4 A;  2EM3 A;  1AH5 A;  2B3T B;  4Q28 A;  2NUF A;  1PJQ A;  1FKA E;  2EOF A;  2RSM A;  1B69 A;  4YY3 E;  2EMB A;  1XNR E;  2YTQ A;  2EMF A;  3OML A;  1N36 E;  5FLX C;  4LFB E;  2M7Q A;  3F6G A;  5LMN E;  3BGH A;  3LLH A;  3DF6 A;  1EH6 A;  4BC7 A;  2EOE A;  2EM5 A;  2N3G A;  2L3J A;  1IQO A;  2EQ0 A;  2V83 A;  2L92 A;  2EMC A;  2EQ1 A;  1IBL E;  1IBK E;  3VHT B;  2HHH E;  5A6A A;  4GZN C;  2MC5 A;  2EN3 A;  5AAS A;  3BID A;  4WXC A;  4B3T E;  3KWR A;  3FIG A;  4BBY A;  2DLQ A;  4R2D A;  4J8Z A;  2EWL A;  2RPC A;  4LU9 A;  2EOQ A;  1A1G A;  3EPH A;  2LCE A;  1I94 E;  4R2Q A;  2A25 A;  4BS9 A;  2YTN A;  1BBO A;  2YWQ A;  4NXN E;  2UXC E;  2MKN A;  1UIL A;  2UXD E;  3ADI A;  2JY9 A;  4DR4 E;  3HPS A;  1HNX E;  4M30 A;  2EM9 A;  2EMZ A;  2YZT A;  4F6M A;  1F2I G;  4DUZ E;  3OTO E;  2L3C A;  1GTK A;  4DV6 E;  4R2A A;  3JU0 A;  2EMK A;  2EPR A;  5DNY A;  1T4O A;  1ZBT A;  3QG5 C;  2EP3 A;  2EOR A;  3H09 A;  2LMZ A;  2LV2 A;  3AV0 A;  4BCA A;  2KON A;  2ODR D;  4F9C B;  4DV1 E;  2BBG A;  2PRT A;  2DLK A;  2NA2 A;  4GKK E;  4KHP E;  1NCS A;  4JI2 E;  1WJP A;  4R2C A;  4B3R E;  2NUE A;  2EM6 A;  2HC5 A;  5AE2 A;  1BBG A;  2DIX A;  2MDR A;  2ELY A;  1XMQ E;  5A6B D;  1XMO E;  2EMH A;  2LJU A;  4Q35 B;  4LF8 E;  4BC9 A;  1X3C A;  2IHR 1;  2VE7 C;  5LL6 R;  5A69 A;  1Z1B A;  2EM7 A;  2V86 A;  2LT7 A;  2L2N A;  5AC5 A;  4DR2 E;  4WX9 A;  2EMY A;  3T1H E;  2YTF A;  2V88 A;  1YPN A;  1YZ9 A;  2B7T A;  4DUY E;  1ZU1 A;  4M0V A;  1IBM E;  4YHH E;  1TF6 A;  2EPK X;  4TUG A;  1L4S A;  3IWC A;  2V89 A;  4LF4 E;  2L2M A;  4X8W A;  4IS1 C;  2YSP A;  3F6H A;  1N34 E;  2YPN A;  2LJH A;  3AUZ A;  3T1Y E;  2EZ6 A;  3EPJ A;  1T38 A;  3JTZ A;  2EPN A;  2EOS A;  4O43 A;  1X48 A;  2GHF A;  4P78 A;  2EJ4 A;  2EN7 A;  4ZYD A;  1RQ0 A;  4R2S A;  2EN2 A;  4DR1 E;  2RS6 A;  4LFC E;  1ZAA C;  2JOB A;  4JI0 E;  2LUQ A;  1MGT A;  3EPL A;  2JP9 A;  4DV5 E;  3K6Q A;  2YTO A;  1BB8 A;  2UUC E;  2YU5 A;  1GQE A;  3P1X A;  4BHC A;  5F3W A;  2VF1 A;  5BR8 E;  2JYA A;  2JPA A;  3ZOQ B;  4X64 E;  2EPL X;  4FK5 C;  4K0K E;  2R1F A;  2ADR A;  1JK1 A;  1WRJ A;  1MEY C;  3ECR A;  3TQM A;  5A6J A;  2EN1 A;  2YSO A;  2K7I A;  1ZBQ A;  3IWB A;  2EOH A;  4DV2 E;  4LTY A;  1DGC A;  2FTX B;  1HNW E;  1TF3 A;  1WHN A;  1NEI A;  2HJJ A;  1WHQ A;  2KHX A;  4AQY E;  2MKD A;  1YYK A;  2RTX A;  2R76 A;  4ZYG A;  5A6B A;  2E1M A;  2LRS A;  2J7J A;  3THN A;  4F54 A;  1KYQ A;  1N3G A;  4JI4 E;  1N32 E;  2EL5 A;  2EPC A;  3ADJ A;  1EKZ A;  1JK2 A;  4R8O A;  2EMI A;  4JI1 E;  2DMI A;  1A1H A;  3BF2 A;  3J7A G;  5KL2 A;  2EOY A;  4M2Z A;  4LF6 E;  2EPA A;  2YTJ A;  4JYA E;  4RH8 A;  2ENA A;  2EN6 A;  2VQE E;  2EOX A;  3MHH C;  4I8O A;  4R2R A;  2KOU A;  2EMX A;  4WFT A;  4X65 E;  2EOI A;  2EOM A;  1AAY A;  3C4B A;  1TN9 A;  2EMW A;  2B7V A;  2WBU A;  2EPU A;  4DV7 E;  2EE8 A;  4WYQ B;  2N8X A;  2DB2 A;  2EM2 A;  2EPX A;  2FGG A;  4DKK A;  2RS7 A;  2FV4 B;  2VRD A;  2YT4 A;  2YRM A;  2NUG A;  4R2P A;  3KZY A;  3ADL A;  2K4V A;  1A1L A;  2JXP A;  1PJT A;  2YTG A;  2DMY A;  1X6F A;  4NHR A;  4O5G A;  4JI6 E;  4IJD A;  1UN6 B;  3J81 C;  2NAB A;  4LF9 E;  3BBG A;  5LLQ A;  4O4K A;  4ZYE A;  5IWA E;  3HXL A;  4L5N C;  4B3S E;  4NXM E;  5ADZ A;  2L8T A;  4P7D A;  1P47 A;  4WXD A;  1IQS A;  1O0W A;  1T4L B;  5CFF E;  2EOJ A;  4WPY A;  1HNZ E;  1DQ3 A;  2EM8 A;  2ENC A;  3VYY A;  1X5W A;  3M99 B;  3ADG A;  2CSH A;  4DR3 E;  2RSI A;  1YSA C;  2EPO A;  4N4R B;  3C6K A;  4X9J A;  5A2Q C;  1J5E E;  1RMD A;  2CPN A;  1G2D C;  2JVA A;  4R2E A;  2LTR A;  4JI3 E;  2ELZ A;  5IXM B;  3HTX A;  1STU A;  2EPP A;  1PJS A;  3RMP A;  2WCC 3;  2ENH A;  2E5L E;  1A1J A;  1X6E A;  3EPK A;  2LTS A;  1LLM C;  2CTD A;  4DR7 E;  4RHB B;  4F9B B;  1T39 A;  1YYW A;  2LUP B;  2V85 A;  3J80 C;  2EPM X;  1N33 E;  2HGH A;  1XNQ E;  4DMI A;  2UUA E;  1QU6 A;  4BMJ A;  2L6M A;  1A1I A;  2DRP A;  4R03 A;  2EOO A;  4NZV A;  2LO3 A;  1SR9 A;  2WZO A;  1X49 A;  2YRH A;  2RQL A;  1UBD C;  4X62 E;  4ZYH A;  1KJK A;  4GKJ E;  2EMA A;  2M1S A;  2YTE A;  4MLQ A;  1UHZ A;  2BB8 A;  2EQ3 A;  5KL3 A;  2LBS B;  2ODR C;  1X47 A;  3C4T A;  1YFH A;  2JWO A;  1YUI A;  3JAM C;  2GLI A;  3UK3 C;  2YU8 A;  2EN4 A;  4WSP A;  5KL6 A;  3MHS C;  2EM0 A;  2I9I A;  2V87 A;  2WBT A;  2D9H A;  4DV0 E;  3LML A;  4F6N A;  4JI8 E;  5KL4 A;  1PDA A;  2B9D A;  4OOG C;  5KL5 A;  4DR6 E;  5TSE A; 
#chains in the Genus database with same CATH homology
 2EQ0 A;  1UN6 B;  2EMC A;  2EQ1 A;  2NAB A;  2YSP A;  4IS1 C;  3VHT B;  4GZN C;  2EML A;  2EN3 A;  2YRK A;  3EPJ A;  2MDG A;  2EOS A;  2I13 A;  2GHF A;  2E72 A;  1P47 A;  2EJ4 A;  2YTI A;  2EN7 A;  2DLQ A;  4R2D A;  2RPC A;  2EOJ A;  5KL7 A;  2LVH A;  4R2S A;  2EN2 A;  2EPZ A;  2EM8 A;  1ZAA C;  1YUJ A;  2EOQ A;  1A1G A;  3EPH A;  2ENC A;  2LCE A;  1X5W A;  3EPL A;  2JP9 A;  2YTO A;  1BB8 A;  4R2Q A;  2A25 A;  3M99 B;  2YU5 A;  2EL4 A;  2CSH A;  2YTN A;  2RSI A;  1YSA C;  1BBO A;  2EMG A;  2JPA A;  4FK5 C;  2MKN A;  2R1F A;  2ADR A;  4X9J A;  1JK1 A;  1MEY C;  1X6H A;  1RMD A;  2EN1 A;  1G2D C;  2YSO A;  2EM9 A;  2EMZ A;  4R2E A;  2EOH A;  1A1F A;  2M9A A;  4F6M A;  1F2I G;  2ELZ A;  1DGC A;  1ZR9 A;  4R2A A;  2EM4 A;  2EMK A;  2EPR A;  1TF3 A;  2EPP A;  2WCC 3;  2DGC A;  2ENH A;  2EP3 A;  2EOR A;  1A1J A;  2MKD A;  1G2F C;  1X6E A;  3EPK A;  1LLM C;  2LV2 A;  2CTD A;  2YTP A;  2J7J A;  4F2J C;  1A1K A;  2EN8 A;  2PRT A;  2EL5 A;  2EPC A;  2HGH A;  4M9V C;  2EL6 A;  1JK2 A;  2EMI A;  2DMI A;  2DLK A;  1A1H A;  1A1I A;  2DRP A;  5KL2 A;  2EOO A;  2EOY A;  1NCS A;  1WJP A;  4R2C A;  2EOZ A;  2EM6 A;  4WSG A;  2EPA A;  2YTJ A;  2ENA A;  2LO3 A;  2CT1 A;  2EN6 A;  2EOX A;  2YRH A;  3MHH C;  2YTD A;  2ELY A;  4R2R A;  2WBS A;  1UBD C;  1AAY A;  2EMX A;  2EM3 A;  2EMH A;  2EOI A;  2EOM A;  1KJK A;  2EMA A;  2YTE A;  1TN9 A;  1X3C A;  2EOF A;  2EMW A;  2WBU A;  2BB8 A;  2EPU A;  1B69 A;  2EE8 A;  2EQ3 A;  5KL3 A;  2EMB A;  2EM2 A;  2EPX A;  1Z1B A;  2EM7 A;  2LT7 A;  2YTQ A;  2EMF A;  1YUI A;  2VRD A;  2YRM A;  3UK3 C;  2EMY A;  2YU8 A;  4R2P A;  2YTF A;  2GLI A;  2EN4 A;  5KL6 A;  3MHS C;  1ZU1 A;  1A1L A;  2EM0 A;  2WBT A;  2D9H A;  2YTG A;  1TF6 A;  4F6N A;  1X6F A;  5KL4 A;  2EOE A;  2EM5 A;  5KL5 A;  4IJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...