2EPAA

Solution structure of the first and second zf-c2h2 domains from human krueppel-like factor 10
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
72
structure length
72
Chain Sequence
GSSGSSGPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the first and second zf-C2H2 domains from human Krueppel-like factor 10
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Krueppel-like factor 10
total genus 9
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epaA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epaA01
1MEYC 1A1IA 2HGHA 2EOJA 3VHTB 4FK5C 4R2RA 2EN2A 2BB8A 2YTEA 2EPAA 2ELYA 2EE8A 5KL3A 4R2PA 2YTFA 1WJPA 1KJKA 2MDGA 2CSHA 2EMWA 2YSPA 1G2DC 4IJDA 2LV2A 2EN4A 2EN1A 2EPPA 2YTPA 2WBTA 2EOYA 2EMKA 2VRDA 4F6MA 4R2EA 1TF3A 2ELZA 2YTNA 2LT7A 2ENAA 4WSGA 2EQ0A 2EOEA 2EL4A 2LO3A 2PRTA 2GLIA 2EPRA 1A1JA 2EOOA 5KL4A 1A1KA 1X6FA 5KL6A 2EORA 2DGCA 1NCSA 4F2JC 2EMYA 2EM9A 2EMGA 2EN3A 1X6EA 2YRMA 2EMXA 1JK2A 1A1HA 2D9HA 2EN8A 1ZAAC 1YUIA 4R2DA 1G2FC 4R2CA 1YSAC 2EN6A 2EPCA 5KL2A 4R2SA 2EJ4A 2EMHA 2YSOA 2JPAA 2EOMA 2EOQA 1A1FA 2EPUA 2J7JA 3EPLA 1BBOA 2R1FA 2EPZA 5KL5A 3EPJA 2DMIA 2YTQA 3MHSC 1UBDC 1RMDA 2EQ3A 2YTDA 1UN6B 5KL7A 2EM5A 1Z1BA 2YU8A 2EM0A 2RPCA 2MKNA 2EM6A 2YTGA 2EOHA 2M9AA 1P47A 2EP3A 1A1GA 2YU5A 2EL5A 2DLKA 2EOSA 2LVHA 3M99B 4R2AA 2EN7A 2EM8A 1AAYA 4M9VC 3UK3C 2YTJA 1DGCA 2YRHA 2ENCA 2EM3A 2WCC3 2CT1A 2EMZA 2YRKA 1B69A 2EM7A 3MHHC 1X6HA 2EMAA 1LLMC 2YTOA 4IS1C 2EOZA 1F2IG 4R2QA 1YUJA 3EPHA 2EMFA 2ENHA 2LCEA 4X9JA 1TN9A 2EMCA 2EMLA 2EOFA 2EM4A 3EPKA 2EMIA 2CTDA 2MKDA 1ZR9A 2EM2A 1ZU1A 2ADRA 2YTIA 1X5WA 1JK1A 4F6NA 1BB8A 2I13A 2WBUA 2EOXA 2WBSA 2EOIA 4GZNC 2GHFA 2NABA 2RSIA 2EQ1A 1TF6A 2EMBA 2EPXA 1A1LA 2A25A 2E72A 2DLQA 1X3CA 2DRPA 2EL6A 2JP9A
chains in the Genus database with same CATH superfamily
2HGHA 4R2RA 1STUA 5IV8B 4WPYA 1WXRA 2EE8A 3QG5C 2RS6A 2L2NA 2YTFA 2UUAE 4HTGA 3C4BA 4B3RE 1KJKA 2EMWA 2BBGA 2YSPA 5AE3A 2JY9A 2F8BA 1IQSA 4I8OA 2N8XA 2EOYA 2ELZA 2YTNA 4OOGC 2EQ0A 4YY3E 1WRJA 2EPOA 2EPMX 2B9DA 4LF8E 2JWOA 4DR4E 3JU0A 4NZVA 3F6GA 1XNRE 1NCSA 3MSWA 4F2JC 2EMYA 1UILA 4DR7E 1IMUA 1JK2A 2EN8A 2EPLX 3VK6A 1YSAC 2NUGA 3AUZA 2JR1A 2YSOA 1IBLE 4JI5E 2EPUA 2J7JA 2R1FA 4BC7A 2EPZA 2WZOA 4LF7E 2R76A 1RMDA 2YTDA 2N3HA 1UN6B 5KL7A 2EM5A 3C6KA 2LMZA 2M7QA 2B3TB 4F9CB 1HNZE 2RPCA 4B3TE 2KHXA 4OX9E 3LLHA 2LJUA 2M9AA 2EP3A 2YU5A 4TUGA 4X65E 5LMUE 3M99B 2V89A 5A6BA 1PJTA 2EM8A 4M9VC 3L00A 3UK3C 2FGGA 1DGCA 5LL6R 5BR8E 4X64E 4BS9A 2EM7A 4KHPE 2EMAA 1N34E 3KZZA 4M30A 2DSYA 3ADLA 4MLVA 5IT9C 3BBGA 2LCEA 3VYXA 4X9JA 2EMCA 4N4RB 4DMIA 1ZU1A 1XMQE 2E5LE 2ADRA 3IWCA 1BB8A 2EOXA 2FV4B 2ZM6E 2VF1A 1TF6A 5A6BD 1MGTA 5IWAE 4BC9A 5FLXC 1RC7A 1KYQA 3FIGA 2EZ6A 2HJJA 1MEYC 2LUPB 2EOJA 4FK5C 4F54A 3VYYA 4DR1E 2YTEA 4RH8A 2I9IA 4JYAE 4Q35B 2VQFE 3T1YE 4LFCE 1WHQA 4JI8E 4B3ME 2K7IA 4IJDA 2LV2A 1PDAA 2EPPA 3DJWA 4M2ZA 4L5NC 2RTXA 4HEIA 4J8ZA 3ADGA 1IBKE 5A6JA 2WBTA 5A2QC 2MC6A 2EMKA 2VRDA 4F6MA 4R2EA 1X48A 4WFTA 2RSMA 3C6MA 2YT4A 4WSGA 2NA2A 3HXLA 3BGHA 2LO3A 2GLIA 1N33E 2EPRA 1A1JA 2EOOA 5KL4A 4GKJE 3ZOQB 4LTYA 5KL6A 4K0KE 4JI0E 3RMPA 2RS7A 4DUYE 2LRSA 1ZAAC 5A6AA 4JI7E 4KZSA 4R2CA 4AQYE 2E1MA 2EPCA 2JPAA 4DV0E 2LTSA 4GEQB 2EOMA 4BHBA 4DV4E 4DR6E 4YHHE 1XNQE 3EPJA 2FTXB 2YU8A 2EM0A 2MKNA 3OMLA 2EM6A 4P78A 2YTGA 1L4SA 2Q8UA 3C4TA 1A1GA 3BIDA 1PKPA 4P7DA 2EN7A 4WX9A 1YYKA 1T4NA 5LMNE 1GQEA 5CFFE 2YRHA 4ZYDA 2UU9E 4B3SE 4KWYA 4ZYHA 2EMZA 3MHHC 4R8OA 1LLMC 2YTOA 3KWRA 5F3WA 2NUEA 1YUJA 2EMFA 2UXBE 2LUQA 1IQOA 2EPNA 1PJSA 3P1XA 4Q28A 1SFEA 2EM2A 5A6KA 3BF2A 1EH7A 4LF4E 2EOIA 4NXNE 2VQEE 4JI3E 2UXDE 2A25A 4O24A 2EL6A 4WSPA 1A1IA 4X8WA 1IBME 1YYWA 2MC5A 2L3CA 2BB8A 1GTKA 2EPAA 4ZYGA 3EQ1A 1WJPA 3JTZA 4DV7E 1J5EE 2MDGA 2CSHA 5AC5A 1G2DC 2ODRD 3AV0A 4JI4E 4WXCA 3ADJA 2JOXA 2JVAA 2YTPA 2F4VE 3KZYA 4ZYEA 1N36E 1SR9A 1O0WA 4NXME 1NEIA 1WHNA 4BBYA 2ENAA 2M4IA 2EOEA 2V86A 2EL4A 1T39A 1AH5A 2DMYA 1YPNA 1A1KA 2ODRC 3K6QA 1DQ3A 2L3JA 2EORA 2NUFA 2GPIA 3THOB 4WYQB 2EMGA 1X6EA 1T4LB 1A1HA 2D9HA 1YUIA 3J81C 1QNTA 1G2FC 1EH6A 1HR0E 2EWLA 5KL2A 4R2SA 2EMHA 4LF6E 2EOQA 1A1FA 1BBOA 4BHCA 2LTRA 4GKKE 2YTQA 5AE1A 2EQ3A 3HPSA 1HNXE 4MLQA 4LFAE 1HNWE 4WXDA 2G7HA 5T6JA 2LVHA 2YPNA 2HC5A 3HTXA 1EH8A 3TQMA 2LBSB 2YZTA 5TSEA 2YTJA 2N3GA 2EM3A 2L2MA 4L8NA 4DV5E 2YRKA 1B69A 1X6HA 3HQ1A 2DB2A 2EOZA 4X66E 4DV1E 4TUIA 4R2QA 1DI2A 4LF9E 1ZBTA 3EPHA 3IWBA 1TN9A 2RQLA 1N32E 2EOFA 2EM4A 3LMLA 3EPKA 2EMIA 2UXCE 1N3GA 1RQ0A 1ZR9A 2YTIA 1X5WA 3IWDA 2WBUA 4DKKA 1FKAE 4DV6E 2GHFA 2LE2A 2RSIA 4DR2E 1UHZA 2EPXA 1A1LA 2DIXA 2DLQA 1X3CA 2DRPA 5DNYA 2JOBA 1QU6A 3VHTB 2EN2A 4LU9A 4DV3E 1YZ9A 2ELYA 2L8TA 1XMOE 5KL3A 4R2PA 2V83A 5AASA 2V88A 2EN4A 2EN1A 2JYAA 4JI1E 4JI6E 2M1SA 5LLQA 2L2KB 2EPKX 2IHR1 4NHRA 4BMJA 1X47A 1TF3A 3T1HE 1FJGE 2LT7A 5ADZA 5IXMB 2PRTA 5AE2A 1I94E 2UUBE 2B7TA 1ZBQA 2KOUA 1X6FA 3ECRA 1X49A 2DGCA 4DV2E 2EM9A 2EN3A 2YRMA 2EMXA 1T38A 4R2DA 2VE7C 2EN6A 2L33A 4DR3E 2L92A 2B7VA 2EJ4A 3EPLA 5KL5A 4RHBB 2DMIA 3MHSC 1UBDC 2V87A 4O4KA 3HPZA 1Z1BA 4JV5E 1J26A 1GZ6A 4BCAA 4DR5E 1T4OA 2EOHA 1P47A 2EL5A 2DLKA 3ADIA 1YFHA 2EOSA 4R2AA 2MDRA 4M0VA 3OTOE 1AAYA 4O43A 4R03A 3H09A 2HHHE 2ENCA 2JXPA 2WCC3 2CT1A 2V8QB 4IS1C 2CPNA 2YWQA 3J7Yp 3JAMC 3DF6A 3F6HA 5AC4A 1F2IG 2K4VA 4O5GA 2ENHA 2LJHA 3J80C 1EKZA 2UUCE 2EMLA 4JI2E 1PJQA 2KONA 2CTDA 2MKDA 1JK1A 4F6NA 2I13A 1YYOA 4F9BB 3J7AG 2WBSA 4GZNC 4X62E 2NABA 4LFBE 2H36X 2EQ1A 5A69A 2EMBA 4F9AB 2E72A 1BBGA 4DUZE 3THNA 2L6MA 2V85A 4LF5E 2JP9A
chains in the Genus database with same CATH topology
1MEYC 1A1IA 2HGHA 2EOJA 3VHTB 4FK5C 4R2RA 2EN2A 2BB8A 2YTEA 2EPAA 2ELYA 2EE8A 5KL3A 4R2PA 2YTFA 1WJPA 1KJKA 2MDGA 2CSHA 2EMWA 2YSPA 1G2DC 4IJDA 2LV2A 2EN4A 2EN1A 2EPPA 2YTPA 2WBTA 2EOYA 2EMKA 2VRDA 4F6MA 4R2EA 1TF3A 2ELZA 2YTNA 2LT7A 2ENAA 4WSGA 2EQ0A 2EOEA 2EL4A 2LO3A 2PRTA 2GLIA 2EPRA 1A1JA 2EOOA 5KL4A 1A1KA 1X6FA 5KL6A 2EORA 2DGCA 1NCSA 4F2JC 2EMYA 2EM9A 2EMGA 2EN3A 1X6EA 2YRMA 2EMXA 1JK2A 1A1HA 2D9HA 2EN8A 1ZAAC 1YUIA 4R2DA 1G2FC 4R2CA 1YSAC 2EN6A 2EPCA 5KL2A 4R2SA 2EJ4A 2EMHA 2YSOA 2JPAA 2EOMA 2EOQA 1A1FA 2EPUA 2J7JA 3EPLA 1BBOA 2R1FA 2EPZA 5KL5A 3EPJA 2DMIA 2YTQA 3MHSC 1UBDC 1RMDA 2EQ3A 2YTDA 1UN6B 5KL7A 2EM5A 1Z1BA 2YU8A 2EM0A 2RPCA 2MKNA 2EM6A 2YTGA 2EOHA 2M9AA 1P47A 2EP3A 1A1GA 2YU5A 2EL5A 2DLKA 2EOSA 2LVHA 3M99B 4R2AA 2EN7A 2EM8A 1AAYA 4M9VC 3UK3C 2YTJA 1DGCA 2YRHA 2ENCA 2EM3A 2WCC3 2CT1A 2EMZA 2YRKA 1B69A 2EM7A 3MHHC 1X6HA 2EMAA 1LLMC 2YTOA 4IS1C 2EOZA 1F2IG 4R2QA 1YUJA 3EPHA 2EMFA 2ENHA 2LCEA 4X9JA 1TN9A 2EMCA 2EMLA 2EOFA 2EM4A 3EPKA 2EMIA 2CTDA 2MKDA 1ZR9A 2EM2A 1ZU1A 2ADRA 2YTIA 1X5WA 1JK1A 4F6NA 1BB8A 2I13A 2WBUA 2EOXA 2WBSA 2EOIA 4GZNC 2GHFA 2NABA 2RSIA 2EQ1A 1TF6A 2EMBA 2EPXA 1A1LA 2A25A 2E72A 2DLQA 1X3CA 2DRPA 2EL6A 2JP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MEY C;  1A1I A;  2HGH A;  2EOJ A;  3VHT B;  4FK5 C;  4R2R A;  2EN2 A;  2BB8 A;  2YTE A;  2EPA A;  2ELY A;  2EE8 A;  5KL3 A;  4R2P A;  2YTF A;  1WJP A;  1KJK A;  2MDG A;  2CSH A;  2EMW A;  2YSP A;  1G2D C;  4IJD A;  2LV2 A;  2EN4 A;  2EN1 A;  2EPP A;  2YTP A;  2WBT A;  2EOY A;  2EMK A;  2VRD A;  4F6M A;  4R2E A;  1TF3 A;  2ELZ A;  2YTN A;  2LT7 A;  2ENA A;  4WSG A;  2EQ0 A;  2EOE A;  2EL4 A;  2LO3 A;  2PRT A;  2GLI A;  2EPR A;  1A1J A;  2EOO A;  5KL4 A;  1A1K A;  1X6F A;  5KL6 A;  2EOR A;  2DGC A;  1NCS A;  4F2J C;  2EMY A;  2EM9 A;  2EMG A;  2EN3 A;  1X6E A;  2YRM A;  2EMX A;  1JK2 A;  1A1H A;  2D9H A;  2EN8 A;  1ZAA C;  1YUI A;  4R2D A;  1G2F C;  4R2C A;  1YSA C;  2EN6 A;  2EPC A;  5KL2 A;  4R2S A;  2EJ4 A;  2EMH A;  2YSO A;  2JPA A;  2EOM A;  2EOQ A;  1A1F A;  2EPU A;  2J7J A;  3EPL A;  1BBO A;  2R1F A;  2EPZ A;  5KL5 A;  3EPJ A;  2DMI A;  2YTQ A;  3MHS C;  1UBD C;  1RMD A;  2EQ3 A;  2YTD A;  1UN6 B;  5KL7 A;  2EM5 A;  1Z1B A;  2YU8 A;  2EM0 A;  2RPC A;  2MKN A;  2EM6 A;  2YTG A;  2EOH A;  2M9A A;  1P47 A;  2EP3 A;  1A1G A;  2YU5 A;  2EL5 A;  2DLK A;  2EOS A;  2LVH A;  3M99 B;  4R2A A;  2EN7 A;  2EM8 A;  1AAY A;  4M9V C;  3UK3 C;  2YTJ A;  1DGC A;  2YRH A;  2ENC A;  2EM3 A;  2WCC 3;  2CT1 A;  2EMZ A;  2YRK A;  1B69 A;  2EM7 A;  3MHH C;  1X6H A;  2EMA A;  1LLM C;  2YTO A;  4IS1 C;  2EOZ A;  1F2I G;  4R2Q A;  1YUJ A;  3EPH A;  2EMF A;  2ENH A;  2LCE A;  4X9J A;  1TN9 A;  2EMC A;  2EML A;  2EOF A;  2EM4 A;  3EPK A;  2EMI A;  2CTD A;  2MKD A;  1ZR9 A;  2EM2 A;  1ZU1 A;  2ADR A;  2YTI A;  1X5W A;  1JK1 A;  4F6N A;  1BB8 A;  2I13 A;  2WBU A;  2EOX A;  2WBS A;  2EOI A;  4GZN C;  2GHF A;  2NAB A;  2RSI A;  2EQ1 A;  1TF6 A;  2EMB A;  2EPX A;  1A1L A;  2A25 A;  2E72 A;  2DLQ A;  1X3C A;  2DRP A;  2EL6 A;  2JP9 A; 
#chains in the Genus database with same CATH topology
 2HGH A;  4R2R A;  1STU A;  5IV8 B;  4WPY A;  1WXR A;  2EE8 A;  3QG5 C;  2RS6 A;  2L2N A;  2YTF A;  2UUA E;  4HTG A;  3C4B A;  4B3R E;  1KJK A;  2EMW A;  2BBG A;  2YSP A;  5AE3 A;  2JY9 A;  2F8B A;  1IQS A;  4I8O A;  2N8X A;  2EOY A;  2ELZ A;  2YTN A;  4OOG C;  2EQ0 A;  4YY3 E;  1WRJ A;  2EPO A;  2EPM X;  2B9D A;  4LF8 E;  2JWO A;  4DR4 E;  3JU0 A;  4NZV A;  3F6G A;  1XNR E;  1NCS A;  3MSW A;  4F2J C;  2EMY A;  1UIL A;  4DR7 E;  1IMU A;  1JK2 A;  2EN8 A;  2EPL X;  3VK6 A;  1YSA C;  2NUG A;  3AUZ A;  2JR1 A;  2YSO A;  1IBL E;  4JI5 E;  2EPU A;  2J7J A;  2R1F A;  4BC7 A;  2EPZ A;  2WZO A;  4LF7 E;  2R76 A;  1RMD A;  2YTD A;  2N3H A;  1UN6 B;  5KL7 A;  2EM5 A;  3C6K A;  2LMZ A;  2M7Q A;  2B3T B;  4F9C B;  1HNZ E;  2RPC A;  4B3T E;  2KHX A;  4OX9 E;  3LLH A;  2LJU A;  2M9A A;  2EP3 A;  2YU5 A;  4TUG A;  4X65 E;  5LMU E;  3M99 B;  2V89 A;  5A6B A;  1PJT A;  2EM8 A;  4M9V C;  3L00 A;  3UK3 C;  2FGG A;  1DGC A;  5LL6 R;  5BR8 E;  4X64 E;  4BS9 A;  2EM7 A;  4KHP E;  2EMA A;  1N34 E;  3KZZ A;  4M30 A;  2DSY A;  3ADL A;  4MLV A;  5IT9 C;  3BBG A;  2LCE A;  3VYX A;  4X9J A;  2EMC A;  4N4R B;  4DMI A;  1ZU1 A;  1XMQ E;  2E5L E;  2ADR A;  3IWC A;  1BB8 A;  2EOX A;  2FV4 B;  2ZM6 E;  2VF1 A;  1TF6 A;  5A6B D;  1MGT A;  5IWA E;  4BC9 A;  5FLX C;  1RC7 A;  1KYQ A;  3FIG A;  2EZ6 A;  2HJJ A;  1MEY C;  2LUP B;  2EOJ A;  4FK5 C;  4F54 A;  3VYY A;  4DR1 E;  2YTE A;  4RH8 A;  2I9I A;  4JYA E;  4Q35 B;  2VQF E;  3T1Y E;  4LFC E;  1WHQ A;  4JI8 E;  4B3M E;  2K7I A;  4IJD A;  2LV2 A;  1PDA A;  2EPP A;  3DJW A;  4M2Z A;  4L5N C;  2RTX A;  4HEI A;  4J8Z A;  3ADG A;  1IBK E;  5A6J A;  2WBT A;  5A2Q C;  2MC6 A;  2EMK A;  2VRD A;  4F6M A;  4R2E A;  1X48 A;  4WFT A;  2RSM A;  3C6M A;  2YT4 A;  4WSG A;  2NA2 A;  3HXL A;  3BGH A;  2LO3 A;  2GLI A;  1N33 E;  2EPR A;  1A1J A;  2EOO A;  5KL4 A;  4GKJ E;  3ZOQ B;  4LTY A;  5KL6 A;  4K0K E;  4JI0 E;  3RMP A;  2RS7 A;  4DUY E;  2LRS A;  1ZAA C;  5A6A A;  4JI7 E;  4KZS A;  4R2C A;  4AQY E;  2E1M A;  2EPC A;  2JPA A;  4DV0 E;  2LTS A;  4GEQ B;  2EOM A;  4BHB A;  4DV4 E;  4DR6 E;  4YHH E;  1XNQ E;  3EPJ A;  2FTX B;  2YU8 A;  2EM0 A;  2MKN A;  3OML A;  2EM6 A;  4P78 A;  2YTG A;  1L4S A;  2Q8U A;  3C4T A;  1A1G A;  3BID A;  1PKP A;  4P7D A;  2EN7 A;  4WX9 A;  1YYK A;  1T4N A;  5LMN E;  1GQE A;  5CFF E;  2YRH A;  4ZYD A;  2UU9 E;  4B3S E;  4KWY A;  4ZYH A;  2EMZ A;  3MHH C;  4R8O A;  1LLM C;  2YTO A;  3KWR A;  5F3W A;  2NUE A;  1YUJ A;  2EMF A;  2UXB E;  2LUQ A;  1IQO A;  2EPN A;  1PJS A;  3P1X A;  4Q28 A;  1SFE A;  2EM2 A;  5A6K A;  3BF2 A;  1EH7 A;  4LF4 E;  2EOI A;  4NXN E;  2VQE E;  4JI3 E;  2UXD E;  2A25 A;  4O24 A;  2EL6 A;  4WSP A;  1A1I A;  4X8W A;  1IBM E;  1YYW A;  2MC5 A;  2L3C A;  2BB8 A;  1GTK A;  2EPA A;  4ZYG A;  3EQ1 A;  1WJP A;  3JTZ A;  4DV7 E;  1J5E E;  2MDG A;  2CSH A;  5AC5 A;  1G2D C;  2ODR D;  3AV0 A;  4JI4 E;  4WXC A;  3ADJ A;  2JOX A;  2JVA A;  2YTP A;  2F4V E;  3KZY A;  4ZYE A;  1N36 E;  1SR9 A;  1O0W A;  4NXM E;  1NEI A;  1WHN A;  4BBY A;  2ENA A;  2M4I A;  2EOE A;  2V86 A;  2EL4 A;  1T39 A;  1AH5 A;  2DMY A;  1YPN A;  1A1K A;  2ODR C;  3K6Q A;  1DQ3 A;  2L3J A;  2EOR A;  2NUF A;  2GPI A;  3THO B;  4WYQ B;  2EMG A;  1X6E A;  1T4L B;  1A1H A;  2D9H A;  1YUI A;  3J81 C;  1QNT A;  1G2F C;  1EH6 A;  1HR0 E;  2EWL A;  5KL2 A;  4R2S A;  2EMH A;  4LF6 E;  2EOQ A;  1A1F A;  1BBO A;  4BHC A;  2LTR A;  4GKK E;  2YTQ A;  5AE1 A;  2EQ3 A;  3HPS A;  1HNX E;  4MLQ A;  4LFA E;  1HNW E;  4WXD A;  2G7H A;  5T6J A;  2LVH A;  2YPN A;  2HC5 A;  3HTX A;  1EH8 A;  3TQM A;  2LBS B;  2YZT A;  5TSE A;  2YTJ A;  2N3G A;  2EM3 A;  2L2M A;  4L8N A;  4DV5 E;  2YRK A;  1B69 A;  1X6H A;  3HQ1 A;  2DB2 A;  2EOZ A;  4X66 E;  4DV1 E;  4TUI A;  4R2Q A;  1DI2 A;  4LF9 E;  1ZBT A;  3EPH A;  3IWB A;  1TN9 A;  2RQL A;  1N32 E;  2EOF A;  2EM4 A;  3LML A;  3EPK A;  2EMI A;  2UXC E;  1N3G A;  1RQ0 A;  1ZR9 A;  2YTI A;  1X5W A;  3IWD A;  2WBU A;  4DKK A;  1FKA E;  4DV6 E;  2GHF A;  2LE2 A;  2RSI A;  4DR2 E;  1UHZ A;  2EPX A;  1A1L A;  2DIX A;  2DLQ A;  1X3C A;  2DRP A;  5DNY A;  2JOB A;  1QU6 A;  3VHT B;  2EN2 A;  4LU9 A;  4DV3 E;  1YZ9 A;  2ELY A;  2L8T A;  1XMO E;  5KL3 A;  4R2P A;  2V83 A;  5AAS A;  2V88 A;  2EN4 A;  2EN1 A;  2JYA A;  4JI1 E;  4JI6 E;  2M1S A;  5LLQ A;  2L2K B;  2EPK X;  2IHR 1;  4NHR A;  4BMJ A;  1X47 A;  1TF3 A;  3T1H E;  1FJG E;  2LT7 A;  5ADZ A;  5IXM B;  2PRT A;  5AE2 A;  1I94 E;  2UUB E;  2B7T A;  1ZBQ A;  2KOU A;  1X6F A;  3ECR A;  1X49 A;  2DGC A;  4DV2 E;  2EM9 A;  2EN3 A;  2YRM A;  2EMX A;  1T38 A;  4R2D A;  2VE7 C;  2EN6 A;  2L33 A;  4DR3 E;  2L92 A;  2B7V A;  2EJ4 A;  3EPL A;  5KL5 A;  4RHB B;  2DMI A;  3MHS C;  1UBD C;  2V87 A;  4O4K A;  3HPZ A;  1Z1B A;  4JV5 E;  1J26 A;  1GZ6 A;  4BCA A;  4DR5 E;  1T4O A;  2EOH A;  1P47 A;  2EL5 A;  2DLK A;  3ADI A;  1YFH A;  2EOS A;  4R2A A;  2MDR A;  4M0V A;  3OTO E;  1AAY A;  4O43 A;  4R03 A;  3H09 A;  2HHH E;  2ENC A;  2JXP A;  2WCC 3;  2CT1 A;  2V8Q B;  4IS1 C;  2CPN A;  2YWQ A;  3J7Y p;  3JAM C;  3DF6 A;  3F6H A;  5AC4 A;  1F2I G;  2K4V A;  4O5G A;  2ENH A;  2LJH A;  3J80 C;  1EKZ A;  2UUC E;  2EML A;  4JI2 E;  1PJQ A;  2KON A;  2CTD A;  2MKD A;  1JK1 A;  4F6N A;  2I13 A;  1YYO A;  4F9B B;  3J7A G;  2WBS A;  4GZN C;  4X62 E;  2NAB A;  4LFB E;  2H36 X;  2EQ1 A;  5A69 A;  2EMB A;  4F9A B;  2E72 A;  1BBG A;  4DUZ E;  3THN A;  2L6M A;  2V85 A;  4LF5 E;  2JP9 A; 
#chains in the Genus database with same CATH homology
 1MEY C;  1A1I A;  2HGH A;  2EOJ A;  3VHT B;  4FK5 C;  4R2R A;  2EN2 A;  2BB8 A;  2YTE A;  2EPA A;  2ELY A;  2EE8 A;  5KL3 A;  4R2P A;  2YTF A;  1WJP A;  1KJK A;  2MDG A;  2CSH A;  2EMW A;  2YSP A;  1G2D C;  4IJD A;  2LV2 A;  2EN4 A;  2EN1 A;  2EPP A;  2YTP A;  2WBT A;  2EOY A;  2EMK A;  2VRD A;  4F6M A;  4R2E A;  1TF3 A;  2ELZ A;  2YTN A;  2LT7 A;  2ENA A;  4WSG A;  2EQ0 A;  2EOE A;  2EL4 A;  2LO3 A;  2PRT A;  2GLI A;  2EPR A;  1A1J A;  2EOO A;  5KL4 A;  1A1K A;  1X6F A;  5KL6 A;  2EOR A;  2DGC A;  1NCS A;  4F2J C;  2EMY A;  2EM9 A;  2EMG A;  2EN3 A;  1X6E A;  2YRM A;  2EMX A;  1JK2 A;  1A1H A;  2D9H A;  2EN8 A;  1ZAA C;  1YUI A;  4R2D A;  1G2F C;  4R2C A;  1YSA C;  2EN6 A;  2EPC A;  5KL2 A;  4R2S A;  2EJ4 A;  2EMH A;  2YSO A;  2JPA A;  2EOM A;  2EOQ A;  1A1F A;  2EPU A;  2J7J A;  3EPL A;  1BBO A;  2R1F A;  2EPZ A;  5KL5 A;  3EPJ A;  2DMI A;  2YTQ A;  3MHS C;  1UBD C;  1RMD A;  2EQ3 A;  2YTD A;  1UN6 B;  5KL7 A;  2EM5 A;  1Z1B A;  2YU8 A;  2EM0 A;  2RPC A;  2MKN A;  2EM6 A;  2YTG A;  2EOH A;  2M9A A;  1P47 A;  2EP3 A;  1A1G A;  2YU5 A;  2EL5 A;  2DLK A;  2EOS A;  2LVH A;  3M99 B;  4R2A A;  2EN7 A;  2EM8 A;  1AAY A;  4M9V C;  3UK3 C;  2YTJ A;  1DGC A;  2YRH A;  2ENC A;  2EM3 A;  2WCC 3;  2CT1 A;  2EMZ A;  2YRK A;  1B69 A;  2EM7 A;  3MHH C;  1X6H A;  2EMA A;  1LLM C;  2YTO A;  4IS1 C;  2EOZ A;  1F2I G;  4R2Q A;  1YUJ A;  3EPH A;  2EMF A;  2ENH A;  2LCE A;  4X9J A;  1TN9 A;  2EMC A;  2EML A;  2EOF A;  2EM4 A;  3EPK A;  2EMI A;  2CTD A;  2MKD A;  1ZR9 A;  2EM2 A;  1ZU1 A;  2ADR A;  2YTI A;  1X5W A;  1JK1 A;  4F6N A;  1BB8 A;  2I13 A;  2WBU A;  2EOX A;  2WBS A;  2EOI A;  4GZN C;  2GHF A;  2NAB A;  2RSI A;  2EQ1 A;  1TF6 A;  2EMB A;  2EPX A;  1A1L A;  2A25 A;  2E72 A;  2DLQ A;  1X3C A;  2DRP A;  2EL6 A;  2JP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...