2EPAA

Solution structure of the first and second zf-c2h2 domains from human krueppel-like factor 10
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
72
structure length
72
Chain Sequence
GSSGSSGPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Krueppel-like factor 10
publication title Solution structure of the first and second zf-C2H2 domains from human Krueppel-like factor 10
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 9
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epaA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epaA01
2EPPA 2EL5A 1LLMC 1X3CA 2LO3A 4IJDA 2WBSA 3EPJA 4F6MA 2LT7A 2EOIA 1A1JA 2DMIA 2EM5A 2EM2A 4F6NA 2ENAA 2EM3A 2ENHA 2A25A 1ZAAC 4R2DA 2YTIA 3VHTB 2EMLA 2BB8A 4F2JC 4WSGA 2YSPA 3EPHA 2EM7A 1A1GA 2EOOA 2YRHA 1KJKA 1G2DC 2EOMA 2EMIA 4R2AA 2EMBA 5KL4A 2DRPA 2EN7A 1BBOA 2GHFA 2EMCA 2EMKA 2MKDA 2J7JA 2EMXA 2MKNA 2EL6A 1NCSA 1P47A 2EMZA 1X6HA 2CTDA 2PRTA 2EE8A 2EN8A 1ZR9A 2DGCA 1BB8A 2EN3A 2ELYA 2CT1A 3M99B 2CSHA 2RPCA 4M9VC 2JPAA 2ENCA 1B69A 1A1KA 2WBTA 2D9HA 4R2EA 2YTJA 1ZU1A 5KL6A 4X9JA 2YTFA 4R2RA 2EN4A 2EM6A 1X5WA 1A1FA 1AAYA 2EOXA 2EN1A 4IS1C 1Z1BA 2EN6A 2LVHA 2R1FA 2I13A 2EMWA 2WCC3 2EOFA 2NABA 2EL4A 5KL5A 2EP3A 3EPKA 2EQ3A 2EN2A 4R2QA 2EPAA 2YRKA 1A1LA 2EM9A 2YRMA 5KL3A 1TF6A 1YUJA 2EOQA 1X6EA 4FK5C 2EQ1A 2EMYA 2EPXA 2DLKA 2YTNA 2LCEA 2EQ0A 2GLIA 2EMHA 2YTGA 1WJPA 2YTEA 2EOHA 3EPLA 2DLQA 3MHSC 2YU5A 2RSIA 2YTOA 4GZNC 2EMFA 2YSOA 2YTDA 1JK2A 2EJ4A 2YU8A 2MDGA 2VRDA 1A1HA 2EOJA 2ADRA 3MHHC 2EPCA 4R2PA 1F2IG 2EOSA 2EM8A 1G2FC 2WBUA 2EPZA 2EPRA 1UBDC 2EOEA 3UK3C 2EMGA 1UN6B 1TF3A 1MEYC 2EMAA 4R2CA 2EM4A 2EOYA 1YUIA 1TN9A 2EM0A 1JK1A 2YTQA 2HGHA 1RMDA 5KL7A 2ELZA 2EORA 1X6FA 5KL2A 2EPUA 1YSAC 4R2SA 1A1IA 2JP9A 2LV2A 2M9AA 2EOZA 2YTPA 2E72A 1DGCA
chains in the Genus database with same CATH superfamily
2EPMX 4LFCE 4IJDA 3ADLA 2DMIA 4KZSA 4K0KE 3C4TA 2A25A 4P78A 2YTIA 1RC7A 2NUFA 1NEIA 4DV5E 2BB8A 1YFHA 1IQOA 3EPHA 1A1GA 4R2AA 3EQ1A 2EMBA 5KL4A 2DRPA 2V86A 2EN7A 2JOBA 2GHFA 2HHHE 2LJHA 2KOUA 1PJTA 2J7JA 4TUGA 1P47A 1EKZA 2VF1A 2CTDA 4MLQA 3VYXA 3J81C 4R8OA 2ELYA 2MC5A 2CT1A 2HC5A 2UUCE 5F3WA 4M9VC 2JR1A 4R2EA 4X9JA 2FTXB 4F54A 1PKPA 2VQFE 5LMUE 3T1HE 3ADGA 4O4KA 1X5WA 2LMZA 1A1FA 4M0VA 1ZBTA 4IS1C 2R1FA 2I13A 1XNQE 5KL5A 1A1LA 1WHQA 2EM9A 5KL3A 4JI0E 2EOQA 2LJUA 1J5EE 3ADJA 1BBGA 2EQ1A 2DB2A 2R76A 2V88A 2GLIA 2I9IA 4B3SE 5CFFE 1UHZA 5FLXC 1X48A 2YZTA 3MHSC 2RSIA 2YTOA 3THOB 1YYKA 2UUBE 2EMFA 2YSOA 2YTDA 4I8OA 2MDGA 4DR1E 1A1HA 2N3GA 2EOJA 2EPCA 2EOSA 2EM8A 1G2FC 2UXBE 3F6GA 2EOYA 4Q35B 2M7QA 2EM0A 1SR9A 4DUZE 2LTSA 4O5GA 1X6FA 2JY9A 3VK6A 1YSAC 2M9AA 2YTPA 1YYOA 2L2KB 2E72A 3C4BA 2KHXA 4L5NC 5A6JA 1DGCA 2YPNA 1LLMC 4RHBB 5LMNE 2EOIA 3THNA 4DMIA 4LF8E 2EM5A 2ODRC 2EM2A 2EM3A 1PDAA 4DR5E 5LL6R 2RS7A 4JI3E 2MC6A 2RQLA 3F6HA 1QNTA 1SFEA 2NUGA 2EOMA 2KONA 4ZYEA 1EH8A 2YWQA 1BBOA 2MKNA 2EL6A 1NCSA 2EMZA 2L2MA 1GZ6A 3BF2A 2PRTA 4LU9A 1N32E 2FV4B 1N33E 4X65E 2CSHA 2RPCA 3IWDA 1B69A 2WBTA 2L2NA 4OOGC 2JWOA 4WXDA 2EM6A 3MSWA 1AAYA 4F9CB 1GQEA 4WPYA 3AUZA 1Z1BA 2EN6A 3KWRA 2EOFA 2NABA 4WYQB 3EPKA 4M2ZA 2EQ3A 2EN2A 4NZVA 2YRKA 2YRMA 1GTKA 4JI6E 1YUJA 4ZYDA 4B3RE 2V8QB 4M30A 4FK5C 2JVAA 5A2QC 2LRSA 2B9DA 4J8ZA 2EMYA 4N4RB 5ADZA 4NXNE 4O43A 4DV0E 2YTNA 2EQ0A 2EMHA 2L8TA 1WJPA 2YTEA 2YT4A 2EOHA 3EPLA 2UXDE 1FKAE 2K4VA 4DV3E 5BR8E 2DLQA 2YU5A 4GZNC 4LFBE 2DSYA 4HEIA 1T38A 4JI1E 2EJ4A 2YU8A 3DF6A 2M4IA 2ADRA 4DV6E 3MHHC 1HNWE 1N34E 2WBUA 2EPZA 4JI5E 4LF7E 2EOEA 1TF3A 4R2CA 4BHCA 4DKKA 1FJGE 2HJJA 1HR0E 3VYYA 1X47A 2HGHA 2ELZA 4DR4E 5AASA 1IBME 2H36X 4R2SA 1ZBQA 2CPNA 2L3CA 2IHR1 4BHBA 2LUPB 2JP9A 4RH8A 1DI2A 3J7AG 3HPSA 3C6MA 2RTXA 2V87A 3BGHA 3K6QA 1XMOE 1XMQE 2LT7A 3QG5C 2NUEA 4LF4E 3HXLA 3JAMC 4R03A 2B7TA 2ENAA 3FIGA 2RSMA 4BC9A 4NHRA 2ENHA 1DQ3A 4R2DA 2JXPA 1EH6A 3VHTB 4LFAE 2N3HA 5A6KA 3J80C 2EMLA 4B3ME 3JTZA 1STUA 2YSPA 2JYAA 4WSGA 4DV1E 1KJKA 2EOOA 2YRHA 1G2DC 1IBKE 2EMIA 2LUQA 4YY3E 4OX9E 1I94E 2MKDA 5T6JA 4JI4E 2EMXA 3C6KA 2EPNA 5A69A 3KZZA 1X6HA 2EN8A 1ZR9A 1N3GA 2DGCA 5AE1A 3AV0A 4DUYE 3DJWA 3TQMA 1N36E 5IXMB 3ECRA 4LF5E 1T4NA 4BMJA 2ENCA 5DNYA 1A1KA 1RQ0A 4X64E 2G7HA 4NXME 5KL6A 1ZU1A 2L6MA 4R2RA 3J7Yp 3IWCA 2WZOA 2B7VA 1XNRE 4Q28A 4WSPA 3OTOE 5IWAE 1IBLE 2EMWA 2EWLA 2EL4A 2EP3A 2V83A 4GEQB 1YPNA 4R2QA 5AC4A 3L00A 1YZ9A 2EPOA 2EPXA 2DLKA 3ADIA 2LCEA 4JI7E 5AC5A 2YTGA 2LE2A 4ZYGA 3RMPA 4MLVA 4BCAA 1UILA 4YHHE 2EPKX 1JK2A 2LBSB 2NA2A 4R2PA 1QU6A 5A6BD 1HNXE 4LTYA 4B3TE 2EZ6A 1UN6B 1IQSA 2EMGA 4AQYE 2DMYA 3IWBA 4GKKE 2EMAA 1PJQA 4F9BB 1MGTA 1TN9A 3T1YE 2F4VE 2BBGA 1WHNA 1T4OA 1RMDA 5KL7A 3P1XA 2EORA 2FGGA 2L33A 1A1IA 4ZYHA 4DR3E 5IT9C 2V89A 4WFTA 2EPPA 2EL5A 2GPIA 1X3CA 2LO3A 4JI8E 2WBSA 3EPJA 4F6MA 4O24A 1A1JA 4WXCA 3LMLA 4F6NA 1EH7A 2L3JA 1KYQA 4DV4E 2F8BA 1ZAAC 4F9AB 2ODRD 3BBGA 5AE3A 4X66E 4F2JC 4GKJE 2EM7A 2EPLX 1YYWA 4BC7A 1HNZE 3H09A 5AE2A 4BS9A 2EMKA 2EMCA 4LF6E 1PJSA 2EE8A 1BB8A 5IV8B 2EN3A 4DR2E 1T4LB 3M99B 2JPAA 2DIXA 4JI2E 2UXCE 1WXRA 3HPZA 2D9HA 2B3TB 2YTJA 2ZM6E 2YTFA 5TSEA 2EN4A 2Q8UA 1X49A 4X8WA 2E5LE 3BIDA 3OMLA 2EOXA 2EN1A 4BBYA 4KHPE 3HTXA 2LVHA 3HQ1A 3JU0A 2WCC3 2VQEE 3KZYA 2EPAA 4DR7E 1TF6A 1X6EA 4DR6E 2RS6A 4P7DA 2K7IA 1O0WA 4KWYA 1WRJA 4L8NA 4TUIA 2E1MA 1IMUA 3LLHA 4DV2E 5A6BA 2UUAE 4DV7E 2VRDA 4WX9A 1T39A 2L92A 4HTGA 1F2IG 1L4SA 1UBDC 2EPRA 2VE7C 3UK3C 1MEYC 2EM4A 2M1SA 1YUIA 1JK1A 4JYAE 4LF9E 2YTQA 2LTRA 5KL2A 5A6AA 4X62E 2MDRA 2EPUA 2V85A 2N8XA 3ZOQB 4JV5E 2LV2A 2JOXA 2EOZA 2UU9E 5LLQA 1AH5A 1J26A
chains in the Genus database with same CATH topology
2EPPA 2EL5A 1LLMC 1X3CA 2LO3A 4IJDA 2WBSA 3EPJA 4F6MA 2LT7A 2EOIA 1A1JA 2DMIA 2EM5A 2EM2A 4F6NA 2ENAA 2EM3A 2ENHA 2A25A 1ZAAC 4R2DA 2YTIA 3VHTB 2EMLA 2BB8A 4F2JC 4WSGA 2YSPA 3EPHA 2EM7A 1A1GA 2EOOA 2YRHA 1KJKA 1G2DC 2EOMA 2EMIA 4R2AA 2EMBA 5KL4A 2DRPA 2EN7A 1BBOA 2GHFA 2EMCA 2EMKA 2MKDA 2J7JA 2EMXA 2MKNA 2EL6A 1NCSA 1P47A 2EMZA 1X6HA 2CTDA 2PRTA 2EE8A 2EN8A 1ZR9A 2DGCA 1BB8A 2EN3A 2ELYA 2CT1A 3M99B 2CSHA 2RPCA 4M9VC 2JPAA 2ENCA 1B69A 1A1KA 2WBTA 2D9HA 4R2EA 2YTJA 1ZU1A 5KL6A 4X9JA 2YTFA 4R2RA 2EN4A 2EM6A 1X5WA 1A1FA 1AAYA 2EOXA 2EN1A 4IS1C 1Z1BA 2EN6A 2LVHA 2R1FA 2I13A 2EMWA 2WCC3 2EOFA 2NABA 2EL4A 5KL5A 2EP3A 3EPKA 2EQ3A 2EN2A 4R2QA 2EPAA 2YRKA 1A1LA 2EM9A 2YRMA 5KL3A 1TF6A 1YUJA 2EOQA 1X6EA 4FK5C 2EQ1A 2EMYA 2EPXA 2DLKA 2YTNA 2LCEA 2EQ0A 2GLIA 2EMHA 2YTGA 1WJPA 2YTEA 2EOHA 3EPLA 2DLQA 3MHSC 2YU5A 2RSIA 2YTOA 4GZNC 2EMFA 2YSOA 2YTDA 1JK2A 2EJ4A 2YU8A 2MDGA 2VRDA 1A1HA 2EOJA 2ADRA 3MHHC 2EPCA 4R2PA 1F2IG 2EOSA 2EM8A 1G2FC 2WBUA 2EPZA 2EPRA 1UBDC 2EOEA 3UK3C 2EMGA 1UN6B 1TF3A 1MEYC 2EMAA 4R2CA 2EM4A 2EOYA 1YUIA 1TN9A 2EM0A 1JK1A 2YTQA 2HGHA 1RMDA 5KL7A 2ELZA 2EORA 1X6FA 5KL2A 2EPUA 1YSAC 4R2SA 1A1IA 2JP9A 2LV2A 2M9AA 2EOZA 2YTPA 2E72A 1DGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPP A;  2EL5 A;  1LLM C;  1X3C A;  2LO3 A;  4IJD A;  2WBS A;  3EPJ A;  4F6M A;  2LT7 A;  2EOI A;  1A1J A;  2DMI A;  2EM5 A;  2EM2 A;  4F6N A;  2ENA A;  2EM3 A;  2ENH A;  2A25 A;  1ZAA C;  4R2D A;  2YTI A;  3VHT B;  2EML A;  2BB8 A;  4F2J C;  4WSG A;  2YSP A;  3EPH A;  2EM7 A;  1A1G A;  2EOO A;  2YRH A;  1KJK A;  1G2D C;  2EOM A;  2EMI A;  4R2A A;  2EMB A;  5KL4 A;  2DRP A;  2EN7 A;  1BBO A;  2GHF A;  2EMC A;  2EMK A;  2MKD A;  2J7J A;  2EMX A;  2MKN A;  2EL6 A;  1NCS A;  1P47 A;  2EMZ A;  1X6H A;  2CTD A;  2PRT A;  2EE8 A;  2EN8 A;  1ZR9 A;  2DGC A;  1BB8 A;  2EN3 A;  2ELY A;  2CT1 A;  3M99 B;  2CSH A;  2RPC A;  4M9V C;  2JPA A;  2ENC A;  1B69 A;  1A1K A;  2WBT A;  2D9H A;  4R2E A;  2YTJ A;  1ZU1 A;  5KL6 A;  4X9J A;  2YTF A;  4R2R A;  2EN4 A;  2EM6 A;  1X5W A;  1A1F A;  1AAY A;  2EOX A;  2EN1 A;  4IS1 C;  1Z1B A;  2EN6 A;  2LVH A;  2R1F A;  2I13 A;  2EMW A;  2WCC 3;  2EOF A;  2NAB A;  2EL4 A;  5KL5 A;  2EP3 A;  3EPK A;  2EQ3 A;  2EN2 A;  4R2Q A;  2EPA A;  2YRK A;  1A1L A;  2EM9 A;  2YRM A;  5KL3 A;  1TF6 A;  1YUJ A;  2EOQ A;  1X6E A;  4FK5 C;  2EQ1 A;  2EMY A;  2EPX A;  2DLK A;  2YTN A;  2LCE A;  2EQ0 A;  2GLI A;  2EMH A;  2YTG A;  1WJP A;  2YTE A;  2EOH A;  3EPL A;  2DLQ A;  3MHS C;  2YU5 A;  2RSI A;  2YTO A;  4GZN C;  2EMF A;  2YSO A;  2YTD A;  1JK2 A;  2EJ4 A;  2YU8 A;  2MDG A;  2VRD A;  1A1H A;  2EOJ A;  2ADR A;  3MHH C;  2EPC A;  4R2P A;  1F2I G;  2EOS A;  2EM8 A;  1G2F C;  2WBU A;  2EPZ A;  2EPR A;  1UBD C;  2EOE A;  3UK3 C;  2EMG A;  1UN6 B;  1TF3 A;  1MEY C;  2EMA A;  4R2C A;  2EM4 A;  2EOY A;  1YUI A;  1TN9 A;  2EM0 A;  1JK1 A;  2YTQ A;  2HGH A;  1RMD A;  5KL7 A;  2ELZ A;  2EOR A;  1X6F A;  5KL2 A;  2EPU A;  1YSA C;  4R2S A;  1A1I A;  2JP9 A;  2LV2 A;  2M9A A;  2EOZ A;  2YTP A;  2E72 A;  1DGC A; 
#chains in the Genus database with same CATH topology
 2EPM X;  4LFC E;  4IJD A;  3ADL A;  2DMI A;  4KZS A;  4K0K E;  3C4T A;  2A25 A;  4P78 A;  2YTI A;  1RC7 A;  2NUF A;  1NEI A;  4DV5 E;  2BB8 A;  1YFH A;  1IQO A;  3EPH A;  1A1G A;  4R2A A;  3EQ1 A;  2EMB A;  5KL4 A;  2DRP A;  2V86 A;  2EN7 A;  2JOB A;  2GHF A;  2HHH E;  2LJH A;  2KOU A;  1PJT A;  2J7J A;  4TUG A;  1P47 A;  1EKZ A;  2VF1 A;  2CTD A;  4MLQ A;  3VYX A;  3J81 C;  4R8O A;  2ELY A;  2MC5 A;  2CT1 A;  2HC5 A;  2UUC E;  5F3W A;  4M9V C;  2JR1 A;  4R2E A;  4X9J A;  2FTX B;  4F54 A;  1PKP A;  2VQF E;  5LMU E;  3T1H E;  3ADG A;  4O4K A;  1X5W A;  2LMZ A;  1A1F A;  4M0V A;  1ZBT A;  4IS1 C;  2R1F A;  2I13 A;  1XNQ E;  5KL5 A;  1A1L A;  1WHQ A;  2EM9 A;  5KL3 A;  4JI0 E;  2EOQ A;  2LJU A;  1J5E E;  3ADJ A;  1BBG A;  2EQ1 A;  2DB2 A;  2R76 A;  2V88 A;  2GLI A;  2I9I A;  4B3S E;  5CFF E;  1UHZ A;  5FLX C;  1X48 A;  2YZT A;  3MHS C;  2RSI A;  2YTO A;  3THO B;  1YYK A;  2UUB E;  2EMF A;  2YSO A;  2YTD A;  4I8O A;  2MDG A;  4DR1 E;  1A1H A;  2N3G A;  2EOJ A;  2EPC A;  2EOS A;  2EM8 A;  1G2F C;  2UXB E;  3F6G A;  2EOY A;  4Q35 B;  2M7Q A;  2EM0 A;  1SR9 A;  4DUZ E;  2LTS A;  4O5G A;  1X6F A;  2JY9 A;  3VK6 A;  1YSA C;  2M9A A;  2YTP A;  1YYO A;  2L2K B;  2E72 A;  3C4B A;  2KHX A;  4L5N C;  5A6J A;  1DGC A;  2YPN A;  1LLM C;  4RHB B;  5LMN E;  2EOI A;  3THN A;  4DMI A;  4LF8 E;  2EM5 A;  2ODR C;  2EM2 A;  2EM3 A;  1PDA A;  4DR5 E;  5LL6 R;  2RS7 A;  4JI3 E;  2MC6 A;  2RQL A;  3F6H A;  1QNT A;  1SFE A;  2NUG A;  2EOM A;  2KON A;  4ZYE A;  1EH8 A;  2YWQ A;  1BBO A;  2MKN A;  2EL6 A;  1NCS A;  2EMZ A;  2L2M A;  1GZ6 A;  3BF2 A;  2PRT A;  4LU9 A;  1N32 E;  2FV4 B;  1N33 E;  4X65 E;  2CSH A;  2RPC A;  3IWD A;  1B69 A;  2WBT A;  2L2N A;  4OOG C;  2JWO A;  4WXD A;  2EM6 A;  3MSW A;  1AAY A;  4F9C B;  1GQE A;  4WPY A;  3AUZ A;  1Z1B A;  2EN6 A;  3KWR A;  2EOF A;  2NAB A;  4WYQ B;  3EPK A;  4M2Z A;  2EQ3 A;  2EN2 A;  4NZV A;  2YRK A;  2YRM A;  1GTK A;  4JI6 E;  1YUJ A;  4ZYD A;  4B3R E;  2V8Q B;  4M30 A;  4FK5 C;  2JVA A;  5A2Q C;  2LRS A;  2B9D A;  4J8Z A;  2EMY A;  4N4R B;  5ADZ A;  4NXN E;  4O43 A;  4DV0 E;  2YTN A;  2EQ0 A;  2EMH A;  2L8T A;  1WJP A;  2YTE A;  2YT4 A;  2EOH A;  3EPL A;  2UXD E;  1FKA E;  2K4V A;  4DV3 E;  5BR8 E;  2DLQ A;  2YU5 A;  4GZN C;  4LFB E;  2DSY A;  4HEI A;  1T38 A;  4JI1 E;  2EJ4 A;  2YU8 A;  3DF6 A;  2M4I A;  2ADR A;  4DV6 E;  3MHH C;  1HNW E;  1N34 E;  2WBU A;  2EPZ A;  4JI5 E;  4LF7 E;  2EOE A;  1TF3 A;  4R2C A;  4BHC A;  4DKK A;  1FJG E;  2HJJ A;  1HR0 E;  3VYY A;  1X47 A;  2HGH A;  2ELZ A;  4DR4 E;  5AAS A;  1IBM E;  2H36 X;  4R2S A;  1ZBQ A;  2CPN A;  2L3C A;  2IHR 1;  4BHB A;  2LUP B;  2JP9 A;  4RH8 A;  1DI2 A;  3J7A G;  3HPS A;  3C6M A;  2RTX A;  2V87 A;  3BGH A;  3K6Q A;  1XMO E;  1XMQ E;  2LT7 A;  3QG5 C;  2NUE A;  4LF4 E;  3HXL A;  3JAM C;  4R03 A;  2B7T A;  2ENA A;  3FIG A;  2RSM A;  4BC9 A;  4NHR A;  2ENH A;  1DQ3 A;  4R2D A;  2JXP A;  1EH6 A;  3VHT B;  4LFA E;  2N3H A;  5A6K A;  3J80 C;  2EML A;  4B3M E;  3JTZ A;  1STU A;  2YSP A;  2JYA A;  4WSG A;  4DV1 E;  1KJK A;  2EOO A;  2YRH A;  1G2D C;  1IBK E;  2EMI A;  2LUQ A;  4YY3 E;  4OX9 E;  1I94 E;  2MKD A;  5T6J A;  4JI4 E;  2EMX A;  3C6K A;  2EPN A;  5A69 A;  3KZZ A;  1X6H A;  2EN8 A;  1ZR9 A;  1N3G A;  2DGC A;  5AE1 A;  3AV0 A;  4DUY E;  3DJW A;  3TQM A;  1N36 E;  5IXM B;  3ECR A;  4LF5 E;  1T4N A;  4BMJ A;  2ENC A;  5DNY A;  1A1K A;  1RQ0 A;  4X64 E;  2G7H A;  4NXM E;  5KL6 A;  1ZU1 A;  2L6M A;  4R2R A;  3J7Y p;  3IWC A;  2WZO A;  2B7V A;  1XNR E;  4Q28 A;  4WSP A;  3OTO E;  5IWA E;  1IBL E;  2EMW A;  2EWL A;  2EL4 A;  2EP3 A;  2V83 A;  4GEQ B;  1YPN A;  4R2Q A;  5AC4 A;  3L00 A;  1YZ9 A;  2EPO A;  2EPX A;  2DLK A;  3ADI A;  2LCE A;  4JI7 E;  5AC5 A;  2YTG A;  2LE2 A;  4ZYG A;  3RMP A;  4MLV A;  4BCA A;  1UIL A;  4YHH E;  2EPK X;  1JK2 A;  2LBS B;  2NA2 A;  4R2P A;  1QU6 A;  5A6B D;  1HNX E;  4LTY A;  4B3T E;  2EZ6 A;  1UN6 B;  1IQS A;  2EMG A;  4AQY E;  2DMY A;  3IWB A;  4GKK E;  2EMA A;  1PJQ A;  4F9B B;  1MGT A;  1TN9 A;  3T1Y E;  2F4V E;  2BBG A;  1WHN A;  1T4O A;  1RMD A;  5KL7 A;  3P1X A;  2EOR A;  2FGG A;  2L33 A;  1A1I A;  4ZYH A;  4DR3 E;  5IT9 C;  2V89 A;  4WFT A;  2EPP A;  2EL5 A;  2GPI A;  1X3C A;  2LO3 A;  4JI8 E;  2WBS A;  3EPJ A;  4F6M A;  4O24 A;  1A1J A;  4WXC A;  3LML A;  4F6N A;  1EH7 A;  2L3J A;  1KYQ A;  4DV4 E;  2F8B A;  1ZAA C;  4F9A B;  2ODR D;  3BBG A;  5AE3 A;  4X66 E;  4F2J C;  4GKJ E;  2EM7 A;  2EPL X;  1YYW A;  4BC7 A;  1HNZ E;  3H09 A;  5AE2 A;  4BS9 A;  2EMK A;  2EMC A;  4LF6 E;  1PJS A;  2EE8 A;  1BB8 A;  5IV8 B;  2EN3 A;  4DR2 E;  1T4L B;  3M99 B;  2JPA A;  2DIX A;  4JI2 E;  2UXC E;  1WXR A;  3HPZ A;  2D9H A;  2B3T B;  2YTJ A;  2ZM6 E;  2YTF A;  5TSE A;  2EN4 A;  2Q8U A;  1X49 A;  4X8W A;  2E5L E;  3BID A;  3OML A;  2EOX A;  2EN1 A;  4BBY A;  4KHP E;  3HTX A;  2LVH A;  3HQ1 A;  3JU0 A;  2WCC 3;  2VQE E;  3KZY A;  2EPA A;  4DR7 E;  1TF6 A;  1X6E A;  4DR6 E;  2RS6 A;  4P7D A;  2K7I A;  1O0W A;  4KWY A;  1WRJ A;  4L8N A;  4TUI A;  2E1M A;  1IMU A;  3LLH A;  4DV2 E;  5A6B A;  2UUA E;  4DV7 E;  2VRD A;  4WX9 A;  1T39 A;  2L92 A;  4HTG A;  1F2I G;  1L4S A;  1UBD C;  2EPR A;  2VE7 C;  3UK3 C;  1MEY C;  2EM4 A;  2M1S A;  1YUI A;  1JK1 A;  4JYA E;  4LF9 E;  2YTQ A;  2LTR A;  5KL2 A;  5A6A A;  4X62 E;  2MDR A;  2EPU A;  2V85 A;  2N8X A;  3ZOQ B;  4JV5 E;  2LV2 A;  2JOX A;  2EOZ A;  2UU9 E;  5LLQ A;  1AH5 A;  1J26 A; 
#chains in the Genus database with same CATH homology
 2EPP A;  2EL5 A;  1LLM C;  1X3C A;  2LO3 A;  4IJD A;  2WBS A;  3EPJ A;  4F6M A;  2LT7 A;  2EOI A;  1A1J A;  2DMI A;  2EM5 A;  2EM2 A;  4F6N A;  2ENA A;  2EM3 A;  2ENH A;  2A25 A;  1ZAA C;  4R2D A;  2YTI A;  3VHT B;  2EML A;  2BB8 A;  4F2J C;  4WSG A;  2YSP A;  3EPH A;  2EM7 A;  1A1G A;  2EOO A;  2YRH A;  1KJK A;  1G2D C;  2EOM A;  2EMI A;  4R2A A;  2EMB A;  5KL4 A;  2DRP A;  2EN7 A;  1BBO A;  2GHF A;  2EMC A;  2EMK A;  2MKD A;  2J7J A;  2EMX A;  2MKN A;  2EL6 A;  1NCS A;  1P47 A;  2EMZ A;  1X6H A;  2CTD A;  2PRT A;  2EE8 A;  2EN8 A;  1ZR9 A;  2DGC A;  1BB8 A;  2EN3 A;  2ELY A;  2CT1 A;  3M99 B;  2CSH A;  2RPC A;  4M9V C;  2JPA A;  2ENC A;  1B69 A;  1A1K A;  2WBT A;  2D9H A;  4R2E A;  2YTJ A;  1ZU1 A;  5KL6 A;  4X9J A;  2YTF A;  4R2R A;  2EN4 A;  2EM6 A;  1X5W A;  1A1F A;  1AAY A;  2EOX A;  2EN1 A;  4IS1 C;  1Z1B A;  2EN6 A;  2LVH A;  2R1F A;  2I13 A;  2EMW A;  2WCC 3;  2EOF A;  2NAB A;  2EL4 A;  5KL5 A;  2EP3 A;  3EPK A;  2EQ3 A;  2EN2 A;  4R2Q A;  2EPA A;  2YRK A;  1A1L A;  2EM9 A;  2YRM A;  5KL3 A;  1TF6 A;  1YUJ A;  2EOQ A;  1X6E A;  4FK5 C;  2EQ1 A;  2EMY A;  2EPX A;  2DLK A;  2YTN A;  2LCE A;  2EQ0 A;  2GLI A;  2EMH A;  2YTG A;  1WJP A;  2YTE A;  2EOH A;  3EPL A;  2DLQ A;  3MHS C;  2YU5 A;  2RSI A;  2YTO A;  4GZN C;  2EMF A;  2YSO A;  2YTD A;  1JK2 A;  2EJ4 A;  2YU8 A;  2MDG A;  2VRD A;  1A1H A;  2EOJ A;  2ADR A;  3MHH C;  2EPC A;  4R2P A;  1F2I G;  2EOS A;  2EM8 A;  1G2F C;  2WBU A;  2EPZ A;  2EPR A;  1UBD C;  2EOE A;  3UK3 C;  2EMG A;  1UN6 B;  1TF3 A;  1MEY C;  2EMA A;  4R2C A;  2EM4 A;  2EOY A;  1YUI A;  1TN9 A;  2EM0 A;  1JK1 A;  2YTQ A;  2HGH A;  1RMD A;  5KL7 A;  2ELZ A;  2EOR A;  1X6F A;  5KL2 A;  2EPU A;  1YSA C;  4R2S A;  1A1I A;  2JP9 A;  2LV2 A;  2M9A A;  2EOZ A;  2YTP A;  2E72 A;  1DGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...