2EPXA

Solution structure of the third c2h2 type zinc finger domain of zinc finger protein 28 homolog
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
47
structure length
47
Chain Sequence
GSSGSSGTGKKPYECIECGKAFIQNTSLIRHWRYYHTGEKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the third C2H2 type zinc finger domain of Zinc finger protein 28 homolog
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc finger protein 28 homolog
total genus 4
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2007-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2epxA01
2DMIA 2EQ0A 1YUJA 1TN9A 2CT1A 2YSPA 2EMGA 2YTGA 2EOOA 2EOZA 3VHTB 1B69A 1MEYC 2EN4A 2YTOA 1YUIA 1BBOA 2EN2A 1A1JA 2E72A 2EPUA 2EMLA 2EM7A 2YTQA 2EJ4A 2YTIA 2EOQA 2YRKA 2EN3A 4R2CA 2EMYA 3MHHC 2ELZA 2EL4A 2M9AA 1TF3A 2EPRA 4FK5C 2EOHA 2YTDA 1LLMC 2NABA 1RMDA 5KL4A 4R2DA 4IJDA 5KL7A 2D9HA 2WBUA 1TF6A 2DRPA 1P47A 1A1LA 2YTPA 4WSGA 1UBDC 2EMAA 1WJPA 2LVHA 4F2JC 2YU5A 1A1GA 2ENCA 2LV2A 5KL6A 2EMFA 2I13A 2YSOA 2EOYA 2EPPA 2EM4A 3M99B 5KL3A 2ADRA 2R1FA 2ELYA 1X6HA 2EMCA 2YTEA 2YTFA 2JP9A 2MKNA 2HGHA 2YRHA 2EPCA 2MKDA 3UK3C 1Z1BA 1G2FC 2EM0A 2A25A 2CSHA 2DLQA 2RSIA 2YU8A 2EOIA 2EMZA 1NCSA 2EM3A 2ENAA 2WBTA 2LT7A 1X3CA 2RPCA 2EM6A 3EPJA 4X9JA 2YTNA 2EOSA 1X6EA 3EPLA 4R2EA 2EN1A 2EOEA 1F2IG 4R2AA 1AAYA 5KL2A 1A1KA 2WCC3 4M9VC 2EOXA 1ZR9A 2EQ3A 1YSAC 2EM8A 2JPAA 1X6FA 4GZNC 2EMXA 1DGCA 2EMHA 2EMIA 1JK2A 3EPHA 2DGCA 2EM9A 2EP3A 2VRDA 3EPKA 1A1FA 1JK1A 1UN6B 4R2RA 2J7JA 2EM5A 2EORA 2BB8A 2ENHA 2GHFA 1A1HA 2GLIA 2PRTA 1ZU1A 3MHSC 2EMBA 2DLKA 4F6MA 2EL5A 2EN7A 2EPAA 1KJKA 1BB8A 2EM2A 4R2SA 1ZAAC 2LO3A 2LCEA 4R2PA 2EQ1A 2EOFA 4F6NA 2CTDA 2EMWA 2EPXA 2EMKA 2YRMA 2WBSA 4IS1C 1G2DC 2EPZA 2EOMA 5KL5A 2EOJA 2EN8A 1A1IA 2EE8A 4R2QA 1X5WA 2EN6A 2EL6A 2YTJA 2MDGA
chains in the Genus database with same CATH superfamily
1YUJA 2EMGA 4JI6E 2EOZA 4DV3E 4F54A 2HC5A 1MGTA 4B3RE 1EH6A 3FIGA 5AASA 4WXDA 5F3WA 5A6BD 2NUEA 2YRKA 4LFCE 5T6JA 1TF3A 2EPRA 1LLMC 2NABA 1RMDA 3J80C 1T38A 3KZYA 3BGHA 1N3GA 2FV4B 2UU9E 2EPKX 1IBLE 1PJSA 2DRPA 3VYYA 4O5GA 5LMNE 4P78A 4F9CB 2L2MA 3P1XA 3J7Yp 3HPZA 4F2JC 2YU5A 4WFTA 4R8OA 1HR0E 2EPPA 3AV0A 3M99B 2VF1A 4WYQB 5AC5A 2E1MA 2JYAA 3ADGA 2YTFA 2DB2A 2L33A 3BIDA 3UK3C 1AH5A 1Z1BA 1QU6A 1T4NA 3J81C 3VYXA 2RSIA 4WSPA 4KHPE 2ODRD 2EM3A 2ENAA 3THNA 4JYAE 4X64E 1X47A 3JTZA 4DV4E 2EPMX 2V86A 3TQMA 1BBGA 4R2EA 2EN1A 2LMZA 4O43A 1A1KA 2EOXA 1XMOE 2JY9A 1YSAC 4DR1E 2NUFA 4GZNC 1WRJA 2EMHA 2YPNA 2EM9A 1A1FA 4NXNE 4OX9E 3EQ1A 1ZU1A 4RH8A 4JI0E 4KWYA 4BMJA 1BB8A 4R2SA 4NZVA 2LO3A 4BC9A 3ADLA 2YWQA 3DJWA 2EPXA 5LMUE 2UUAE 2EOMA 2LTRA 4MLQA 2EOJA 2DMYA 3OMLA 4X8WA 5CFFE 2V85A 4F9BB 4ZYEA 2MC5A 1TN9A 2YSPA 4DR2E 1YPNA 2EN4A 2L3JA 2YTOA 1GQEA 2EN2A 1WHQA 1A1JA 2E72A 2EZ6A 2RS7A 2EM7A 2YTQA 2YTIA 2F8BA 2MDRA 2UXCE 1EH7A 2EN3A 1YYWA 4R2CA 1SR9A 3MHHC 3IWBA 2V87A 4M30A 1WHNA 3LLHA 2JOBA 2YTDA 4BHCA 4O4KA 3ADJA 4IJDA 3J7AG 4LFBE 2FTXB 1L4SA 1HNWE 1A1LA 5DNYA 2KOUA 2ENCA 2LBSB 2LV2A 4DR6E 2EMFA 3HPSA 2EM4A 5KL3A 2ADRA 2RSMA 1UILA 2ELYA 2EMCA 5A6AA 2JP9A 2LJUA 2K4VA 2HHHE 4BHBA 1N36E 5FLXC 2EOIA 1IBME 1X48A 2RS6A 2RPCA 2EM6A 2DIXA 2V8QB 4LFAE 3EPJA 4X9JA 2VQEE 2EOSA 2UUBE 2JR1A 1F2IG 1EH8A 1AAYA 2LUQA 5KL2A 3RMPA 4ZYDA 2NUGA 3BBGA 1SFEA 2M4IA 2N3HA 2EMXA 2N3GA 1YFHA 4LF7E 4KZSA 1XNRE 5AC4A 4L8NA 4JI1E 2VRDA 1IBKE 4OOGC 2WZOA 5IV8B 3ADIA 2G7HA 1RQ0A 4R2RA 2J7JA 2EORA 2BB8A 2ENHA 2GHFA 2GLIA 2PRTA 2DLKA 1N34E 2EPAA 2EM2A 4WPYA 2LCEA 4R2PA 5BR8E 4M2ZA 2EMWA 4I8OA 2EMKA 4IS1C 1G2DC 2EPZA 5A2QC 4HEIA 5KL5A 2L92A 5IXMB 2CPNA 2EWLA 4BBYA 1GZ6A 1X5WA 2EN6A 2YTJA 4RHBB 2BBGA 4X62E 2MDGA 3KWRA 2E5LE 2YTGA 3VHTB 2LTSA 1B69A 1MEYC 2EPLX 4J8ZA 2B3TB 2EPUA 1UHZA 3IWDA 2EOQA 2L6MA 1PKPA 4BS9A 1NEIA 2EMYA 4JI2E 2EL4A 2NA2A 2M9AA 2B7VA 3L00A 1WXRA 2JVAA 2V89A 2F4VE 5KL4A 4R2DA 4BCAA 4DUZE 5KL7A 2D9HA 3C4BA 1STUA 2ZM6E 2YTPA 2EMAA 1WJPA 4M0VA 4GKKE 5KL6A 2I13A 3IWCA 4X66E 2RTXA 1ZBQA 1ZBTA 2MKNA 2HGHA 2LE2A 4DV5E 4DV6E 4P7DA 1G2FC 2EPOA 2EM0A 2R76A 2GPIA 2FGGA 2DLQA 2YU8A 2VQFE 4WXCA 1YYKA 1NCSA 4N4RB 2L3CA 1IQSA 3C6MA 1YYOA 3EPLA 1KYQA 1X6EA 2EOEA 4Q35B 3HTXA 2WCC3 4M9VC 1ZR9A 4O24A 2EM8A 1X6FA 1DGCA 5A69A 2HJJA 2VE7C 3EPHA 2DGCA 2M1SA 4AQYE 2EP3A 1UN6B 4LTYA 1JK1A 3T1HE 2EM5A 4DR5E 5AE3A 2V83A 3OTOE 1T4LB 1FKAE 3THOB 3F6GA 4LF4E 1N33E 2EMBA 4F6MA 4TUIA 2B7TA 4JV5E 4YHHE 2UXDE 2EQ1A 3C4TA 3HXLA 2EOFA 4F6NA 2CTDA 3T1YE 2YRMA 5AE1A 2WBSA 1GTKA 4JI4E 4HTGA 2YT4A 1A1IA 4JI8E 4DUYE 1PJQA 2L8TA 3F6HA 2Q8UA 4JI5E 4NXME 2EE8A 4R2QA 3ECRA 3DF6A 2EL6A 4L5NC 1DI2A 3QG5C 4JI3E 2DMIA 2EQ0A 3C6KA 4BC7A 2CT1A 2EOOA 4DV7E 1EKZA 5ADZA 2L2KB 1BBOA 1YUIA 2N8XA 5LLQA 2I9IA 1FJGE 2EMLA 2EJ4A 1HNZE 2ELZA 5LL6R 4FK5C 2EOHA 4B3TE 2LUPB 2JWOA 4Q28A 4LF6E 3BF2A 3VK6A 2WBUA 1TF6A 1IMUA 1P47A 2JXPA 1PDAA 4WSGA 2DSYA 2JOXA 1UBDC 4LF8E 5A6JA 2B9DA 2RQLA 2UUCE 2LVHA 2LRSA 4WX9A 4JI7E 1A1GA 2UXBE 1XMQE 2YSOA 2EOYA 2M7QA 4ZYGA 2K7IA 2R1FA 1X6HA 3JU0A 4LU9A 4ZYHA 4DR3E 2YTEA 1T4OA 4DMIA 4DKKA 2LJHA 4DR7E 4B3ME 2YRHA 5A6BA 2EPCA 2MKDA 4DV1E 4GKJE 1T39A 3JAMC 1HNXE 2A25A 2CSHA 2EMZA 2WBTA 2LT7A 4R03A 4NHRA 1X3CA 1QNTA 2YTNA 1J26A 4YY3E 4R2AA 4TUGA 4LF5E 2KONA 4DV0E 2EQ3A 2JPAA 4LF9E 3H09A 2EMIA 3HQ1A 1JK2A 4GEQB 1IQOA 5A6KA 2YZTA 3EPKA 1RC7A 4F9AB 2H36X 4X65E 2IHR1 3ZOQB 4B3SE 1A1HA 2V88A 1PJTA 3K6QA 5TSEA 3MHSC 2EL5A 2EN7A 2MC6A 5IT9C 4DV2E 1KJKA 1YZ9A 1ZAAC 3LMLA 2ODRC 5AE2A 1X49A 4DR4E 1I94E 2KHXA 3KZZA 2EPNA 1O0WA 4K0KE 1N32E 2EN8A 1XNQE 1J5EE 2L2NA 3AUZA 4MLVA 3MSWA 5IWAE 1DQ3A
chains in the Genus database with same CATH topology
2DMIA 2EQ0A 1YUJA 1TN9A 2CT1A 2YSPA 2EMGA 2YTGA 2EOOA 2EOZA 3VHTB 1B69A 1MEYC 2EN4A 2YTOA 1YUIA 1BBOA 2EN2A 1A1JA 2E72A 2EPUA 2EMLA 2EM7A 2YTQA 2EJ4A 2YTIA 2EOQA 2YRKA 2EN3A 4R2CA 2EMYA 3MHHC 2ELZA 2EL4A 2M9AA 1TF3A 2EPRA 4FK5C 2EOHA 2YTDA 1LLMC 2NABA 1RMDA 5KL4A 4R2DA 4IJDA 5KL7A 2D9HA 2WBUA 1TF6A 2DRPA 1P47A 1A1LA 2YTPA 4WSGA 1UBDC 2EMAA 1WJPA 2LVHA 4F2JC 2YU5A 1A1GA 2ENCA 2LV2A 5KL6A 2EMFA 2I13A 2YSOA 2EOYA 2EPPA 2EM4A 3M99B 5KL3A 2ADRA 2R1FA 2ELYA 1X6HA 2EMCA 2YTEA 2YTFA 2JP9A 2MKNA 2HGHA 2YRHA 2EPCA 2MKDA 3UK3C 1Z1BA 1G2FC 2EM0A 2A25A 2CSHA 2DLQA 2RSIA 2YU8A 2EOIA 2EMZA 1NCSA 2EM3A 2ENAA 2WBTA 2LT7A 1X3CA 2RPCA 2EM6A 3EPJA 4X9JA 2YTNA 2EOSA 1X6EA 3EPLA 4R2EA 2EN1A 2EOEA 1F2IG 4R2AA 1AAYA 5KL2A 1A1KA 2WCC3 4M9VC 2EOXA 1ZR9A 2EQ3A 1YSAC 2EM8A 2JPAA 1X6FA 4GZNC 2EMXA 1DGCA 2EMHA 2EMIA 1JK2A 3EPHA 2DGCA 2EM9A 2EP3A 2VRDA 3EPKA 1A1FA 1JK1A 1UN6B 4R2RA 2J7JA 2EM5A 2EORA 2BB8A 2ENHA 2GHFA 1A1HA 2GLIA 2PRTA 1ZU1A 3MHSC 2EMBA 2DLKA 4F6MA 2EL5A 2EN7A 2EPAA 1KJKA 1BB8A 2EM2A 4R2SA 1ZAAC 2LO3A 2LCEA 4R2PA 2EQ1A 2EOFA 4F6NA 2CTDA 2EMWA 2EPXA 2EMKA 2YRMA 2WBSA 4IS1C 1G2DC 2EPZA 2EOMA 5KL5A 2EOJA 2EN8A 1A1IA 2EE8A 4R2QA 1X5WA 2EN6A 2EL6A 2YTJA 2MDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMI A;  2EQ0 A;  1YUJ A;  1TN9 A;  2CT1 A;  2YSP A;  2EMG A;  2YTG A;  2EOO A;  2EOZ A;  3VHT B;  1B69 A;  1MEY C;  2EN4 A;  2YTO A;  1YUI A;  1BBO A;  2EN2 A;  1A1J A;  2E72 A;  2EPU A;  2EML A;  2EM7 A;  2YTQ A;  2EJ4 A;  2YTI A;  2EOQ A;  2YRK A;  2EN3 A;  4R2C A;  2EMY A;  3MHH C;  2ELZ A;  2EL4 A;  2M9A A;  1TF3 A;  2EPR A;  4FK5 C;  2EOH A;  2YTD A;  1LLM C;  2NAB A;  1RMD A;  5KL4 A;  4R2D A;  4IJD A;  5KL7 A;  2D9H A;  2WBU A;  1TF6 A;  2DRP A;  1P47 A;  1A1L A;  2YTP A;  4WSG A;  1UBD C;  2EMA A;  1WJP A;  2LVH A;  4F2J C;  2YU5 A;  1A1G A;  2ENC A;  2LV2 A;  5KL6 A;  2EMF A;  2I13 A;  2YSO A;  2EOY A;  2EPP A;  2EM4 A;  3M99 B;  5KL3 A;  2ADR A;  2R1F A;  2ELY A;  1X6H A;  2EMC A;  2YTE A;  2YTF A;  2JP9 A;  2MKN A;  2HGH A;  2YRH A;  2EPC A;  2MKD A;  3UK3 C;  1Z1B A;  1G2F C;  2EM0 A;  2A25 A;  2CSH A;  2DLQ A;  2RSI A;  2YU8 A;  2EOI A;  2EMZ A;  1NCS A;  2EM3 A;  2ENA A;  2WBT A;  2LT7 A;  1X3C A;  2RPC A;  2EM6 A;  3EPJ A;  4X9J A;  2YTN A;  2EOS A;  1X6E A;  3EPL A;  4R2E A;  2EN1 A;  2EOE A;  1F2I G;  4R2A A;  1AAY A;  5KL2 A;  1A1K A;  2WCC 3;  4M9V C;  2EOX A;  1ZR9 A;  2EQ3 A;  1YSA C;  2EM8 A;  2JPA A;  1X6F A;  4GZN C;  2EMX A;  1DGC A;  2EMH A;  2EMI A;  1JK2 A;  3EPH A;  2DGC A;  2EM9 A;  2EP3 A;  2VRD A;  3EPK A;  1A1F A;  1JK1 A;  1UN6 B;  4R2R A;  2J7J A;  2EM5 A;  2EOR A;  2BB8 A;  2ENH A;  2GHF A;  1A1H A;  2GLI A;  2PRT A;  1ZU1 A;  3MHS C;  2EMB A;  2DLK A;  4F6M A;  2EL5 A;  2EN7 A;  2EPA A;  1KJK A;  1BB8 A;  2EM2 A;  4R2S A;  1ZAA C;  2LO3 A;  2LCE A;  4R2P A;  2EQ1 A;  2EOF A;  4F6N A;  2CTD A;  2EMW A;  2EPX A;  2EMK A;  2YRM A;  2WBS A;  4IS1 C;  1G2D C;  2EPZ A;  2EOM A;  5KL5 A;  2EOJ A;  2EN8 A;  1A1I A;  2EE8 A;  4R2Q A;  1X5W A;  2EN6 A;  2EL6 A;  2YTJ A;  2MDG A; 
#chains in the Genus database with same CATH topology
 1YUJ A;  2EMG A;  4JI6 E;  2EOZ A;  4DV3 E;  4F54 A;  2HC5 A;  1MGT A;  4B3R E;  1EH6 A;  3FIG A;  5AAS A;  4WXD A;  5F3W A;  5A6B D;  2NUE A;  2YRK A;  4LFC E;  5T6J A;  1TF3 A;  2EPR A;  1LLM C;  2NAB A;  1RMD A;  3J80 C;  1T38 A;  3KZY A;  3BGH A;  1N3G A;  2FV4 B;  2UU9 E;  2EPK X;  1IBL E;  1PJS A;  2DRP A;  3VYY A;  4O5G A;  5LMN E;  4P78 A;  4F9C B;  2L2M A;  3P1X A;  3J7Y p;  3HPZ A;  4F2J C;  2YU5 A;  4WFT A;  4R8O A;  1HR0 E;  2EPP A;  3AV0 A;  3M99 B;  2VF1 A;  4WYQ B;  5AC5 A;  2E1M A;  2JYA A;  3ADG A;  2YTF A;  2DB2 A;  2L33 A;  3BID A;  3UK3 C;  1AH5 A;  1Z1B A;  1QU6 A;  1T4N A;  3J81 C;  3VYX A;  2RSI A;  4WSP A;  4KHP E;  2ODR D;  2EM3 A;  2ENA A;  3THN A;  4JYA E;  4X64 E;  1X47 A;  3JTZ A;  4DV4 E;  2EPM X;  2V86 A;  3TQM A;  1BBG A;  4R2E A;  2EN1 A;  2LMZ A;  4O43 A;  1A1K A;  2EOX A;  1XMO E;  2JY9 A;  1YSA C;  4DR1 E;  2NUF A;  4GZN C;  1WRJ A;  2EMH A;  2YPN A;  2EM9 A;  1A1F A;  4NXN E;  4OX9 E;  3EQ1 A;  1ZU1 A;  4RH8 A;  4JI0 E;  4KWY A;  4BMJ A;  1BB8 A;  4R2S A;  4NZV A;  2LO3 A;  4BC9 A;  3ADL A;  2YWQ A;  3DJW A;  2EPX A;  5LMU E;  2UUA E;  2EOM A;  2LTR A;  4MLQ A;  2EOJ A;  2DMY A;  3OML A;  4X8W A;  5CFF E;  2V85 A;  4F9B B;  4ZYE A;  2MC5 A;  1TN9 A;  2YSP A;  4DR2 E;  1YPN A;  2EN4 A;  2L3J A;  2YTO A;  1GQE A;  2EN2 A;  1WHQ A;  1A1J A;  2E72 A;  2EZ6 A;  2RS7 A;  2EM7 A;  2YTQ A;  2YTI A;  2F8B A;  2MDR A;  2UXC E;  1EH7 A;  2EN3 A;  1YYW A;  4R2C A;  1SR9 A;  3MHH C;  3IWB A;  2V87 A;  4M30 A;  1WHN A;  3LLH A;  2JOB A;  2YTD A;  4BHC A;  4O4K A;  3ADJ A;  4IJD A;  3J7A G;  4LFB E;  2FTX B;  1L4S A;  1HNW E;  1A1L A;  5DNY A;  2KOU A;  2ENC A;  2LBS B;  2LV2 A;  4DR6 E;  2EMF A;  3HPS A;  2EM4 A;  5KL3 A;  2ADR A;  2RSM A;  1UIL A;  2ELY A;  2EMC A;  5A6A A;  2JP9 A;  2LJU A;  2K4V A;  2HHH E;  4BHB A;  1N36 E;  5FLX C;  2EOI A;  1IBM E;  1X48 A;  2RS6 A;  2RPC A;  2EM6 A;  2DIX A;  2V8Q B;  4LFA E;  3EPJ A;  4X9J A;  2VQE E;  2EOS A;  2UUB E;  2JR1 A;  1F2I G;  1EH8 A;  1AAY A;  2LUQ A;  5KL2 A;  3RMP A;  4ZYD A;  2NUG A;  3BBG A;  1SFE A;  2M4I A;  2N3H A;  2EMX A;  2N3G A;  1YFH A;  4LF7 E;  4KZS A;  1XNR E;  5AC4 A;  4L8N A;  4JI1 E;  2VRD A;  1IBK E;  4OOG C;  2WZO A;  5IV8 B;  3ADI A;  2G7H A;  1RQ0 A;  4R2R A;  2J7J A;  2EOR A;  2BB8 A;  2ENH A;  2GHF A;  2GLI A;  2PRT A;  2DLK A;  1N34 E;  2EPA A;  2EM2 A;  4WPY A;  2LCE A;  4R2P A;  5BR8 E;  4M2Z A;  2EMW A;  4I8O A;  2EMK A;  4IS1 C;  1G2D C;  2EPZ A;  5A2Q C;  4HEI A;  5KL5 A;  2L92 A;  5IXM B;  2CPN A;  2EWL A;  4BBY A;  1GZ6 A;  1X5W A;  2EN6 A;  2YTJ A;  4RHB B;  2BBG A;  4X62 E;  2MDG A;  3KWR A;  2E5L E;  2YTG A;  3VHT B;  2LTS A;  1B69 A;  1MEY C;  2EPL X;  4J8Z A;  2B3T B;  2EPU A;  1UHZ A;  3IWD A;  2EOQ A;  2L6M A;  1PKP A;  4BS9 A;  1NEI A;  2EMY A;  4JI2 E;  2EL4 A;  2NA2 A;  2M9A A;  2B7V A;  3L00 A;  1WXR A;  2JVA A;  2V89 A;  2F4V E;  5KL4 A;  4R2D A;  4BCA A;  4DUZ E;  5KL7 A;  2D9H A;  3C4B A;  1STU A;  2ZM6 E;  2YTP A;  2EMA A;  1WJP A;  4M0V A;  4GKK E;  5KL6 A;  2I13 A;  3IWC A;  4X66 E;  2RTX A;  1ZBQ A;  1ZBT A;  2MKN A;  2HGH A;  2LE2 A;  4DV5 E;  4DV6 E;  4P7D A;  1G2F C;  2EPO A;  2EM0 A;  2R76 A;  2GPI A;  2FGG A;  2DLQ A;  2YU8 A;  2VQF E;  4WXC A;  1YYK A;  1NCS A;  4N4R B;  2L3C A;  1IQS A;  3C6M A;  1YYO A;  3EPL A;  1KYQ A;  1X6E A;  2EOE A;  4Q35 B;  3HTX A;  2WCC 3;  4M9V C;  1ZR9 A;  4O24 A;  2EM8 A;  1X6F A;  1DGC A;  5A69 A;  2HJJ A;  2VE7 C;  3EPH A;  2DGC A;  2M1S A;  4AQY E;  2EP3 A;  1UN6 B;  4LTY A;  1JK1 A;  3T1H E;  2EM5 A;  4DR5 E;  5AE3 A;  2V83 A;  3OTO E;  1T4L B;  1FKA E;  3THO B;  3F6G A;  4LF4 E;  1N33 E;  2EMB A;  4F6M A;  4TUI A;  2B7T A;  4JV5 E;  4YHH E;  2UXD E;  2EQ1 A;  3C4T A;  3HXL A;  2EOF A;  4F6N A;  2CTD A;  3T1Y E;  2YRM A;  5AE1 A;  2WBS A;  1GTK A;  4JI4 E;  4HTG A;  2YT4 A;  1A1I A;  4JI8 E;  4DUY E;  1PJQ A;  2L8T A;  3F6H A;  2Q8U A;  4JI5 E;  4NXM E;  2EE8 A;  4R2Q A;  3ECR A;  3DF6 A;  2EL6 A;  4L5N C;  1DI2 A;  3QG5 C;  4JI3 E;  2DMI A;  2EQ0 A;  3C6K A;  4BC7 A;  2CT1 A;  2EOO A;  4DV7 E;  1EKZ A;  5ADZ A;  2L2K B;  1BBO A;  1YUI A;  2N8X A;  5LLQ A;  2I9I A;  1FJG E;  2EML A;  2EJ4 A;  1HNZ E;  2ELZ A;  5LL6 R;  4FK5 C;  2EOH A;  4B3T E;  2LUP B;  2JWO A;  4Q28 A;  4LF6 E;  3BF2 A;  3VK6 A;  2WBU A;  1TF6 A;  1IMU A;  1P47 A;  2JXP A;  1PDA A;  4WSG A;  2DSY A;  2JOX A;  1UBD C;  4LF8 E;  5A6J A;  2B9D A;  2RQL A;  2UUC E;  2LVH A;  2LRS A;  4WX9 A;  4JI7 E;  1A1G A;  2UXB E;  1XMQ E;  2YSO A;  2EOY A;  2M7Q A;  4ZYG A;  2K7I A;  2R1F A;  1X6H A;  3JU0 A;  4LU9 A;  4ZYH A;  4DR3 E;  2YTE A;  1T4O A;  4DMI A;  4DKK A;  2LJH A;  4DR7 E;  4B3M E;  2YRH A;  5A6B A;  2EPC A;  2MKD A;  4DV1 E;  4GKJ E;  1T39 A;  3JAM C;  1HNX E;  2A25 A;  2CSH A;  2EMZ A;  2WBT A;  2LT7 A;  4R03 A;  4NHR A;  1X3C A;  1QNT A;  2YTN A;  1J26 A;  4YY3 E;  4R2A A;  4TUG A;  4LF5 E;  2KON A;  4DV0 E;  2EQ3 A;  2JPA A;  4LF9 E;  3H09 A;  2EMI A;  3HQ1 A;  1JK2 A;  4GEQ B;  1IQO A;  5A6K A;  2YZT A;  3EPK A;  1RC7 A;  4F9A B;  2H36 X;  4X65 E;  2IHR 1;  3ZOQ B;  4B3S E;  1A1H A;  2V88 A;  1PJT A;  3K6Q A;  5TSE A;  3MHS C;  2EL5 A;  2EN7 A;  2MC6 A;  5IT9 C;  4DV2 E;  1KJK A;  1YZ9 A;  1ZAA C;  3LML A;  2ODR C;  5AE2 A;  1X49 A;  4DR4 E;  1I94 E;  2KHX A;  3KZZ A;  2EPN A;  1O0W A;  4K0K E;  1N32 E;  2EN8 A;  1XNQ E;  1J5E E;  2L2N A;  3AUZ A;  4MLV A;  3MSW A;  5IWA E;  1DQ3 A; 
#chains in the Genus database with same CATH homology
 2DMI A;  2EQ0 A;  1YUJ A;  1TN9 A;  2CT1 A;  2YSP A;  2EMG A;  2YTG A;  2EOO A;  2EOZ A;  3VHT B;  1B69 A;  1MEY C;  2EN4 A;  2YTO A;  1YUI A;  1BBO A;  2EN2 A;  1A1J A;  2E72 A;  2EPU A;  2EML A;  2EM7 A;  2YTQ A;  2EJ4 A;  2YTI A;  2EOQ A;  2YRK A;  2EN3 A;  4R2C A;  2EMY A;  3MHH C;  2ELZ A;  2EL4 A;  2M9A A;  1TF3 A;  2EPR A;  4FK5 C;  2EOH A;  2YTD A;  1LLM C;  2NAB A;  1RMD A;  5KL4 A;  4R2D A;  4IJD A;  5KL7 A;  2D9H A;  2WBU A;  1TF6 A;  2DRP A;  1P47 A;  1A1L A;  2YTP A;  4WSG A;  1UBD C;  2EMA A;  1WJP A;  2LVH A;  4F2J C;  2YU5 A;  1A1G A;  2ENC A;  2LV2 A;  5KL6 A;  2EMF A;  2I13 A;  2YSO A;  2EOY A;  2EPP A;  2EM4 A;  3M99 B;  5KL3 A;  2ADR A;  2R1F A;  2ELY A;  1X6H A;  2EMC A;  2YTE A;  2YTF A;  2JP9 A;  2MKN A;  2HGH A;  2YRH A;  2EPC A;  2MKD A;  3UK3 C;  1Z1B A;  1G2F C;  2EM0 A;  2A25 A;  2CSH A;  2DLQ A;  2RSI A;  2YU8 A;  2EOI A;  2EMZ A;  1NCS A;  2EM3 A;  2ENA A;  2WBT A;  2LT7 A;  1X3C A;  2RPC A;  2EM6 A;  3EPJ A;  4X9J A;  2YTN A;  2EOS A;  1X6E A;  3EPL A;  4R2E A;  2EN1 A;  2EOE A;  1F2I G;  4R2A A;  1AAY A;  5KL2 A;  1A1K A;  2WCC 3;  4M9V C;  2EOX A;  1ZR9 A;  2EQ3 A;  1YSA C;  2EM8 A;  2JPA A;  1X6F A;  4GZN C;  2EMX A;  1DGC A;  2EMH A;  2EMI A;  1JK2 A;  3EPH A;  2DGC A;  2EM9 A;  2EP3 A;  2VRD A;  3EPK A;  1A1F A;  1JK1 A;  1UN6 B;  4R2R A;  2J7J A;  2EM5 A;  2EOR A;  2BB8 A;  2ENH A;  2GHF A;  1A1H A;  2GLI A;  2PRT A;  1ZU1 A;  3MHS C;  2EMB A;  2DLK A;  4F6M A;  2EL5 A;  2EN7 A;  2EPA A;  1KJK A;  1BB8 A;  2EM2 A;  4R2S A;  1ZAA C;  2LO3 A;  2LCE A;  4R2P A;  2EQ1 A;  2EOF A;  4F6N A;  2CTD A;  2EMW A;  2EPX A;  2EMK A;  2YRM A;  2WBS A;  4IS1 C;  1G2D C;  2EPZ A;  2EOM A;  5KL5 A;  2EOJ A;  2EN8 A;  1A1I A;  2EE8 A;  4R2Q A;  1X5W A;  2EN6 A;  2EL6 A;  2YTJ A;  2MDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...