2EQIA

Solution structure of the sh3 domain from phospholipase c, gamma 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
GSSGSSGRTVKALYDYKAKRSDELTFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain from Phospholipase C, gamma 2
rcsb
source organism Mus musculus
molecule tags Immune system, hydrolase
molecule keywords Phospholipase C, gamma 2
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2eqiA00
2DE0X 2X3WD 4FSSA 4J9CA 2KT1A 1WFWA 2JM9A 3TSZA 3KFVA 1M3BA 2AZVA 1NEBA 2RPNA 1UTIA 3H0HA 2DL7A 1SRLA 2HCKA 1QKXA 4Z88A 2KYMA 4RUGA 2YSQA 1ARKA 4HVVA 1E7OA 1NG2A 1WXUA 2DLPA 4Y92A 1UHCA 3LH5A 2DJQA 1UE9A 3NGPA 1WLPB 2H8HA 2D8JA 2YT6A 3UA6A 3SHWA 2EYWA 2J6KA 4F14A 1BBZA 4RTUA 1MV0B 1RUWA 1NYFA 4DEXA 2L3SA 2KYBA 2DBMA 2I0NA 3VS1A 5IHKA 4CC7A 1ZBJA 5FWBA 1WI7A 1UGVA 4ORZA 1GBQA 3REAB 2C0TA 2CSQA 2FRWA 1J3TA 1Z9ZA 1I0CA 2DL3A 1WA7A 2KR3A 2VVKA 4LUEA 2LQWA 2LQNA 1VYVA 2HSPA 2YUOA 1JQQA 2KNBB 3EHQA 3M0UA 1YWOA 2DNUA 1NEGA 1SEMA 1M3CA 2EYZA 4J9EA 5GJWB 4J9DA 4DEYA 1QWFA 4AFSC 4D8DA 4OMOA 2KBTA 3THKA 4QT7A 1VYTA 3ZL7C 3TVTA 1AEYA 1E6GA 1QKWA 3EGUA 3VS7A 1K0XA 1NLOC 2LJ0A 5FWCA 2GTJA 4HVWA 2FEIA 2SRCA 1UG1A 1MV3A 5HCKA 1GFDA 1AD5A 2GQIA 1QCFA 1M27C 2EBPA 2ENMA 3VRYA 4F17A 2DL4A 2DRKA 4WCIA 1MUZA 4AG2C 5L23A 1VYUA 2O9VA 1JU5C 2KRSA 4OMPA 3FJ5A 2KROA 1S1NA 2QDLA 1KJWA 4X1VA 2DL8A 1Z9QA 1IO6A 3TSWA 1WIEA 4ZNXA 3RBBB 2ABLA 3I5RA 1ZX6A 1SSHA 1T0HA 3VS3A 1H92A 3H41A 1UJ0A 2NUZA 2YUQA 4RTTA 1K4US 2V1RA 2KE9A 5GJVB 1X69A 2MCNA 1KSWA 1BU1A 2DMOA 4RTYA 1UDLA 2O31A 2J6FA 4CC4B 2KRNA 2AKLA 1B3QA 1QWEA 1GL5A 2YDLA 4J9BA 2NWMA 4OMQA 3EG2A 2L0AA 4JZ4A 1TG0A 1AWWA 1GRIA 1ZUUA 3UA7A 2IIMA 2AK5A 1K1ZA 1OPLA 2FO0A 3VS0A 3H0FA 4LUDA 2C0IA 2C0OA 2JXBA 2K79A 3REBB 3ULRB 5IHNA 1H8KA 1ZSGA 1W6XA 2KRMA 2FPDA 4KRTA 4R0KA 1ZUKA 3VRZA 2GNCA 4HCKA 2CH4W 1M8MA 1I1JA 2G6FX 4CC2A 2JMCA 1B07A 2LZ6B 2RMOA 2CSIA 5ECAA 3VS5A 2MIOA 2K3BA 2D0NA 2DL5A 1RLQC 1GFCA 1X2KA 1YNZA 2FPFA 4HVUA 3VS6A 3M0RA 2VKNA 1PHTA 2DILA 5EC7A 1AOJA 2CT4A 4M4ZA 3C0CA 1CSKA 4Z89A 1SPKA 2J6OA 2CUBA 1NLPC 2HBWA 2BZ8A 2AKKA 3M0QA 3M0TA 1WYXA 1AVZC 1BK2A 1GBRA 1GCQC 2O2OA 1NM7A 1TUDA 2F2WA 2LJ3A 5FW9A 3NMZC 2EKHA 3EG3A 2DYBA 2K6DA 1ZUYA 1CKAA 1FMKA 3UF4A 1PRLC 4AFQC 4AFUC 2BZXA 4IIMA 4RTWA 2JMAA 2JM8A 3GBQA 2BTTA 1YP5A 2P4RA 2OAWA 4J9FA 2JT4A 3UATA 2GGRA 2FG0A 2KGTA 2RQRA 3QWXX 2PTKA 1U3OA 2X3XD 2K7AA 2HDAA 2MOXA 1FYNA 1T0JA 1W1FA 4CC3A 5IH2A 1HJDA 1SRMA 1K9AA 3PVQA 4J9HA 1H3HA 2EGAA 4RTZA 4OMLA 3I35A 4OMNA 2B86A 2DX1A 2J06A 1HSQA 3PE0A 1A0NB 1UJYA 1X27A 1OPKA 1PKTA 4AG1C 4GBQA 1G83A 1JXMA 4LNPA 2RF0A 1QLYA 4D8KA 1AZGB 2RN8A 1GCPA 1N5ZA 1LCKA 1PWTA 2CDTA 2E5KA 3VS4A 1GCQA 1JXOA 1U5SA 2LX7A 4IIOA 2K2MA 2EGCA 1CKBA 1ABQA 2KEAA 2DRMA 3NPFA 2ECZA 2RQWA 2V1QA 2ROTA 3R6NA 2A08A 1ABOA 2PNIA 1T3SA 2O88A 1KFZA 1V1CA 2KXCA 3A98A 1HD3A 2OI3A 3H0IA 1OOTA 1M30A 2L3QA 2F2XA 1PNJA 4GLMA 5IXFA 1XOVA 2HEQA 1OEBA 4JJDA 3NHNA 2GBQA 2EVRA 1K0SA 1SHFA 2AZSA 2EYYA 1VA7A 2KXDA 4J9IA 2JS2A 4ESRA 2GTOA 2LP5A 2F2VA 2PZ1A 1E6HA 2ED0A 4Z8AA 2W0ZA 1UFFA 4LE9A 2DBKA 1Y57A 1G2BA 3EG1A 2M0YA 3VS2A 1X43A 1EFNA 5IXBA 1KIKA 2LNHB 2JS0A 2OJ2A 3I5SA 1YN8A 2EQIA 4JJBA 1SHGA 3EHRA 5I11A 2LJ1A 3O5ZA 4JZ3A 1M3AA 2RQVA 1JO8A 1WXBA 5IHIA 2XMFA 2DVJA 4JPBW 1UECA 1ZLMA 1YWPA 1K76A 2A37A 2SEMA 3I9QA 2ESWA 4RTVA 3U23A 4K11A 2JTEA 1U06A 4HXJA 2A36A 2FRYA 4AFZC 3SEMA 4JJCA 2ED1A 2K9GA 1Y0MA 4OMMA 1NYGA 3M0SA 1AWXA 1TUCA 2YUNA 1OV3A 5I22A 2L3PA 2J05A 2LCSA 1I07A 1AWOA 1RLPC 2CH4A 4LN2A 4F16A 1WX6A 1PRMC 1JEGA 2W10A 4RTXA 1YCSB 2LMJA 2O9SA 2YUPA 2BZYA 2DF6A 2L2PA 3EG0A 4A63B 2CREA 2D1XA 1W70A 3IQLA 1AZEA 1UHFA 2CT3A 2A28A 2JW4A 2CUDA 1X6BA 2VWFA 2DA9A 4EIKA 1T3LA 1X6GA 2DM1A 2RNAA 4E6RA 4J9GA 1UUEA 1X2QA 2M51A 2FPEA 1WDXA 3CQTA 2EW3A 2EYXA 3JV3A 2D8HA 2EGEA 3M0PA 2KT8A 2EPDA 3RNJA 2ROLA 1PKSA 1WXTA 1RI9A 2RQTA 3PVLA 2RQUA 3QWYA 2J7IA 1BB9A 1AWJA
chains in the Genus database with same CATH superfamily
2DE0X 3I55Q 2X3WD 1I8FA 3OYIA 4NOYA 4PK4A 1OI1A 4ELZC 3HKSA 2LQKA 1M3BA 3MCAB 1UTIA 1QVFP 1SRLA 2YSQA 4BD3A 4HVVA 1NG2A 4N4IA 2DLPA 4Y92A 5EG2A 1RACB 1VQ9T 3A8OB 5A2QE 3UPUA 2YXYA 2DJQA 1WLPB 1UGSB 4PJOD 3C12A 3VYHB 1TU0B 2K3YA 4DBHA 4M75F 4RTUA 1MV0B 4M7DB 3HRUA 3CCEA 1MMDA 1K73R 1IRXA 2E3IA 3QXEB 5IHKA 2FYKA 4CC7A 2EQJA 5FWBA 2CSQA 2E10A 2DXUA 1Z9ZA 5KYUB 5IN1A 4DBRA 1Q81U 1YBYA 2EJFA 4RCCA 2XIDA 3M57A 1QWFA 4D8DA 3JRZA 2KBTA 4DOWA 4QT7A 1VYTA 5FLXE 3ZL7C 3TVTA 3OYHA 1AEYA 3EGUA 1NLOC 5FRNA 4BDZA 5DLOA 2GTJA 4PJOG 1KD1R 2SRCA 4C92D 1ZA1B 1QVFS 5HCKA 1GFDA 2L89A 1AD5A 3QO3A 1M27C 4F17A 3VRYA 1ZBXA 2QTXA 3RKXA 3J80E 4QVDA 2IG0A 1XQHA 4JRIA 3SDZA 5DM7R 4M7DF 2GFAA 2KROA 3MPUB 1VQMQ 1KHIA 1KJWA 4R56A 1Z9QA 2F1LA 1NE8A 1VQOT 2B8AA 1WIEA 5GANg 4J83A 5KE2A 3I5RA 4LDUA 5M9OA 1ZX6A 1SSHA 2FHDA 1WHMA 2KY9A 1UJ0A 1B34B 2YUQA 3CCLT 4MDWA 5CR2A 2FL7A 3NTHA 4D6WA 5GJVB 3J81E 1VQ5Q 5FU7C 3L2ZA 3G71Q 2J6FA 2OX7A 2KRNA 4PJOA 4OB0B 2NWMA 2C06A 1IGQA 3EG2A 1VQLQ 3CC7Q 3CCET 3QJ6A 4JUVA 1TG0A 3JB9H 1KK7A 4BI3A 3CCUA 4ANJA 1NJIR 2JJ9A 3PMIA 2K2VA 2PQWA 1EX4A 1EZZB 3UA7A 3LGLA 4R55A 5GAMd 1K1ZA 2Z0WA 3VS0A 3OYLA 4ZTFA 4LUDA 2K79A 5AYFA 1C1AA 3MEAA 4OF1A 2KRMA 2MF2A 2D6FA 1G3TA 2FPDA 2QQRA 4M7AB 2X35A 4M75C 3VRZA 4HCKA 4A4HA 2G6FX 3X28B 2JMCA 2VUBA 2LZ6B 1KC8C 4M78B 5LJ3j 4EPCA 2K3BA 1RLQC 1YNZA 2VKNA 3X24B 4ZGEB 3OS2A 1PHTA 2QA4A 2DILA 4LD9K 1PD0A 3GOXA 3C0CA 3CMET 1Y96B 2RI5A 3PMTA 4M78G 2ZPIB 1JB0E 2OTJA 1NLPC 2HBWA 2JVVA 3T9NA 1TSFA 3OYFA 3PIPA 2V26A 3CC4A 1TUDA 2DTIA 4M7DG 2HL3A 3WXMB 4M75D 3TREA 3LWHA 2DYBA 4C92F 2CP7A 3KBGA 3UF4A 1VQPQ 3AT1B 4AFQC 3TU4K 2F5TX 4A4KA 3EAEA 4KGXB 4RTWA 2R5MA 1TOVA 5CO7A 3OQ5A 4BY6C 2GGRA 2KGTA 2RQRA 4EMGA 2E6ZA 3G4ST 4XQ3A 2MOXA 1SRMA 2QQAA 3HRSA 2K57A 4J6YA 1K9AA 5GMKi 2DO3A 4E7ZA 4WF2A 3CCJQ 4J7IA 3FDRA 4OMLA 1WHLA 1K73C 4BI4A 1OX9A 1WHGA 1Q7YC 2J06A 1HSQA 4HT9A 5GAN6 2FB7A 1G3WA 2MWPA 1BCOA 3VJPA 3FB9A 3P8BB 5HKCA 1VQMA 4BUGA 3G6ET 1D0YA 4M77A 4LNPA 1QLYA 2CP6A 1TXQA 5KYYB 1GCPA 3JB9J 2MK5A 3CCQA 2VGMA 1YHQA 4F7UB 1I4K1 3OA6A 2ECZA 2XKOC 2RQWA 2ZPFB 3GP8A 2ROTA 2OAUA 5D6YA 3R6NA 1WHHA 3S3NA 1RAFB 1JJ2S 2R57A 3PFSA 4E7KA 1PG5B 2IVWA 1LJOA 1YITA 2KXCA 1HD3A 3M53A 2VXEA 1OOTA 1M30A 3UT1A 3ASKA 3G4SQ 3RESA 2E70A 3PGGA 4M7DC 4GLMA 2ZPEB 1XOVA 2CZ6B 4JJDA 2EVRA 2MAMA 1K0SA 2KXDA 1M1GA 1VA7A 2F2VA 1U8RA 4KBMB 1YIJQ 4Z8AA 2W0ZA 1UFFA 3CCSA 3SWNB 1Y57A 1WJSA 3EG1A 3RUXA 2ZCFB 5CK9A 2M0YA 4JS5A 1X43A 1EFNA 1D0XA 3GIBA 1Y71A 3I56T 2COZA 1K8AC 4J5YA 3JCMJ 1M1FA 3J7AF 4FT2A 3I5SA 1YN8A 2EQIA 1N27A 2XI9A 1SHGA 5GAOn 4JJNK 4HCZA 1M3AA 2RQVA 3EG9A 1TUGB 5CQXA 1ZLMA 4F7UF 3LWIA 4XU0A 5LJ5f 1IGUA 2CZ7B 1D09B 1U06A 5DLQE 1M5Q1 2LX9A 2QXFA 4AFZC 2ED1A 4DBQA 4KH0B 2P0PA 5GAOl 4VUBA 3EG9B 5DY9A 1ACMB 3CEYA 5GANj 1I07A 2M02A 1RLPC 4QW2A 3CCLA 1PRMC 4HA8A 3CCRQ 4RTXA 4KGVB 1VQPA 3X25B 2WSCE 1N8RR 4C8QA 3NTKA 2DF6A 1ZQ1A 1R0CB 3RIRA 3RERA 2KQWA 1M90C 2CUDA 4XTZA 1KC8U 1T3LA 1X6GA 2DFUA 1BI2A 4J9GA 3M54A 2M51A 2RHZA 1UB4A 2EGEA 3M0PA 1IXDA 2EPDA 3RNJA 1PKSA 1WXTA 3L2WA 1QW1A 3QWYA 1S72Q 5GANf 4FYVB 1GBQA 2BE7D 1AWJA 2JTFA 2QK0A 3M9QA 4FSSA 1WFWA 1MHNA 3TSZA 2XK0A 3CPWS 2XD0A 3TCJA 4FL6A 1M2VB 3QPHA 3KFVA 4M7DD 2M0OA 3JB9G 2AZVA 3LH0A 2F5KA 2RPNA 2YRVA 2DL7A 1VIEA 1QKXA 2CKKA 4QQGA 4M7AD 1ARKA 4V2SA 2QTVA 1WXUA 3OYBA 4M7DA 2NUPA 1K8AR 3QDRB 2X4JA 2D8JA 5GAN3 3JCMQ 5AT1B 2L5QA 3QYGB 1YITQ 2D0QB 1BBZA 1VQNQ 3OB9A 2KSSA 1RUWA 3RMSA 4QVCA 4DEXA 2OTLT 2I0NA 1RL2A 2RK1A 1HXDA 3CMEQ 4HCCA 3JCMf 1ZBJA 1UGVA 4ZN3A 1Q7YU 4M75A 2DD4A 4C8QE 5GAOq 2FRWA 1J3TA 1C0MA 1RADB 3CXCA 1I0CA 1VQ5T 4LDXA 2HKQB 3E2UA 3JCMd 2LQNA 1VYVA 3OY9A 2EQMA 2VC8A 2YUOA 4LXCA 3A8HB 3M0UA 3VUBA 3CCST 2EYZA 4J9EA 4OMFB 3Q1JA 5GJWB 4EDUA 4J9DA 2RH2A 4OMOA 4II1A 5FRMA 1TH7A 5GAOm 3V8JA 1E6GA 1QKWA 3OYYA 3VS7A 1VQ4T 2DD5A 3HRTA 4PFPA 2FEIA 1M2OA 4M7AE 4A4GA 3UDCA 1KQ1A 1VQ7Q 1FWZA 1Q86C 2ENMA 4PJNA 4EMKC 1M4ZA 4WCIA 1MUZA 1YI2T 3E9FA 1VYUA 1JU5C 1YFNA 2O9VA 1PD1A 2K5FA 2Y90A 4J6WA 4ZNXA 2EAYA 3GNFB 4L5GA 2DZ9A 3HFOA 3SB2A 4M7DE 3RKWA 1H92A 2NUZA 4IUUA 1K4US 1X69A 4FYYB 2DMOA 4RTYA 2O31A 3JB9F 4KULA 2AKLA 1B3QA 3CC2T 1QVFA 4J9BA 4QQ6A 4C8QF 4M78E 5FU7B 3TEEA 3H9NA 2E6NA 1AWWA 1ZUUA 1MNDA 2AK5A 1OPLA 1VQ6A 2DK3A 2QG9B 1MNEA 4JLIA 2C0OA 2GQVA 3ULRB 3SD4A 5IHNA 5HK0A 1SF9A 1ZSGA 1QVPA 2BKDN 2K5LA 3VYGA 2DTOA 3JB9I 4R0KA 4KRTA 5LL6S 2GNCA 3OW2P 4F7UE 1I5OB 1I1JA 4CC2A 2DEUA 3O8VA 2CSIA 3VS5A 4KT0E 2MIOA 2D0NA 4X9DA 2DL5A 1G5VA 5KYWA 4HVUA 4PJOB 2FPFA 3M0RA 4XTYA 4M7AA 2FZKB 3OMCA 5EC7A 1AOJA 4M4ZA 4A54A 2QGGA 3A1PA 4E7LA 4C0FA 2J6OA 4RCBA 1V29B 3S3OA 3OS0A 2NUTB 3HPWA 4JRPA 3CCQT 1PC0A 3M0TA 5A0GA 4O5VA 1PSEA 1LPLA 3PNWC 1GCQC 2O2OA 4N4HA 1B7TA 6AT1B 2F2WA 1K8AU 5FW9A 3QSUA 1D1AA 4FYWB 4C8QD 2EKHA 2O4XA 3MHXA 3EFRA 3JCMg 4UC4A 2CYZB 1CKAA 1FMKA 1VQ9Q 5GAMe 2WSEE 5I2SA 2RHUA 2YRDA 4GY5A 5J26A 2JM8A 3GBQA 3HP9A 1YP5A 2P4RA 2QEXA 2OAWA 2FG0A 1DJ7B 2PTKA 1U3OA 2DAQA 2O4XB 2X3XD 2HDAA 4L6V5 1VQLT 3CC7T 3ZEHA 5IH2A 1YJWA 1VQPT 1FMVA 4FW1A 4J9HA 4C8QC 3VKIA 1H3HA 2EGAA 3G4SA 1M1KC 1VQ8T 3CCLQ 2LRQA 4E7JA 3C94A 2V8JA 1OU9A 2D9TA 2MI6A 4OMNA 3UWNA 2DX1A 1VQOQ 2DZCA 2HMAA 1UJYA 1VUBA 2ZPHB 1OPKA 3MEWA 5HK3A 4AG1C 4C92B 4XTXA 4GBQA 1G83A 1JXMA 4JRKA 4HCBA 1JJ2P 4OB2B 2A7YA 2RF0A 3OYCA 2RN8A 1HK9A 3LX7A 1YJWT 4C5GA 1U1SA 3CCMT 3OW2A 3JCMX 3BW1A 1KHCA 4IIOA 2NUTA 2EGCA 2KEAA 2DRMA 3L2RA 4KUDK 1S72A 1WGSA 1VQ8Q 3JCMc 4EMKB 3WVEB 2PNIA 3OS1A 1T3SA 5LJ3e 5GAN4 3JB9D 1BI0A 2X4XA 1IREB 1YI2Q 2RJDA 1N8RU 2CP0A 2X51A 4ZGJB 4E47A 3GPLA 2RHIA 3D7SB 2EWNA 5IXFA 1KQSA 5KE3A 1SHFA 2K5IA 4MZPA 2AZSA 4J9IA 3V7SA 2JS2A 2LP5A 3I55T 1VQ8A 1M2VA 2LQ8A 4XTWA 1YJ9T 1XNIA 3A5ZB 4JDSA 4MDXA 3X26B 2JS0A 1M90U 2LTOA 3V8KA 3CCJT 2JNGA 3CCMQ 2E1HA 4JJBA 5D6WA 3V8LA 4XU1A 5I11A 1P92A 2WSFE 2G3RA 1JO8A 2RK2A 4Z02A 3EGDA 2XMFA 2DVJA 1KG1A 1K76A 2A37A 2SEMA 4M77D 2OTLQ 4RTVA 3A8GB 4KUIA 4HXJA 1BYMA 2HD0A 3GNGA 3SEMA 2K9GA 1TS9A 4JRQA 4BI8B 4OMMA 3URGA 3C95A 1OQKA 1WNLA 2RD1A 1OV3A 5I22A 2L3PA 2J05A 9ATCB 2HL5C 5GAMh 1D3BA 2COWA 4LN2A 2QGFB 2XHCA 3AHUA 2JTMA 1WZOA 1Y07A 5IAYA 2LMJA 2YUPA 1WPYA 1G3YA 4CRIA 1I81A 4ELYC 4FCYA 3QJYA 1W4SA 1W70A 3LW5E 4HKEA 1R0BG 4MZMA 1AZEA 1UHFA 2A28A 2JW4A 2YLCA 2M9UA 4EIKA 2DM1A 4E6RA 1UUEA 2FPEA 4XU2A 3CQTA 4QQDA 5HY6A 1N6AA 2DPPB 3EGXA 4M77G 1BI1A 2ROLA 1RAGB 4PNOA 2RQTA 1OU8A 3PVLA 4FU6A 4TVRA 2RQUA 3OYMA 2J7IA 3PTAA 3P8HA 2MWOA 2EJGA 4E7SA 4J9CA 2JM9A 2P0QA 4N0AC 4M77F 3C4SA 1OZ2A 3SFMA 1NEBA 3P8DA 2E3HA 2HZYA 4WTOB 3RR6A 2HCKA 4RUGA 1E7OA 1VIFA 2RHYA 3RMQA 2CGHA 3M4YA 3CCRT 3G71T 2PU9B 2QQ9A 1UE9A 3NGPA 1Q86U 1TWBA 3QHSA 3CC2A 2H8HA 2YT6A 4J6XA 4PFZA 3SHWA 4ZGDB 4QKUA 2KVQG 3EFOA 2EYWA 2J6KA 4F14A 3LGFA 4C92C 1YJ9Q 1NBEB 4IUVA 1XTDA 2Y4YA 2QQBA 1BIBA 2E4HA 3QG1A 5KCOA 2DBMA 2XDPA 2YLBA 4BB7A 4ORZA 3JCMP 3ZFJA 3CXCP 4A53A 2JOYA 2VYTA 3OSVA 2DL3A 2VVKA 4LUEA 2LQWA 1K9MC 4PFOA 5FU6C 1JQQA 2KNBB 3CCVQ 3EHQA 1YWOA 3L1AA 2DNUA 5CKDA 3FIFA 2NUPB 3QDFA 2DVEA 4DEYA 4AFSC 1YJ9A 2LCCA 2E64A 3THKA 2VB6A 3EFOB 5GMKl 1YIJT 1K0XA 5J39A 5FWCA 3FJPA 1UG1A 3CCJA 4C5IA 3JCMe 3L2UA 2GQIA 1QCFA 3GLXA 2ZAEA 1K9MU 4M78C 5LJ5j 4M75G 1WHJA 1LNXA 2KRSA 4OMPA 3FJ5A 2QDLA 1VQKA 2DIGA 4LDVA 2DEQA 2DL8A 3WVDB 3M55A 3QYHB 5CCAA 4MZTA 5GMKh 1IB8A 2ABLA 1YHQQ 1T0HA 1WJRA 4LD6A 4RTTA 2M16A 3M56A 1W2BP 2MCNA 1KSWA 2LNVA 1WQWA 1QP2A 4HT8A 1QWEA 1SSFA 4OMQA 3OBWA 3E1SA 4PLIA 3OYNA 4KH1B 4C92G 1LOJA 1BI3A 3L2QA 1Y96A 2DXBA 3JCMh 1GRIA 3QZ9B 2CZ1B 2HNIA 3OSSC 2LCLA 2O01E 2FO0A 3H0FA 2XDDA 1YITT 1NJIC 2JXBA 5LJ5e 1M1KR 1O75A 3G71A 1W6XA 4BACA 4N0AA 1ZUKA 2DJZA 2LDMA 3MP6A 5CVIA 2PUOB 3CCSQ 8ATCB 1ZSZA 4BE2A 5I2MA 3S3MA 1B07A 2RMOA 5ECAA 1N8RC 3BY7A 1YJWQ 1K9MR 4C8QG 4KGZB 5LJ3f 1X2KA 2X9HA 3VS6A 1BCMA 5GAOp 5GANd 1FX7A 3CC2Q 2CT4A 3G6EA 1CSKA 4Z89A 4C92E 2RO0A 1SPKA 1RI0A 2CUBA 1VQOA 2BZ8A 3A8LB 2AKKA 3M0QA 1X01A 5D6XA 2GFUA 2QEXT 1WYXA 2YHTA 2MMPA 3QIIA 2LJ3A 2FVUA 3NMZC 4C0DB 2EFIA 4N4GA 1VQ6Q 2QA4Q 1Q86R 2K6DA 1ZUYA 1MGQA 2GCXA 4NL2A 3DLMA 4M7AF 2CP3A 2QASA 3META 2BZXA 2JMAA 2F69A 2BTTA 2KI7A 2JT4A 2BUDA 4AT1B 2K7AA 4OVAA 1HJDA 1RAEB 1GXIE 4XTUA 4CI0C 1VQ4Q 4Q5WA 3TQ7P 4MMLA 5C6SA 4X9CA 5LJ5d 4OB3B 2B86A 2VXFA 3KXTA 1OX8A 4PLLA 3PE0A 1X27A 3DLLA 1PKTA 2DETA 4C5EA 4E7HA 3MP8A 4IUPA 5KH6A 1MMNA 1H3ZA 1AZGB 3MEUA 1TTHB 1N5ZA 2P4TA 5C0MA 1LCKA 1JXOA 2A3LA 2LX7A 2K2MA 2HKNA 1VQ5A 1VQ9A 4PJJA 5CKBA 2HQEA 3HSBA 1YJNQ 1YIJA 2A08A 4FT4A 2ATCB 3CBPA 2HAXA 2O88A 1KFZA 1V1CA 1R8OB 4FSXA 2BE9B 3H0IA 2L3QA 2I2LA 1VQNA 2LT4A 4BDYA 1PNJA 2QYZA 2HEQA 1OEBA 2GF7A 1OYXA 3G7ZA 4OB1B 4C0ZA 1NZ9A 2XG8D 1YJNA 3JCMb 4ESRA 2VGNA 1E6HA 2E65A 2NYSA 3FRNA 4LE9A 1NPRA 2PVOB 1G2BA 2E5QA 3EH2A 2DIQA 1Q95G 3QUIA 1JBMA 2K3XA 4RG2A 1VQNT 2LVMA 5IXBA 4M78F 1KIKA 1X75C 3MP1A 3EH1A 2NLUA 5KCHA 5LJ3g 2DXTA 2LJ1A 3O5ZA 2XU8A 4Y91A 3G6EQ 1WXBA 4E2FB 5GMKj 5IHIA 4FYXB 3JCMV 1UECA 5GANe 1SKUB 3VU3C 4DOVA 4K11A 2JTEA 5LJ3h 3CC4Q 4Y28E 2A36A 4B9WA 3OS5A 4B9XA 3I55A 4LDYA 4OP0A 4JJCA 1YI2A 2CZ0B 1NYGA 3ME9A 1AWXA 1QCOA 3OYAA 4XAXB 1TUCA 2YUNA 4M77B 3MJXA 2LCSA 1AWOA 1FMWA 3OYKA 2DKGA 2CH4A 4F16A 1WX6A 3M58A 5KYUA 2RJEA 4MMKA 1YCSB 1PM3A 1OULA 5CKHA 3CPWA 3F70A 4M78A 2CP2A 3EG0A 3CC4T 2CREA 3BDUA 3OYJA 2ZPBB 2ZZDA 2D1XA 2RA2A 4BE1A 5IT9E 3ER0A 3SWNC 2CT3A 2EYQA 1X6BA 1VQ4A 3OYDA 3GF5A 4M7AC 2EYXA 4XTVA 1UEBA 1ZA2B 2EQUA 1VQKT 2RB6A 3HL8A 2OTLA 1RI9A 3V7RA 1U1TA 1RAAB 3OMGA 4L59A 4YTLA 1ZSZB 2AHJB 3CD6Q 2KT1A 4A4EA 1MMAA 2EIFA 1D1BA 8AT1B 4JS4A 3CCVA 1F1BB 3H0HA 1N9SA 4X34A 4Z88A 3CMEA 1KQ2A 2IPOB 2MYSA 2KYMA 1FXXA 2HSEB 3CXCS 3CMAA 2LT1A 4F04B 5KYYA 2E41A 2KK4A 1UHCA 3LH5A 1KC8R 2DXCA 5GAMf 3UA6A 2CP5A 3H6ZA 2MPXC 4P5NA 3I56Q 5CAIA 1JJ2A 3G1JA 1NYFA 4BY6B 2L3SA 2KYBA 3VS1A 4BE0A 3VUZA 1ZSZC 4O6JA 4NL3A 1WI7A 3BFMA 4B6MA 4ZN1A 3REAB 2C0TA 3CPWP 2OTJQ 2VV5A 2XICA 1N9RA 1WA7A 2KR3A 3QKJA 4F7UG 2HSPA 1WJQA 5GANh 3I56A 2EJ9A 1NEGA 2X4WA 1SEMA 3SWNA 1M3CA 1Q82C 4A4FA 1OZ3A 1G8XA 1KQSS 1YJNT 3CBOA 1VQMT 5L8RE 2LJ0A 4HVWA 1XJWB 1MV3A 3FEOA 2RJCA 2EBPA 1M8VA 3HFNA 2DL4A 2DRKA 1UGQB 2OTJT 2EKOA 1SG5A 5CIUA 5LJ5g 4AG2C 1QP3A 5L23A 3L2VA 3DKMA 1D1CA 3KUFA 2QDYB 1ZHIA 1S1NA 2KMTA 1MMGA 1VQ6T 3MEVA 1WQ7A 3PT9A 4X1VA 5GAN7 1IO6A 5FROA 4RG8A 3TSWA 2BIVA 3RKYA 3RBBB 1M90R 2EQKA 4PL6A 3VS3A 3H41A 3MKDA 3FC3A 2K4YA 2V1RA 4ATOA 2KE9A 2RJFA 1BU1A 1UDLA 4XK8E 4CC4B 2VASA 5A0LA 1GL5A 1KD1U 2YDLA 4JLGA 2HBPA 2XDBA 2L0AA 4JZ4A 4IKFA 3V7CA 4LDWA 1V76A 4PJOE 4PKCC 5CKEA 4DA4A 2IIMA 3FLGA 5GAN5 2C0IA 2H3JA 1UGPB 2R58A 3REBB 1H8KA 5CKFA 2PUKB 3JAME 5D7UA 2DTHA 3CD6A 1Q82R 2CH4W 5CQYA 1M8MA 1HYOA 3OBYA 1QMCA 1VQKQ 4FIBA 1KD1C 1B34A 4C8QB 3HTRA 1EIFA 2V8KA 4C92A 4C5HA 2YWWA 4ME7A 1GFCA 4DBFA 1W2BA 4PJLA 2DERA 2L8DA 2E12A 3CBMA 3PIOA 4C0GA 1QQJA 3M4GA 1IHWA 1I5LA 5J3BA 7AT1B 1AVZC 4OGCA 1YHQT 2AT1B 1BK2A 1QVGP 1GBRA 1NM7A 3BDLA 4RMOA 1M1KU 4IUQA 3EG3A 3EFSA 1G3SA 1PRLC 3CPFA 3R6OA 4AFUC 4IIMA 2COYA 3UATA 4J9FA 2LC4A 3QZ5B 4PJOF 3OYEA 3QWXX 1AT1B 1BIAA 3H8ZA 5KYWB 4M75E 3JSCA 2DYIA 2ZGWA 3CMAT 1FYNA 1T0JA 1W1FA 3S6WA 4CC3A 2CS7A 5GAMj 4M78D 1R77A 3PVQA 2QA4T 4M7AG 3X20B 4RTZA 3JCMW 5FU6B 5KYNA 3CCRA 3I35A 2QEXQ 1W2BS 1C6VX 4PJOC 4PJMA 1VQ7A 1A0NB 2P84A 2H3EB 2QQSA 5LJ5h 1Q7YR 1Q81C 3A8MB 3ZBDA 4D8KA 4XU3A 3CCUQ 2PVDB 1RAIB 3MO8A 4AMCA 1PWTA 2CDTA 2E5KA 3RDVA 4OGEA 3VS4A 1GCQA 1U5SA 1D0ZA 5GAN2 1CKBA 1ABQA 2WACA 3NPFA 2V1QA 4GLKA 1YCYA 4DQ2A 3OYGA 3N5BB 1QVGS 1ABOA 1Q82U 3CCVT 3A98A 2OI3A 3VV0A 3CCMA 1RAHB 1PCXA 5GMKe 2F2XA 2M1HA 4M75B 1H641 4QVZA 4IURA 1AHJB 3M5AA 3NHNA 1K73U 2GBQA 4EMHA 1VQ7T 3CCEQ 1M9SA 4RKUE 5KYXA 2EYYA 1X6OA 2GTOA 3OW2S 2PZ1A 2ED0A 2RI2A 3INZA 2JN0A 4M77C 2V8IA 2Y4XA 2DBKA 5GMKm 3EGXB 5A0DA 3E19A 3VS2A 3BE3A 2HQHA 1PSFA 2LNHB 2QI2A 2L3RA 3CCQQ 4M77E 2OJ2A 2X4YA 5GAOr 3CCUT 4F7UA 3EHRA 4EMKA 2FZCB 1IHVA 4JZ3A 5I21A 2FZGB 1JRIA 1O9SA 1NJIU 4JPBW 1YWPA 2A0FB 3I9QA 2ESWA 5GAN8 3U23A 3M59A 1Q81R 5LJ3d 1RABB 2JZ2A 2YRCA 2KDSA 2FRYA 2R5AA 1Y0MA 3LYIA 4ZTJA 3M0SA 3E9GA 3EGDB 1NPPA 2PVGB 2KAFA 1VOMA 2RI3A 2AIRB 2JUFA 1JEGA 2W10A 1WHKA 2O9SA 3CMAQ 2BZYA 3HHTB 2L2PA 4A63B 4C0DC 2RHXA 3IQLA 2HQXA 1LVKA 2QAZA 1D3BB 1IZ6A 4J8OA 3L42A 2VWFA 1QVGA 2DA9A 5KYXB 5GAMg 3CD6T 2RNAA 3DB3A 4E7IA 3CC7A 1UGRB 1BKBA 1X2QA 1VQLA 3QBYA 1WDXA 1S72T 4FM4B 2EW3A 4FW2A 3JV3A 2P0KA 3NTIA 2D8HA 3LLRA 1QCNA 2KT8A 2RM4A 1Y7XA 4J7FA 4NS5A 4IUTA 3NFCA 2ZPGB 1BB9A 3DB4A 1KQSP
chains in the Genus database with same CATH topology
2DE0X 2X3WD 4FSSA 4J9CA 2KT1A 1WFWA 2JM9A 3TSZA 3KFVA 1M3BA 2AZVA 1NEBA 2RPNA 1UTIA 3H0HA 2DL7A 1SRLA 2HCKA 1QKXA 4Z88A 2KYMA 4RUGA 2YSQA 1ARKA 4HVVA 1E7OA 1NG2A 1WXUA 2DLPA 4Y92A 1UHCA 3LH5A 2DJQA 1UE9A 3NGPA 1WLPB 2H8HA 2D8JA 2YT6A 3UA6A 3SHWA 2EYWA 2J6KA 4F14A 1BBZA 4RTUA 1MV0B 1RUWA 1NYFA 4DEXA 2L3SA 2KYBA 2DBMA 2I0NA 3VS1A 5IHKA 4CC7A 1ZBJA 5FWBA 1WI7A 1UGVA 4ORZA 1GBQA 3REAB 2C0TA 2CSQA 2FRWA 1J3TA 1Z9ZA 1I0CA 2DL3A 1WA7A 2KR3A 2VVKA 4LUEA 2LQWA 2LQNA 1VYVA 2HSPA 2YUOA 1JQQA 2KNBB 3EHQA 3M0UA 1YWOA 2DNUA 1NEGA 1SEMA 1M3CA 2EYZA 4J9EA 5GJWB 4J9DA 4DEYA 1QWFA 4AFSC 4D8DA 4OMOA 2KBTA 3THKA 4QT7A 1VYTA 3ZL7C 3TVTA 1AEYA 1E6GA 1QKWA 3EGUA 3VS7A 1K0XA 1NLOC 2LJ0A 5FWCA 2GTJA 4HVWA 2FEIA 2SRCA 1UG1A 1MV3A 5HCKA 1GFDA 1AD5A 2GQIA 1QCFA 1M27C 2EBPA 2ENMA 3VRYA 4F17A 2DL4A 2DRKA 4WCIA 1MUZA 4AG2C 5L23A 1VYUA 2O9VA 1JU5C 2KRSA 4OMPA 3FJ5A 2KROA 1S1NA 2QDLA 1KJWA 4X1VA 2DL8A 1Z9QA 1IO6A 3TSWA 1WIEA 4ZNXA 3RBBB 2ABLA 3I5RA 1ZX6A 1SSHA 1T0HA 3VS3A 1H92A 3H41A 1UJ0A 2NUZA 2YUQA 4RTTA 1K4US 2V1RA 2KE9A 5GJVB 1X69A 2MCNA 1KSWA 1BU1A 2DMOA 4RTYA 1UDLA 2O31A 2J6FA 4CC4B 2KRNA 2AKLA 1B3QA 1QWEA 1GL5A 2YDLA 4J9BA 2NWMA 4OMQA 3EG2A 2L0AA 4JZ4A 1TG0A 1AWWA 1GRIA 1ZUUA 3UA7A 2IIMA 2AK5A 1K1ZA 1OPLA 2FO0A 3VS0A 3H0FA 4LUDA 2C0IA 2C0OA 2JXBA 2K79A 3REBB 3ULRB 5IHNA 1H8KA 1ZSGA 1W6XA 2KRMA 2FPDA 4KRTA 4R0KA 1ZUKA 3VRZA 2GNCA 4HCKA 2CH4W 1M8MA 1I1JA 2G6FX 4CC2A 2JMCA 1B07A 2LZ6B 2RMOA 2CSIA 5ECAA 3VS5A 2MIOA 2K3BA 2D0NA 2DL5A 1RLQC 1GFCA 1X2KA 1YNZA 2FPFA 4HVUA 3VS6A 3M0RA 2VKNA 1PHTA 2DILA 5EC7A 1AOJA 2CT4A 4M4ZA 3C0CA 1CSKA 4Z89A 1SPKA 2J6OA 2CUBA 1NLPC 2HBWA 2BZ8A 2AKKA 3M0QA 3M0TA 1WYXA 1AVZC 1BK2A 1GBRA 1GCQC 2O2OA 1NM7A 1TUDA 2F2WA 2LJ3A 5FW9A 3NMZC 2EKHA 3EG3A 2DYBA 2K6DA 1ZUYA 1CKAA 1FMKA 3UF4A 1PRLC 4AFQC 4AFUC 2BZXA 4IIMA 4RTWA 2JMAA 2JM8A 3GBQA 2BTTA 1YP5A 2P4RA 2OAWA 4J9FA 2JT4A 3UATA 2GGRA 2FG0A 2KGTA 2RQRA 3QWXX 2PTKA 1U3OA 2X3XD 2K7AA 2HDAA 2MOXA 1FYNA 1T0JA 1W1FA 4CC3A 5IH2A 1HJDA 1SRMA 1K9AA 3PVQA 4J9HA 1H3HA 2EGAA 4RTZA 4OMLA 3I35A 4OMNA 2B86A 2DX1A 2J06A 1HSQA 3PE0A 1A0NB 1UJYA 1X27A 1OPKA 1PKTA 4AG1C 4GBQA 1G83A 1JXMA 4LNPA 2RF0A 1QLYA 4D8KA 1AZGB 2RN8A 1GCPA 1N5ZA 1LCKA 1PWTA 2CDTA 2E5KA 3VS4A 1GCQA 1JXOA 1U5SA 2LX7A 4IIOA 2K2MA 2EGCA 1CKBA 1ABQA 2KEAA 2DRMA 3NPFA 2ECZA 2RQWA 2V1QA 2ROTA 3R6NA 2A08A 1ABOA 2PNIA 1T3SA 2O88A 1KFZA 1V1CA 2KXCA 3A98A 1HD3A 2OI3A 3H0IA 1OOTA 1M30A 2L3QA 2F2XA 1PNJA 4GLMA 5IXFA 1XOVA 2HEQA 1OEBA 4JJDA 3NHNA 2GBQA 2EVRA 1K0SA 1SHFA 2AZSA 2EYYA 1VA7A 2KXDA 4J9IA 2JS2A 4ESRA 2GTOA 2LP5A 2F2VA 2PZ1A 1E6HA 2ED0A 4Z8AA 2W0ZA 1UFFA 4LE9A 2DBKA 1Y57A 1G2BA 3EG1A 2M0YA 3VS2A 1X43A 1EFNA 5IXBA 1KIKA 2LNHB 2JS0A 2OJ2A 3I5SA 1YN8A 2EQIA 4JJBA 1SHGA 3EHRA 5I11A 2LJ1A 3O5ZA 4JZ3A 1M3AA 2RQVA 1JO8A 1WXBA 5IHIA 2XMFA 2DVJA 4JPBW 1UECA 1ZLMA 1YWPA 1K76A 2A37A 2SEMA 3I9QA 2ESWA 4RTVA 3U23A 4K11A 2JTEA 1U06A 4HXJA 2A36A 2FRYA 4AFZC 3SEMA 4JJCA 2ED1A 2K9GA 1Y0MA 4OMMA 1NYGA 3M0SA 1AWXA 1TUCA 2YUNA 1OV3A 5I22A 2L3PA 2J05A 2LCSA 1I07A 1AWOA 1RLPC 2CH4A 4LN2A 4F16A 1WX6A 1PRMC 1JEGA 2W10A 4RTXA 1YCSB 2LMJA 2O9SA 2YUPA 2BZYA 2DF6A 2L2PA 3EG0A 4A63B 2CREA 2D1XA 1W70A 3IQLA 1AZEA 1UHFA 2CT3A 2A28A 2JW4A 2CUDA 1X6BA 2VWFA 2DA9A 4EIKA 1T3LA 1X6GA 2DM1A 2RNAA 4E6RA 4J9GA 1UUEA 1X2QA 2M51A 2FPEA 1WDXA 3CQTA 2EW3A 2EYXA 3JV3A 2D8HA 2EGEA 3M0PA 2KT8A 2EPDA 3RNJA 2ROLA 1PKSA 1WXTA 1RI9A 2RQTA 3PVLA 2RQUA 3QWYA 2J7IA 1BB9A 1AWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE0 X;  2X3W D;  4FSS A;  4J9C A;  2KT1 A;  1WFW A;  2JM9 A;  3TSZ A;  3KFV A;  1M3B A;  2AZV A;  1NEB A;  2RPN A;  1UTI A;  3H0H A;  2DL7 A;  1SRL A;  2HCK A;  1QKX A;  4Z88 A;  2KYM A;  4RUG A;  2YSQ A;  1ARK A;  4HVV A;  1E7O A;  1NG2 A;  1WXU A;  2DLP A;  4Y92 A;  1UHC A;  3LH5 A;  2DJQ A;  1UE9 A;  3NGP A;  1WLP B;  2H8H A;  2D8J A;  2YT6 A;  3UA6 A;  3SHW A;  2EYW A;  2J6K A;  4F14 A;  1BBZ A;  4RTU A;  1MV0 B;  1RUW A;  1NYF A;  4DEX A;  2L3S A;  2KYB A;  2DBM A;  2I0N A;  3VS1 A;  5IHK A;  4CC7 A;  1ZBJ A;  5FWB A;  1WI7 A;  1UGV A;  4ORZ A;  1GBQ A;  3REA B;  2C0T A;  2CSQ A;  2FRW A;  1J3T A;  1Z9Z A;  1I0C A;  2DL3 A;  1WA7 A;  2KR3 A;  2VVK A;  4LUE A;  2LQW A;  2LQN A;  1VYV A;  2HSP A;  2YUO A;  1JQQ A;  2KNB B;  3EHQ A;  3M0U A;  1YWO A;  2DNU A;  1NEG A;  1SEM A;  1M3C A;  2EYZ A;  4J9E A;  5GJW B;  4J9D A;  4DEY A;  1QWF A;  4AFS C;  4D8D A;  4OMO A;  2KBT A;  3THK A;  4QT7 A;  1VYT A;  3ZL7 C;  3TVT A;  1AEY A;  1E6G A;  1QKW A;  3EGU A;  3VS7 A;  1K0X A;  1NLO C;  2LJ0 A;  5FWC A;  2GTJ A;  4HVW A;  2FEI A;  2SRC A;  1UG1 A;  1MV3 A;  5HCK A;  1GFD A;  1AD5 A;  2GQI A;  1QCF A;  1M27 C;  2EBP A;  2ENM A;  3VRY A;  4F17 A;  2DL4 A;  2DRK A;  4WCI A;  1MUZ A;  4AG2 C;  5L23 A;  1VYU A;  2O9V A;  1JU5 C;  2KRS A;  4OMP A;  3FJ5 A;  2KRO A;  1S1N A;  2QDL A;  1KJW A;  4X1V A;  2DL8 A;  1Z9Q A;  1IO6 A;  3TSW A;  1WIE A;  4ZNX A;  3RBB B;  2ABL A;  3I5R A;  1ZX6 A;  1SSH A;  1T0H A;  3VS3 A;  1H92 A;  3H41 A;  1UJ0 A;  2NUZ A;  2YUQ A;  4RTT A;  1K4U S;  2V1R A;  2KE9 A;  5GJV B;  1X69 A;  2MCN A;  1KSW A;  1BU1 A;  2DMO A;  4RTY A;  1UDL A;  2O31 A;  2J6F A;  4CC4 B;  2KRN A;  2AKL A;  1B3Q A;  1QWE A;  1GL5 A;  2YDL A;  4J9B A;  2NWM A;  4OMQ A;  3EG2 A;  2L0A A;  4JZ4 A;  1TG0 A;  1AWW A;  1GRI A;  1ZUU A;  3UA7 A;  2IIM A;  2AK5 A;  1K1Z A;  1OPL A;  2FO0 A;  3VS0 A;  3H0F A;  4LUD A;  2C0I A;  2C0O A;  2JXB A;  2K79 A;  3REB B;  3ULR B;  5IHN A;  1H8K A;  1ZSG A;  1W6X A;  2KRM A;  2FPD A;  4KRT A;  4R0K A;  1ZUK A;  3VRZ A;  2GNC A;  4HCK A;  2CH4 W;  1M8M A;  1I1J A;  2G6F X;  4CC2 A;  2JMC A;  1B07 A;  2LZ6 B;  2RMO A;  2CSI A;  5ECA A;  3VS5 A;  2MIO A;  2K3B A;  2D0N A;  2DL5 A;  1RLQ C;  1GFC A;  1X2K A;  1YNZ A;  2FPF A;  4HVU A;  3VS6 A;  3M0R A;  2VKN A;  1PHT A;  2DIL A;  5EC7 A;  1AOJ A;  2CT4 A;  4M4Z A;  3C0C A;  1CSK A;  4Z89 A;  1SPK A;  2J6O A;  2CUB A;  1NLP C;  2HBW A;  2BZ8 A;  2AKK A;  3M0Q A;  3M0T A;  1WYX A;  1AVZ C;  1BK2 A;  1GBR A;  1GCQ C;  2O2O A;  1NM7 A;  1TUD A;  2F2W A;  2LJ3 A;  5FW9 A;  3NMZ C;  2EKH A;  3EG3 A;  2DYB A;  2K6D A;  1ZUY A;  1CKA A;  1FMK A;  3UF4 A;  1PRL C;  4AFQ C;  4AFU C;  2BZX A;  4IIM A;  4RTW A;  2JMA A;  2JM8 A;  3GBQ A;  2BTT A;  1YP5 A;  2P4R A;  2OAW A;  4J9F A;  2JT4 A;  3UAT A;  2GGR A;  2FG0 A;  2KGT A;  2RQR A;  3QWX X;  2PTK A;  1U3O A;  2X3X D;  2K7A A;  2HDA A;  2MOX A;  1FYN A;  1T0J A;  1W1F A;  4CC3 A;  5IH2 A;  1HJD A;  1SRM A;  1K9A A;  3PVQ A;  4J9H A;  1H3H A;  2EGA A;  4RTZ A;  4OML A;  3I35 A;  4OMN A;  2B86 A;  2DX1 A;  2J06 A;  1HSQ A;  3PE0 A;  1A0N B;  1UJY A;  1X27 A;  1OPK A;  1PKT A;  4AG1 C;  4GBQ A;  1G83 A;  1JXM A;  4LNP A;  2RF0 A;  1QLY A;  4D8K A;  1AZG B;  2RN8 A;  1GCP A;  1N5Z A;  1LCK A;  1PWT A;  2CDT A;  2E5K A;  3VS4 A;  1GCQ A;  1JXO A;  1U5S A;  2LX7 A;  4IIO A;  2K2M A;  2EGC A;  1CKB A;  1ABQ A;  2KEA A;  2DRM A;  3NPF A;  2ECZ A;  2RQW A;  2V1Q A;  2ROT A;  3R6N A;  2A08 A;  1ABO A;  2PNI A;  1T3S A;  2O88 A;  1KFZ A;  1V1C A;  2KXC A;  3A98 A;  1HD3 A;  2OI3 A;  3H0I A;  1OOT A;  1M30 A;  2L3Q A;  2F2X A;  1PNJ A;  4GLM A;  5IXF A;  1XOV A;  2HEQ A;  1OEB A;  4JJD A;  3NHN A;  2GBQ A;  2EVR A;  1K0S A;  1SHF A;  2AZS A;  2EYY A;  1VA7 A;  2KXD A;  4J9I A;  2JS2 A;  4ESR A;  2GTO A;  2LP5 A;  2F2V A;  2PZ1 A;  1E6H A;  2ED0 A;  4Z8A A;  2W0Z A;  1UFF A;  4LE9 A;  2DBK A;  1Y57 A;  1G2B A;  3EG1 A;  2M0Y A;  3VS2 A;  1X43 A;  1EFN A;  5IXB A;  1KIK A;  2LNH B;  2JS0 A;  2OJ2 A;  3I5S A;  1YN8 A;  2EQI A;  4JJB A;  1SHG A;  3EHR A;  5I11 A;  2LJ1 A;  3O5Z A;  4JZ3 A;  1M3A A;  2RQV A;  1JO8 A;  1WXB A;  5IHI A;  2XMF A;  2DVJ A;  4JPB W;  1UEC A;  1ZLM A;  1YWP A;  1K76 A;  2A37 A;  2SEM A;  3I9Q A;  2ESW A;  4RTV A;  3U23 A;  4K11 A;  2JTE A;  1U06 A;  4HXJ A;  2A36 A;  2FRY A;  4AFZ C;  3SEM A;  4JJC A;  2ED1 A;  2K9G A;  1Y0M A;  4OMM A;  1NYG A;  3M0S A;  1AWX A;  1TUC A;  2YUN A;  1OV3 A;  5I22 A;  2L3P A;  2J05 A;  2LCS A;  1I07 A;  1AWO A;  1RLP C;  2CH4 A;  4LN2 A;  4F16 A;  1WX6 A;  1PRM C;  1JEG A;  2W10 A;  4RTX A;  1YCS B;  2LMJ A;  2O9S A;  2YUP A;  2BZY A;  2DF6 A;  2L2P A;  3EG0 A;  4A63 B;  2CRE A;  2D1X A;  1W70 A;  3IQL A;  1AZE A;  1UHF A;  2CT3 A;  2A28 A;  2JW4 A;  2CUD A;  1X6B A;  2VWF A;  2DA9 A;  4EIK A;  1T3L A;  1X6G A;  2DM1 A;  2RNA A;  4E6R A;  4J9G A;  1UUE A;  1X2Q A;  2M51 A;  2FPE A;  1WDX A;  3CQT A;  2EW3 A;  2EYX A;  3JV3 A;  2D8H A;  2EGE A;  3M0P A;  2KT8 A;  2EPD A;  3RNJ A;  2ROL A;  1PKS A;  1WXT A;  1RI9 A;  2RQT A;  3PVL A;  2RQU A;  3QWY A;  2J7I A;  1BB9 A;  1AWJ A; 
#chains in the Genus database with same CATH topology
 2DE0 X;  3I55 Q;  2X3W D;  1I8F A;  3OYI A;  4NOY A;  4PK4 A;  1OI1 A;  4ELZ C;  3HKS A;  2LQK A;  1M3B A;  3MCA B;  1UTI A;  1QVF P;  1SRL A;  2YSQ A;  4BD3 A;  4HVV A;  1NG2 A;  4N4I A;  2DLP A;  4Y92 A;  5EG2 A;  1RAC B;  1VQ9 T;  3A8O B;  5A2Q E;  3UPU A;  2YXY A;  2DJQ A;  1WLP B;  1UGS B;  4PJO D;  3C12 A;  3VYH B;  1TU0 B;  2K3Y A;  4DBH A;  4M75 F;  4RTU A;  1MV0 B;  4M7D B;  3HRU A;  3CCE A;  1MMD A;  1K73 R;  1IRX A;  2E3I A;  3QXE B;  5IHK A;  2FYK A;  4CC7 A;  2EQJ A;  5FWB A;  2CSQ A;  2E10 A;  2DXU A;  1Z9Z A;  5KYU B;  5IN1 A;  4DBR A;  1Q81 U;  1YBY A;  2EJF A;  4RCC A;  2XID A;  3M57 A;  1QWF A;  4D8D A;  3JRZ A;  2KBT A;  4DOW A;  4QT7 A;  1VYT A;  5FLX E;  3ZL7 C;  3TVT A;  3OYH A;  1AEY A;  3EGU A;  1NLO C;  5FRN A;  4BDZ A;  5DLO A;  2GTJ A;  4PJO G;  1KD1 R;  2SRC A;  4C92 D;  1ZA1 B;  1QVF S;  5HCK A;  1GFD A;  2L89 A;  1AD5 A;  3QO3 A;  1M27 C;  4F17 A;  3VRY A;  1ZBX A;  2QTX A;  3RKX A;  3J80 E;  4QVD A;  2IG0 A;  1XQH A;  4JRI A;  3SDZ A;  5DM7 R;  4M7D F;  2GFA A;  2KRO A;  3MPU B;  1VQM Q;  1KHI A;  1KJW A;  4R56 A;  1Z9Q A;  2F1L A;  1NE8 A;  1VQO T;  2B8A A;  1WIE A;  5GAN g;  4J83 A;  5KE2 A;  3I5R A;  4LDU A;  5M9O A;  1ZX6 A;  1SSH A;  2FHD A;  1WHM A;  2KY9 A;  1UJ0 A;  1B34 B;  2YUQ A;  3CCL T;  4MDW A;  5CR2 A;  2FL7 A;  3NTH A;  4D6W A;  5GJV B;  3J81 E;  1VQ5 Q;  5FU7 C;  3L2Z A;  3G71 Q;  2J6F A;  2OX7 A;  2KRN A;  4PJO A;  4OB0 B;  2NWM A;  2C06 A;  1IGQ A;  3EG2 A;  1VQL Q;  3CC7 Q;  3CCE T;  3QJ6 A;  4JUV A;  1TG0 A;  3JB9 H;  1KK7 A;  4BI3 A;  3CCU A;  4ANJ A;  1NJI R;  2JJ9 A;  3PMI A;  2K2V A;  2PQW A;  1EX4 A;  1EZZ B;  3UA7 A;  3LGL A;  4R55 A;  5GAM d;  1K1Z A;  2Z0W A;  3VS0 A;  3OYL A;  4ZTF A;  4LUD A;  2K79 A;  5AYF A;  1C1A A;  3MEA A;  4OF1 A;  2KRM A;  2MF2 A;  2D6F A;  1G3T A;  2FPD A;  2QQR A;  4M7A B;  2X35 A;  4M75 C;  3VRZ A;  4HCK A;  4A4H A;  2G6F X;  3X28 B;  2JMC A;  2VUB A;  2LZ6 B;  1KC8 C;  4M78 B;  5LJ3 j;  4EPC A;  2K3B A;  1RLQ C;  1YNZ A;  2VKN A;  3X24 B;  4ZGE B;  3OS2 A;  1PHT A;  2QA4 A;  2DIL A;  4LD9 K;  1PD0 A;  3GOX A;  3C0C A;  3CME T;  1Y96 B;  2RI5 A;  3PMT A;  4M78 G;  2ZPI B;  1JB0 E;  2OTJ A;  1NLP C;  2HBW A;  2JVV A;  3T9N A;  1TSF A;  3OYF A;  3PIP A;  2V26 A;  3CC4 A;  1TUD A;  2DTI A;  4M7D G;  2HL3 A;  3WXM B;  4M75 D;  3TRE A;  3LWH A;  2DYB A;  4C92 F;  2CP7 A;  3KBG A;  3UF4 A;  1VQP Q;  3AT1 B;  4AFQ C;  3TU4 K;  2F5T X;  4A4K A;  3EAE A;  4KGX B;  4RTW A;  2R5M A;  1TOV A;  5CO7 A;  3OQ5 A;  4BY6 C;  2GGR A;  2KGT A;  2RQR A;  4EMG A;  2E6Z A;  3G4S T;  4XQ3 A;  2MOX A;  1SRM A;  2QQA A;  3HRS A;  2K57 A;  4J6Y A;  1K9A A;  5GMK i;  2DO3 A;  4E7Z A;  4WF2 A;  3CCJ Q;  4J7I A;  3FDR A;  4OML A;  1WHL A;  1K73 C;  4BI4 A;  1OX9 A;  1WHG A;  1Q7Y C;  2J06 A;  1HSQ A;  4HT9 A;  5GAN 6;  2FB7 A;  1G3W A;  2MWP A;  1BCO A;  3VJP A;  3FB9 A;  3P8B B;  5HKC A;  1VQM A;  4BUG A;  3G6E T;  1D0Y A;  4M77 A;  4LNP A;  1QLY A;  2CP6 A;  1TXQ A;  5KYY B;  1GCP A;  3JB9 J;  2MK5 A;  3CCQ A;  2VGM A;  1YHQ A;  4F7U B;  1I4K 1;  3OA6 A;  2ECZ A;  2XKO C;  2RQW A;  2ZPF B;  3GP8 A;  2ROT A;  2OAU A;  5D6Y A;  3R6N A;  1WHH A;  3S3N A;  1RAF B;  1JJ2 S;  2R57 A;  3PFS A;  4E7K A;  1PG5 B;  2IVW A;  1LJO A;  1YIT A;  2KXC A;  1HD3 A;  3M53 A;  2VXE A;  1OOT A;  1M30 A;  3UT1 A;  3ASK A;  3G4S Q;  3RES A;  2E70 A;  3PGG A;  4M7D C;  4GLM A;  2ZPE B;  1XOV A;  2CZ6 B;  4JJD A;  2EVR A;  2MAM A;  1K0S A;  2KXD A;  1M1G A;  1VA7 A;  2F2V A;  1U8R A;  4KBM B;  1YIJ Q;  4Z8A A;  2W0Z A;  1UFF A;  3CCS A;  3SWN B;  1Y57 A;  1WJS A;  3EG1 A;  3RUX A;  2ZCF B;  5CK9 A;  2M0Y A;  4JS5 A;  1X43 A;  1EFN A;  1D0X A;  3GIB A;  1Y71 A;  3I56 T;  2COZ A;  1K8A C;  4J5Y A;  3JCM J;  1M1F A;  3J7A F;  4FT2 A;  3I5S A;  1YN8 A;  2EQI A;  1N27 A;  2XI9 A;  1SHG A;  5GAO n;  4JJN K;  4HCZ A;  1M3A A;  2RQV A;  3EG9 A;  1TUG B;  5CQX A;  1ZLM A;  4F7U F;  3LWI A;  4XU0 A;  5LJ5 f;  1IGU A;  2CZ7 B;  1D09 B;  1U06 A;  5DLQ E;  1M5Q 1;  2LX9 A;  2QXF A;  4AFZ C;  2ED1 A;  4DBQ A;  4KH0 B;  2P0P A;  5GAO l;  4VUB A;  3EG9 B;  5DY9 A;  1ACM B;  3CEY A;  5GAN j;  1I07 A;  2M02 A;  1RLP C;  4QW2 A;  3CCL A;  1PRM C;  4HA8 A;  3CCR Q;  4RTX A;  4KGV B;  1VQP A;  3X25 B;  2WSC E;  1N8R R;  4C8Q A;  3NTK A;  2DF6 A;  1ZQ1 A;  1R0C B;  3RIR A;  3RER A;  2KQW A;  1M90 C;  2CUD A;  4XTZ A;  1KC8 U;  1T3L A;  1X6G A;  2DFU A;  1BI2 A;  4J9G A;  3M54 A;  2M51 A;  2RHZ A;  1UB4 A;  2EGE A;  3M0P A;  1IXD A;  2EPD A;  3RNJ A;  1PKS A;  1WXT A;  3L2W A;  1QW1 A;  3QWY A;  1S72 Q;  5GAN f;  4FYV B;  1GBQ A;  2BE7 D;  1AWJ A;  2JTF A;  2QK0 A;  3M9Q A;  4FSS A;  1WFW A;  1MHN A;  3TSZ A;  2XK0 A;  3CPW S;  2XD0 A;  3TCJ A;  4FL6 A;  1M2V B;  3QPH A;  3KFV A;  4M7D D;  2M0O A;  3JB9 G;  2AZV A;  3LH0 A;  2F5K A;  2RPN A;  2YRV A;  2DL7 A;  1VIE A;  1QKX A;  2CKK A;  4QQG A;  4M7A D;  1ARK A;  4V2S A;  2QTV A;  1WXU A;  3OYB A;  4M7D A;  2NUP A;  1K8A R;  3QDR B;  2X4J A;  2D8J A;  5GAN 3;  3JCM Q;  5AT1 B;  2L5Q A;  3QYG B;  1YIT Q;  2D0Q B;  1BBZ A;  1VQN Q;  3OB9 A;  2KSS A;  1RUW A;  3RMS A;  4QVC A;  4DEX A;  2OTL T;  2I0N A;  1RL2 A;  2RK1 A;  1HXD A;  3CME Q;  4HCC A;  3JCM f;  1ZBJ A;  1UGV A;  4ZN3 A;  1Q7Y U;  4M75 A;  2DD4 A;  4C8Q E;  5GAO q;  2FRW A;  1J3T A;  1C0M A;  1RAD B;  3CXC A;  1I0C A;  1VQ5 T;  4LDX A;  2HKQ B;  3E2U A;  3JCM d;  2LQN A;  1VYV A;  3OY9 A;  2EQM A;  2VC8 A;  2YUO A;  4LXC A;  3A8H B;  3M0U A;  3VUB A;  3CCS T;  2EYZ A;  4J9E A;  4OMF B;  3Q1J A;  5GJW B;  4EDU A;  4J9D A;  2RH2 A;  4OMO A;  4II1 A;  5FRM A;  1TH7 A;  5GAO m;  3V8J A;  1E6G A;  1QKW A;  3OYY A;  3VS7 A;  1VQ4 T;  2DD5 A;  3HRT A;  4PFP A;  2FEI A;  1M2O A;  4M7A E;  4A4G A;  3UDC A;  1KQ1 A;  1VQ7 Q;  1FWZ A;  1Q86 C;  2ENM A;  4PJN A;  4EMK C;  1M4Z A;  4WCI A;  1MUZ A;  1YI2 T;  3E9F A;  1VYU A;  1JU5 C;  1YFN A;  2O9V A;  1PD1 A;  2K5F A;  2Y90 A;  4J6W A;  4ZNX A;  2EAY A;  3GNF B;  4L5G A;  2DZ9 A;  3HFO A;  3SB2 A;  4M7D E;  3RKW A;  1H92 A;  2NUZ A;  4IUU A;  1K4U S;  1X69 A;  4FYY B;  2DMO A;  4RTY A;  2O31 A;  3JB9 F;  4KUL A;  2AKL A;  1B3Q A;  3CC2 T;  1QVF A;  4J9B A;  4QQ6 A;  4C8Q F;  4M78 E;  5FU7 B;  3TEE A;  3H9N A;  2E6N A;  1AWW A;  1ZUU A;  1MND A;  2AK5 A;  1OPL A;  1VQ6 A;  2DK3 A;  2QG9 B;  1MNE A;  4JLI A;  2C0O A;  2GQV A;  3ULR B;  3SD4 A;  5IHN A;  5HK0 A;  1SF9 A;  1ZSG A;  1QVP A;  2BKD N;  2K5L A;  3VYG A;  2DTO A;  3JB9 I;  4R0K A;  4KRT A;  5LL6 S;  2GNC A;  3OW2 P;  4F7U E;  1I5O B;  1I1J A;  4CC2 A;  2DEU A;  3O8V A;  2CSI A;  3VS5 A;  4KT0 E;  2MIO A;  2D0N A;  4X9D A;  2DL5 A;  1G5V A;  5KYW A;  4HVU A;  4PJO B;  2FPF A;  3M0R A;  4XTY A;  4M7A A;  2FZK B;  3OMC A;  5EC7 A;  1AOJ A;  4M4Z A;  4A54 A;  2QGG A;  3A1P A;  4E7L A;  4C0F A;  2J6O A;  4RCB A;  1V29 B;  3S3O A;  3OS0 A;  2NUT B;  3HPW A;  4JRP A;  3CCQ T;  1PC0 A;  3M0T A;  5A0G A;  4O5V A;  1PSE A;  1LPL A;  3PNW C;  1GCQ C;  2O2O A;  4N4H A;  1B7T A;  6AT1 B;  2F2W A;  1K8A U;  5FW9 A;  3QSU A;  1D1A A;  4FYW B;  4C8Q D;  2EKH A;  2O4X A;  3MHX A;  3EFR A;  3JCM g;  4UC4 A;  2CYZ B;  1CKA A;  1FMK A;  1VQ9 Q;  5GAM e;  2WSE E;  5I2S A;  2RHU A;  2YRD A;  4GY5 A;  5J26 A;  2JM8 A;  3GBQ A;  3HP9 A;  1YP5 A;  2P4R A;  2QEX A;  2OAW A;  2FG0 A;  1DJ7 B;  2PTK A;  1U3O A;  2DAQ A;  2O4X B;  2X3X D;  2HDA A;  4L6V 5;  1VQL T;  3CC7 T;  3ZEH A;  5IH2 A;  1YJW A;  1VQP T;  1FMV A;  4FW1 A;  4J9H A;  4C8Q C;  3VKI A;  1H3H A;  2EGA A;  3G4S A;  1M1K C;  1VQ8 T;  3CCL Q;  2LRQ A;  4E7J A;  3C94 A;  2V8J A;  1OU9 A;  2D9T A;  2MI6 A;  4OMN A;  3UWN A;  2DX1 A;  1VQO Q;  2DZC A;  2HMA A;  1UJY A;  1VUB A;  2ZPH B;  1OPK A;  3MEW A;  5HK3 A;  4AG1 C;  4C92 B;  4XTX A;  4GBQ A;  1G83 A;  1JXM A;  4JRK A;  4HCB A;  1JJ2 P;  4OB2 B;  2A7Y A;  2RF0 A;  3OYC A;  2RN8 A;  1HK9 A;  3LX7 A;  1YJW T;  4C5G A;  1U1S A;  3CCM T;  3OW2 A;  3JCM X;  3BW1 A;  1KHC A;  4IIO A;  2NUT A;  2EGC A;  2KEA A;  2DRM A;  3L2R A;  4KUD K;  1S72 A;  1WGS A;  1VQ8 Q;  3JCM c;  4EMK B;  3WVE B;  2PNI A;  3OS1 A;  1T3S A;  5LJ3 e;  5GAN 4;  3JB9 D;  1BI0 A;  2X4X A;  1IRE B;  1YI2 Q;  2RJD A;  1N8R U;  2CP0 A;  2X51 A;  4ZGJ B;  4E47 A;  3GPL A;  2RHI A;  3D7S B;  2EWN A;  5IXF A;  1KQS A;  5KE3 A;  1SHF A;  2K5I A;  4MZP A;  2AZS A;  4J9I A;  3V7S A;  2JS2 A;  2LP5 A;  3I55 T;  1VQ8 A;  1M2V A;  2LQ8 A;  4XTW A;  1YJ9 T;  1XNI A;  3A5Z B;  4JDS A;  4MDX A;  3X26 B;  2JS0 A;  1M90 U;  2LTO A;  3V8K A;  3CCJ T;  2JNG A;  3CCM Q;  2E1H A;  4JJB A;  5D6W A;  3V8L A;  4XU1 A;  5I11 A;  1P92 A;  2WSF E;  2G3R A;  1JO8 A;  2RK2 A;  4Z02 A;  3EGD A;  2XMF A;  2DVJ A;  1KG1 A;  1K76 A;  2A37 A;  2SEM A;  4M77 D;  2OTL Q;  4RTV A;  3A8G B;  4KUI A;  4HXJ A;  1BYM A;  2HD0 A;  3GNG A;  3SEM A;  2K9G A;  1TS9 A;  4JRQ A;  4BI8 B;  4OMM A;  3URG A;  3C95 A;  1OQK A;  1WNL A;  2RD1 A;  1OV3 A;  5I22 A;  2L3P A;  2J05 A;  9ATC B;  2HL5 C;  5GAM h;  1D3B A;  2COW A;  4LN2 A;  2QGF B;  2XHC A;  3AHU A;  2JTM A;  1WZO A;  1Y07 A;  5IAY A;  2LMJ A;  2YUP A;  1WPY A;  1G3Y A;  4CRI A;  1I81 A;  4ELY C;  4FCY A;  3QJY A;  1W4S A;  1W70 A;  3LW5 E;  4HKE A;  1R0B G;  4MZM A;  1AZE A;  1UHF A;  2A28 A;  2JW4 A;  2YLC A;  2M9U A;  4EIK A;  2DM1 A;  4E6R A;  1UUE A;  2FPE A;  4XU2 A;  3CQT A;  4QQD A;  5HY6 A;  1N6A A;  2DPP B;  3EGX A;  4M77 G;  1BI1 A;  2ROL A;  1RAG B;  4PNO A;  2RQT A;  1OU8 A;  3PVL A;  4FU6 A;  4TVR A;  2RQU A;  3OYM A;  2J7I A;  3PTA A;  3P8H A;  2MWO A;  2EJG A;  4E7S A;  4J9C A;  2JM9 A;  2P0Q A;  4N0A C;  4M77 F;  3C4S A;  1OZ2 A;  3SFM A;  1NEB A;  3P8D A;  2E3H A;  2HZY A;  4WTO B;  3RR6 A;  2HCK A;  4RUG A;  1E7O A;  1VIF A;  2RHY A;  3RMQ A;  2CGH A;  3M4Y A;  3CCR T;  3G71 T;  2PU9 B;  2QQ9 A;  1UE9 A;  3NGP A;  1Q86 U;  1TWB A;  3QHS A;  3CC2 A;  2H8H A;  2YT6 A;  4J6X A;  4PFZ A;  3SHW A;  4ZGD B;  4QKU A;  2KVQ G;  3EFO A;  2EYW A;  2J6K A;  4F14 A;  3LGF A;  4C92 C;  1YJ9 Q;  1NBE B;  4IUV A;  1XTD A;  2Y4Y A;  2QQB A;  1BIB A;  2E4H A;  3QG1 A;  5KCO A;  2DBM A;  2XDP A;  2YLB A;  4BB7 A;  4ORZ A;  3JCM P;  3ZFJ A;  3CXC P;  4A53 A;  2JOY A;  2VYT A;  3OSV A;  2DL3 A;  2VVK A;  4LUE A;  2LQW A;  1K9M C;  4PFO A;  5FU6 C;  1JQQ A;  2KNB B;  3CCV Q;  3EHQ A;  1YWO A;  3L1A A;  2DNU A;  5CKD A;  3FIF A;  2NUP B;  3QDF A;  2DVE A;  4DEY A;  4AFS C;  1YJ9 A;  2LCC A;  2E64 A;  3THK A;  2VB6 A;  3EFO B;  5GMK l;  1YIJ T;  1K0X A;  5J39 A;  5FWC A;  3FJP A;  1UG1 A;  3CCJ A;  4C5I A;  3JCM e;  3L2U A;  2GQI A;  1QCF A;  3GLX A;  2ZAE A;  1K9M U;  4M78 C;  5LJ5 j;  4M75 G;  1WHJ A;  1LNX A;  2KRS A;  4OMP A;  3FJ5 A;  2QDL A;  1VQK A;  2DIG A;  4LDV A;  2DEQ A;  2DL8 A;  3WVD B;  3M55 A;  3QYH B;  5CCA A;  4MZT A;  5GMK h;  1IB8 A;  2ABL A;  1YHQ Q;  1T0H A;  1WJR A;  4LD6 A;  4RTT A;  2M16 A;  3M56 A;  1W2B P;  2MCN A;  1KSW A;  2LNV A;  1WQW A;  1QP2 A;  4HT8 A;  1QWE A;  1SSF A;  4OMQ A;  3OBW A;  3E1S A;  4PLI A;  3OYN A;  4KH1 B;  4C92 G;  1LOJ A;  1BI3 A;  3L2Q A;  1Y96 A;  2DXB A;  3JCM h;  1GRI A;  3QZ9 B;  2CZ1 B;  2HNI A;  3OSS C;  2LCL A;  2O01 E;  2FO0 A;  3H0F A;  2XDD A;  1YIT T;  1NJI C;  2JXB A;  5LJ5 e;  1M1K R;  1O75 A;  3G71 A;  1W6X A;  4BAC A;  4N0A A;  1ZUK A;  2DJZ A;  2LDM A;  3MP6 A;  5CVI A;  2PUO B;  3CCS Q;  8ATC B;  1ZSZ A;  4BE2 A;  5I2M A;  3S3M A;  1B07 A;  2RMO A;  5ECA A;  1N8R C;  3BY7 A;  1YJW Q;  1K9M R;  4C8Q G;  4KGZ B;  5LJ3 f;  1X2K A;  2X9H A;  3VS6 A;  1BCM A;  5GAO p;  5GAN d;  1FX7 A;  3CC2 Q;  2CT4 A;  3G6E A;  1CSK A;  4Z89 A;  4C92 E;  2RO0 A;  1SPK A;  1RI0 A;  2CUB A;  1VQO A;  2BZ8 A;  3A8L B;  2AKK A;  3M0Q A;  1X01 A;  5D6X A;  2GFU A;  2QEX T;  1WYX A;  2YHT A;  2MMP A;  3QII A;  2LJ3 A;  2FVU A;  3NMZ C;  4C0D B;  2EFI A;  4N4G A;  1VQ6 Q;  2QA4 Q;  1Q86 R;  2K6D A;  1ZUY A;  1MGQ A;  2GCX A;  4NL2 A;  3DLM A;  4M7A F;  2CP3 A;  2QAS A;  3MET A;  2BZX A;  2JMA A;  2F69 A;  2BTT A;  2KI7 A;  2JT4 A;  2BUD A;  4AT1 B;  2K7A A;  4OVA A;  1HJD A;  1RAE B;  1GXI E;  4XTU A;  4CI0 C;  1VQ4 Q;  4Q5W A;  3TQ7 P;  4MML A;  5C6S A;  4X9C A;  5LJ5 d;  4OB3 B;  2B86 A;  2VXF A;  3KXT A;  1OX8 A;  4PLL A;  3PE0 A;  1X27 A;  3DLL A;  1PKT A;  2DET A;  4C5E A;  4E7H A;  3MP8 A;  4IUP A;  5KH6 A;  1MMN A;  1H3Z A;  1AZG B;  3MEU A;  1TTH B;  1N5Z A;  2P4T A;  5C0M A;  1LCK A;  1JXO A;  2A3L A;  2LX7 A;  2K2M A;  2HKN A;  1VQ5 A;  1VQ9 A;  4PJJ A;  5CKB A;  2HQE A;  3HSB A;  1YJN Q;  1YIJ A;  2A08 A;  4FT4 A;  2ATC B;  3CBP A;  2HAX A;  2O88 A;  1KFZ A;  1V1C A;  1R8O B;  4FSX A;  2BE9 B;  3H0I A;  2L3Q A;  2I2L A;  1VQN A;  2LT4 A;  4BDY A;  1PNJ A;  2QYZ A;  2HEQ A;  1OEB A;  2GF7 A;  1OYX A;  3G7Z A;  4OB1 B;  4C0Z A;  1NZ9 A;  2XG8 D;  1YJN A;  3JCM b;  4ESR A;  2VGN A;  1E6H A;  2E65 A;  2NYS A;  3FRN A;  4LE9 A;  1NPR A;  2PVO B;  1G2B A;  2E5Q A;  3EH2 A;  2DIQ A;  1Q95 G;  3QUI A;  1JBM A;  2K3X A;  4RG2 A;  1VQN T;  2LVM A;  5IXB A;  4M78 F;  1KIK A;  1X75 C;  3MP1 A;  3EH1 A;  2NLU A;  5KCH A;  5LJ3 g;  2DXT A;  2LJ1 A;  3O5Z A;  2XU8 A;  4Y91 A;  3G6E Q;  1WXB A;  4E2F B;  5GMK j;  5IHI A;  4FYX B;  3JCM V;  1UEC A;  5GAN e;  1SKU B;  3VU3 C;  4DOV A;  4K11 A;  2JTE A;  5LJ3 h;  3CC4 Q;  4Y28 E;  2A36 A;  4B9W A;  3OS5 A;  4B9X A;  3I55 A;  4LDY A;  4OP0 A;  4JJC A;  1YI2 A;  2CZ0 B;  1NYG A;  3ME9 A;  1AWX A;  1QCO A;  3OYA A;  4XAX B;  1TUC A;  2YUN A;  4M77 B;  3MJX A;  2LCS A;  1AWO A;  1FMW A;  3OYK A;  2DKG A;  2CH4 A;  4F16 A;  1WX6 A;  3M58 A;  5KYU A;  2RJE A;  4MMK A;  1YCS B;  1PM3 A;  1OUL A;  5CKH A;  3CPW A;  3F70 A;  4M78 A;  2CP2 A;  3EG0 A;  3CC4 T;  2CRE A;  3BDU A;  3OYJ A;  2ZPB B;  2ZZD A;  2D1X A;  2RA2 A;  4BE1 A;  5IT9 E;  3ER0 A;  3SWN C;  2CT3 A;  2EYQ A;  1X6B A;  1VQ4 A;  3OYD A;  3GF5 A;  4M7A C;  2EYX A;  4XTV A;  1UEB A;  1ZA2 B;  2EQU A;  1VQK T;  2RB6 A;  3HL8 A;  2OTL A;  1RI9 A;  3V7R A;  1U1T A;  1RAA B;  3OMG A;  4L59 A;  4YTL A;  1ZSZ B;  2AHJ B;  3CD6 Q;  2KT1 A;  4A4E A;  1MMA A;  2EIF A;  1D1B A;  8AT1 B;  4JS4 A;  3CCV A;  1F1B B;  3H0H A;  1N9S A;  4X34 A;  4Z88 A;  3CME A;  1KQ2 A;  2IPO B;  2MYS A;  2KYM A;  1FXX A;  2HSE B;  3CXC S;  3CMA A;  2LT1 A;  4F04 B;  5KYY A;  2E41 A;  2KK4 A;  1UHC A;  3LH5 A;  1KC8 R;  2DXC A;  5GAM f;  3UA6 A;  2CP5 A;  3H6Z A;  2MPX C;  4P5N A;  3I56 Q;  5CAI A;  1JJ2 A;  3G1J A;  1NYF A;  4BY6 B;  2L3S A;  2KYB A;  3VS1 A;  4BE0 A;  3VUZ A;  1ZSZ C;  4O6J A;  4NL3 A;  1WI7 A;  3BFM A;  4B6M A;  4ZN1 A;  3REA B;  2C0T A;  3CPW P;  2OTJ Q;  2VV5 A;  2XIC A;  1N9R A;  1WA7 A;  2KR3 A;  3QKJ A;  4F7U G;  2HSP A;  1WJQ A;  5GAN h;  3I56 A;  2EJ9 A;  1NEG A;  2X4W A;  1SEM A;  3SWN A;  1M3C A;  1Q82 C;  4A4F A;  1OZ3 A;  1G8X A;  1KQS S;  1YJN T;  3CBO A;  1VQM T;  5L8R E;  2LJ0 A;  4HVW A;  1XJW B;  1MV3 A;  3FEO A;  2RJC A;  2EBP A;  1M8V A;  3HFN A;  2DL4 A;  2DRK A;  1UGQ B;  2OTJ T;  2EKO A;  1SG5 A;  5CIU A;  5LJ5 g;  4AG2 C;  1QP3 A;  5L23 A;  3L2V A;  3DKM A;  1D1C A;  3KUF A;  2QDY B;  1ZHI A;  1S1N A;  2KMT A;  1MMG A;  1VQ6 T;  3MEV A;  1WQ7 A;  3PT9 A;  4X1V A;  5GAN 7;  1IO6 A;  5FRO A;  4RG8 A;  3TSW A;  2BIV A;  3RKY A;  3RBB B;  1M90 R;  2EQK A;  4PL6 A;  3VS3 A;  3H41 A;  3MKD A;  3FC3 A;  2K4Y A;  2V1R A;  4ATO A;  2KE9 A;  2RJF A;  1BU1 A;  1UDL A;  4XK8 E;  4CC4 B;  2VAS A;  5A0L A;  1GL5 A;  1KD1 U;  2YDL A;  4JLG A;  2HBP A;  2XDB A;  2L0A A;  4JZ4 A;  4IKF A;  3V7C A;  4LDW A;  1V76 A;  4PJO E;  4PKC C;  5CKE A;  4DA4 A;  2IIM A;  3FLG A;  5GAN 5;  2C0I A;  2H3J A;  1UGP B;  2R58 A;  3REB B;  1H8K A;  5CKF A;  2PUK B;  3JAM E;  5D7U A;  2DTH A;  3CD6 A;  1Q82 R;  2CH4 W;  5CQY A;  1M8M A;  1HYO A;  3OBY A;  1QMC A;  1VQK Q;  4FIB A;  1KD1 C;  1B34 A;  4C8Q B;  3HTR A;  1EIF A;  2V8K A;  4C92 A;  4C5H A;  2YWW A;  4ME7 A;  1GFC A;  4DBF A;  1W2B A;  4PJL A;  2DER A;  2L8D A;  2E12 A;  3CBM A;  3PIO A;  4C0G A;  1QQJ A;  3M4G A;  1IHW A;  1I5L A;  5J3B A;  7AT1 B;  1AVZ C;  4OGC A;  1YHQ T;  2AT1 B;  1BK2 A;  1QVG P;  1GBR A;  1NM7 A;  3BDL A;  4RMO A;  1M1K U;  4IUQ A;  3EG3 A;  3EFS A;  1G3S A;  1PRL C;  3CPF A;  3R6O A;  4AFU C;  4IIM A;  2COY A;  3UAT A;  4J9F A;  2LC4 A;  3QZ5 B;  4PJO F;  3OYE A;  3QWX X;  1AT1 B;  1BIA A;  3H8Z A;  5KYW B;  4M75 E;  3JSC A;  2DYI A;  2ZGW A;  3CMA T;  1FYN A;  1T0J A;  1W1F A;  3S6W A;  4CC3 A;  2CS7 A;  5GAM j;  4M78 D;  1R77 A;  3PVQ A;  2QA4 T;  4M7A G;  3X20 B;  4RTZ A;  3JCM W;  5FU6 B;  5KYN A;  3CCR A;  3I35 A;  2QEX Q;  1W2B S;  1C6V X;  4PJO C;  4PJM A;  1VQ7 A;  1A0N B;  2P84 A;  2H3E B;  2QQS A;  5LJ5 h;  1Q7Y R;  1Q81 C;  3A8M B;  3ZBD A;  4D8K A;  4XU3 A;  3CCU Q;  2PVD B;  1RAI B;  3MO8 A;  4AMC A;  1PWT A;  2CDT A;  2E5K A;  3RDV A;  4OGE A;  3VS4 A;  1GCQ A;  1U5S A;  1D0Z A;  5GAN 2;  1CKB A;  1ABQ A;  2WAC A;  3NPF A;  2V1Q A;  4GLK A;  1YCY A;  4DQ2 A;  3OYG A;  3N5B B;  1QVG S;  1ABO A;  1Q82 U;  3CCV T;  3A98 A;  2OI3 A;  3VV0 A;  3CCM A;  1RAH B;  1PCX A;  5GMK e;  2F2X A;  2M1H A;  4M75 B;  1H64 1;  4QVZ A;  4IUR A;  1AHJ B;  3M5A A;  3NHN A;  1K73 U;  2GBQ A;  4EMH A;  1VQ7 T;  3CCE Q;  1M9S A;  4RKU E;  5KYX A;  2EYY A;  1X6O A;  2GTO A;  3OW2 S;  2PZ1 A;  2ED0 A;  2RI2 A;  3INZ A;  2JN0 A;  4M77 C;  2V8I A;  2Y4X A;  2DBK A;  5GMK m;  3EGX B;  5A0D A;  3E19 A;  3VS2 A;  3BE3 A;  2HQH A;  1PSF A;  2LNH B;  2QI2 A;  2L3R A;  3CCQ Q;  4M77 E;  2OJ2 A;  2X4Y A;  5GAO r;  3CCU T;  4F7U A;  3EHR A;  4EMK A;  2FZC B;  1IHV A;  4JZ3 A;  5I21 A;  2FZG B;  1JRI A;  1O9S A;  1NJI U;  4JPB W;  1YWP A;  2A0F B;  3I9Q A;  2ESW A;  5GAN 8;  3U23 A;  3M59 A;  1Q81 R;  5LJ3 d;  1RAB B;  2JZ2 A;  2YRC A;  2KDS A;  2FRY A;  2R5A A;  1Y0M A;  3LYI A;  4ZTJ A;  3M0S A;  3E9G A;  3EGD B;  1NPP A;  2PVG B;  2KAF A;  1VOM A;  2RI3 A;  2AIR B;  2JUF A;  1JEG A;  2W10 A;  1WHK A;  2O9S A;  3CMA Q;  2BZY A;  3HHT B;  2L2P A;  4A63 B;  4C0D C;  2RHX A;  3IQL A;  2HQX A;  1LVK A;  2QAZ A;  1D3B B;  1IZ6 A;  4J8O A;  3L42 A;  2VWF A;  1QVG A;  2DA9 A;  5KYX B;  5GAM g;  3CD6 T;  2RNA A;  3DB3 A;  4E7I A;  3CC7 A;  1UGR B;  1BKB A;  1X2Q A;  1VQL A;  3QBY A;  1WDX A;  1S72 T;  4FM4 B;  2EW3 A;  4FW2 A;  3JV3 A;  2P0K A;  3NTI A;  2D8H A;  3LLR A;  1QCN A;  2KT8 A;  2RM4 A;  1Y7X A;  4J7F A;  4NS5 A;  4IUT A;  3NFC A;  2ZPG B;  1BB9 A;  3DB4 A;  1KQS P; 
#chains in the Genus database with same CATH homology
 2DE0 X;  2X3W D;  4FSS A;  4J9C A;  2KT1 A;  1WFW A;  2JM9 A;  3TSZ A;  3KFV A;  1M3B A;  2AZV A;  1NEB A;  2RPN A;  1UTI A;  3H0H A;  2DL7 A;  1SRL A;  2HCK A;  1QKX A;  4Z88 A;  2KYM A;  4RUG A;  2YSQ A;  1ARK A;  4HVV A;  1E7O A;  1NG2 A;  1WXU A;  2DLP A;  4Y92 A;  1UHC A;  3LH5 A;  2DJQ A;  1UE9 A;  3NGP A;  1WLP B;  2H8H A;  2D8J A;  2YT6 A;  3UA6 A;  3SHW A;  2EYW A;  2J6K A;  4F14 A;  1BBZ A;  4RTU A;  1MV0 B;  1RUW A;  1NYF A;  4DEX A;  2L3S A;  2KYB A;  2DBM A;  2I0N A;  3VS1 A;  5IHK A;  4CC7 A;  1ZBJ A;  5FWB A;  1WI7 A;  1UGV A;  4ORZ A;  1GBQ A;  3REA B;  2C0T A;  2CSQ A;  2FRW A;  1J3T A;  1Z9Z A;  1I0C A;  2DL3 A;  1WA7 A;  2KR3 A;  2VVK A;  4LUE A;  2LQW A;  2LQN A;  1VYV A;  2HSP A;  2YUO A;  1JQQ A;  2KNB B;  3EHQ A;  3M0U A;  1YWO A;  2DNU A;  1NEG A;  1SEM A;  1M3C A;  2EYZ A;  4J9E A;  5GJW B;  4J9D A;  4DEY A;  1QWF A;  4AFS C;  4D8D A;  4OMO A;  2KBT A;  3THK A;  4QT7 A;  1VYT A;  3ZL7 C;  3TVT A;  1AEY A;  1E6G A;  1QKW A;  3EGU A;  3VS7 A;  1K0X A;  1NLO C;  2LJ0 A;  5FWC A;  2GTJ A;  4HVW A;  2FEI A;  2SRC A;  1UG1 A;  1MV3 A;  5HCK A;  1GFD A;  1AD5 A;  2GQI A;  1QCF A;  1M27 C;  2EBP A;  2ENM A;  3VRY A;  4F17 A;  2DL4 A;  2DRK A;  4WCI A;  1MUZ A;  4AG2 C;  5L23 A;  1VYU A;  2O9V A;  1JU5 C;  2KRS A;  4OMP A;  3FJ5 A;  2KRO A;  1S1N A;  2QDL A;  1KJW A;  4X1V A;  2DL8 A;  1Z9Q A;  1IO6 A;  3TSW A;  1WIE A;  4ZNX A;  3RBB B;  2ABL A;  3I5R A;  1ZX6 A;  1SSH A;  1T0H A;  3VS3 A;  1H92 A;  3H41 A;  1UJ0 A;  2NUZ A;  2YUQ A;  4RTT A;  1K4U S;  2V1R A;  2KE9 A;  5GJV B;  1X69 A;  2MCN A;  1KSW A;  1BU1 A;  2DMO A;  4RTY A;  1UDL A;  2O31 A;  2J6F A;  4CC4 B;  2KRN A;  2AKL A;  1B3Q A;  1QWE A;  1GL5 A;  2YDL A;  4J9B A;  2NWM A;  4OMQ A;  3EG2 A;  2L0A A;  4JZ4 A;  1TG0 A;  1AWW A;  1GRI A;  1ZUU A;  3UA7 A;  2IIM A;  2AK5 A;  1K1Z A;  1OPL A;  2FO0 A;  3VS0 A;  3H0F A;  4LUD A;  2C0I A;  2C0O A;  2JXB A;  2K79 A;  3REB B;  3ULR B;  5IHN A;  1H8K A;  1ZSG A;  1W6X A;  2KRM A;  2FPD A;  4KRT A;  4R0K A;  1ZUK A;  3VRZ A;  2GNC A;  4HCK A;  2CH4 W;  1M8M A;  1I1J A;  2G6F X;  4CC2 A;  2JMC A;  1B07 A;  2LZ6 B;  2RMO A;  2CSI A;  5ECA A;  3VS5 A;  2MIO A;  2K3B A;  2D0N A;  2DL5 A;  1RLQ C;  1GFC A;  1X2K A;  1YNZ A;  2FPF A;  4HVU A;  3VS6 A;  3M0R A;  2VKN A;  1PHT A;  2DIL A;  5EC7 A;  1AOJ A;  2CT4 A;  4M4Z A;  3C0C A;  1CSK A;  4Z89 A;  1SPK A;  2J6O A;  2CUB A;  1NLP C;  2HBW A;  2BZ8 A;  2AKK A;  3M0Q A;  3M0T A;  1WYX A;  1AVZ C;  1BK2 A;  1GBR A;  1GCQ C;  2O2O A;  1NM7 A;  1TUD A;  2F2W A;  2LJ3 A;  5FW9 A;  3NMZ C;  2EKH A;  3EG3 A;  2DYB A;  2K6D A;  1ZUY A;  1CKA A;  1FMK A;  3UF4 A;  1PRL C;  4AFQ C;  4AFU C;  2BZX A;  4IIM A;  4RTW A;  2JMA A;  2JM8 A;  3GBQ A;  2BTT A;  1YP5 A;  2P4R A;  2OAW A;  4J9F A;  2JT4 A;  3UAT A;  2GGR A;  2FG0 A;  2KGT A;  2RQR A;  3QWX X;  2PTK A;  1U3O A;  2X3X D;  2K7A A;  2HDA A;  2MOX A;  1FYN A;  1T0J A;  1W1F A;  4CC3 A;  5IH2 A;  1HJD A;  1SRM A;  1K9A A;  3PVQ A;  4J9H A;  1H3H A;  2EGA A;  4RTZ A;  4OML A;  3I35 A;  4OMN A;  2B86 A;  2DX1 A;  2J06 A;  1HSQ A;  3PE0 A;  1A0N B;  1UJY A;  1X27 A;  1OPK A;  1PKT A;  4AG1 C;  4GBQ A;  1G83 A;  1JXM A;  4LNP A;  2RF0 A;  1QLY A;  4D8K A;  1AZG B;  2RN8 A;  1GCP A;  1N5Z A;  1LCK A;  1PWT A;  2CDT A;  2E5K A;  3VS4 A;  1GCQ A;  1JXO A;  1U5S A;  2LX7 A;  4IIO A;  2K2M A;  2EGC A;  1CKB A;  1ABQ A;  2KEA A;  2DRM A;  3NPF A;  2ECZ A;  2RQW A;  2V1Q A;  2ROT A;  3R6N A;  2A08 A;  1ABO A;  2PNI A;  1T3S A;  2O88 A;  1KFZ A;  1V1C A;  2KXC A;  3A98 A;  1HD3 A;  2OI3 A;  3H0I A;  1OOT A;  1M30 A;  2L3Q A;  2F2X A;  1PNJ A;  4GLM A;  5IXF A;  1XOV A;  2HEQ A;  1OEB A;  4JJD A;  3NHN A;  2GBQ A;  2EVR A;  1K0S A;  1SHF A;  2AZS A;  2EYY A;  1VA7 A;  2KXD A;  4J9I A;  2JS2 A;  4ESR A;  2GTO A;  2LP5 A;  2F2V A;  2PZ1 A;  1E6H A;  2ED0 A;  4Z8A A;  2W0Z A;  1UFF A;  4LE9 A;  2DBK A;  1Y57 A;  1G2B A;  3EG1 A;  2M0Y A;  3VS2 A;  1X43 A;  1EFN A;  5IXB A;  1KIK A;  2LNH B;  2JS0 A;  2OJ2 A;  3I5S A;  1YN8 A;  2EQI A;  4JJB A;  1SHG A;  3EHR A;  5I11 A;  2LJ1 A;  3O5Z A;  4JZ3 A;  1M3A A;  2RQV A;  1JO8 A;  1WXB A;  5IHI A;  2XMF A;  2DVJ A;  4JPB W;  1UEC A;  1ZLM A;  1YWP A;  1K76 A;  2A37 A;  2SEM A;  3I9Q A;  2ESW A;  4RTV A;  3U23 A;  4K11 A;  2JTE A;  1U06 A;  4HXJ A;  2A36 A;  2FRY A;  4AFZ C;  3SEM A;  4JJC A;  2ED1 A;  2K9G A;  1Y0M A;  4OMM A;  1NYG A;  3M0S A;  1AWX A;  1TUC A;  2YUN A;  1OV3 A;  5I22 A;  2L3P A;  2J05 A;  2LCS A;  1I07 A;  1AWO A;  1RLP C;  2CH4 A;  4LN2 A;  4F16 A;  1WX6 A;  1PRM C;  1JEG A;  2W10 A;  4RTX A;  1YCS B;  2LMJ A;  2O9S A;  2YUP A;  2BZY A;  2DF6 A;  2L2P A;  3EG0 A;  4A63 B;  2CRE A;  2D1X A;  1W70 A;  3IQL A;  1AZE A;  1UHF A;  2CT3 A;  2A28 A;  2JW4 A;  2CUD A;  1X6B A;  2VWF A;  2DA9 A;  4EIK A;  1T3L A;  1X6G A;  2DM1 A;  2RNA A;  4E6R A;  4J9G A;  1UUE A;  1X2Q A;  2M51 A;  2FPE A;  1WDX A;  3CQT A;  2EW3 A;  2EYX A;  3JV3 A;  2D8H A;  2EGE A;  3M0P A;  2KT8 A;  2EPD A;  3RNJ A;  2ROL A;  1PKS A;  1WXT A;  1RI9 A;  2RQT A;  3PVL A;  2RQU A;  3QWY A;  2J7I A;  1BB9 A;  1AWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...