2EQIA

Solution structure of the sh3 domain from phospholipase c, gamma 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
GSSGSSGRTVKALYDYKAKRSDELTFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholipase C, gamma 2
publication title Solution structure of the SH3 domain from Phospholipase C, gamma 2
rcsb
source organism Mus musculus
molecule tags Immune system, hydrolase
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2eqiA00
4JZ4A 2CH4A 3TSWA 2CDTA 4HVVA 2PNIA 4HVUA 1M30A 2RNAA 1AD5A 2O9VA 2ROLA 4FSSA 3U23A 1GL5A 1ZBJA 3EG1A 4RTVA 2NUZA 2HBWA 3M0QA 2RQTA 2EYZA 4KRTA 1V1CA 1E6GA 2DL3A 2RQRA 1NLPC 1AWWA 1H92A 4JJDA 1PKTA 3FJ5A 2B86A 2FG0A 4IIMA 4DEYA 1PRLC 4AFSC 4D8DA 1WI7A 2MOXA 3PVQA 3VS3A 1W70A 4OMPA 1SHGA 5FW9A 1YWPA 4D8KA 3A98A 1ABOA 3UA6A 1VA7A 1Z9QA 4RTYA 1W1FA 2LJ3A 1UGVA 2A36A 4K11A 1N5ZA 1GBQA 1X6BA 1IO6A 3M0PA 4F14A 4F17A 1M3AA 5EC7A 2F2VA 2YDLA 3M0UA 3I35A 4RUGA 1GFDA 3VS1A 3EHRA 3QWYA 1X43A 1ARKA 2D1XA 2J6OA 5IHKA 1WXTA 1HSQA 5GJVB 1MV3A 1BB9A 2LQNA 2O31A 4R0KA 1YWOA 1VYTA 2F2XA 1UECA 1FYNA 3SEMA 1K4US 1NEBA 4Z89A 2KRMA 1ZUKA 2EYYA 2EYWA 4GLMA 1GBRA 2A37A 1JU5C 2MCNA 2YUNA 1QWEA 2KNBB 5IHIA 2JS2A 2FRWA 2JT4A 2ED1A 4HXJA 2AKLA 1SRMA 1K0XA 2LP5A 1AWOA 1NLOC 3UATA 3EG3A 1OPKA 2L0AA 1G83A 2CSQA 1AWXA 3UF4A 4JPBW 1GCQC 1RLPC 3M0RA 2LMJA 4ESRA 2RQWA 3NPFA 4Y92A 1W6XA 1JO8A 2EPDA 1LCKA 4HCKA 2BZYA 5HCKA 1BK2A 3JV3A 2DM1A 1T0JA 2M0YA 4LNPA 2FPDA 3H0FA 4J9IA 1U5SA 2JMAA 1M3BA 3VS5A 4EIKA 2CH4W 1UFFA 1EFNA 2PTKA 1I07A 4J9CA 1E6HA 3I9QA 2CT4A 1X2QA 3PE0A 4AFQC 1X27A 4DEXA 1CKAA 2ED0A 2DRMA 4GBQA 2OI3A 3RNJA 2ECZA 1MUZA 1RUWA 1UE9A 2QDLA 3SHWA 2JXBA 2KYMA 2BTTA 2FRYA 2J6KA 2KXCA 2RPNA 3REAB 2K9GA 1OV3A 1AWJA 1WLPB 1AOJA 1WXBA 2DVJA 2M51A 1GRIA 2X3WD 4OMNA 1JQQA 1HJDA 2CT3A 1SEMA 2KRNA 4WCIA 2K3BA 1J3TA 3ZL7C 1YCSB 2KR3A 3RBBB 1KSWA 2EQIA 1T3LA 2EBPA 2DF6A 5I22A 3EG2A 2LNHB 1NEGA 2KGTA 2L3PA 5GJWB 2CSIA 2AK5A 2JTEA 1SRLA 1UHFA 2MIOA 2W10A 1YN8A 5ECAA 3VS7A 3IQLA 1BU1A 2CREA 2GQIA 2AZSA 1ABQA 1NYGA 1SSHA 1Z9ZA 5IXFA 3UA7A 5IXBA 3VRYA 1GFCA 2JMCA 2KXDA 2K6DA 2ROTA 2L3SA 1B07A 1K76A 2BZ8A 2AKKA 3VS4A 1TG0A 2HSPA 2X3XD 2GBQA 3NHNA 2P4RA 3VRZA 2L2PA 1AZEA 2GNCA 3TSZA 1PNJA 2A08A 4F16A 1QCFA 4IIOA 2YSQA 2RMOA 1G2BA 2V1QA 2RQUA 1I1JA 2CUDA 3I5SA 3REBB 2FO0A 3R6NA 2K79A 1M8MA 4RTZA 2EW3A 2FPEA 4ZNXA 2KEAA 2VKNA 1VYUA 2EYXA 4JJCA 3C0CA 1S1NA 2KT8A 1K0SA 4RTTA 1WIEA 1MV0B 1YP5A 2VVKA 1X2KA 3H41A 4J9GA 2NWMA 1JEGA 3KFVA 4A63B 1PWTA 1RI9A 1ZUYA 2J05A 4LUEA 3PVLA 2DNUA 2GTOA 2F2WA 4CC4B 2ESWA 2ABLA 2L3QA 2DL4A 4J9DA 4AFZC 4HVWA 2KROA 1Y0MA 1UDLA 2HCKA 2KYBA 1E7OA 1QLYA 2GGRA 1WXUA 2A28A 3VS0A 1JXOA 1UHCA 1KIKA 1ZUUA 4JZ3A 3M0SA 2JM9A 1ZLMA 2DBMA 2EGCA 2DA9A 4AFUC 2EKHA 1ZX6A 2DL5A 1NM7A 3QWXX 3EGUA 1T0HA 1WDXA 1HD3A 4QT7A 1FMKA 1OOTA 4LN2A 1CSKA 4M4ZA 4J9FA 2EGAA 2J7IA 2KRSA 2DJQA 2O88A 2FEIA 1OPLA 2J06A 1UJYA 1OEBA 5IHNA 1H3HA 1TUCA 2SRCA 4OMOA 1M27C 2DL7A 2DLPA 2YUOA 3VS2A 2KE9A 2DE0X 2OJ2A 1QKXA 4JJBA 2DILA 4ORZA 2D8HA 1ZSGA 4AG2C 2LCSA 1I0CA 4Z88A 4X1VA 1K9AA 2JW4A 3H0IA 1AVZC 4CC7A 2LZ6B 2E5KA 1PRMC 2O2OA 3ULRB 2EGEA 2ENMA 4J9HA 3VS6A 1U3OA 4J9BA 2J6FA 3EHQA 5FWBA 2K2MA 1X6GA 1WX6A 2KBTA 1K1ZA 2LQWA 2C0TA 1AZGB 1WA7A 5L23A 1GCPA 4J9EA 2I0NA 1YNZA 2RQVA 2DYBA 2W0ZA 2YT6A 1TUDA 2EVRA 1RLQC 2YUPA 4CC2A 1PHTA 1KJWA 1M3CA 2KT1A 2RF0A 2O9SA 3EG0A 1SPKA 4OMLA 4E6RA 2DBKA 1A0NB 1Y57A 3NGPA 2PZ1A 2HDAA 4LE9A 4AG1C 4RTXA 2IIMA 1QWFA 1NYFA 3TVTA 2FPFA 2RN8A 1UTIA 1QKWA 2BZXA 2DL8A 3M0TA 1KFZA 3O5ZA 3H0HA 1GCQA 2YUQA 2D0NA 2D8JA 2AZVA 1U06A 2JM8A 2LJ0A 5IH2A 3THKA 2LJ1A 1WYXA 1BBZA 2H8HA 1VYVA 4RTWA 5I11A 2DRKA 3GBQA 1AEYA 4OMMA 3LH5A 1PKSA 2DMOA 4Z8AA 3I5RA 2GTJA 2C0OA 1UG1A 2XMFA 1JXMA 4RTUA 2VWFA 2OAWA 1B3QA 2JS0A 1UJ0A 2SEMA 1T3SA 1X69A 1H8KA 2HEQA 4OMQA 1WFWA 1CKBA 2G6FX 2K7AA 2CUBA 1NG2A 2LX7A 2V1RA 3CQTA 4CC3A 1XOVA 4LUDA 5FWCA 3NMZC 1UUEA 1SHFA 2C0IA 2DX1A
chains in the Genus database with same CATH superfamily
5GAN6 5KYXB 2CH4A 3INZA 3V7SA 4E7IA 3M5AA 4HVVA 2NUPA 3OS1A 3L2WA 4MZTA 3CCEQ 1M30A 4C8QB 1K73U 3C4SA 3EGXB 1ZBJA 3EG1A 4C5HA 1KQSA 1K8AR 3GNGA 3OMCA 2NUZA 1KQ2A 3PGGA 3E19A 1QCOA 1NLPC 1Y7XA 4XTWA 1TU0B 1M1KC 5FU6B 2GQVA 2DIGA 4DEYA 3CCVT 2XDBA 4AFSC 4D8DA 2MOXA 3QUIA 2D9TA 1IB8A 3VS3A 1IREB 1Q82R 1NPPA 3JCMb 3MP6A 3ZEHA 3UA6A 4M78B 1VA7A 1N5ZA 1GBQA 3HKSA 1VQPA 2HQXA 4F17A 4C8QD 3QDFA 2F69A 2XIDA 2DYIA 5EC7A 2OTLQ 1VQ7A 1VUBA 1XJWB 3V8JA 2GFUA 2MAMA 5FU7B 2D1XA 1WXTA 1LVKA 3GP8A 1MV3A 2O31A 4LD6A 1VYTA 4JUVA 1UECA 1K4US 3RIRA 1RAAB 4EDUA 3QZ9B 2E6NA 5GMKj 2KRMA 2ZAEA 2EYYA 2M9UA 1YCYA 2E4HA 2RD1A 1GBRA 2A37A 1JU5C 2RI5A 1QVFP 4C92G 1QWEA 2KNBB 4M78D 4TVRA 2A3LA 4FYVB 1RAFB 2YRVA 3SWNA 3JB9D 1EIFA 2ED1A 3CCUA 3RKYA 4M77G 2V8KA 2K3XA 1OU8A 3HFNA 4LDWA 2LVMA 1K8AU 2X4YA 1GCQC 5IT9E 3FLGA 2CZ0B 1YJ9A 4Y92A 4QVCA 2O4XA 1JO8A 2EPDA 3G1JA 4HCKA 5D7UA 1OQKA 3ZFJA 4Z02A 1T0JA 4C5IA 4FU6A 3QHSA 4LNPA 4OB0B 2QTVA 1Q95G 3H0FA 4J9IA 1VQLT 2VB6A 1YI2A 1YJNQ 4Q5WA 1M3BA 1UFFA 1I07A 2XD0A 3CC7A 1NBEB 2XICA 1X2QA 4A4HA 4AFQC 1H3ZA 3C94A 1CKAA 3X24B 4GBQA 2ECZA 2FB7A 5KCOA 3I56Q 3OYHA 1RUWA 3OY9A 1UE9A 2QDLA 3GOXA 4XAXB 2KYMA 3JRZA 1XQHA 2J6KA 1M4ZA 3FDRA 2RPNA 1VQ5T 4D6WA 3ER0A 1AWJA 2DERA 3L1AA 1WXBA 2QG9B 2DVJA 3LX7A 2X3WD 5CKEA 4PJOF 2ATCB 1FXXA 4E7SA 3A8GB 1J3TA 2QQ9A 1VIEA 2EAYA 3RBBB 2EJGA 2FHDA 2H3EB 4E7KA 2DF6A 2E5QA 4PL6A 2DEUA 3EG2A 5GMKm 4FIBA 3JCMX 1NEGA 1OI1A 1M1KU 1WHGA 1MHNA 2CSIA 2VASA 2DD4A 2E3HA 1UHFA 1YN8A 4PFOA 5ECAA 1BU1A 1ABQA 1NYGA 1SSHA 1Z9ZA 3G7ZA 3VU3C 1G5VA 1GFCA 2JMCA 2KXDA 2K6DA 4C8QG 3C12A 1K76A 2BZ8A 2AKKA 2E6ZA 1BIBA 2R57A 3NHNA 2GBQA 2PUKB 4PFPA 3UPUA 1Y71A 2ZPFB 1BCMA 2AIRB 3QXEB 4QQDA 4C0DC 2MK5A 1PNJA 1QCFA 4EMHA 1D1AA 2RHXA 1KQSP 1VQKQ 2EYQA 2RHUA 1QP2A 4M75E 2FO0A 1D1BA 3R6NA 3NTKA 4OF1A 2ZCFB 4NOYA 1M2OA 2EW3A 2XU8A 3S3OA 4ZNXA 2OTLA 1VYUA 4JJCA 5CKBA 1S1NA 2KAFA 2KT8A 2L89A 4M78G 3X20B 2LCCA 1WIEA 2VXFA 3JB9G 3A5ZB 3CD6Q 4XU3A 1LPLA 4IUPA 5IAYA 2CP2A 1YIJQ 5CK9A 1QW1A 3KFVA 1PWTA 3PVLA 2DNUA 1IXDA 2BUDA 1XTDA 2ESWA 4XU1A 2ABLA 3OMGA 2KROA 2Z0WA 2YLCA 8AT1B 1PSFA 1UDLA 4M75F 3RMQA 4LDYA 3I55Q 1E7OA 3CCMT 1OZ2A 3LGFA 1QLYA 2GGRA 1WXUA 1BKBA 3EFSA 1JXOA 3PT9A 4JZ3A 2QYZA 2A0FB 3CC4Q 2DBMA 3V7CA 1WHMA 3EGUA 3JCMQ 1I5LA 1G8XA 4ME7A 5KE2A 1O9SA 2FYKA 4MDXA 1HD3A 2YRDA 4F7UG 4M7DF 3SDZA 3MP1A 2R5MA 3VKIA 4FW2A 4DBQA 1OOTA 2XDPA 1CSKA 1C0MA 2EQJA 2EGAA 1H641 1YJNA 5GAOp 1TUCA 2FVUA 3PMIA 1YHQQ 5A2QE 2YUOA 2KE9A 2IPOB 2DJZA 3I56A 4JJBA 1KHIA 3V8KA 4ORZA 2IVWA 3CC2Q 5KYNA 4C0DB 4Z88A 1VQ9T 1AVZC 5HK3A 2E5KA 2PVOB 2JZ2A 2ENMA 2K5FA 3EFOB 1OU9A 2J6FA 5FWBA 3OYBA 1PSEA 1MNDA 1X6GA 5FRNA 1WX6A 4L59A 1K1ZA 1WPYA 1Y96B 1D3BA 5KYYA 2OTJT 1IGQA 1JB0E 4ZTFA 3G4SQ 1ZSZA 1YNZA 4C92C 5KYUB 2RQVA 2H3JA 1WZOA 1DJ7B 1UGQB 3HHTB 2O01E 4FYWB 1KJWA 4M77C 2GF7A 1VQMT 2RF0A 2RHZA 2DVEA 4KH1B 3D7SB 1SPKA 4NL3A 3E2UA 3NGPA 4RTXA 5GAOl 5LJ5g 2FPFA 1UTIA 2C06A 1QKWA 4BB7A 2DXBA 4OB3B 3FJPA 2V8JA 1WJSA 2D0NA 2VXEA 4C92E 1VQKA 1U06A 5D6XA 3J7AF 2XI9A 2JM8A 4A4EA 1WJRA 4OB1B 3QG1A 5IH2A 2LJ1A 3R6OA 4M77E 2DD5A 2H8HA 3PIOA 5I11A 1AEYA 4PKCC 1JJ2A 4J5YA 2DMOA 2GTJA 3GF5A 3UDCA 4BE2A 4QKUA 1YIJA 1B3QA 2HEQA 4MZMA 4LXCA 2CUBA 5FLXE 1NG2A 2XK0A 1WHKA 5LJ3f 3I55A 2C0IA 2RJEA 4JZ4A 3S3NA 4HCZA 2PNIA 1QCNA 3G6EQ 4HVUA 3JCMV 4ZGEB 2WSFE 3CC4A 2DAQA 2QA4Q 1AD5A 2O9VA 5A0LA 1WQWA 4DOVA 3A8OB 5GAMd 1D0YA 3M57A 1Q81C 4M7AA 4KRTA 4MZPA 3OQ5A 2DL3A 4JRQA 3AHUA 1H92A 3NFCA 2WACA 3FJ5A 2QQRA 1VQOQ 2HNIA 1VQ6T 1PRLC 1JBMA 4C92B 5CVIA 3PVQA 1W70A 4D8KA 2FZCB 1WQ7A 3JSCA 4RTYA 2L8DA 1UGVA 2LJ3A 2QGGA 4J8OA 4PLIA 5KYYB 4M77B 5DY9A 4L6V5 1IO6A 5CIUA 4F04B 4PJJA 1M9SA 1M3AA 2RM4A 3QYGB 2F2VA 4PJLA 1VQ8T 3I35A 4RUGA 5LL6S 3BE3A 4CI0C 3VS1A 3CC2A 1PCXA 3EHRA 3QWYA 4EMKA 1X43A 2KMTA 5IHKA 4DQ2A 2NLUA 5CO7A 1BB9A 1D0XA 1YWOA 2F2XA 3SB2A 3MKDA 1FYNA 2RK2A 1TUGB 1NEBA 5A0DA 4C92D 4Z89A 2EYWA 3NTIA 3Q1JA 2MCNA 4FL6A 2E3IA 7AT1B 3CCST 3G4SA 4FYXB 2JS2A 3ASKA 4M77D 3MO8A 2JN0A 1QVGA 4JS4A 2XDDA 2JT4A 2QEXT 3CMEQ 2AKLA 3UWNA 3MCAB 3H9NA 4C8QF 3EG3A 2MF2A 2CSQA 4BUGA 1AWXA 3CBOA 5GANf 4QVDA 3M0RA 2E10A 3M56A 2RQWA 3NPFA 1JRIA 2YLBA 4DOWA 1LCKA 5HCKA 1PD1A 3OA6A 3JCMg 2ZPEB 2MMPA 1Q82C 1MMAA 1OX9A 1PM3A 1VQ4T 2FPDA 2DEQA 2DXCA 2WSCE 2JMAA 2QAZA 3VS5A 3UT1A 2CH4W 4QW2A 4DBRA 1KHCA 3PNWC 2CT4A 4M78F 4LDVA 5GAMh 1VOMA 1D0ZA 3JB9F 5D6YA 1R8OB 3NTHA 5C6SA 3SHWA 2VGMA 2FRYA 4ZGDB 3H6ZA 1OV3A 3JCMf 4EPCA 2RHYA 3P8DA 3CCLQ 4F7UE 1WNLA 1TTHB 2M51A 1JQQA 1HJDA 1SEMA 2ZGWA 3CCQQ 3FRNA 5GAMe 2IG0A 1Q81U 2EWNA 2DK3A 5KYWA 2L3PA 5GJWB 4FW1A 1V76A 4BDZA 1JJ2P 5GMKl 2LQ8A 3G6EA 4JRKA 2XKOC 1KK7A 3QSUA 2QA4A 2CREA 2GQIA 4MMLA 3OS5A 1P92A 2JOYA 4XQ3A 3QJYA 1X01A 4JLIA 1N27A 3BDLA 1KC8C 2RA2A 1B07A 1LOJA 5CQYA 1TG0A 2HSPA 4BI3A 1VQOA 2JUFA 3VRZA 4O5VA 2X4XA 1SKUB 2GNCA 2E1HA 1TS9A 5DLQE 4FM4B 2DZ9A 1G3TA 3PTAA 4IIOA 3I5SA 4HA8A 1RACB 1M2VB 2FPEA 1VQNQ 1VIFA 4J7IA 2KEAA 2VKNA 4N4GA 4PJOA 2CZ6B 4RTTA 1MV0B 4F7UB 3M4GA 4OMFB 3EG9A 2YHTA 3BDUA 4E7JA 2E70A 3GPLA 2F5TX 2K57A 1ZUYA 1RI9A 1R0CB 4LDUA 2X9HA 3SWNC 2AHJB 2F2WA 1RL2A 4CC4B 2L3QA 4J9DA 2DL4A 4AFZC 4HVWA 4AMCA 1KC8R 3CCRT 2KVQG 3F70A 1R77A 3JCMJ 4ZTJA 2JJ9A 2CP3A 2MWPA 3VS0A 4A4KA 1Q82U 1B7TA 3CMEA 1VQPT 5FRMA 2JM9A 1U1TA 1U8RA 1KQ1A 3OS2A 1VQMQ 4KGVB 2NUTA 2YWWA 2DA9A 1VQ7T 4AFUC 4JRIA 1ZX6A 2DFUA 2NUPB 3QWXX 5GAMg 1I81A 2R5AA 5AYFA 1TOVA 2PU9B 3EAEA 1F1BB 5LJ3d 4JRPA 1NPRA 2F5KA 1QVGP 3BY7A 3QZ5B 4FYYB 2LX9A 2FEIA 2I2LA 2J06A 1UJYA 5IHNA 2SRCA 1M27C 3G71Q 4BACA 3CCUT 2CKKA 5GAMj 1QKXA 2A7YA 2DILA 1K9MR 4E47A 3CCEA 3L2UA 3SFMA 3MEAA 2D8HA 4AG2C 5A0GA 2Y4YA 3CCLA 2EIFA 4X1VA 4M75A 4R56A 4X9CA 3PIPA 2COZA 3MP8A 1N8RR 3CCQA 1Q7YR 4J9HA 3E9FA 2V8IA 3VS6A 1IZ6A 1UEBA 2QQBA 4B6MA 1KC8U 2KBTA 1FWZA 1YI2T 4E7LA 1AZGB 1QP3A 1GCPA 3CC7T 4LD9K 2RK1A 1FX7A 1TUDA 1S72Q 4J83A 4M7DA 5HK0A 1RLQC 2YUPA 4CC2A 2V26A 3DB3A 1M3CA 5GAN3 3SWNB 3A8HB 3EG0A 4OGCA 4ZN1A 4DBFA 4OMLA 1A0NB 1Y57A 4LE9A 4AG1C 4BE1A 1NYFA 2NYSA 3OW2S 4J6WA 1Q86R 1YBYA 3RERA 2ZZDA 2RN8A 3CXCS 1RADB 4MDWA 1V29B 2O4XB 3A8MB 3O5ZA 2EQMA 2BE7D 3LW5E 3CPWS 2LJ0A 4BI8B 4HCBA 2FZGB 1VQNA 1VQ8Q 5GANd 3OW2A 1BBZA 2E65A 5J3BA 1VYVA 4RTWA 2DRKA 1BI2A 2FZKB 3GBQA 1HXDA 1YJWQ 1PKSA 4RKUE 5LJ3h 3CCJQ 1UG1A 1JXMA 2VWFA 2LQKA 4JLGA 3CMAQ 1M1FA 1H8KA 4OMQA 1SSFA 2KY9A 2LT1A 1CKBA 1Y07A 3CPFA 2K7AA 1EZZB 3CQTA 5FWCA 1RAGB 2RO0A 1SHFA 4KH0B 3KUFA 1KG1A 3P8BB 1UGPB 4FT4A 4Y91A 3OYCA 2QEXQ 4DBHA 3M59A 2K2VA 3M53A 2VC8A 1GXIE 2OTLT 2ROLA 4FSSA 3U23A 1M90R 2HL5C 4RTVA 3WVEB 2RQTA 1E6GA 1ZQ1A 1VQ4Q 1YITQ 4IIMA 3HSBA 1MMDA 5CCAA 2X4WA 4XU0A 4OMPA 5FW9A 1SHGA 5J26A 3X25B 1IHWA 3OYEA 2A36A 4K11A 1QMCA 1NJIC 3OS0A 3G71A 1X6BA 2PQWA 4B9XA 2GCXA 2MPXC 3M0PA 4F14A 2CGHA 1BI3A 1HK9A 3M9QA 4ZN3A 3M0UA 1GFDA 5AT1B 2KI7A 5KH6A 2CS7A 4IUQA 1HYOA 1KD1C 2RJFA 1ZSZC 4KT0E 2LQNA 4R0KA 3SEMA 3MJXA 2ZPIB 3QYHB 4P5NA 3CCVQ 4GLMA 1YJNT 4KULA 2YUNA 4L5GA 5GANh 5CKHA 1MNEA 3VYHB 2FRWA 1G3WA 2VYTA 1S72A 1RABB 3I56T 3META 3QDRB 1AWOA 3UATA 3EGDA 1LJOA 2L0AA 1TSFA 2QXFA 4JPBW 3UF4A 1NJIR 1ZBXA 3P8HA 1RLPC 2DTOA 4X9DA 4ESRA 2LMJA 4XU2A 1W6XA 3CD6A 3MEWA 1BCOA 3SD4A 5C0MA 5LJ5f 2DM1A 5GAOn 1OULA 1B34A 2M0YA 3KBGA 1KD1R 4C92F 1C1AA 1QVPA 1EFNA 4J9CA 2MI6A 1PD0A 3I9QA 4II1A 3PE0A 3MEUA 1ZA1B 2ED0A 3TCJA 2DRMA 4M77F 1MUZA 2EQUA 4RG8A 2CZ7B 1YJWA 6AT1B 2KXCA 1OX8A 2K9GA 3CCJA 1WLPB 5LJ3j 3TU4K 3CMAA 4BE0A 4OMNA 1QVFS 2CT3A 2KRNA 4WCIA 3CCRQ 3DKMA 4C0ZA 3ZL7C 5KYXA 2KR3A 4XK8E 1KSWA 2EQIA 2HL3A 5D6WA 2EBPA 5I22A 3VUBA 4A4GA 1VQLQ 4IUTA 4C8QA 1VQKT 2QEXA 3EGXA 2E41A 3OYMA 3S6WA 4N0AA 4M7AC 4JS5A 2JTEA 3M55A 4PK4A 1TXQA 1YHQA 2RH2A 1QVFA 2MIOA 1D3BB 2W10A 2AZSA 2JNGA 2DXUA 1ZSZB 3OYYA 3VV0A 1VQ5Q 3UA7A 5IXBA 4PNOA 2M16A 1YIJT 2ROTA 2L3SA 1O75A 3CBMA 2QQAA 1U1SA 2EKOA 2P4RA 2L5QA 2L2PA 1YITA 2KK4A 4M78A 4FCYA 3DB4A 2A08A 3RKXA 5CAIA 4M7AE 3OBWA 4WTOB 3I55T 3CEYA 2DTHA 3JB9I 4EMKC 2YSQA 4HKEA 3T9NA 1K73R 1G2BA 2V1QA 2RQUA 1I1JA 3FB9A 2CUDA 3REBB 2CYZB 5CKDA 3OYKA 1M8MA 2PVDB 1TH7A 3WXMB 4GY5A 3C0CA 2HAXA 5GAN7 3BW1A 3H41A 3QKJA 1OZ3A 2NWMA 1AHJB 3OYDA 5DLOA 3J81E 4KGZB 4A63B 4LUEA 3FC3A 4IURA 4C5GA 3CCVA 2LT4A 1Y0MA 1QQJA 1MMGA 2COYA 5GANj 3JAME 1UHCA 2K5LA 3MHXA 3HRSA 4BY6C 3OSVA 1ZLMA 1WGSA 2HSEB 3OYGA 2EJFA 2EKHA 2DL5A 1NM7A 1T0HA 1SG5A 4E7HA 1WDXA 3QO3A 4QT7A 2HQEA 3WVDB 1KQSS 4ELYC 4M7AB 4M4ZA 4J9FA 2LCLA 2KRSA 1OPLA 2HBPA 1NZ9A 3RMSA 1OEBA 4C0GA 3CCMQ 1R0BG 4HT9A 4OMOA 3G4ST 2DL7A 2DLPA 5CQXA 3VS2A 2DE0X 3L2ZA 1PC0A 4A4FA 2QASA 4KUIA 4N4IA 2DXTA 1ZSGA 4KGXB 1I0CA 4QVZA 4F7UF 2VV5A 2MWOA 2JW4A 3H0IA 5HKCA 2HD0A 2LZ6B 1PRMC 2KSSA 3GLXA 3ULRB 3CCRA 4EMKB 2QDYB 4RG2A 1U3OA 2ZPGB 3OYJA 4M7AD 2K2MA 2P0KA 2BE9B 5KCHA 1VQLA 5I2MA 3RUXA 2C0TA 1WA7A 4ZGJB 2DTIA 3HFOA 3L2RA 5L23A 3EH1A 4OVAA 2I0NA 1XNIA 1MMNA 4PLLA 2VGNA 2YT6A 2DYBA 2Y4XA 1AT1B 3JCMP 5I21A 2BKDN 2RI3A 1PHTA 2KT1A 1VQ5A 2X35A 1RI0A 4IKFA 2O9SA 3OB9A 2OAUA 1PG5B 2COWA 1VQ9Q 2HQHA 3TVTA 5FROA 2DL8A 4PJOC 1M1KR 1KFZA 3LWHA 1GCQA 4BY6B 2JVVA 3AT1B 4BDYA 2OTJQ 3J80E 3VUZA 3G6ET 1K9MC 2RJDA 1UB4A 4OGEA 4OB2B 3THKA 2LDMA 2QA4T 3EH2A 3RDVA 2RHIA 3DLMA 2F1LA 4OMMA 3LH5A 4A53A 5LJ5d 2C0OA 4WF2A 1N8RC 1Q7YC 4FSXA 2JS0A 4JDSA 1W2BS 2YRCA 2SEMA 5CKFA 1T3SA 4PJOE 1VQOT 1N6AA 1I5OB 2G6FX 3HL8A 3GIBA 2LX7A 2V1RA 3V8LA 1XOVA 4LUDA 2P0PA 2DX1A 5CR2A 2CZ1B 3TSWA 2CDTA 2YXYA 1W2BA 2VUBA 2RNAA 5KYWB 1YFNA 3VYGA 1GL5A 3MEVA 3JB9J 2X51A 5GAMf 4X34A 2HBWA 3LYIA 2QI2A 3M0QA 2RB6A 1ZA2B 2EYZA 1V1CA 1Q86C 3OYLA 2PVGB 2LRQA 2RQRA 1RAEB 2DZCA 1AWWA 4JJDA 1PKTA 1YJ9T 4ELZC 3L2QA 2B86A 2FG0A 5GAN4 4N4HA 1N9SA 1WI7A 1I4K1 2JTMA 4OP0A 2FL7A 5I2SA 1YWPA 3A98A 3CCMA 1ABOA 4JJNK 1Z9QA 1W1FA 4HCCA 3HP9A 4M7AG 4M75C 3CMET 4C0FA 4QQ6A 3RR6A 2YDLA 3C95A 1C6VX 4MMKA 2P4TA 5GAN2 2QQSA 1WHJA 1ARKA 3EFOA 2J6OA 2XG8D 4PJOB 1HSQA 5GJVB 1Y96A 1M8VA 1NE8A 3EG9B 1VQ6Q 2P84A 1TWBA 4M7DC 1OYXA 5KYUA 1ZUKA 3JB9H 2K4YA 2AT1B 1BYMA 1EX4A 2WSEE 2EJ9A 3VJPA 5IHIA 4XTZA 1M90C 4R55A 1X6OA 4HXJA 1SRMA 1K0XA 3M58A 3OYFA 5LJ5h 2LP5A 4J6XA 1NLOC 1BI1A 3OYIA 3CCET 1OPKA 1G83A 3CXCA 2E12A 1K9MU 1IRXA 3CCLT 1VQ9A 2NUTB 4PJOD 2BZYA 3CPWA 4XTXA 4M7DE 1BK2A 3JV3A 3CCQT 3OYNA 3L2VA 5GAN5 2EFIA 5LJ5e 1N8RU 4E2FB 2KDSA 1Q7YU 4GLKA 1U5SA 4EIKA 2OTJA 4A54A 2R58A 2ZPBB 2PTKA 4NS5A 4XTUA 2Y90A 1E6HA 2LTOA 3CCSQ 2MYSA 4RCBA 4DEXA 1X27A 2QK0A 2HZYA 2OI3A 3RNJA 2HKNA 5LJ3e 3OYAA 4PJNA 2JXBA 3MPUB 2BTTA 1VQMA 2L3RA 3JCMd 3REAB 4ATOA 3HRUA 1AOJA 4RMOA 1FMVA 1GRIA 3H8ZA 2K3BA 1YCSB 2K5IA 1T3LA 4M75B 5GMKi 3S3MA 1BI0A 5M9OA 3LWIA 1Q86U 5L8RE 2LNHB 4B9WA 2KGTA 3A1PA 1ACMB 3TEEA 1WJQA 2JTFA 3OSSC 1IHVA 3OBYA 2AK5A 1SRLA 3X26B 2GFAA 3ZBDA 1VQNT 4DA4A 2DPPB 3VS7A 3IQLA 2DETA 4C5EA 3KXTA 2P0QA 3FIFA 2OX7A 5IXFA 3VRYA 2M0OA 3QIIA 3GNFB 4M7DB 4C92A 3URGA 3VS4A 2X3XD 2M02A 4EMGA 3M4YA 1AZEA 5EG2A 1W2BP 4KBMB 3TSZA 4M77A 4M75D 4F16A 3LGLA 1FMWA 3QJ6A 3TREA 2RMOA 4AT1B 2DO3A 1RAIB 2K79A 1WHHA 3CBPA 4RTZA 2CP6A 4O6JA 3LH0A 4E7ZA 2EYXA 2DKGA 3PFSA 1K0SA 1YP5A 2VVKA 1M90U 1X2KA 4M7DD 3TQ7P 4J9GA 2PUOB 1JEGA 4V2SA 4PJMA 2J05A 1VQ6A 1JJ2S 2GTOA 5GANe 4RCCA 4PJOG 2EQKA 2HCKA 2KYBA 5LJ3g 3FEOA 2A28A 3G71T 1KIKA 3LLRA 1ZUUA 3M0SA 3JCMh 5J39A 2EGCA 5LJ5j 1VQ8A 2KQWA 3N5BB 2G3RA 8ATCB 1D1CA 5HY6A 3X28B 3JCMW 3V7RA 2E64A 4NL2A 1UGSB 1FMKA 5GAN8 3JCMe 4J7FA 4LN2A 1X75C 1RAHB 5KE3A 1K73C 2J7IA 2DJQA 2O88A 3E1SA 1G3YA 1IGUA 4YTLA 2M1HA 1H3HA 3OW2P 3CCSA 1WHLA 3CXCP 2HKQB 1S72T 1VQPQ 3O8VA 2D6FA 9ATCB 2OJ2A 3CPWP 1MGQA 1VQ7Q 3BFMA 2LCSA 4C8QC 1G3SA 3PMTA 1K9AA 5IN1A 3QPHA 4N0AC 1NJIU 3CD6T 4HT8A 4CC7A 2B8AA 2O2OA 2EGEA 4Y28E 1UGRB 2K3YA 4J9BA 2XHCA 3EHQA 5GMKh 1VQ4A 3L42A 4VUBA 1D09B 5GAOq 2LQWA 5FU6C 4PFZA 4J9EA 2D0QB 1W4SA 4ANJA 3A8LB 4QQGA 3EFRA 1KD1U 4M75G 2W0ZA 4KUDK 2EVRA 3CCUQ 4M78C 4C8QE 3CC4T 1YJWT 4J6YA 4CRIA 5GMKe 3CCJT 3QBYA 1QVGS 5GANg 4E6RA 2DBKA 1YJ9Q 3EGDB 3RKWA 3ME9A 5GAOm 1Q81R 3CMAT 2PZ1A 1M1GA 2HDAA 2ZPHB 2IIMA 1QWFA 3HRTA 5FU7C 1LNXA 4XTYA 3HTRA 2LC4A 4M7DG 2BZXA 4BI4A 3M0TA 4XTVA 3H0HA 4M7AF 3M54A 3HPWA 1ZHIA 1M2VA 2YUQA 5GAOr 2D8JA 2AZVA 3RESA 1YI2Q 2CP7A 3E9GA 3CC7Q 1K8AC 1B34B 2LNVA 2QGFB 4BD3A 1YHQT 4M78E 4F7UA 1WYXA 2CP5A 1SF9A 1BIAA 2DIQA 4FT2A 4LDXA 4Z8AA 3I5RA 5DM7R 2XMFA 3CC2T 1N9RA 2HMAA 4IUVA 4RTUA 2OAWA 2BIVA 1UJ0A 1M5Q1 2QTXA 1X69A 1YITT 3JCMc 1WFWA 1I8FA 4UC4A 4CC3A 4IUUA 2CP0A 3NMZC 3DLLA 2RI2A 1UUEA 2RJCA 2X4JA
chains in the Genus database with same CATH topology
4JZ4A 2CH4A 3TSWA 2CDTA 4HVVA 2PNIA 4HVUA 1M30A 2RNAA 1AD5A 2O9VA 2ROLA 4FSSA 3U23A 1GL5A 1ZBJA 3EG1A 4RTVA 2NUZA 2HBWA 3M0QA 2RQTA 2EYZA 4KRTA 1V1CA 1E6GA 2DL3A 2RQRA 1NLPC 1AWWA 1H92A 4JJDA 1PKTA 3FJ5A 2B86A 2FG0A 4IIMA 4DEYA 1PRLC 4AFSC 4D8DA 1WI7A 2MOXA 3PVQA 3VS3A 1W70A 4OMPA 1SHGA 5FW9A 1YWPA 4D8KA 3A98A 1ABOA 3UA6A 1VA7A 1Z9QA 4RTYA 1W1FA 2LJ3A 1UGVA 2A36A 4K11A 1N5ZA 1GBQA 1X6BA 1IO6A 3M0PA 4F14A 4F17A 1M3AA 5EC7A 2F2VA 2YDLA 3M0UA 3I35A 4RUGA 1GFDA 3VS1A 3EHRA 3QWYA 1X43A 1ARKA 2D1XA 2J6OA 5IHKA 1WXTA 1HSQA 5GJVB 1MV3A 1BB9A 2LQNA 2O31A 4R0KA 1YWOA 1VYTA 2F2XA 1UECA 1FYNA 3SEMA 1K4US 1NEBA 4Z89A 2KRMA 1ZUKA 2EYYA 2EYWA 4GLMA 1GBRA 2A37A 1JU5C 2MCNA 2YUNA 1QWEA 2KNBB 5IHIA 2JS2A 2FRWA 2JT4A 2ED1A 4HXJA 2AKLA 1SRMA 1K0XA 2LP5A 1AWOA 1NLOC 3UATA 3EG3A 1OPKA 2L0AA 1G83A 2CSQA 1AWXA 3UF4A 4JPBW 1GCQC 1RLPC 3M0RA 2LMJA 4ESRA 2RQWA 3NPFA 4Y92A 1W6XA 1JO8A 2EPDA 1LCKA 4HCKA 2BZYA 5HCKA 1BK2A 3JV3A 2DM1A 1T0JA 2M0YA 4LNPA 2FPDA 3H0FA 4J9IA 1U5SA 2JMAA 1M3BA 3VS5A 4EIKA 2CH4W 1UFFA 1EFNA 2PTKA 1I07A 4J9CA 1E6HA 3I9QA 2CT4A 1X2QA 3PE0A 4AFQC 1X27A 4DEXA 1CKAA 2ED0A 2DRMA 4GBQA 2OI3A 3RNJA 2ECZA 1MUZA 1RUWA 1UE9A 2QDLA 3SHWA 2JXBA 2KYMA 2BTTA 2FRYA 2J6KA 2KXCA 2RPNA 3REAB 2K9GA 1OV3A 1AWJA 1WLPB 1AOJA 1WXBA 2DVJA 2M51A 1GRIA 2X3WD 4OMNA 1JQQA 1HJDA 2CT3A 1SEMA 2KRNA 4WCIA 2K3BA 1J3TA 3ZL7C 1YCSB 2KR3A 3RBBB 1KSWA 2EQIA 1T3LA 2EBPA 2DF6A 5I22A 3EG2A 2LNHB 1NEGA 2KGTA 2L3PA 5GJWB 2CSIA 2AK5A 2JTEA 1SRLA 1UHFA 2MIOA 2W10A 1YN8A 5ECAA 3VS7A 3IQLA 1BU1A 2CREA 2GQIA 2AZSA 1ABQA 1NYGA 1SSHA 1Z9ZA 5IXFA 3UA7A 5IXBA 3VRYA 1GFCA 2JMCA 2KXDA 2K6DA 2ROTA 2L3SA 1B07A 1K76A 2BZ8A 2AKKA 3VS4A 1TG0A 2HSPA 2X3XD 2GBQA 3NHNA 2P4RA 3VRZA 2L2PA 1AZEA 2GNCA 3TSZA 1PNJA 2A08A 4F16A 1QCFA 4IIOA 2YSQA 2RMOA 1G2BA 2V1QA 2RQUA 1I1JA 2CUDA 3I5SA 3REBB 2FO0A 3R6NA 2K79A 1M8MA 4RTZA 2EW3A 2FPEA 4ZNXA 2KEAA 2VKNA 1VYUA 2EYXA 4JJCA 3C0CA 1S1NA 2KT8A 1K0SA 4RTTA 1WIEA 1MV0B 1YP5A 2VVKA 1X2KA 3H41A 4J9GA 2NWMA 1JEGA 3KFVA 4A63B 1PWTA 1RI9A 1ZUYA 2J05A 4LUEA 3PVLA 2DNUA 2GTOA 2F2WA 4CC4B 2ESWA 2ABLA 2L3QA 2DL4A 4J9DA 4AFZC 4HVWA 2KROA 1Y0MA 1UDLA 2HCKA 2KYBA 1E7OA 1QLYA 2GGRA 1WXUA 2A28A 3VS0A 1JXOA 1UHCA 1KIKA 1ZUUA 4JZ3A 3M0SA 2JM9A 1ZLMA 2DBMA 2EGCA 2DA9A 4AFUC 2EKHA 1ZX6A 2DL5A 1NM7A 3QWXX 3EGUA 1T0HA 1WDXA 1HD3A 4QT7A 1FMKA 1OOTA 4LN2A 1CSKA 4M4ZA 4J9FA 2EGAA 2J7IA 2KRSA 2DJQA 2O88A 2FEIA 1OPLA 2J06A 1UJYA 1OEBA 5IHNA 1H3HA 1TUCA 2SRCA 4OMOA 1M27C 2DL7A 2DLPA 2YUOA 3VS2A 2KE9A 2DE0X 2OJ2A 1QKXA 4JJBA 2DILA 4ORZA 2D8HA 1ZSGA 4AG2C 2LCSA 1I0CA 4Z88A 4X1VA 1K9AA 2JW4A 3H0IA 1AVZC 4CC7A 2LZ6B 2E5KA 1PRMC 2O2OA 3ULRB 2EGEA 2ENMA 4J9HA 3VS6A 1U3OA 4J9BA 2J6FA 3EHQA 5FWBA 2K2MA 1X6GA 1WX6A 2KBTA 1K1ZA 2LQWA 2C0TA 1AZGB 1WA7A 5L23A 1GCPA 4J9EA 2I0NA 1YNZA 2RQVA 2DYBA 2W0ZA 2YT6A 1TUDA 2EVRA 1RLQC 2YUPA 4CC2A 1PHTA 1KJWA 1M3CA 2KT1A 2RF0A 2O9SA 3EG0A 1SPKA 4OMLA 4E6RA 2DBKA 1A0NB 1Y57A 3NGPA 2PZ1A 2HDAA 4LE9A 4AG1C 4RTXA 2IIMA 1QWFA 1NYFA 3TVTA 2FPFA 2RN8A 1UTIA 1QKWA 2BZXA 2DL8A 3M0TA 1KFZA 3O5ZA 3H0HA 1GCQA 2YUQA 2D0NA 2D8JA 2AZVA 1U06A 2JM8A 2LJ0A 5IH2A 3THKA 2LJ1A 1WYXA 1BBZA 2H8HA 1VYVA 4RTWA 5I11A 2DRKA 3GBQA 1AEYA 4OMMA 3LH5A 1PKSA 2DMOA 4Z8AA 3I5RA 2GTJA 2C0OA 1UG1A 2XMFA 1JXMA 4RTUA 2VWFA 2OAWA 1B3QA 2JS0A 1UJ0A 2SEMA 1T3SA 1X69A 1H8KA 2HEQA 4OMQA 1WFWA 1CKBA 2G6FX 2K7AA 2CUBA 1NG2A 2LX7A 2V1RA 3CQTA 4CC3A 1XOVA 4LUDA 5FWCA 3NMZC 1UUEA 1SHFA 2C0IA 2DX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZ4 A;  2CH4 A;  3TSW A;  2CDT A;  4HVV A;  2PNI A;  4HVU A;  1M30 A;  2RNA A;  1AD5 A;  2O9V A;  2ROL A;  4FSS A;  3U23 A;  1GL5 A;  1ZBJ A;  3EG1 A;  4RTV A;  2NUZ A;  2HBW A;  3M0Q A;  2RQT A;  2EYZ A;  4KRT A;  1V1C A;  1E6G A;  2DL3 A;  2RQR A;  1NLP C;  1AWW A;  1H92 A;  4JJD A;  1PKT A;  3FJ5 A;  2B86 A;  2FG0 A;  4IIM A;  4DEY A;  1PRL C;  4AFS C;  4D8D A;  1WI7 A;  2MOX A;  3PVQ A;  3VS3 A;  1W70 A;  4OMP A;  1SHG A;  5FW9 A;  1YWP A;  4D8K A;  3A98 A;  1ABO A;  3UA6 A;  1VA7 A;  1Z9Q A;  4RTY A;  1W1F A;  2LJ3 A;  1UGV A;  2A36 A;  4K11 A;  1N5Z A;  1GBQ A;  1X6B A;  1IO6 A;  3M0P A;  4F14 A;  4F17 A;  1M3A A;  5EC7 A;  2F2V A;  2YDL A;  3M0U A;  3I35 A;  4RUG A;  1GFD A;  3VS1 A;  3EHR A;  3QWY A;  1X43 A;  1ARK A;  2D1X A;  2J6O A;  5IHK A;  1WXT A;  1HSQ A;  5GJV B;  1MV3 A;  1BB9 A;  2LQN A;  2O31 A;  4R0K A;  1YWO A;  1VYT A;  2F2X A;  1UEC A;  1FYN A;  3SEM A;  1K4U S;  1NEB A;  4Z89 A;  2KRM A;  1ZUK A;  2EYY A;  2EYW A;  4GLM A;  1GBR A;  2A37 A;  1JU5 C;  2MCN A;  2YUN A;  1QWE A;  2KNB B;  5IHI A;  2JS2 A;  2FRW A;  2JT4 A;  2ED1 A;  4HXJ A;  2AKL A;  1SRM A;  1K0X A;  2LP5 A;  1AWO A;  1NLO C;  3UAT A;  3EG3 A;  1OPK A;  2L0A A;  1G83 A;  2CSQ A;  1AWX A;  3UF4 A;  4JPB W;  1GCQ C;  1RLP C;  3M0R A;  2LMJ A;  4ESR A;  2RQW A;  3NPF A;  4Y92 A;  1W6X A;  1JO8 A;  2EPD A;  1LCK A;  4HCK A;  2BZY A;  5HCK A;  1BK2 A;  3JV3 A;  2DM1 A;  1T0J A;  2M0Y A;  4LNP A;  2FPD A;  3H0F A;  4J9I A;  1U5S A;  2JMA A;  1M3B A;  3VS5 A;  4EIK A;  2CH4 W;  1UFF A;  1EFN A;  2PTK A;  1I07 A;  4J9C A;  1E6H A;  3I9Q A;  2CT4 A;  1X2Q A;  3PE0 A;  4AFQ C;  1X27 A;  4DEX A;  1CKA A;  2ED0 A;  2DRM A;  4GBQ A;  2OI3 A;  3RNJ A;  2ECZ A;  1MUZ A;  1RUW A;  1UE9 A;  2QDL A;  3SHW A;  2JXB A;  2KYM A;  2BTT A;  2FRY A;  2J6K A;  2KXC A;  2RPN A;  3REA B;  2K9G A;  1OV3 A;  1AWJ A;  1WLP B;  1AOJ A;  1WXB A;  2DVJ A;  2M51 A;  1GRI A;  2X3W D;  4OMN A;  1JQQ A;  1HJD A;  2CT3 A;  1SEM A;  2KRN A;  4WCI A;  2K3B A;  1J3T A;  3ZL7 C;  1YCS B;  2KR3 A;  3RBB B;  1KSW A;  2EQI A;  1T3L A;  2EBP A;  2DF6 A;  5I22 A;  3EG2 A;  2LNH B;  1NEG A;  2KGT A;  2L3P A;  5GJW B;  2CSI A;  2AK5 A;  2JTE A;  1SRL A;  1UHF A;  2MIO A;  2W10 A;  1YN8 A;  5ECA A;  3VS7 A;  3IQL A;  1BU1 A;  2CRE A;  2GQI A;  2AZS A;  1ABQ A;  1NYG A;  1SSH A;  1Z9Z A;  5IXF A;  3UA7 A;  5IXB A;  3VRY A;  1GFC A;  2JMC A;  2KXD A;  2K6D A;  2ROT A;  2L3S A;  1B07 A;  1K76 A;  2BZ8 A;  2AKK A;  3VS4 A;  1TG0 A;  2HSP A;  2X3X D;  2GBQ A;  3NHN A;  2P4R A;  3VRZ A;  2L2P A;  1AZE A;  2GNC A;  3TSZ A;  1PNJ A;  2A08 A;  4F16 A;  1QCF A;  4IIO A;  2YSQ A;  2RMO A;  1G2B A;  2V1Q A;  2RQU A;  1I1J A;  2CUD A;  3I5S A;  3REB B;  2FO0 A;  3R6N A;  2K79 A;  1M8M A;  4RTZ A;  2EW3 A;  2FPE A;  4ZNX A;  2KEA A;  2VKN A;  1VYU A;  2EYX A;  4JJC A;  3C0C A;  1S1N A;  2KT8 A;  1K0S A;  4RTT A;  1WIE A;  1MV0 B;  1YP5 A;  2VVK A;  1X2K A;  3H41 A;  4J9G A;  2NWM A;  1JEG A;  3KFV A;  4A63 B;  1PWT A;  1RI9 A;  1ZUY A;  2J05 A;  4LUE A;  3PVL A;  2DNU A;  2GTO A;  2F2W A;  4CC4 B;  2ESW A;  2ABL A;  2L3Q A;  2DL4 A;  4J9D A;  4AFZ C;  4HVW A;  2KRO A;  1Y0M A;  1UDL A;  2HCK A;  2KYB A;  1E7O A;  1QLY A;  2GGR A;  1WXU A;  2A28 A;  3VS0 A;  1JXO A;  1UHC A;  1KIK A;  1ZUU A;  4JZ3 A;  3M0S A;  2JM9 A;  1ZLM A;  2DBM A;  2EGC A;  2DA9 A;  4AFU C;  2EKH A;  1ZX6 A;  2DL5 A;  1NM7 A;  3QWX X;  3EGU A;  1T0H A;  1WDX A;  1HD3 A;  4QT7 A;  1FMK A;  1OOT A;  4LN2 A;  1CSK A;  4M4Z A;  4J9F A;  2EGA A;  2J7I A;  2KRS A;  2DJQ A;  2O88 A;  2FEI A;  1OPL A;  2J06 A;  1UJY A;  1OEB A;  5IHN A;  1H3H A;  1TUC A;  2SRC A;  4OMO A;  1M27 C;  2DL7 A;  2DLP A;  2YUO A;  3VS2 A;  2KE9 A;  2DE0 X;  2OJ2 A;  1QKX A;  4JJB A;  2DIL A;  4ORZ A;  2D8H A;  1ZSG A;  4AG2 C;  2LCS A;  1I0C A;  4Z88 A;  4X1V A;  1K9A A;  2JW4 A;  3H0I A;  1AVZ C;  4CC7 A;  2LZ6 B;  2E5K A;  1PRM C;  2O2O A;  3ULR B;  2EGE A;  2ENM A;  4J9H A;  3VS6 A;  1U3O A;  4J9B A;  2J6F A;  3EHQ A;  5FWB A;  2K2M A;  1X6G A;  1WX6 A;  2KBT A;  1K1Z A;  2LQW A;  2C0T A;  1AZG B;  1WA7 A;  5L23 A;  1GCP A;  4J9E A;  2I0N A;  1YNZ A;  2RQV A;  2DYB A;  2W0Z A;  2YT6 A;  1TUD A;  2EVR A;  1RLQ C;  2YUP A;  4CC2 A;  1PHT A;  1KJW A;  1M3C A;  2KT1 A;  2RF0 A;  2O9S A;  3EG0 A;  1SPK A;  4OML A;  4E6R A;  2DBK A;  1A0N B;  1Y57 A;  3NGP A;  2PZ1 A;  2HDA A;  4LE9 A;  4AG1 C;  4RTX A;  2IIM A;  1QWF A;  1NYF A;  3TVT A;  2FPF A;  2RN8 A;  1UTI A;  1QKW A;  2BZX A;  2DL8 A;  3M0T A;  1KFZ A;  3O5Z A;  3H0H A;  1GCQ A;  2YUQ A;  2D0N A;  2D8J A;  2AZV A;  1U06 A;  2JM8 A;  2LJ0 A;  5IH2 A;  3THK A;  2LJ1 A;  1WYX A;  1BBZ A;  2H8H A;  1VYV A;  4RTW A;  5I11 A;  2DRK A;  3GBQ A;  1AEY A;  4OMM A;  3LH5 A;  1PKS A;  2DMO A;  4Z8A A;  3I5R A;  2GTJ A;  2C0O A;  1UG1 A;  2XMF A;  1JXM A;  4RTU A;  2VWF A;  2OAW A;  1B3Q A;  2JS0 A;  1UJ0 A;  2SEM A;  1T3S A;  1X69 A;  1H8K A;  2HEQ A;  4OMQ A;  1WFW A;  1CKB A;  2G6F X;  2K7A A;  2CUB A;  1NG2 A;  2LX7 A;  2V1R A;  3CQT A;  4CC3 A;  1XOV A;  4LUD A;  5FWC A;  3NMZ C;  1UUE A;  1SHF A;  2C0I A;  2DX1 A; 
#chains in the Genus database with same CATH topology
 5GAN 6;  5KYX B;  2CH4 A;  3INZ A;  3V7S A;  4E7I A;  3M5A A;  4HVV A;  2NUP A;  3OS1 A;  3L2W A;  4MZT A;  3CCE Q;  1M30 A;  4C8Q B;  1K73 U;  3C4S A;  3EGX B;  1ZBJ A;  3EG1 A;  4C5H A;  1KQS A;  1K8A R;  3GNG A;  3OMC A;  2NUZ A;  1KQ2 A;  3PGG A;  3E19 A;  1QCO A;  1NLP C;  1Y7X A;  4XTW A;  1TU0 B;  1M1K C;  5FU6 B;  2GQV A;  2DIG A;  4DEY A;  3CCV T;  2XDB A;  4AFS C;  4D8D A;  2MOX A;  3QUI A;  2D9T A;  1IB8 A;  3VS3 A;  1IRE B;  1Q82 R;  1NPP A;  3JCM b;  3MP6 A;  3ZEH A;  3UA6 A;  4M78 B;  1VA7 A;  1N5Z A;  1GBQ A;  3HKS A;  1VQP A;  2HQX A;  4F17 A;  4C8Q D;  3QDF A;  2F69 A;  2XID A;  2DYI A;  5EC7 A;  2OTL Q;  1VQ7 A;  1VUB A;  1XJW B;  3V8J A;  2GFU A;  2MAM A;  5FU7 B;  2D1X A;  1WXT A;  1LVK A;  3GP8 A;  1MV3 A;  2O31 A;  4LD6 A;  1VYT A;  4JUV A;  1UEC A;  1K4U S;  3RIR A;  1RAA B;  4EDU A;  3QZ9 B;  2E6N A;  5GMK j;  2KRM A;  2ZAE A;  2EYY A;  2M9U A;  1YCY A;  2E4H A;  2RD1 A;  1GBR A;  2A37 A;  1JU5 C;  2RI5 A;  1QVF P;  4C92 G;  1QWE A;  2KNB B;  4M78 D;  4TVR A;  2A3L A;  4FYV B;  1RAF B;  2YRV A;  3SWN A;  3JB9 D;  1EIF A;  2ED1 A;  3CCU A;  3RKY A;  4M77 G;  2V8K A;  2K3X A;  1OU8 A;  3HFN A;  4LDW A;  2LVM A;  1K8A U;  2X4Y A;  1GCQ C;  5IT9 E;  3FLG A;  2CZ0 B;  1YJ9 A;  4Y92 A;  4QVC A;  2O4X A;  1JO8 A;  2EPD A;  3G1J A;  4HCK A;  5D7U A;  1OQK A;  3ZFJ A;  4Z02 A;  1T0J A;  4C5I A;  4FU6 A;  3QHS A;  4LNP A;  4OB0 B;  2QTV A;  1Q95 G;  3H0F A;  4J9I A;  1VQL T;  2VB6 A;  1YI2 A;  1YJN Q;  4Q5W A;  1M3B A;  1UFF A;  1I07 A;  2XD0 A;  3CC7 A;  1NBE B;  2XIC A;  1X2Q A;  4A4H A;  4AFQ C;  1H3Z A;  3C94 A;  1CKA A;  3X24 B;  4GBQ A;  2ECZ A;  2FB7 A;  5KCO A;  3I56 Q;  3OYH A;  1RUW A;  3OY9 A;  1UE9 A;  2QDL A;  3GOX A;  4XAX B;  2KYM A;  3JRZ A;  1XQH A;  2J6K A;  1M4Z A;  3FDR A;  2RPN A;  1VQ5 T;  4D6W A;  3ER0 A;  1AWJ A;  2DER A;  3L1A A;  1WXB A;  2QG9 B;  2DVJ A;  3LX7 A;  2X3W D;  5CKE A;  4PJO F;  2ATC B;  1FXX A;  4E7S A;  3A8G B;  1J3T A;  2QQ9 A;  1VIE A;  2EAY A;  3RBB B;  2EJG A;  2FHD A;  2H3E B;  4E7K A;  2DF6 A;  2E5Q A;  4PL6 A;  2DEU A;  3EG2 A;  5GMK m;  4FIB A;  3JCM X;  1NEG A;  1OI1 A;  1M1K U;  1WHG A;  1MHN A;  2CSI A;  2VAS A;  2DD4 A;  2E3H A;  1UHF A;  1YN8 A;  4PFO A;  5ECA A;  1BU1 A;  1ABQ A;  1NYG A;  1SSH A;  1Z9Z A;  3G7Z A;  3VU3 C;  1G5V A;  1GFC A;  2JMC A;  2KXD A;  2K6D A;  4C8Q G;  3C12 A;  1K76 A;  2BZ8 A;  2AKK A;  2E6Z A;  1BIB A;  2R57 A;  3NHN A;  2GBQ A;  2PUK B;  4PFP A;  3UPU A;  1Y71 A;  2ZPF B;  1BCM A;  2AIR B;  3QXE B;  4QQD A;  4C0D C;  2MK5 A;  1PNJ A;  1QCF A;  4EMH A;  1D1A A;  2RHX A;  1KQS P;  1VQK Q;  2EYQ A;  2RHU A;  1QP2 A;  4M75 E;  2FO0 A;  1D1B A;  3R6N A;  3NTK A;  4OF1 A;  2ZCF B;  4NOY A;  1M2O A;  2EW3 A;  2XU8 A;  3S3O A;  4ZNX A;  2OTL A;  1VYU A;  4JJC A;  5CKB A;  1S1N A;  2KAF A;  2KT8 A;  2L89 A;  4M78 G;  3X20 B;  2LCC A;  1WIE A;  2VXF A;  3JB9 G;  3A5Z B;  3CD6 Q;  4XU3 A;  1LPL A;  4IUP A;  5IAY A;  2CP2 A;  1YIJ Q;  5CK9 A;  1QW1 A;  3KFV A;  1PWT A;  3PVL A;  2DNU A;  1IXD A;  2BUD A;  1XTD A;  2ESW A;  4XU1 A;  2ABL A;  3OMG A;  2KRO A;  2Z0W A;  2YLC A;  8AT1 B;  1PSF A;  1UDL A;  4M75 F;  3RMQ A;  4LDY A;  3I55 Q;  1E7O A;  3CCM T;  1OZ2 A;  3LGF A;  1QLY A;  2GGR A;  1WXU A;  1BKB A;  3EFS A;  1JXO A;  3PT9 A;  4JZ3 A;  2QYZ A;  2A0F B;  3CC4 Q;  2DBM A;  3V7C A;  1WHM A;  3EGU A;  3JCM Q;  1I5L A;  1G8X A;  4ME7 A;  5KE2 A;  1O9S A;  2FYK A;  4MDX A;  1HD3 A;  2YRD A;  4F7U G;  4M7D F;  3SDZ A;  3MP1 A;  2R5M A;  3VKI A;  4FW2 A;  4DBQ A;  1OOT A;  2XDP A;  1CSK A;  1C0M A;  2EQJ A;  2EGA A;  1H64 1;  1YJN A;  5GAO p;  1TUC A;  2FVU A;  3PMI A;  1YHQ Q;  5A2Q E;  2YUO A;  2KE9 A;  2IPO B;  2DJZ A;  3I56 A;  4JJB A;  1KHI A;  3V8K A;  4ORZ A;  2IVW A;  3CC2 Q;  5KYN A;  4C0D B;  4Z88 A;  1VQ9 T;  1AVZ C;  5HK3 A;  2E5K A;  2PVO B;  2JZ2 A;  2ENM A;  2K5F A;  3EFO B;  1OU9 A;  2J6F A;  5FWB A;  3OYB A;  1PSE A;  1MND A;  1X6G A;  5FRN A;  1WX6 A;  4L59 A;  1K1Z A;  1WPY A;  1Y96 B;  1D3B A;  5KYY A;  2OTJ T;  1IGQ A;  1JB0 E;  4ZTF A;  3G4S Q;  1ZSZ A;  1YNZ A;  4C92 C;  5KYU B;  2RQV A;  2H3J A;  1WZO A;  1DJ7 B;  1UGQ B;  3HHT B;  2O01 E;  4FYW B;  1KJW A;  4M77 C;  2GF7 A;  1VQM T;  2RF0 A;  2RHZ A;  2DVE A;  4KH1 B;  3D7S B;  1SPK A;  4NL3 A;  3E2U A;  3NGP A;  4RTX A;  5GAO l;  5LJ5 g;  2FPF A;  1UTI A;  2C06 A;  1QKW A;  4BB7 A;  2DXB A;  4OB3 B;  3FJP A;  2V8J A;  1WJS A;  2D0N A;  2VXE A;  4C92 E;  1VQK A;  1U06 A;  5D6X A;  3J7A F;  2XI9 A;  2JM8 A;  4A4E A;  1WJR A;  4OB1 B;  3QG1 A;  5IH2 A;  2LJ1 A;  3R6O A;  4M77 E;  2DD5 A;  2H8H A;  3PIO A;  5I11 A;  1AEY A;  4PKC C;  1JJ2 A;  4J5Y A;  2DMO A;  2GTJ A;  3GF5 A;  3UDC A;  4BE2 A;  4QKU A;  1YIJ A;  1B3Q A;  2HEQ A;  4MZM A;  4LXC A;  2CUB A;  5FLX E;  1NG2 A;  2XK0 A;  1WHK A;  5LJ3 f;  3I55 A;  2C0I A;  2RJE A;  4JZ4 A;  3S3N A;  4HCZ A;  2PNI A;  1QCN A;  3G6E Q;  4HVU A;  3JCM V;  4ZGE B;  2WSF E;  3CC4 A;  2DAQ A;  2QA4 Q;  1AD5 A;  2O9V A;  5A0L A;  1WQW A;  4DOV A;  3A8O B;  5GAM d;  1D0Y A;  3M57 A;  1Q81 C;  4M7A A;  4KRT A;  4MZP A;  3OQ5 A;  2DL3 A;  4JRQ A;  3AHU A;  1H92 A;  3NFC A;  2WAC A;  3FJ5 A;  2QQR A;  1VQO Q;  2HNI A;  1VQ6 T;  1PRL C;  1JBM A;  4C92 B;  5CVI A;  3PVQ A;  1W70 A;  4D8K A;  2FZC B;  1WQ7 A;  3JSC A;  4RTY A;  2L8D A;  1UGV A;  2LJ3 A;  2QGG A;  4J8O A;  4PLI A;  5KYY B;  4M77 B;  5DY9 A;  4L6V 5;  1IO6 A;  5CIU A;  4F04 B;  4PJJ A;  1M9S A;  1M3A A;  2RM4 A;  3QYG B;  2F2V A;  4PJL A;  1VQ8 T;  3I35 A;  4RUG A;  5LL6 S;  3BE3 A;  4CI0 C;  3VS1 A;  3CC2 A;  1PCX A;  3EHR A;  3QWY A;  4EMK A;  1X43 A;  2KMT A;  5IHK A;  4DQ2 A;  2NLU A;  5CO7 A;  1BB9 A;  1D0X A;  1YWO A;  2F2X A;  3SB2 A;  3MKD A;  1FYN A;  2RK2 A;  1TUG B;  1NEB A;  5A0D A;  4C92 D;  4Z89 A;  2EYW A;  3NTI A;  3Q1J A;  2MCN A;  4FL6 A;  2E3I A;  7AT1 B;  3CCS T;  3G4S A;  4FYX B;  2JS2 A;  3ASK A;  4M77 D;  3MO8 A;  2JN0 A;  1QVG A;  4JS4 A;  2XDD A;  2JT4 A;  2QEX T;  3CME Q;  2AKL A;  3UWN A;  3MCA B;  3H9N A;  4C8Q F;  3EG3 A;  2MF2 A;  2CSQ A;  4BUG A;  1AWX A;  3CBO A;  5GAN f;  4QVD A;  3M0R A;  2E10 A;  3M56 A;  2RQW A;  3NPF A;  1JRI A;  2YLB A;  4DOW A;  1LCK A;  5HCK A;  1PD1 A;  3OA6 A;  3JCM g;  2ZPE B;  2MMP A;  1Q82 C;  1MMA A;  1OX9 A;  1PM3 A;  1VQ4 T;  2FPD A;  2DEQ A;  2DXC A;  2WSC E;  2JMA A;  2QAZ A;  3VS5 A;  3UT1 A;  2CH4 W;  4QW2 A;  4DBR A;  1KHC A;  3PNW C;  2CT4 A;  4M78 F;  4LDV A;  5GAM h;  1VOM A;  1D0Z A;  3JB9 F;  5D6Y A;  1R8O B;  3NTH A;  5C6S A;  3SHW A;  2VGM A;  2FRY A;  4ZGD B;  3H6Z A;  1OV3 A;  3JCM f;  4EPC A;  2RHY A;  3P8D A;  3CCL Q;  4F7U E;  1WNL A;  1TTH B;  2M51 A;  1JQQ A;  1HJD A;  1SEM A;  2ZGW A;  3CCQ Q;  3FRN A;  5GAM e;  2IG0 A;  1Q81 U;  2EWN A;  2DK3 A;  5KYW A;  2L3P A;  5GJW B;  4FW1 A;  1V76 A;  4BDZ A;  1JJ2 P;  5GMK l;  2LQ8 A;  3G6E A;  4JRK A;  2XKO C;  1KK7 A;  3QSU A;  2QA4 A;  2CRE A;  2GQI A;  4MML A;  3OS5 A;  1P92 A;  2JOY A;  4XQ3 A;  3QJY A;  1X01 A;  4JLI A;  1N27 A;  3BDL A;  1KC8 C;  2RA2 A;  1B07 A;  1LOJ A;  5CQY A;  1TG0 A;  2HSP A;  4BI3 A;  1VQO A;  2JUF A;  3VRZ A;  4O5V A;  2X4X A;  1SKU B;  2GNC A;  2E1H A;  1TS9 A;  5DLQ E;  4FM4 B;  2DZ9 A;  1G3T A;  3PTA A;  4IIO A;  3I5S A;  4HA8 A;  1RAC B;  1M2V B;  2FPE A;  1VQN Q;  1VIF A;  4J7I A;  2KEA A;  2VKN A;  4N4G A;  4PJO A;  2CZ6 B;  4RTT A;  1MV0 B;  4F7U B;  3M4G A;  4OMF B;  3EG9 A;  2YHT A;  3BDU A;  4E7J A;  2E70 A;  3GPL A;  2F5T X;  2K57 A;  1ZUY A;  1RI9 A;  1R0C B;  4LDU A;  2X9H A;  3SWN C;  2AHJ B;  2F2W A;  1RL2 A;  4CC4 B;  2L3Q A;  4J9D A;  2DL4 A;  4AFZ C;  4HVW A;  4AMC A;  1KC8 R;  3CCR T;  2KVQ G;  3F70 A;  1R77 A;  3JCM J;  4ZTJ A;  2JJ9 A;  2CP3 A;  2MWP A;  3VS0 A;  4A4K A;  1Q82 U;  1B7T A;  3CME A;  1VQP T;  5FRM A;  2JM9 A;  1U1T A;  1U8R A;  1KQ1 A;  3OS2 A;  1VQM Q;  4KGV B;  2NUT A;  2YWW A;  2DA9 A;  1VQ7 T;  4AFU C;  4JRI A;  1ZX6 A;  2DFU A;  2NUP B;  3QWX X;  5GAM g;  1I81 A;  2R5A A;  5AYF A;  1TOV A;  2PU9 B;  3EAE A;  1F1B B;  5LJ3 d;  4JRP A;  1NPR A;  2F5K A;  1QVG P;  3BY7 A;  3QZ5 B;  4FYY B;  2LX9 A;  2FEI A;  2I2L A;  2J06 A;  1UJY A;  5IHN A;  2SRC A;  1M27 C;  3G71 Q;  4BAC A;  3CCU T;  2CKK A;  5GAM j;  1QKX A;  2A7Y A;  2DIL A;  1K9M R;  4E47 A;  3CCE A;  3L2U A;  3SFM A;  3MEA A;  2D8H A;  4AG2 C;  5A0G A;  2Y4Y A;  3CCL A;  2EIF A;  4X1V A;  4M75 A;  4R56 A;  4X9C A;  3PIP A;  2COZ A;  3MP8 A;  1N8R R;  3CCQ A;  1Q7Y R;  4J9H A;  3E9F A;  2V8I A;  3VS6 A;  1IZ6 A;  1UEB A;  2QQB A;  4B6M A;  1KC8 U;  2KBT A;  1FWZ A;  1YI2 T;  4E7L A;  1AZG B;  1QP3 A;  1GCP A;  3CC7 T;  4LD9 K;  2RK1 A;  1FX7 A;  1TUD A;  1S72 Q;  4J83 A;  4M7D A;  5HK0 A;  1RLQ C;  2YUP A;  4CC2 A;  2V26 A;  3DB3 A;  1M3C A;  5GAN 3;  3SWN B;  3A8H B;  3EG0 A;  4OGC A;  4ZN1 A;  4DBF A;  4OML A;  1A0N B;  1Y57 A;  4LE9 A;  4AG1 C;  4BE1 A;  1NYF A;  2NYS A;  3OW2 S;  4J6W A;  1Q86 R;  1YBY A;  3RER A;  2ZZD A;  2RN8 A;  3CXC S;  1RAD B;  4MDW A;  1V29 B;  2O4X B;  3A8M B;  3O5Z A;  2EQM A;  2BE7 D;  3LW5 E;  3CPW S;  2LJ0 A;  4BI8 B;  4HCB A;  2FZG B;  1VQN A;  1VQ8 Q;  5GAN d;  3OW2 A;  1BBZ A;  2E65 A;  5J3B A;  1VYV A;  4RTW A;  2DRK A;  1BI2 A;  2FZK B;  3GBQ A;  1HXD A;  1YJW Q;  1PKS A;  4RKU E;  5LJ3 h;  3CCJ Q;  1UG1 A;  1JXM A;  2VWF A;  2LQK A;  4JLG A;  3CMA Q;  1M1F A;  1H8K A;  4OMQ A;  1SSF A;  2KY9 A;  2LT1 A;  1CKB A;  1Y07 A;  3CPF A;  2K7A A;  1EZZ B;  3CQT A;  5FWC A;  1RAG B;  2RO0 A;  1SHF A;  4KH0 B;  3KUF A;  1KG1 A;  3P8B B;  1UGP B;  4FT4 A;  4Y91 A;  3OYC A;  2QEX Q;  4DBH A;  3M59 A;  2K2V A;  3M53 A;  2VC8 A;  1GXI E;  2OTL T;  2ROL A;  4FSS A;  3U23 A;  1M90 R;  2HL5 C;  4RTV A;  3WVE B;  2RQT A;  1E6G A;  1ZQ1 A;  1VQ4 Q;  1YIT Q;  4IIM A;  3HSB A;  1MMD A;  5CCA A;  2X4W A;  4XU0 A;  4OMP A;  5FW9 A;  1SHG A;  5J26 A;  3X25 B;  1IHW A;  3OYE A;  2A36 A;  4K11 A;  1QMC A;  1NJI C;  3OS0 A;  3G71 A;  1X6B A;  2PQW A;  4B9X A;  2GCX A;  2MPX C;  3M0P A;  4F14 A;  2CGH A;  1BI3 A;  1HK9 A;  3M9Q A;  4ZN3 A;  3M0U A;  1GFD A;  5AT1 B;  2KI7 A;  5KH6 A;  2CS7 A;  4IUQ A;  1HYO A;  1KD1 C;  2RJF A;  1ZSZ C;  4KT0 E;  2LQN A;  4R0K A;  3SEM A;  3MJX A;  2ZPI B;  3QYH B;  4P5N A;  3CCV Q;  4GLM A;  1YJN T;  4KUL A;  2YUN A;  4L5G A;  5GAN h;  5CKH A;  1MNE A;  3VYH B;  2FRW A;  1G3W A;  2VYT A;  1S72 A;  1RAB B;  3I56 T;  3MET A;  3QDR B;  1AWO A;  3UAT A;  3EGD A;  1LJO A;  2L0A A;  1TSF A;  2QXF A;  4JPB W;  3UF4 A;  1NJI R;  1ZBX A;  3P8H A;  1RLP C;  2DTO A;  4X9D A;  4ESR A;  2LMJ A;  4XU2 A;  1W6X A;  3CD6 A;  3MEW A;  1BCO A;  3SD4 A;  5C0M A;  5LJ5 f;  2DM1 A;  5GAO n;  1OUL A;  1B34 A;  2M0Y A;  3KBG A;  1KD1 R;  4C92 F;  1C1A A;  1QVP A;  1EFN A;  4J9C A;  2MI6 A;  1PD0 A;  3I9Q A;  4II1 A;  3PE0 A;  3MEU A;  1ZA1 B;  2ED0 A;  3TCJ A;  2DRM A;  4M77 F;  1MUZ A;  2EQU A;  4RG8 A;  2CZ7 B;  1YJW A;  6AT1 B;  2KXC A;  1OX8 A;  2K9G A;  3CCJ A;  1WLP B;  5LJ3 j;  3TU4 K;  3CMA A;  4BE0 A;  4OMN A;  1QVF S;  2CT3 A;  2KRN A;  4WCI A;  3CCR Q;  3DKM A;  4C0Z A;  3ZL7 C;  5KYX A;  2KR3 A;  4XK8 E;  1KSW A;  2EQI A;  2HL3 A;  5D6W A;  2EBP A;  5I22 A;  3VUB A;  4A4G A;  1VQL Q;  4IUT A;  4C8Q A;  1VQK T;  2QEX A;  3EGX A;  2E41 A;  3OYM A;  3S6W A;  4N0A A;  4M7A C;  4JS5 A;  2JTE A;  3M55 A;  4PK4 A;  1TXQ A;  1YHQ A;  2RH2 A;  1QVF A;  2MIO A;  1D3B B;  2W10 A;  2AZS A;  2JNG A;  2DXU A;  1ZSZ B;  3OYY A;  3VV0 A;  1VQ5 Q;  3UA7 A;  5IXB A;  4PNO A;  2M16 A;  1YIJ T;  2ROT A;  2L3S A;  1O75 A;  3CBM A;  2QQA A;  1U1S A;  2EKO A;  2P4R A;  2L5Q A;  2L2P A;  1YIT A;  2KK4 A;  4M78 A;  4FCY A;  3DB4 A;  2A08 A;  3RKX A;  5CAI A;  4M7A E;  3OBW A;  4WTO B;  3I55 T;  3CEY A;  2DTH A;  3JB9 I;  4EMK C;  2YSQ A;  4HKE A;  3T9N A;  1K73 R;  1G2B A;  2V1Q A;  2RQU A;  1I1J A;  3FB9 A;  2CUD A;  3REB B;  2CYZ B;  5CKD A;  3OYK A;  1M8M A;  2PVD B;  1TH7 A;  3WXM B;  4GY5 A;  3C0C A;  2HAX A;  5GAN 7;  3BW1 A;  3H41 A;  3QKJ A;  1OZ3 A;  2NWM A;  1AHJ B;  3OYD A;  5DLO A;  3J81 E;  4KGZ B;  4A63 B;  4LUE A;  3FC3 A;  4IUR A;  4C5G A;  3CCV A;  2LT4 A;  1Y0M A;  1QQJ A;  1MMG A;  2COY A;  5GAN j;  3JAM E;  1UHC A;  2K5L A;  3MHX A;  3HRS A;  4BY6 C;  3OSV A;  1ZLM A;  1WGS A;  2HSE B;  3OYG A;  2EJF A;  2EKH A;  2DL5 A;  1NM7 A;  1T0H A;  1SG5 A;  4E7H A;  1WDX A;  3QO3 A;  4QT7 A;  2HQE A;  3WVD B;  1KQS S;  4ELY C;  4M7A B;  4M4Z A;  4J9F A;  2LCL A;  2KRS A;  1OPL A;  2HBP A;  1NZ9 A;  3RMS A;  1OEB A;  4C0G A;  3CCM Q;  1R0B G;  4HT9 A;  4OMO A;  3G4S T;  2DL7 A;  2DLP A;  5CQX A;  3VS2 A;  2DE0 X;  3L2Z A;  1PC0 A;  4A4F A;  2QAS A;  4KUI A;  4N4I A;  2DXT A;  1ZSG A;  4KGX B;  1I0C A;  4QVZ A;  4F7U F;  2VV5 A;  2MWO A;  2JW4 A;  3H0I A;  5HKC A;  2HD0 A;  2LZ6 B;  1PRM C;  2KSS A;  3GLX A;  3ULR B;  3CCR A;  4EMK B;  2QDY B;  4RG2 A;  1U3O A;  2ZPG B;  3OYJ A;  4M7A D;  2K2M A;  2P0K A;  2BE9 B;  5KCH A;  1VQL A;  5I2M A;  3RUX A;  2C0T A;  1WA7 A;  4ZGJ B;  2DTI A;  3HFO A;  3L2R A;  5L23 A;  3EH1 A;  4OVA A;  2I0N A;  1XNI A;  1MMN A;  4PLL A;  2VGN A;  2YT6 A;  2DYB A;  2Y4X A;  1AT1 B;  3JCM P;  5I21 A;  2BKD N;  2RI3 A;  1PHT A;  2KT1 A;  1VQ5 A;  2X35 A;  1RI0 A;  4IKF A;  2O9S A;  3OB9 A;  2OAU A;  1PG5 B;  2COW A;  1VQ9 Q;  2HQH A;  3TVT A;  5FRO A;  2DL8 A;  4PJO C;  1M1K R;  1KFZ A;  3LWH A;  1GCQ A;  4BY6 B;  2JVV A;  3AT1 B;  4BDY A;  2OTJ Q;  3J80 E;  3VUZ A;  3G6E T;  1K9M C;  2RJD A;  1UB4 A;  4OGE A;  4OB2 B;  3THK A;  2LDM A;  2QA4 T;  3EH2 A;  3RDV A;  2RHI A;  3DLM A;  2F1L A;  4OMM A;  3LH5 A;  4A53 A;  5LJ5 d;  2C0O A;  4WF2 A;  1N8R C;  1Q7Y C;  4FSX A;  2JS0 A;  4JDS A;  1W2B S;  2YRC A;  2SEM A;  5CKF A;  1T3S A;  4PJO E;  1VQO T;  1N6A A;  1I5O B;  2G6F X;  3HL8 A;  3GIB A;  2LX7 A;  2V1R A;  3V8L A;  1XOV A;  4LUD A;  2P0P A;  2DX1 A;  5CR2 A;  2CZ1 B;  3TSW A;  2CDT A;  2YXY A;  1W2B A;  2VUB A;  2RNA A;  5KYW B;  1YFN A;  3VYG A;  1GL5 A;  3MEV A;  3JB9 J;  2X51 A;  5GAM f;  4X34 A;  2HBW A;  3LYI A;  2QI2 A;  3M0Q A;  2RB6 A;  1ZA2 B;  2EYZ A;  1V1C A;  1Q86 C;  3OYL A;  2PVG B;  2LRQ A;  2RQR A;  1RAE B;  2DZC A;  1AWW A;  4JJD A;  1PKT A;  1YJ9 T;  4ELZ C;  3L2Q A;  2B86 A;  2FG0 A;  5GAN 4;  4N4H A;  1N9S A;  1WI7 A;  1I4K 1;  2JTM A;  4OP0 A;  2FL7 A;  5I2S A;  1YWP A;  3A98 A;  3CCM A;  1ABO A;  4JJN K;  1Z9Q A;  1W1F A;  4HCC A;  3HP9 A;  4M7A G;  4M75 C;  3CME T;  4C0F A;  4QQ6 A;  3RR6 A;  2YDL A;  3C95 A;  1C6V X;  4MMK A;  2P4T A;  5GAN 2;  2QQS A;  1WHJ A;  1ARK A;  3EFO A;  2J6O A;  2XG8 D;  4PJO B;  1HSQ A;  5GJV B;  1Y96 A;  1M8V A;  1NE8 A;  3EG9 B;  1VQ6 Q;  2P84 A;  1TWB A;  4M7D C;  1OYX A;  5KYU A;  1ZUK A;  3JB9 H;  2K4Y A;  2AT1 B;  1BYM A;  1EX4 A;  2WSE E;  2EJ9 A;  3VJP A;  5IHI A;  4XTZ A;  1M90 C;  4R55 A;  1X6O A;  4HXJ A;  1SRM A;  1K0X A;  3M58 A;  3OYF A;  5LJ5 h;  2LP5 A;  4J6X A;  1NLO C;  1BI1 A;  3OYI A;  3CCE T;  1OPK A;  1G83 A;  3CXC A;  2E12 A;  1K9M U;  1IRX A;  3CCL T;  1VQ9 A;  2NUT B;  4PJO D;  2BZY A;  3CPW A;  4XTX A;  4M7D E;  1BK2 A;  3JV3 A;  3CCQ T;  3OYN A;  3L2V A;  5GAN 5;  2EFI A;  5LJ5 e;  1N8R U;  4E2F B;  2KDS A;  1Q7Y U;  4GLK A;  1U5S A;  4EIK A;  2OTJ A;  4A54 A;  2R58 A;  2ZPB B;  2PTK A;  4NS5 A;  4XTU A;  2Y90 A;  1E6H A;  2LTO A;  3CCS Q;  2MYS A;  4RCB A;  4DEX A;  1X27 A;  2QK0 A;  2HZY A;  2OI3 A;  3RNJ A;  2HKN A;  5LJ3 e;  3OYA A;  4PJN A;  2JXB A;  3MPU B;  2BTT A;  1VQM A;  2L3R A;  3JCM d;  3REA B;  4ATO A;  3HRU A;  1AOJ A;  4RMO A;  1FMV A;  1GRI A;  3H8Z A;  2K3B A;  1YCS B;  2K5I A;  1T3L A;  4M75 B;  5GMK i;  3S3M A;  1BI0 A;  5M9O A;  3LWI A;  1Q86 U;  5L8R E;  2LNH B;  4B9W A;  2KGT A;  3A1P A;  1ACM B;  3TEE A;  1WJQ A;  2JTF A;  3OSS C;  1IHV A;  3OBY A;  2AK5 A;  1SRL A;  3X26 B;  2GFA A;  3ZBD A;  1VQN T;  4DA4 A;  2DPP B;  3VS7 A;  3IQL A;  2DET A;  4C5E A;  3KXT A;  2P0Q A;  3FIF A;  2OX7 A;  5IXF A;  3VRY A;  2M0O A;  3QII A;  3GNF B;  4M7D B;  4C92 A;  3URG A;  3VS4 A;  2X3X D;  2M02 A;  4EMG A;  3M4Y A;  1AZE A;  5EG2 A;  1W2B P;  4KBM B;  3TSZ A;  4M77 A;  4M75 D;  4F16 A;  3LGL A;  1FMW A;  3QJ6 A;  3TRE A;  2RMO A;  4AT1 B;  2DO3 A;  1RAI B;  2K79 A;  1WHH A;  3CBP A;  4RTZ A;  2CP6 A;  4O6J A;  3LH0 A;  4E7Z A;  2EYX A;  2DKG A;  3PFS A;  1K0S A;  1YP5 A;  2VVK A;  1M90 U;  1X2K A;  4M7D D;  3TQ7 P;  4J9G A;  2PUO B;  1JEG A;  4V2S A;  4PJM A;  2J05 A;  1VQ6 A;  1JJ2 S;  2GTO A;  5GAN e;  4RCC A;  4PJO G;  2EQK A;  2HCK A;  2KYB A;  5LJ3 g;  3FEO A;  2A28 A;  3G71 T;  1KIK A;  3LLR A;  1ZUU A;  3M0S A;  3JCM h;  5J39 A;  2EGC A;  5LJ5 j;  1VQ8 A;  2KQW A;  3N5B B;  2G3R A;  8ATC B;  1D1C A;  5HY6 A;  3X28 B;  3JCM W;  3V7R A;  2E64 A;  4NL2 A;  1UGS B;  1FMK A;  5GAN 8;  3JCM e;  4J7F A;  4LN2 A;  1X75 C;  1RAH B;  5KE3 A;  1K73 C;  2J7I A;  2DJQ A;  2O88 A;  3E1S A;  1G3Y A;  1IGU A;  4YTL A;  2M1H A;  1H3H A;  3OW2 P;  3CCS A;  1WHL A;  3CXC P;  2HKQ B;  1S72 T;  1VQP Q;  3O8V A;  2D6F A;  9ATC B;  2OJ2 A;  3CPW P;  1MGQ A;  1VQ7 Q;  3BFM A;  2LCS A;  4C8Q C;  1G3S A;  3PMT A;  1K9A A;  5IN1 A;  3QPH A;  4N0A C;  1NJI U;  3CD6 T;  4HT8 A;  4CC7 A;  2B8A A;  2O2O A;  2EGE A;  4Y28 E;  1UGR B;  2K3Y A;  4J9B A;  2XHC A;  3EHQ A;  5GMK h;  1VQ4 A;  3L42 A;  4VUB A;  1D09 B;  5GAO q;  2LQW A;  5FU6 C;  4PFZ A;  4J9E A;  2D0Q B;  1W4S A;  4ANJ A;  3A8L B;  4QQG A;  3EFR A;  1KD1 U;  4M75 G;  2W0Z A;  4KUD K;  2EVR A;  3CCU Q;  4M78 C;  4C8Q E;  3CC4 T;  1YJW T;  4J6Y A;  4CRI A;  5GMK e;  3CCJ T;  3QBY A;  1QVG S;  5GAN g;  4E6R A;  2DBK A;  1YJ9 Q;  3EGD B;  3RKW A;  3ME9 A;  5GAO m;  1Q81 R;  3CMA T;  2PZ1 A;  1M1G A;  2HDA A;  2ZPH B;  2IIM A;  1QWF A;  3HRT A;  5FU7 C;  1LNX A;  4XTY A;  3HTR A;  2LC4 A;  4M7D G;  2BZX A;  4BI4 A;  3M0T A;  4XTV A;  3H0H A;  4M7A F;  3M54 A;  3HPW A;  1ZHI A;  1M2V A;  2YUQ A;  5GAO r;  2D8J A;  2AZV A;  3RES A;  1YI2 Q;  2CP7 A;  3E9G A;  3CC7 Q;  1K8A C;  1B34 B;  2LNV A;  2QGF B;  4BD3 A;  1YHQ T;  4M78 E;  4F7U A;  1WYX A;  2CP5 A;  1SF9 A;  1BIA A;  2DIQ A;  4FT2 A;  4LDX A;  4Z8A A;  3I5R A;  5DM7 R;  2XMF A;  3CC2 T;  1N9R A;  2HMA A;  4IUV A;  4RTU A;  2OAW A;  2BIV A;  1UJ0 A;  1M5Q 1;  2QTX A;  1X69 A;  1YIT T;  3JCM c;  1WFW A;  1I8F A;  4UC4 A;  4CC3 A;  4IUU A;  2CP0 A;  3NMZ C;  3DLL A;  2RI2 A;  1UUE A;  2RJC A;  2X4J A; 
#chains in the Genus database with same CATH homology
 4JZ4 A;  2CH4 A;  3TSW A;  2CDT A;  4HVV A;  2PNI A;  4HVU A;  1M30 A;  2RNA A;  1AD5 A;  2O9V A;  2ROL A;  4FSS A;  3U23 A;  1GL5 A;  1ZBJ A;  3EG1 A;  4RTV A;  2NUZ A;  2HBW A;  3M0Q A;  2RQT A;  2EYZ A;  4KRT A;  1V1C A;  1E6G A;  2DL3 A;  2RQR A;  1NLP C;  1AWW A;  1H92 A;  4JJD A;  1PKT A;  3FJ5 A;  2B86 A;  2FG0 A;  4IIM A;  4DEY A;  1PRL C;  4AFS C;  4D8D A;  1WI7 A;  2MOX A;  3PVQ A;  3VS3 A;  1W70 A;  4OMP A;  1SHG A;  5FW9 A;  1YWP A;  4D8K A;  3A98 A;  1ABO A;  3UA6 A;  1VA7 A;  1Z9Q A;  4RTY A;  1W1F A;  2LJ3 A;  1UGV A;  2A36 A;  4K11 A;  1N5Z A;  1GBQ A;  1X6B A;  1IO6 A;  3M0P A;  4F14 A;  4F17 A;  1M3A A;  5EC7 A;  2F2V A;  2YDL A;  3M0U A;  3I35 A;  4RUG A;  1GFD A;  3VS1 A;  3EHR A;  3QWY A;  1X43 A;  1ARK A;  2D1X A;  2J6O A;  5IHK A;  1WXT A;  1HSQ A;  5GJV B;  1MV3 A;  1BB9 A;  2LQN A;  2O31 A;  4R0K A;  1YWO A;  1VYT A;  2F2X A;  1UEC A;  1FYN A;  3SEM A;  1K4U S;  1NEB A;  4Z89 A;  2KRM A;  1ZUK A;  2EYY A;  2EYW A;  4GLM A;  1GBR A;  2A37 A;  1JU5 C;  2MCN A;  2YUN A;  1QWE A;  2KNB B;  5IHI A;  2JS2 A;  2FRW A;  2JT4 A;  2ED1 A;  4HXJ A;  2AKL A;  1SRM A;  1K0X A;  2LP5 A;  1AWO A;  1NLO C;  3UAT A;  3EG3 A;  1OPK A;  2L0A A;  1G83 A;  2CSQ A;  1AWX A;  3UF4 A;  4JPB W;  1GCQ C;  1RLP C;  3M0R A;  2LMJ A;  4ESR A;  2RQW A;  3NPF A;  4Y92 A;  1W6X A;  1JO8 A;  2EPD A;  1LCK A;  4HCK A;  2BZY A;  5HCK A;  1BK2 A;  3JV3 A;  2DM1 A;  1T0J A;  2M0Y A;  4LNP A;  2FPD A;  3H0F A;  4J9I A;  1U5S A;  2JMA A;  1M3B A;  3VS5 A;  4EIK A;  2CH4 W;  1UFF A;  1EFN A;  2PTK A;  1I07 A;  4J9C A;  1E6H A;  3I9Q A;  2CT4 A;  1X2Q A;  3PE0 A;  4AFQ C;  1X27 A;  4DEX A;  1CKA A;  2ED0 A;  2DRM A;  4GBQ A;  2OI3 A;  3RNJ A;  2ECZ A;  1MUZ A;  1RUW A;  1UE9 A;  2QDL A;  3SHW A;  2JXB A;  2KYM A;  2BTT A;  2FRY A;  2J6K A;  2KXC A;  2RPN A;  3REA B;  2K9G A;  1OV3 A;  1AWJ A;  1WLP B;  1AOJ A;  1WXB A;  2DVJ A;  2M51 A;  1GRI A;  2X3W D;  4OMN A;  1JQQ A;  1HJD A;  2CT3 A;  1SEM A;  2KRN A;  4WCI A;  2K3B A;  1J3T A;  3ZL7 C;  1YCS B;  2KR3 A;  3RBB B;  1KSW A;  2EQI A;  1T3L A;  2EBP A;  2DF6 A;  5I22 A;  3EG2 A;  2LNH B;  1NEG A;  2KGT A;  2L3P A;  5GJW B;  2CSI A;  2AK5 A;  2JTE A;  1SRL A;  1UHF A;  2MIO A;  2W10 A;  1YN8 A;  5ECA A;  3VS7 A;  3IQL A;  1BU1 A;  2CRE A;  2GQI A;  2AZS A;  1ABQ A;  1NYG A;  1SSH A;  1Z9Z A;  5IXF A;  3UA7 A;  5IXB A;  3VRY A;  1GFC A;  2JMC A;  2KXD A;  2K6D A;  2ROT A;  2L3S A;  1B07 A;  1K76 A;  2BZ8 A;  2AKK A;  3VS4 A;  1TG0 A;  2HSP A;  2X3X D;  2GBQ A;  3NHN A;  2P4R A;  3VRZ A;  2L2P A;  1AZE A;  2GNC A;  3TSZ A;  1PNJ A;  2A08 A;  4F16 A;  1QCF A;  4IIO A;  2YSQ A;  2RMO A;  1G2B A;  2V1Q A;  2RQU A;  1I1J A;  2CUD A;  3I5S A;  3REB B;  2FO0 A;  3R6N A;  2K79 A;  1M8M A;  4RTZ A;  2EW3 A;  2FPE A;  4ZNX A;  2KEA A;  2VKN A;  1VYU A;  2EYX A;  4JJC A;  3C0C A;  1S1N A;  2KT8 A;  1K0S A;  4RTT A;  1WIE A;  1MV0 B;  1YP5 A;  2VVK A;  1X2K A;  3H41 A;  4J9G A;  2NWM A;  1JEG A;  3KFV A;  4A63 B;  1PWT A;  1RI9 A;  1ZUY A;  2J05 A;  4LUE A;  3PVL A;  2DNU A;  2GTO A;  2F2W A;  4CC4 B;  2ESW A;  2ABL A;  2L3Q A;  2DL4 A;  4J9D A;  4AFZ C;  4HVW A;  2KRO A;  1Y0M A;  1UDL A;  2HCK A;  2KYB A;  1E7O A;  1QLY A;  2GGR A;  1WXU A;  2A28 A;  3VS0 A;  1JXO A;  1UHC A;  1KIK A;  1ZUU A;  4JZ3 A;  3M0S A;  2JM9 A;  1ZLM A;  2DBM A;  2EGC A;  2DA9 A;  4AFU C;  2EKH A;  1ZX6 A;  2DL5 A;  1NM7 A;  3QWX X;  3EGU A;  1T0H A;  1WDX A;  1HD3 A;  4QT7 A;  1FMK A;  1OOT A;  4LN2 A;  1CSK A;  4M4Z A;  4J9F A;  2EGA A;  2J7I A;  2KRS A;  2DJQ A;  2O88 A;  2FEI A;  1OPL A;  2J06 A;  1UJY A;  1OEB A;  5IHN A;  1H3H A;  1TUC A;  2SRC A;  4OMO A;  1M27 C;  2DL7 A;  2DLP A;  2YUO A;  3VS2 A;  2KE9 A;  2DE0 X;  2OJ2 A;  1QKX A;  4JJB A;  2DIL A;  4ORZ A;  2D8H A;  1ZSG A;  4AG2 C;  2LCS A;  1I0C A;  4Z88 A;  4X1V A;  1K9A A;  2JW4 A;  3H0I A;  1AVZ C;  4CC7 A;  2LZ6 B;  2E5K A;  1PRM C;  2O2O A;  3ULR B;  2EGE A;  2ENM A;  4J9H A;  3VS6 A;  1U3O A;  4J9B A;  2J6F A;  3EHQ A;  5FWB A;  2K2M A;  1X6G A;  1WX6 A;  2KBT A;  1K1Z A;  2LQW A;  2C0T A;  1AZG B;  1WA7 A;  5L23 A;  1GCP A;  4J9E A;  2I0N A;  1YNZ A;  2RQV A;  2DYB A;  2W0Z A;  2YT6 A;  1TUD A;  2EVR A;  1RLQ C;  2YUP A;  4CC2 A;  1PHT A;  1KJW A;  1M3C A;  2KT1 A;  2RF0 A;  2O9S A;  3EG0 A;  1SPK A;  4OML A;  4E6R A;  2DBK A;  1A0N B;  1Y57 A;  3NGP A;  2PZ1 A;  2HDA A;  4LE9 A;  4AG1 C;  4RTX A;  2IIM A;  1QWF A;  1NYF A;  3TVT A;  2FPF A;  2RN8 A;  1UTI A;  1QKW A;  2BZX A;  2DL8 A;  3M0T A;  1KFZ A;  3O5Z A;  3H0H A;  1GCQ A;  2YUQ A;  2D0N A;  2D8J A;  2AZV A;  1U06 A;  2JM8 A;  2LJ0 A;  5IH2 A;  3THK A;  2LJ1 A;  1WYX A;  1BBZ A;  2H8H A;  1VYV A;  4RTW A;  5I11 A;  2DRK A;  3GBQ A;  1AEY A;  4OMM A;  3LH5 A;  1PKS A;  2DMO A;  4Z8A A;  3I5R A;  2GTJ A;  2C0O A;  1UG1 A;  2XMF A;  1JXM A;  4RTU A;  2VWF A;  2OAW A;  1B3Q A;  2JS0 A;  1UJ0 A;  2SEM A;  1T3S A;  1X69 A;  1H8K A;  2HEQ A;  4OMQ A;  1WFW A;  1CKB A;  2G6F X;  2K7A A;  2CUB A;  1NG2 A;  2LX7 A;  2V1R A;  3CQT A;  4CC3 A;  1XOV A;  4LUD A;  5FWC A;  3NMZ C;  1UUE A;  1SHF A;  2C0I A;  2DX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...