2EQIA

Solution structure of the sh3 domain from phospholipase c, gamma 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
GSSGSSGRTVKALYDYKAKRSDELTFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholipase C, gamma 2
publication title Solution structure of the SH3 domain from Phospholipase C, gamma 2
rcsb
source organism Mus musculus
molecule tags Immune system, hydrolase
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2eqiA00
2OI3A 2KEAA 1BU1A 2EQIA 2V1RA 2RQRA 4D8KA 1FMKA 3VS5A 1RUWA 1PHTA 1HD3A 4Y92A 2RF0A 2ABLA 2O9SA 1WI7A 4IIMA 4ESRA 2DL8A 5IXFA 1T0HA 2EYYA 1AVZC 1UUEA 2JT4A 2K6DA 1ZUUA 1AWJA 2GQIA 5I22A 1K0XA 2GNCA 5EC7A 1AZGB 1UG1A 2RMOA 3JV3A 3NHNA 3O5ZA 2JS0A 3VRYA 2JM8A 3KFVA 1IO6A 2MOXA 1CKAA 2DL4A 5IHIA 1I0CA 1W70A 1X27A 2DE0X 5IHNA 2W10A 3EHQA 4X1VA 2J6FA 2KNBB 2LQNA 2RQUA 5GJVB 1PKSA 3VS4A 1H3HA 5I11A 2DF6A 2CDTA 3LH5A 3ULRB 1JO8A 1QKWA 4LUEA 2AKLA 2LCSA 4HVUA 4LN2A 1ZX6A 1ZSGA 2D1XA 2BZYA 2HSPA 2J6OA 1K76A 2HDAA 2ROTA 1WXBA 1QWFA 3EHRA 1JEGA 2G6FX 1UJ0A 2LJ0A 3REBB 2AZVA 1WFWA 2EGAA 2ED0A 2V1QA 1H8KA 4J9BA 1QKXA 2RQWA 2DMOA 3EG1A 1M3CA 2A36A 2J06A 3H41A 1MV0B 2KT1A 1ZLMA 1WYXA 2C0IA 2GTJA 1KJWA 1M27C 2PNIA 3VS7A 3U23A 2LJ3A 2JS2A 2PZ1A 1LCKA 2DBKA 2KRMA 4J9CA 1KFZA 3M0RA 2XMFA 1VYTA 3IQLA 4J9IA 2DNUA 2L3PA 1ZUYA 4AFUC 2GGRA 2L2PA 1GBRA 1K9AA 1PWTA 2C0TA 2FRWA 4M4ZA 2VKNA 4OMQA 1V1CA 3UA6A 1UTIA 2DLPA 1NM7A 3EG3A 2K3BA 3NPFA 4GBQA 3REAB 1SEMA 2H8HA 1PNJA 1E6HA 5IXBA 2EYZA 5L23A 4LUDA 1UJYA 2CH4W 2LQWA 2F2VA 2C0OA 2EYXA 1QCFA 1SHGA 1X6BA 4WCIA 1W1FA 3VS1A 1JU5C 1OPLA 2KR3A 4HCKA 1NYFA 3TVTA 2YUPA 4RTXA 1UE9A 1M3AA 4KRTA 1SPKA 1BB9A 2X3XD 1G2BA 2P4RA 2O31A 1YNZA 4ORZA 5FWBA 2D0NA 1RLQC 2BZ8A 2W0ZA 3M0QA 1CSKA 4J9HA 4JZ3A 2F2XA 2CSIA 2K7AA 1GCPA 2FO0A 1BBZA 1NLPC 1AD5A 1RI9A 3QWXX 2I0NA 4OMLA 1U5SA 3C0CA 4E6RA 1UFFA 2EBPA 3I9QA 1KIKA 1JXOA 1WXTA 2YDLA 2DJQA 2JW4A 5GJWB 1NG2A 1WA7A 5IHKA 4CC2A 3PVLA 2CUBA 2L3SA 1AOJA 3M0PA 1OOTA 2DVJA 2FRYA 2KXCA 2ED1A 2YSQA 1K4US 2VWFA 3RBBB 2KXDA 3H0FA 3VS6A 1UHCA 2DL5A 1GFDA 1A0NB 1GCQA 1QWEA 1ARKA 2ROLA 1YN8A 2HCKA 1J3TA 2KYBA 1OV3A 4OMPA 2MIOA 3ZL7C 4J9FA 4ZNXA 1BK2A 1MV3A 1N5ZA 2LP5A 2AK5A 2JMCA 1W6XA 1Y57A 2RQVA 2KRSA 1PRLC 3QWYA 2IIMA 3EG2A 2CREA 2MCNA 2DA9A 1UECA 3NMZC 2JTEA 4F14A 2NUZA 4J9EA 1T3LA 2E5KA 2FPEA 1RLPC 1T0JA 2LNHB 4LE9A 4D8DA 4AFSC 3FJ5A 2DRMA 3VRZA 4RTUA 2GBQA 4HVWA 3M0UA 2BZXA 4CC4B 1AWWA 1ZBJA 1EFNA 3UF4A 2HBWA 4OMNA 4RTZA 2M0YA 4FSSA 4K11A 4R0KA 3PVQA 4EIKA 1H92A 1S1NA 4IIOA 3TSWA 1HJDA 4RTTA 4AG1C 2KBTA 2CH4A 1AEYA 4RUGA 1AWXA 2GTOA 1YWPA 2CT4A 1E7OA 2A08A 3EGUA 3TSZA 1GCQC 2KE9A 2KROA 3EG0A 1KSWA 2K9GA 1M3BA 2O9VA 2FEIA 4GLMA 5FW9A 1AZEA 2LX7A 2RN8A 2FPDA 1HSQA 3SHWA 1SRMA 1Z9QA 2L3QA 3H0IA 3VS3A 1YP5A 1GRIA 1MUZA 1JXMA 2EGEA 1T3SA 2JM9A 2B86A 2KGTA 3RNJA 1E6GA 2CT3A 1WXUA 2EYWA 1X69A 1YWOA 2HEQA 1TUCA 1NEGA 1YCSB 1X43A 2DX1A 1WLPB 1SSHA 1UGVA 2DM1A 4CC7A 1XOVA 4DEXA 2LZ6B 2J6KA 2KT8A 1WIEA 1M30A 2JMAA 2CSQA 2DL7A 2YT6A 1PKTA 2K2MA 2QDLA 5IH2A 2ESWA 4OMMA 1Y0MA 4JPBW 4CC3A 2FG0A 2DILA 1K1ZA 3THKA 3H0HA 1I1JA 3I5RA 3I5SA 1SHFA 2X3WD 2FPFA 1ABQA 4RTVA 2D8HA 2DYBA 4RTYA 1WX6A 2NWMA 1UHFA 1GBQA 4J9DA 4J9GA 4AFZC 1X2KA 4JJDA 2VVKA 4QT7A 1ZUKA 1AWOA 4JZ4A 3SEMA 2YUNA 2LMJA 1NEBA 1VYVA 1UDLA 1TUDA 4OMOA 4HVVA 1GFCA 4F17A 2OJ2A 1NYGA 2CUDA 2EKHA 1K0SA 2ENMA 2RPNA 2JXBA 2EPDA 4AFQC 4JJBA 5HCKA 1U06A 2D8JA 3I35A 4HXJA 1X2QA 3R6NA 2DBMA 1GL5A 2L0AA 2DRKA 2ECZA 3M0SA 4Z89A 3NGPA 3PE0A 2J05A 2BTTA 2J7IA 1JQQA 2RQTA 1CKBA 4RTWA 1OPKA 1QLYA 2KYMA 2EW3A 4Z8AA 5FWCA 3UA7A 1WDXA 2A28A 2A37A 2EGCA 1TG0A 4JJCA 2K79A 2M51A 1I07A 4A63B 3A98A 4Z88A 1G83A 1NLOC 5ECAA 1VA7A 1PRMC 2AZSA 2RNAA 2YUQA 3CQTA 2O2OA 3GBQA 2F2WA 1U3OA 2O88A 2DL3A 3VS2A 1FYNA 1SRLA 2SRCA 1X6GA 3UATA 1VYUA 2EVRA 2LJ1A 4LNPA 1ABOA 1B3QA 1M8MA 1OEBA 4F16A 1Z9ZA 2YUOA 4DEYA 4AG2C 1B07A 2OAWA 2SEMA 3VS0A 2AKKA 2KRNA 3M0TA 2PTKA
chains in the Genus database with same CATH superfamily
2OI3A 3JCMP 4QKUA 1BU1A 2DVEA 2EQIA 3QDFA 2CS7A 3MHXA 1FMKA 1RUWA 2E65A 4XTYA 5LJ5d 2JVVA 5DM7R 1RAEB 3CCVQ 1FX7A 1YJ9Q 4PFOA 1AVZC 1BCOA 5GANg 1UUEA 4PJOF 2R5AA 1TSFA 4F7UG 2GQIA 3DLLA 1LOJA 1VQNT 4N0AC 3M4YA 4N4HA 2GNCA 1AZGB 1U1SA 2FB7A 3OSSC 2JM8A 2E3IA 2X4WA 3KFVA 4M75F 4A54A 2MOXA 4C92C 1I0CA 1K8AC 5GMKi 1OYXA 5GMKe 2RHYA 1LNXA 4XTXA 4JS5A 5LJ5e 2PVDB 1Q82U 1TUGB 1PSFA 2FL7A 5CIUA 4A4HA 1YJWT 5D6XA 1VQKQ 2RQUA 5GAOl 3VS4A 1VIFA 1Y07A 2VUBA 4WTOB 2QTXA 2MF2A 4KULA 4LUEA 3MEVA 3HFOA 4OB0B 3MP6A 4HVUA 1Q86C 4M7DA 3SFMA 4JRQA 2J6OA 1K76A 2HDAA 1D1AA 3LWHA 4LDXA 4LDWA 1WPYA 3OYHA 2QQBA 5KYXB 2LT4A 3QZ5B 3REBB 4PKCC 1WFWA 1UB4A 5FU7C 2NYSA 1H8KA 2QASA 3EG1A 3H41A 4F7UE 2GTJA 3OYYA 1M27C 3JCMQ 1VIEA 3BDLA 2PNIA 2E12A 2VYTA 4AMCA 5HK3A 3VS7A 3JCMX 4JUVA 4J9CA 2PU9B 1G3YA 3CPWS 3A8MB 2DNUA 3ZFJA 1U1TA 3TCJA 5GAN3 3NTIA 3GNFB 2DO3A 1K9AA 1PWTA 4DBQA 1Y96A 2DPPB 1D1CA 1QP2A 3X28B 2VKNA 2ZPEB 1V1CA 3UA6A 1I5OB 2DLPA 4BD3A 3OYKA 3OYLA 3GPLA 4M7DD 3H9NA 1E6HA 3MKDA 5J3BA 1YI2T 1PD1A 4LUDA 4PNOA 2LQWA 3PIPA 3V8KA 2VASA 2X35A 3CD6T 1YI2A 4BY6B 4RG8A 2QA4A 1I81A 2M0OA 4EMKB 1DJ7B 3VS1A 1KQSP 2L89A 2NUPA 2RHUA 1BB9A 2X3XD 1G2BA 2COWA 2P4RA 1Q82R 2W0ZA 1Q95G 4M7DB 3J81E 3OYIA 3L2QA 5GAN4 3S3NA 1UEBA 2K7AA 2XDPA 3RESA 3E2UA 3P8DA 5KYYA 3HRTA 2MPXC 3QWXX 2G3RA 3I9QA 3H8ZA 2JW4A 5GMKj 3EH2A 4RG2A 1KQSA 3OYMA 5IHKA 5LJ5j 5AT1B 2CUBA 2L3SA 2IVWA 3M0PA 5KCOA 1RACB 2BE7D 2ED1A 1K4US 2VWFA 4OP0A 3RBBB 3H0FA 1C6VX 3CCJT 2HCKA 5GMKh 5A0DA 2MIOA 1M8VA 3ZL7C 2LT1A 1OU9A 4ZTJA 4FT4A 2CGHA 1EX4A 1OX8A 1Y57A 1PRLC 3OQ5A 3QWYA 2OAUA 2QA4Q 5GAN8 4Q5WA 3H6ZA 2DIQA 4F14A 2NUZA 5GMKm 1YJNT 1T3LA 1W4SA 1SKUB 3RMSA 5GAN2 4LE9A 3L2UA 5LJ5f 4FM4B 1K73U 3VRZA 4HVWA 2BZXA 1I8FA 2CYZB 3GOXA 3RR6A 4OGEA 4OMNA 3AHUA 4FSSA 4R0KA 1S72T 3PVQA 1H92A 1VQOT 2COYA 4RTTA 1VQ5A 1S72A 4JLGA 1K9MC 1AEYA 1YWPA 8ATCB 1E7OA 2A08A 3QUIA 1Y71A 1GCQC 2KROA 2CZ6B 1BI1A 5KYYB 2A7YA 1WHGA 2X9HA 2LX7A 2B8AA 1KD1R 4M7AG 1Z9QA 3H0IA 3X20B 2EGEA 1T3SA 2KGTA 4J5YA 2CT3A 4C0FA 2EYWA 2HEQA 4C8QG 1NEGA 3LW5E 3V7SA 1KG1A 4J6WA 2DX1A 1WLPB 2KK4A 4M75C 1VQ8A 3OMCA 1UGVA 4CC7A 1B34A 4YTLA 1XOVA 2YWWA 2HL5C 3R6OA 2E5QA 1IZ6A 2MYSA 2F1LA 2FZCB 3RKXA 4A4KA 1QCOA 1PKTA 3P8BB 4ELZC 4QQGA 4CC3A 3JCMc 4QVDA 1K1ZA 1M1FA 1JJ2S 4M7DF 2QQAA 1SHFA 2X3WD 2ZPHB 2FPFA 1ABQA 2DD4A 2YRCA 1VQ5Q 1S72Q 3L42A 1UGPB 1WX6A 4M77B 6AT1B 4C92G 5CCAA 4J9DA 4DBHA 1HYOA 4AFZC 1W2BS 2PVGB 3L1AA 1D3BB 4FYXB 4QT7A 3V8JA 1VQ4T 4LDUA 4OF1A 4JLIA 3INZA 1IB8A 1WNLA 2ZZDA 2ATCB 3QIIA 3CCUT 4M7AE 4B9XA 4F17A 1K73R 2QYZA 1NJIU 4JJBA 4C8QE 5HCKA 1U06A 2YXYA 2ZGWA 2ZPBB 1VQ8Q 1NPPA 4AT1B 2EJGA 2L0AA 2P0PA 2DRKA 3NGPA 2X4JA 4CRIA 2BTTA 4L59A 1IREB 3GF5A 3X26B 3WXMB 1OPKA 1VQPT 2RI3A 1WDXA 2CP3A 3L2VA 3OSVA 3EFRA 5KE3A 8AT1B 2OTJA 2DZCA 1I07A 3A98A 4C92E 5CR2A 3CCSA 1F1BB 3FJPA 2V8KA 3QPHA 3CQTA 1D1BA 3A8OB 3HPWA 1U3OA 2O88A 2ZPIB 1SRLA 1X6GA 3UATA 2M16A 1IGUA 4A4EA 4LNPA 3QJYA 3M9QA 2CKKA 5LJ5g 3CPWP 2RA2A 2AKKA 2KRNA 3EGDB 4IUPA 3M0TA 3CBOA 4XU1A 3A1PA 3OYNA 2RO0A 3J7AF 4JRPA 3OW2S 3HL8A 4D8KA 4JJNK 2HQHA 1HD3A 2ABLA 2O9SA 1KQ1A 1RI0A 5IXFA 1M1GA 3OY9A 2K57A 5GMKl 3CPWA 3QDRB 4C5GA 2CP5A 4N4IA 2OTJQ 2DJZA 4C0DB 5KH6A 1BI3A 1NJIR 2QTVA 2RMOA 3WVDB 1G3TA 2JNGA 4Y91A 3NHNA 3CCSQ 4JRKA 2JS0A 2K5FA 2DL4A 5FU6C 1W70A 4E7JA 1X27A 2HQXA 2VGMA 3EHQA 4X1VA 1WZOA 2KNBB 3JCMW 1RL2A 4C0GA 5DLOA 4F7UB 2CDTA 3LH5A 2GFAA 1JO8A 3M58A 3QZ9B 9ATCB 2Y4YA 2E4HA 2LCSA 4LN2A 3BFMA 2BZYA 5GAOp 3RDVA 1TXQA 1X75C 1MMGA 2ROTA 4J7FA 1WXBA 3CCVT 3MEUA 2HL3A 1YJ9T 3CC4A 1UJ0A 3C12A 2LJ0A 1EZZB 3O8VA 2EGAA 2ED0A 4MZTA 4J9BA 1R8OB 1QKXA 2VGNA 1MV0B 4FL6A 1N9SA 1ZLMA 2C0IA 1KJWA 3CCMA 5CVIA 3VU3C 5CKBA 1QP3A 2KY9A 3GLXA 2DBKA 2KRMA 2FZGB 2RB6A 2WACA 3CCQQ 3M57A 2F5TX 4M78C 4VUBA 1ZUYA 4AFUC 3HRUA 3NFCA 3C94A 1G3SA 1VQKT 4LD9K 1IXDA 4KUIA 4R56A 3CMAQ 2OTLA 1RAAB 4FU6A 4M7AC 2C06A 3CCRT 1WGSA 2LTOA 4DBFA 1UTIA 1NM7A 3CCRA 2NLUA 3EG3A 3JB9I 5LJ3d 4GBQA 3REAB 2CP2A 5CK9A 5IXBA 1BKBA 2KDSA 5C6SA 4C5IA 2GF7A 2L5QA 2HZYA 4M75G 1QCNA 2F2VA 1YHQQ 3X24B 2E70A 3CC4Q 1SHGA 1X6BA 1M2OA 1W1FA 3LGLA 3LH0A 4WCIA 1U8RA 2KR3A 4J8OA 4RTXA 1D0XA 3PGGA 1UE9A 2EKOA 1WJQA 1SPKA 3KBGA 4ORZA 4F04B 5FWBA 1YNZA 3HRSA 1ACMB 2D0NA 1RABB 2BZ8A 2QEXQ 3CCMQ 3NTHA 1CSKA 1WQ7A 4JZ3A 4DA4A 2X4XA 2I2LA 3AT1B 5GAN5 5LJ3e 4QQ6A 1BBZA 2FO0A 1BI2A 2DTOA 4OMLA 4HT9A 3OYBA 1JXOA 2YDLA 1N8RC 2DZ9A 3A8GB 1M90C 2LDMA 3X25B 1HK9A 3FIFA 2OTLQ 4MZMA 2LX9A 1OU8A 3UPUA 2DVJA 1WHHA 2KXCA 4EMKA 3LYIA 4FYYB 4PLIA 3I55Q 1QWEA 1ARKA 2ROLA 3QXEB 3CCRQ 1J3TA 2KYBA 2MWPA 2XD0A 3BW1A 2DD5A 1BYMA 1JJ2P 2H3JA 4ZNXA 2KQWA 4JS4A 2LP5A 3L2ZA 2AK5A 2R58A 5CKDA 1PG5B 4M75E 1OULA 2KSSA 1W2BP 2IIMA 3EG2A 3BE3A 4ELYC 3OYAA 1UECA 3QKJA 2JTEA 2FZKB 1JJ2A 2E1HA 4XU3A 2HMAA 1VQLA 4D8DA 3EFSA 4KGXB 1YIJT 3FJ5A 2BUDA 2P4TA 4RTUA 4BDZA 1YIJA 1W2BA 1AWWA 3META 3UF4A 4QQDA 1KQ2A 5HKCA 1S1NA 2MK5A 2CP0A 4AG1C 4N0AA 2CT4A 3HHTB 2X4YA 1Q81C 2KE9A 3DB4A 3SWNC 4GLMA 3BDUA 4J83A 2DKGA 4C92A 2XIDA 1PM3A 3SHWA 1SRMA 2K5LA 3VS3A 4RKUE 1YP5A 1GRIA 1JXMA 3PNWC 2O4XB 4O6JA 2QA4T 5KE2A 1YWOA 2BE9B 4TVRA 1EIFA 4MDXA 2HAXA 2E6ZA 1KD1U 3ME9A 2YRVA 2EAYA 4DEXA 1Q7YC 3EG9A 2F69A 5IAYA 1VQLQ 1WIEA 2XICA 2Y4XA 5LJ3j 2DXUA 4NS5A 1YIJQ 1M1KU 4PL6A 3OS1A 2DILA 4PFZA 3H0HA 3KUFA 1JBMA 1I1JA 3WVEB 3I5SA 4C8QB 2D8HA 3OW2P 1R0BG 4EMGA 2QAZA 2NWMA 1OX9A 1GBQA 1X2KA 4JJDA 3QBYA 2RH2A 1AWOA 3SEMA 1B7TA 5J26A 2D9TA 5LJ5h 1NEBA 1VYVA 3RERA 1TUDA 4OMOA 2DFUA 4PJMA 5GAMj 1NYGA 2ZAEA 3HTRA 3OW2A 5M9OA 2EPDA 3CCLQ 2DIGA 4FW2A 3ZEHA 1X6OA 3I35A 1ZA2B 3EFOA 1C1AA 1M9SA 2DBMA 2VV5A 3MP1A 4XU2A 2LRQA 5EG2A 4C92B 3E9GA 3Q1JA 4Y28E 3PE0A 1PSEA 1VQ6A 2P0KA 1BI0A 1JQQA 2DEQA 1CKBA 4M77A 4RTWA 4OB3B 1QLYA 1D3BA 3UA7A 2A28A 2GQVA 1KHCA 2R5MA 3JAME 3GNGA 3PMTA 1VQ5T 1TG0A 3E19A 2DXCA 2M51A 3EG9B 1HXDA 5DLQE 2ZPGB 2QK0A 3BY7A 4M78G 2L3RA 1KC8U 2E6NA 2Y90A 3GBQA 2QGGA 1I4K1 4PJOC 2DL3A 1FYNA 5FU7B 3M4GA 1QVFS 5A0LA 3A5ZB 1WJSA 2RHIA 3JB9D 2M1HA 1B3QA 1M1KR 1VQ8T 2RI2A 1Z9ZA 1B07A 2OAWA 2SEMA 1FMWA 3SD4A 3VS0A 3JCMJ 4NOYA 2PTKA 4M77D 2KEAA 1VQ6Q 2RQRA 1G8XA 3JCMd 3VS5A 1RAHB 1PHTA 2PVOB 4IIMA 4ESRA 2DL8A 1T0HA 2RK1A 2EYYA 1P92A 3EFOB 3MEAA 4NL2A 3CCEQ 2JT4A 2K6DA 5CAIA 3JB9H 1K0XA 3CBPA 5EC7A 1NPRA 1UG1A 5IT9E 3JV3A 3FRNA 4M78E 3VRYA 5C0MA 2RJDA 2RM4A 1Q82C 5IHIA 3EGDA 1M2VB 2QQ9A 1D09B 3JCMe 3NTKA 2DXTA 4Z02A 1K8AU 2LQNA 2E64A 1H3ZA 4HCCA 3LGFA 1VQMA 1PKSA 3V7CA 1D0YA 5I11A 4M7DE 2LC4A 3PT9A 3VV0A 4DQ2A 2MMPA 3ULRB 3OMGA 4EPCA 1QKWA 4KBMB 2AKLA 1ZX6A 1ZSGA 2D1XA 2KI7A 1ZSZC 3J80E 4IKFA 2WSCE 3M55A 1BIAA 3QYHB 4PLLA 3G6EA 1G3WA 1WHKA 3TU4K 1QWFA 3A8HB 1Q86U 2G6FX 1KC8R 3KXTA 4KGZB 4HKEA 5KYWB 1AT1B 2AZVA 1H641 3F70A 2OTJT 2JTFA 1XJWB 1M3CA 2A36A 1JB0E 1WYXA 4IUVA 3CCST 2DEUA 4O5VA 1N27A 4OMFB 3U23A 4GLKA 2PZ1A 4F7UA 4V2SA 1VQ7A 3M0RA 2XMFA 1KHIA 4BE0A 4J9IA 1ZHIA 4HA8A 1YFNA 2KVQG 3OB9A 1ZA1B 3EH1A 3DLMA 5LJ3g 4FW1A 2C0TA 2FRWA 4EDUA 4M4ZA 1VQMQ 4IUQA 1OZ3A 1MNEA 3CMEQ 2WSFE 5KCHA 2RHXA 2HBPA 2K3BA 3NPFA 4XTZA 3TREA 1SEMA 4QW2A 2EYZA 5L23A 1UJYA 5GAN6 3HKSA 3QHSA 4MZPA 3G6EQ 4FCYA 2JTMA 2HSEB 5J39A 2C0OA 2EYXA 4MMLA 1KD1C 3CC2T 4HCKA 3HP9A 3CC2A 1M3AA 4KRTA 2P0QA 3LX7A 1WHJA 1SG5A 2XDBA 1BCMA 4N4GA 1N8RR 5GAMg 1K8AR 3M0QA 1QVGS 2E3HA 3CBMA 4J9HA 1M90R 1FXXA 2CSIA 2AIRB 3VKIA 1MMDA 2V8JA 3JB9F 1GCPA 1NLPC 2JOYA 3M53A 3CCQT 5FRMA 1AD5A 1VQ7Q 1GXIE 1UFFA 2EBPA 1IHWA 1WXTA 5GAOr 1X01A 5GJWB 3CCQA 1NG2A 1WA7A 4E7HA 3G71A 4CC2A 5GAN7 4M75B 3CMAT 4PFPA 4M77F 1OI1A 1LVKA 3OYEA 3CMAA 4C5HA 4E47A 2DK3A 2YSQA 1Q86R 2KXDA 2CZ0B 3VS6A 3CC7Q 1A0NB 4HT8A 1BIBA 3D7SB 2EWNA 1VUBA 1OQKA 1SF9A 3JCMh 4J9FA 1BK2A 1MV3A 1YHQT 2HKNA 3URGA 4JRIA 1W6XA 3CC4T 2KRSA 1YHQA 4C5EA 4E7ZA 3M54A 3SB2A 2MCNA 2DA9A 2VB6A 3NMZC 4A4FA 4RCCA 1K73C 2QEXT 3CC2Q 4J9EA 2XG8D 3CCMT 4XTVA 3ASKA 1WQWA 3VYGA 1T0JA 2QEXA 3JCMf 4OVAA 5AYFA 2D0QB 2DRMA 5I2SA 4CC4B 1O9SA 2DAQA 1VQ9A 2M0YA 3G71Q 2X51A 2OTLT 4EIKA 4IIOA 1UGSB 4QVCA 3TSWA 1HJDA 1MMAA 3QYGB 4BY6C 4X34A 1TU0B 1WHLA 3PFSA 3VJPA 4RUGA 1AWXA 2GTOA 3I55T 4EMKC 2KAFA 5CQXA 3EGUA 3TSZA 3EG0A 3I55A 4PJOG 1M3BA 2FEIA 1K9MU 3EAEA 5CKFA 1AZEA 3CXCS 4M7DC 3M56A 2L3QA 3RNJA 2JM9A 2B86A 2KMTA 3CPFA 1TUCA 3M59A 1Q7YR 1X43A 4HCBA 4FIBA 3DKMA 2DM1A 2A3LA 4BI8B 2LNVA 4ZN1A 1M30A 1XTDA 5I2MA 1QVFP 1PC0A 2JMAA 2BKDN 2EJFA 3RIRA 5KYNA 3S3MA 5IH2A 4OMMA 2HQEA 5A2QE 5GAMd 4JPBW 4R55A 5LL6S 4D6WA 2FG0A 3JRZA 1VQ9Q 1UGQB 4X9DA 3I5RA 4EMHA 3N5BB 3OS0A 2O4XA 2QQSA 2DYBA 4RTYA 2JUFA 2RI5A 3UT1A 1QVFA 4BE2A 1VQNA 4J9GA 1OZ2A 5D6YA 3TEEA 4PJOE 4BACA 2YUNA 2LMJA 1NJIC 4M78A 3G1JA 3RUXA 1GFCA 1I5LA 2CUDA 2DXBA 2FYKA 4P5NA 4F7UF 5GAMe 2EKHA 1K0SA 2QG9B 2JXBA 4II1A 4E7IA 4AFQC 1YJWA 4M7AA 5FLXE 4KGVB 1IRXA 4HXJA 1ZBXA 2IPOB 3R6NA 4DBRA 3QSUA 2JJ9A 1VQLT 5FU6B 4C8QA 3M0SA 4BI3A 4ZGJB 2J05A 3L2WA 2DTIA 3OS2A 2BIVA 2XKOC 2KYMA 2EW3A 2MWOA 1M5Q1 1MGQA 3FLGA 4E7KA 1K9MR 2K4YA 2V8IA 4B6MA 2K3YA 2ZPFB 1QVPA 4Z88A 1G83A 4KUDK 3PTAA 2IG0A 2YLCA 1VQNQ 1VA7A 3T9NA 5GAOn 2AZSA 2RNAA 2YUQA 4M78D 3G7ZA 4QVZA 2XK0A 3VS2A 2E41A 3CCLT 1VYUA 2WSEE 4M7AD 2LJ1A 2QGFB 3RKYA 3CCLA 5FROA 2LVMA 1ABOA 1YJWQ 2RJFA 1M8MA 3UDCA 1RAIB 4F16A 2R57A 4IUUA 3PIOA 4AG2C 4L6V5 3JCMg 4C8QD 2QXFA 1TS9A 3OYFA 4WF2A 4M78B 3QO3A 4M77C 2V1RA 2PUKB 2RK2A 5KYUA 2PUOB 1NE8A 5CKEA 4Y92A 2RF0A 1WI7A 2FHDA 4M7AB 3CD6A 1RAGB 2F5KA 4LDYA 2LQ8A 2COZA 4FSXA 1VOMA 1ZUUA 2AT1B 1AWJA 5I22A 3RMQA 5GANd 5LJ3h 3I56T 3O5ZA 4XTUA 1NBEB 3OBWA 1IO6A 4C92D 3I56A 1CKAA 3GP8A 2DE0X 5IHNA 2W10A 2EYQA 5HK0A 4OB1B 2J6FA 2ZCFB 1QVGP 3SDZA 4ZTFA 3OA6A 3ER0A 5IN1A 5GJVB 4E2FB 2QI2A 2PQWA 1H3HA 4KH0B 2DF6A 3OYJA 2HNIA 5LJ3f 3SWNA 2O01E 4OGCA 1VQ6T 1UGRB 3CCJA 2RD1A 5GANe 5CO7A 3VUZA 2HSPA 3MCAB 4BDYA 5GAMh 1TWBA 1QVGA 3EHRA 1YI2Q 1Y96B 3A8LB 1JEGA 1V29B 2FVUA 3CD6Q 1M2VA 4PK4A 3CCET 1SSFA 2E10A 2NUTA 2V1QA 4IUTA 1RAFB 2RQWA 3CCEA 2DMOA 1PD0A 3LLRA 2J06A 2KT1A 4XU0A 2HKQB 1LJOA 2K2VA 1YJNA 4MMKA 5KYUB 2LJ3A 2JS2A 1LCKA 2MI6A 3RKWA 5GAMf 1KFZA 3I56Q 1VYTA 3IQLA 2YRDA 2NUPB 2L3PA 1MMNA 2GGRA 1D0ZA 2L2PA 4XQ3A 1XQHA 3PMIA 1GBRA 1VQOA 4FYVB 3JCMV 1QMCA 2EQMA 4XTWA 4GY5A 4OMQA 5KYWA 5FRNA 4M7DG 1Y7XA 3OBYA 3JSCA 1ZQ1A 4BE1A 1TOVA 4C0DC 3CCJQ 4LXCA 2YLBA 2H8HA 1PNJA 2EQKA 2CH4W 4J6YA 4NL3A 3ZBDA 1QCFA 1PCXA 1JU5C 1OPLA 1YCYA 1N9RA 4M78F 1NYFA 3TVTA 2YUPA 3SWNB 3CXCP 2O31A 1RLQC 2LCLA 1YJNQ 4M7AF 2F2XA 3EGXA 3P8HA 4A53A 4ZGEB 2V26A 1RI9A 2I0NA 1U5SA 2QQRA 3C0CA 4E6RA 1KIKA 4PJLA 4C8QF 2DJQA 1IHVA 2NUTB 3PVLA 2OX7A 2D6FA 4JDSA 3CXCA 1AOJA 1TTHB 4KT0E 2H3EB 1N8RU 1VQMT 1VQOQ 2DTHA 1OOTA 2FRYA 3CMET 3OS5A 1M90U 1NZ9A 2EIFA 2YHTA 2AHJB 1UHCA 2DL5A 1GFDA 1GCQA 3CMEA 2DERA 5CQYA 1YN8A 2VXEA 1OV3A 2EJ9A 1FMVA 4OMPA 4E7SA 5GANj 1TH7A 3G6ET 1VQ4A 4PJOA 4A4GA 2EQJA 2XI9A 1N5ZA 1LPLA 3E9FA 3QJ6A 3CCUA 2JMCA 2RQVA 3MPUB 2CZ1B 2CREA 2M9UA 1R0CB 4C92F 4J6XA 3MEWA 4M75A 5GANh 2E5KA 2FPEA 3JCMb 1RLPC 3FC3A 4DOVA 2LNHB 1M4ZA 5GAOq 4AFSC 3V7RA 1VQ7T 2CP7A 3E1SA 2GBQA 3M0UA 1O75A 5HY6A 4L5GA 3S6WA 1ZBJA 1VQPA 1EFNA 4DOWA 4BUGA 2HBWA 4RTZA 4K11A 4RCBA 3V8LA 3FB9A 1B34B 4LDVA 2KBTA 2CH4A 1N6AA 2RJCA 5GANf 3CC7T 3GIBA 2QDYB 1WJRA 3EGXB 5GAOm 3CC7A 1KSWA 2JZ2A 2K9GA 3MJXA 3HSBA 2O9VA 1KQSS 5FW9A 1JRIA 5DY9A 4PJOD 2RN8A 1FWZA 4B9WA 2FPDA 1HSQA 7AT1B 1Q81U 1VQ4Q 3S3OA 4ZGDB 1AHJB 2Z0WA 3JB9G 1MUZA 1KK7A 1YBYA 1E6GA 3CCUQ 1WXUA 1X69A 1XNIA 3VYHB 1YCSB 4UC4A 2RHZA 4M75D 1YITT 1SSHA 2XU8A 2CP6A 3UWNA 4M77G 1RADB 1YITA 2MAMA 1C0MA 1M1KC 2LZ6B 2J6KA 2KT8A 4PJOB 1ZSZA 3FEOA 2LCCA 2CSQA 2LQKA 4E7LA 4J7IA 2DL7A 2YT6A 1V76A 2K2MA 2GFUA 2QDLA 2ESWA 1Q7YU 1Y0MA 1QQJA 3G71T 4ZN3A 5I21A 1VQPQ 3MP8A 4X9CA 4LD6A 3THKA 5L8RE 4BB7A 3L2RA 4RTVA 3MO8A 4MDWA 4C0ZA 5CKHA 3JB9J 1UHFA 4ANJA 3G4ST 4FYWB 2CZ7B 2VVKA 3G4SA 1ZUKA 2A0FB 4JZ4A 2DYIA 1UDLA 2EFIA 1G5VA 4HVVA 2OJ2A 2VC8A 2ENMA 2RPNA 3C95A 4PJJA 2D8JA 4FT2A 1X2QA 3C4SA 1MNDA 4M77E 1GL5A 2RJEA 2P84A 1YITQ 4PJNA 2ECZA 4Z89A 2JN0A 2J7IA 4CI0C 2RQTA 3QG1A 3FDRA 2VXFA 2L8DA 2EQUA 2K5IA 4RMOA 5D6WA 3OYDA 5FWCA 4Z8AA 1VQ9T 2M02A 3CCVA 5A0GA 2A37A 4XK8E 1YJ9A 4OB2B 4XAXB 1Q81R 1WHMA 2GCXA 4KH1B 1QW1A 2EGCA 4JJCA 2K79A 1KC8C 2DETA 4A63B 1NLOC 1ZSZB 3M5AA 3HFNA 5ECAA 1PRMC 4ME7A 3LWIA 1MHNA 3G4SQ 2O2OA 2HD0A 4IURA 2XDDA 2F2WA 3OYCA 3DB3A 3TQ7P 1IGQA 5D7UA 3OYGA 2SRCA 2EVRA 4HCZA 1VQKA 3VUBA 4BI4A 3CEYA 1R77A 5KYXA 1OEBA 2YUOA 4DEYA 4ATOA 4C8QC 2XHCA 2K3XA
chains in the Genus database with same CATH topology
2OI3A 2KEAA 1BU1A 2EQIA 2V1RA 2RQRA 4D8KA 1FMKA 3VS5A 1RUWA 1PHTA 1HD3A 4Y92A 2RF0A 2ABLA 2O9SA 1WI7A 4IIMA 4ESRA 2DL8A 5IXFA 1T0HA 2EYYA 1AVZC 1UUEA 2JT4A 2K6DA 1ZUUA 1AWJA 2GQIA 5I22A 1K0XA 2GNCA 5EC7A 1AZGB 1UG1A 2RMOA 3JV3A 3NHNA 3O5ZA 2JS0A 3VRYA 2JM8A 3KFVA 1IO6A 2MOXA 1CKAA 2DL4A 5IHIA 1I0CA 1W70A 1X27A 2DE0X 5IHNA 2W10A 3EHQA 4X1VA 2J6FA 2KNBB 2LQNA 2RQUA 5GJVB 1PKSA 3VS4A 1H3HA 5I11A 2DF6A 2CDTA 3LH5A 3ULRB 1JO8A 1QKWA 4LUEA 2AKLA 2LCSA 4HVUA 4LN2A 1ZX6A 1ZSGA 2D1XA 2BZYA 2HSPA 2J6OA 1K76A 2HDAA 2ROTA 1WXBA 1QWFA 3EHRA 1JEGA 2G6FX 1UJ0A 2LJ0A 3REBB 2AZVA 1WFWA 2EGAA 2ED0A 2V1QA 1H8KA 4J9BA 1QKXA 2RQWA 2DMOA 3EG1A 1M3CA 2A36A 2J06A 3H41A 1MV0B 2KT1A 1ZLMA 1WYXA 2C0IA 2GTJA 1KJWA 1M27C 2PNIA 3VS7A 3U23A 2LJ3A 2JS2A 2PZ1A 1LCKA 2DBKA 2KRMA 4J9CA 1KFZA 3M0RA 2XMFA 1VYTA 3IQLA 4J9IA 2DNUA 2L3PA 1ZUYA 4AFUC 2GGRA 2L2PA 1GBRA 1K9AA 1PWTA 2C0TA 2FRWA 4M4ZA 2VKNA 4OMQA 1V1CA 3UA6A 1UTIA 2DLPA 1NM7A 3EG3A 2K3BA 3NPFA 4GBQA 3REAB 1SEMA 2H8HA 1PNJA 1E6HA 5IXBA 2EYZA 5L23A 4LUDA 1UJYA 2CH4W 2LQWA 2F2VA 2C0OA 2EYXA 1QCFA 1SHGA 1X6BA 4WCIA 1W1FA 3VS1A 1JU5C 1OPLA 2KR3A 4HCKA 1NYFA 3TVTA 2YUPA 4RTXA 1UE9A 1M3AA 4KRTA 1SPKA 1BB9A 2X3XD 1G2BA 2P4RA 2O31A 1YNZA 4ORZA 5FWBA 2D0NA 1RLQC 2BZ8A 2W0ZA 3M0QA 1CSKA 4J9HA 4JZ3A 2F2XA 2CSIA 2K7AA 1GCPA 2FO0A 1BBZA 1NLPC 1AD5A 1RI9A 3QWXX 2I0NA 4OMLA 1U5SA 3C0CA 4E6RA 1UFFA 2EBPA 3I9QA 1KIKA 1JXOA 1WXTA 2YDLA 2DJQA 2JW4A 5GJWB 1NG2A 1WA7A 5IHKA 4CC2A 3PVLA 2CUBA 2L3SA 1AOJA 3M0PA 1OOTA 2DVJA 2FRYA 2KXCA 2ED1A 2YSQA 1K4US 2VWFA 3RBBB 2KXDA 3H0FA 3VS6A 1UHCA 2DL5A 1GFDA 1A0NB 1GCQA 1QWEA 1ARKA 2ROLA 1YN8A 2HCKA 1J3TA 2KYBA 1OV3A 4OMPA 2MIOA 3ZL7C 4J9FA 4ZNXA 1BK2A 1MV3A 1N5ZA 2LP5A 2AK5A 2JMCA 1W6XA 1Y57A 2RQVA 2KRSA 1PRLC 3QWYA 2IIMA 3EG2A 2CREA 2MCNA 2DA9A 1UECA 3NMZC 2JTEA 4F14A 2NUZA 4J9EA 1T3LA 2E5KA 2FPEA 1RLPC 1T0JA 2LNHB 4LE9A 4D8DA 4AFSC 3FJ5A 2DRMA 3VRZA 4RTUA 2GBQA 4HVWA 3M0UA 2BZXA 4CC4B 1AWWA 1ZBJA 1EFNA 3UF4A 2HBWA 4OMNA 4RTZA 2M0YA 4FSSA 4K11A 4R0KA 3PVQA 4EIKA 1H92A 1S1NA 4IIOA 3TSWA 1HJDA 4RTTA 4AG1C 2KBTA 2CH4A 1AEYA 4RUGA 1AWXA 2GTOA 1YWPA 2CT4A 1E7OA 2A08A 3EGUA 3TSZA 1GCQC 2KE9A 2KROA 3EG0A 1KSWA 2K9GA 1M3BA 2O9VA 2FEIA 4GLMA 5FW9A 1AZEA 2LX7A 2RN8A 2FPDA 1HSQA 3SHWA 1SRMA 1Z9QA 2L3QA 3H0IA 3VS3A 1YP5A 1GRIA 1MUZA 1JXMA 2EGEA 1T3SA 2JM9A 2B86A 2KGTA 3RNJA 1E6GA 2CT3A 1WXUA 2EYWA 1X69A 1YWOA 2HEQA 1TUCA 1NEGA 1YCSB 1X43A 2DX1A 1WLPB 1SSHA 1UGVA 2DM1A 4CC7A 1XOVA 4DEXA 2LZ6B 2J6KA 2KT8A 1WIEA 1M30A 2JMAA 2CSQA 2DL7A 2YT6A 1PKTA 2K2MA 2QDLA 5IH2A 2ESWA 4OMMA 1Y0MA 4JPBW 4CC3A 2FG0A 2DILA 1K1ZA 3THKA 3H0HA 1I1JA 3I5RA 3I5SA 1SHFA 2X3WD 2FPFA 1ABQA 4RTVA 2D8HA 2DYBA 4RTYA 1WX6A 2NWMA 1UHFA 1GBQA 4J9DA 4J9GA 4AFZC 1X2KA 4JJDA 2VVKA 4QT7A 1ZUKA 1AWOA 4JZ4A 3SEMA 2YUNA 2LMJA 1NEBA 1VYVA 1UDLA 1TUDA 4OMOA 4HVVA 1GFCA 4F17A 2OJ2A 1NYGA 2CUDA 2EKHA 1K0SA 2ENMA 2RPNA 2JXBA 2EPDA 4AFQC 4JJBA 5HCKA 1U06A 2D8JA 3I35A 4HXJA 1X2QA 3R6NA 2DBMA 1GL5A 2L0AA 2DRKA 2ECZA 3M0SA 4Z89A 3NGPA 3PE0A 2J05A 2BTTA 2J7IA 1JQQA 2RQTA 1CKBA 4RTWA 1OPKA 1QLYA 2KYMA 2EW3A 4Z8AA 5FWCA 3UA7A 1WDXA 2A28A 2A37A 2EGCA 1TG0A 4JJCA 2K79A 2M51A 1I07A 4A63B 3A98A 4Z88A 1G83A 1NLOC 5ECAA 1VA7A 1PRMC 2AZSA 2RNAA 2YUQA 3CQTA 2O2OA 3GBQA 2F2WA 1U3OA 2O88A 2DL3A 3VS2A 1FYNA 1SRLA 2SRCA 1X6GA 3UATA 1VYUA 2EVRA 2LJ1A 4LNPA 1ABOA 1B3QA 1M8MA 1OEBA 4F16A 1Z9ZA 2YUOA 4DEYA 4AG2C 1B07A 2OAWA 2SEMA 3VS0A 2AKKA 2KRNA 3M0TA 2PTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OI3 A;  2KEA A;  1BU1 A;  2EQI A;  2V1R A;  2RQR A;  4D8K A;  1FMK A;  3VS5 A;  1RUW A;  1PHT A;  1HD3 A;  4Y92 A;  2RF0 A;  2ABL A;  2O9S A;  1WI7 A;  4IIM A;  4ESR A;  2DL8 A;  5IXF A;  1T0H A;  2EYY A;  1AVZ C;  1UUE A;  2JT4 A;  2K6D A;  1ZUU A;  1AWJ A;  2GQI A;  5I22 A;  1K0X A;  2GNC A;  5EC7 A;  1AZG B;  1UG1 A;  2RMO A;  3JV3 A;  3NHN A;  3O5Z A;  2JS0 A;  3VRY A;  2JM8 A;  3KFV A;  1IO6 A;  2MOX A;  1CKA A;  2DL4 A;  5IHI A;  1I0C A;  1W70 A;  1X27 A;  2DE0 X;  5IHN A;  2W10 A;  3EHQ A;  4X1V A;  2J6F A;  2KNB B;  2LQN A;  2RQU A;  5GJV B;  1PKS A;  3VS4 A;  1H3H A;  5I11 A;  2DF6 A;  2CDT A;  3LH5 A;  3ULR B;  1JO8 A;  1QKW A;  4LUE A;  2AKL A;  2LCS A;  4HVU A;  4LN2 A;  1ZX6 A;  1ZSG A;  2D1X A;  2BZY A;  2HSP A;  2J6O A;  1K76 A;  2HDA A;  2ROT A;  1WXB A;  1QWF A;  3EHR A;  1JEG A;  2G6F X;  1UJ0 A;  2LJ0 A;  3REB B;  2AZV A;  1WFW A;  2EGA A;  2ED0 A;  2V1Q A;  1H8K A;  4J9B A;  1QKX A;  2RQW A;  2DMO A;  3EG1 A;  1M3C A;  2A36 A;  2J06 A;  3H41 A;  1MV0 B;  2KT1 A;  1ZLM A;  1WYX A;  2C0I A;  2GTJ A;  1KJW A;  1M27 C;  2PNI A;  3VS7 A;  3U23 A;  2LJ3 A;  2JS2 A;  2PZ1 A;  1LCK A;  2DBK A;  2KRM A;  4J9C A;  1KFZ A;  3M0R A;  2XMF A;  1VYT A;  3IQL A;  4J9I A;  2DNU A;  2L3P A;  1ZUY A;  4AFU C;  2GGR A;  2L2P A;  1GBR A;  1K9A A;  1PWT A;  2C0T A;  2FRW A;  4M4Z A;  2VKN A;  4OMQ A;  1V1C A;  3UA6 A;  1UTI A;  2DLP A;  1NM7 A;  3EG3 A;  2K3B A;  3NPF A;  4GBQ A;  3REA B;  1SEM A;  2H8H A;  1PNJ A;  1E6H A;  5IXB A;  2EYZ A;  5L23 A;  4LUD A;  1UJY A;  2CH4 W;  2LQW A;  2F2V A;  2C0O A;  2EYX A;  1QCF A;  1SHG A;  1X6B A;  4WCI A;  1W1F A;  3VS1 A;  1JU5 C;  1OPL A;  2KR3 A;  4HCK A;  1NYF A;  3TVT A;  2YUP A;  4RTX A;  1UE9 A;  1M3A A;  4KRT A;  1SPK A;  1BB9 A;  2X3X D;  1G2B A;  2P4R A;  2O31 A;  1YNZ A;  4ORZ A;  5FWB A;  2D0N A;  1RLQ C;  2BZ8 A;  2W0Z A;  3M0Q A;  1CSK A;  4J9H A;  4JZ3 A;  2F2X A;  2CSI A;  2K7A A;  1GCP A;  2FO0 A;  1BBZ A;  1NLP C;  1AD5 A;  1RI9 A;  3QWX X;  2I0N A;  4OML A;  1U5S A;  3C0C A;  4E6R A;  1UFF A;  2EBP A;  3I9Q A;  1KIK A;  1JXO A;  1WXT A;  2YDL A;  2DJQ A;  2JW4 A;  5GJW B;  1NG2 A;  1WA7 A;  5IHK A;  4CC2 A;  3PVL A;  2CUB A;  2L3S A;  1AOJ A;  3M0P A;  1OOT A;  2DVJ A;  2FRY A;  2KXC A;  2ED1 A;  2YSQ A;  1K4U S;  2VWF A;  3RBB B;  2KXD A;  3H0F A;  3VS6 A;  1UHC A;  2DL5 A;  1GFD A;  1A0N B;  1GCQ A;  1QWE A;  1ARK A;  2ROL A;  1YN8 A;  2HCK A;  1J3T A;  2KYB A;  1OV3 A;  4OMP A;  2MIO A;  3ZL7 C;  4J9F A;  4ZNX A;  1BK2 A;  1MV3 A;  1N5Z A;  2LP5 A;  2AK5 A;  2JMC A;  1W6X A;  1Y57 A;  2RQV A;  2KRS A;  1PRL C;  3QWY A;  2IIM A;  3EG2 A;  2CRE A;  2MCN A;  2DA9 A;  1UEC A;  3NMZ C;  2JTE A;  4F14 A;  2NUZ A;  4J9E A;  1T3L A;  2E5K A;  2FPE A;  1RLP C;  1T0J A;  2LNH B;  4LE9 A;  4D8D A;  4AFS C;  3FJ5 A;  2DRM A;  3VRZ A;  4RTU A;  2GBQ A;  4HVW A;  3M0U A;  2BZX A;  4CC4 B;  1AWW A;  1ZBJ A;  1EFN A;  3UF4 A;  2HBW A;  4OMN A;  4RTZ A;  2M0Y A;  4FSS A;  4K11 A;  4R0K A;  3PVQ A;  4EIK A;  1H92 A;  1S1N A;  4IIO A;  3TSW A;  1HJD A;  4RTT A;  4AG1 C;  2KBT A;  2CH4 A;  1AEY A;  4RUG A;  1AWX A;  2GTO A;  1YWP A;  2CT4 A;  1E7O A;  2A08 A;  3EGU A;  3TSZ A;  1GCQ C;  2KE9 A;  2KRO A;  3EG0 A;  1KSW A;  2K9G A;  1M3B A;  2O9V A;  2FEI A;  4GLM A;  5FW9 A;  1AZE A;  2LX7 A;  2RN8 A;  2FPD A;  1HSQ A;  3SHW A;  1SRM A;  1Z9Q A;  2L3Q A;  3H0I A;  3VS3 A;  1YP5 A;  1GRI A;  1MUZ A;  1JXM A;  2EGE A;  1T3S A;  2JM9 A;  2B86 A;  2KGT A;  3RNJ A;  1E6G A;  2CT3 A;  1WXU A;  2EYW A;  1X69 A;  1YWO A;  2HEQ A;  1TUC A;  1NEG A;  1YCS B;  1X43 A;  2DX1 A;  1WLP B;  1SSH A;  1UGV A;  2DM1 A;  4CC7 A;  1XOV A;  4DEX A;  2LZ6 B;  2J6K A;  2KT8 A;  1WIE A;  1M30 A;  2JMA A;  2CSQ A;  2DL7 A;  2YT6 A;  1PKT A;  2K2M A;  2QDL A;  5IH2 A;  2ESW A;  4OMM A;  1Y0M A;  4JPB W;  4CC3 A;  2FG0 A;  2DIL A;  1K1Z A;  3THK A;  3H0H A;  1I1J A;  3I5R A;  3I5S A;  1SHF A;  2X3W D;  2FPF A;  1ABQ A;  4RTV A;  2D8H A;  2DYB A;  4RTY A;  1WX6 A;  2NWM A;  1UHF A;  1GBQ A;  4J9D A;  4J9G A;  4AFZ C;  1X2K A;  4JJD A;  2VVK A;  4QT7 A;  1ZUK A;  1AWO A;  4JZ4 A;  3SEM A;  2YUN A;  2LMJ A;  1NEB A;  1VYV A;  1UDL A;  1TUD A;  4OMO A;  4HVV A;  1GFC A;  4F17 A;  2OJ2 A;  1NYG A;  2CUD A;  2EKH A;  1K0S A;  2ENM A;  2RPN A;  2JXB A;  2EPD A;  4AFQ C;  4JJB A;  5HCK A;  1U06 A;  2D8J A;  3I35 A;  4HXJ A;  1X2Q A;  3R6N A;  2DBM A;  1GL5 A;  2L0A A;  2DRK A;  2ECZ A;  3M0S A;  4Z89 A;  3NGP A;  3PE0 A;  2J05 A;  2BTT A;  2J7I A;  1JQQ A;  2RQT A;  1CKB A;  4RTW A;  1OPK A;  1QLY A;  2KYM A;  2EW3 A;  4Z8A A;  5FWC A;  3UA7 A;  1WDX A;  2A28 A;  2A37 A;  2EGC A;  1TG0 A;  4JJC A;  2K79 A;  2M51 A;  1I07 A;  4A63 B;  3A98 A;  4Z88 A;  1G83 A;  1NLO C;  5ECA A;  1VA7 A;  1PRM C;  2AZS A;  2RNA A;  2YUQ A;  3CQT A;  2O2O A;  3GBQ A;  2F2W A;  1U3O A;  2O88 A;  2DL3 A;  3VS2 A;  1FYN A;  1SRL A;  2SRC A;  1X6G A;  3UAT A;  1VYU A;  2EVR A;  2LJ1 A;  4LNP A;  1ABO A;  1B3Q A;  1M8M A;  1OEB A;  4F16 A;  1Z9Z A;  2YUO A;  4DEY A;  4AG2 C;  1B07 A;  2OAW A;  2SEM A;  3VS0 A;  2AKK A;  2KRN A;  3M0T A;  2PTK A; 
#chains in the Genus database with same CATH topology
 2OI3 A;  3JCM P;  4QKU A;  1BU1 A;  2DVE A;  2EQI A;  3QDF A;  2CS7 A;  3MHX A;  1FMK A;  1RUW A;  2E65 A;  4XTY A;  5LJ5 d;  2JVV A;  5DM7 R;  1RAE B;  3CCV Q;  1FX7 A;  1YJ9 Q;  4PFO A;  1AVZ C;  1BCO A;  5GAN g;  1UUE A;  4PJO F;  2R5A A;  1TSF A;  4F7U G;  2GQI A;  3DLL A;  1LOJ A;  1VQN T;  4N0A C;  3M4Y A;  4N4H A;  2GNC A;  1AZG B;  1U1S A;  2FB7 A;  3OSS C;  2JM8 A;  2E3I A;  2X4W A;  3KFV A;  4M75 F;  4A54 A;  2MOX A;  4C92 C;  1I0C A;  1K8A C;  5GMK i;  1OYX A;  5GMK e;  2RHY A;  1LNX A;  4XTX A;  4JS5 A;  5LJ5 e;  2PVD B;  1Q82 U;  1TUG B;  1PSF A;  2FL7 A;  5CIU A;  4A4H A;  1YJW T;  5D6X A;  1VQK Q;  2RQU A;  5GAO l;  3VS4 A;  1VIF A;  1Y07 A;  2VUB A;  4WTO B;  2QTX A;  2MF2 A;  4KUL A;  4LUE A;  3MEV A;  3HFO A;  4OB0 B;  3MP6 A;  4HVU A;  1Q86 C;  4M7D A;  3SFM A;  4JRQ A;  2J6O A;  1K76 A;  2HDA A;  1D1A A;  3LWH A;  4LDX A;  4LDW A;  1WPY A;  3OYH A;  2QQB A;  5KYX B;  2LT4 A;  3QZ5 B;  3REB B;  4PKC C;  1WFW A;  1UB4 A;  5FU7 C;  2NYS A;  1H8K A;  2QAS A;  3EG1 A;  3H41 A;  4F7U E;  2GTJ A;  3OYY A;  1M27 C;  3JCM Q;  1VIE A;  3BDL A;  2PNI A;  2E12 A;  2VYT A;  4AMC A;  5HK3 A;  3VS7 A;  3JCM X;  4JUV A;  4J9C A;  2PU9 B;  1G3Y A;  3CPW S;  3A8M B;  2DNU A;  3ZFJ A;  1U1T A;  3TCJ A;  5GAN 3;  3NTI A;  3GNF B;  2DO3 A;  1K9A A;  1PWT A;  4DBQ A;  1Y96 A;  2DPP B;  1D1C A;  1QP2 A;  3X28 B;  2VKN A;  2ZPE B;  1V1C A;  3UA6 A;  1I5O B;  2DLP A;  4BD3 A;  3OYK A;  3OYL A;  3GPL A;  4M7D D;  3H9N A;  1E6H A;  3MKD A;  5J3B A;  1YI2 T;  1PD1 A;  4LUD A;  4PNO A;  2LQW A;  3PIP A;  3V8K A;  2VAS A;  2X35 A;  3CD6 T;  1YI2 A;  4BY6 B;  4RG8 A;  2QA4 A;  1I81 A;  2M0O A;  4EMK B;  1DJ7 B;  3VS1 A;  1KQS P;  2L89 A;  2NUP A;  2RHU A;  1BB9 A;  2X3X D;  1G2B A;  2COW A;  2P4R A;  1Q82 R;  2W0Z A;  1Q95 G;  4M7D B;  3J81 E;  3OYI A;  3L2Q A;  5GAN 4;  3S3N A;  1UEB A;  2K7A A;  2XDP A;  3RES A;  3E2U A;  3P8D A;  5KYY A;  3HRT A;  2MPX C;  3QWX X;  2G3R A;  3I9Q A;  3H8Z A;  2JW4 A;  5GMK j;  3EH2 A;  4RG2 A;  1KQS A;  3OYM A;  5IHK A;  5LJ5 j;  5AT1 B;  2CUB A;  2L3S A;  2IVW A;  3M0P A;  5KCO A;  1RAC B;  2BE7 D;  2ED1 A;  1K4U S;  2VWF A;  4OP0 A;  3RBB B;  3H0F A;  1C6V X;  3CCJ T;  2HCK A;  5GMK h;  5A0D A;  2MIO A;  1M8V A;  3ZL7 C;  2LT1 A;  1OU9 A;  4ZTJ A;  4FT4 A;  2CGH A;  1EX4 A;  1OX8 A;  1Y57 A;  1PRL C;  3OQ5 A;  3QWY A;  2OAU A;  2QA4 Q;  5GAN 8;  4Q5W A;  3H6Z A;  2DIQ A;  4F14 A;  2NUZ A;  5GMK m;  1YJN T;  1T3L A;  1W4S A;  1SKU B;  3RMS A;  5GAN 2;  4LE9 A;  3L2U A;  5LJ5 f;  4FM4 B;  1K73 U;  3VRZ A;  4HVW A;  2BZX A;  1I8F A;  2CYZ B;  3GOX A;  3RR6 A;  4OGE A;  4OMN A;  3AHU A;  4FSS A;  4R0K A;  1S72 T;  3PVQ A;  1H92 A;  1VQO T;  2COY A;  4RTT A;  1VQ5 A;  1S72 A;  4JLG A;  1K9M C;  1AEY A;  1YWP A;  8ATC B;  1E7O A;  2A08 A;  3QUI A;  1Y71 A;  1GCQ C;  2KRO A;  2CZ6 B;  1BI1 A;  5KYY B;  2A7Y A;  1WHG A;  2X9H A;  2LX7 A;  2B8A A;  1KD1 R;  4M7A G;  1Z9Q A;  3H0I A;  3X20 B;  2EGE A;  1T3S A;  2KGT A;  4J5Y A;  2CT3 A;  4C0F A;  2EYW A;  2HEQ A;  4C8Q G;  1NEG A;  3LW5 E;  3V7S A;  1KG1 A;  4J6W A;  2DX1 A;  1WLP B;  2KK4 A;  4M75 C;  1VQ8 A;  3OMC A;  1UGV A;  4CC7 A;  1B34 A;  4YTL A;  1XOV A;  2YWW A;  2HL5 C;  3R6O A;  2E5Q A;  1IZ6 A;  2MYS A;  2F1L A;  2FZC B;  3RKX A;  4A4K A;  1QCO A;  1PKT A;  3P8B B;  4ELZ C;  4QQG A;  4CC3 A;  3JCM c;  4QVD A;  1K1Z A;  1M1F A;  1JJ2 S;  4M7D F;  2QQA A;  1SHF A;  2X3W D;  2ZPH B;  2FPF A;  1ABQ A;  2DD4 A;  2YRC A;  1VQ5 Q;  1S72 Q;  3L42 A;  1UGP B;  1WX6 A;  4M77 B;  6AT1 B;  4C92 G;  5CCA A;  4J9D A;  4DBH A;  1HYO A;  4AFZ C;  1W2B S;  2PVG B;  3L1A A;  1D3B B;  4FYX B;  4QT7 A;  3V8J A;  1VQ4 T;  4LDU A;  4OF1 A;  4JLI A;  3INZ A;  1IB8 A;  1WNL A;  2ZZD A;  2ATC B;  3QII A;  3CCU T;  4M7A E;  4B9X A;  4F17 A;  1K73 R;  2QYZ A;  1NJI U;  4JJB A;  4C8Q E;  5HCK A;  1U06 A;  2YXY A;  2ZGW A;  2ZPB B;  1VQ8 Q;  1NPP A;  4AT1 B;  2EJG A;  2L0A A;  2P0P A;  2DRK A;  3NGP A;  2X4J A;  4CRI A;  2BTT A;  4L59 A;  1IRE B;  3GF5 A;  3X26 B;  3WXM B;  1OPK A;  1VQP T;  2RI3 A;  1WDX A;  2CP3 A;  3L2V A;  3OSV A;  3EFR A;  5KE3 A;  8AT1 B;  2OTJ A;  2DZC A;  1I07 A;  3A98 A;  4C92 E;  5CR2 A;  3CCS A;  1F1B B;  3FJP A;  2V8K A;  3QPH A;  3CQT A;  1D1B A;  3A8O B;  3HPW A;  1U3O A;  2O88 A;  2ZPI B;  1SRL A;  1X6G A;  3UAT A;  2M16 A;  1IGU A;  4A4E A;  4LNP A;  3QJY A;  3M9Q A;  2CKK A;  5LJ5 g;  3CPW P;  2RA2 A;  2AKK A;  2KRN A;  3EGD B;  4IUP A;  3M0T A;  3CBO A;  4XU1 A;  3A1P A;  3OYN A;  2RO0 A;  3J7A F;  4JRP A;  3OW2 S;  3HL8 A;  4D8K A;  4JJN K;  2HQH A;  1HD3 A;  2ABL A;  2O9S A;  1KQ1 A;  1RI0 A;  5IXF A;  1M1G A;  3OY9 A;  2K57 A;  5GMK l;  3CPW A;  3QDR B;  4C5G A;  2CP5 A;  4N4I A;  2OTJ Q;  2DJZ A;  4C0D B;  5KH6 A;  1BI3 A;  1NJI R;  2QTV A;  2RMO A;  3WVD B;  1G3T A;  2JNG A;  4Y91 A;  3NHN A;  3CCS Q;  4JRK A;  2JS0 A;  2K5F A;  2DL4 A;  5FU6 C;  1W70 A;  4E7J A;  1X27 A;  2HQX A;  2VGM A;  3EHQ A;  4X1V A;  1WZO A;  2KNB B;  3JCM W;  1RL2 A;  4C0G A;  5DLO A;  4F7U B;  2CDT A;  3LH5 A;  2GFA A;  1JO8 A;  3M58 A;  3QZ9 B;  9ATC B;  2Y4Y A;  2E4H A;  2LCS A;  4LN2 A;  3BFM A;  2BZY A;  5GAO p;  3RDV A;  1TXQ A;  1X75 C;  1MMG A;  2ROT A;  4J7F A;  1WXB A;  3CCV T;  3MEU A;  2HL3 A;  1YJ9 T;  3CC4 A;  1UJ0 A;  3C12 A;  2LJ0 A;  1EZZ B;  3O8V A;  2EGA A;  2ED0 A;  4MZT A;  4J9B A;  1R8O B;  1QKX A;  2VGN A;  1MV0 B;  4FL6 A;  1N9S A;  1ZLM A;  2C0I A;  1KJW A;  3CCM A;  5CVI A;  3VU3 C;  5CKB A;  1QP3 A;  2KY9 A;  3GLX A;  2DBK A;  2KRM A;  2FZG B;  2RB6 A;  2WAC A;  3CCQ Q;  3M57 A;  2F5T X;  4M78 C;  4VUB A;  1ZUY A;  4AFU C;  3HRU A;  3NFC A;  3C94 A;  1G3S A;  1VQK T;  4LD9 K;  1IXD A;  4KUI A;  4R56 A;  3CMA Q;  2OTL A;  1RAA B;  4FU6 A;  4M7A C;  2C06 A;  3CCR T;  1WGS A;  2LTO A;  4DBF A;  1UTI A;  1NM7 A;  3CCR A;  2NLU A;  3EG3 A;  3JB9 I;  5LJ3 d;  4GBQ A;  3REA B;  2CP2 A;  5CK9 A;  5IXB A;  1BKB A;  2KDS A;  5C6S A;  4C5I A;  2GF7 A;  2L5Q A;  2HZY A;  4M75 G;  1QCN A;  2F2V A;  1YHQ Q;  3X24 B;  2E70 A;  3CC4 Q;  1SHG A;  1X6B A;  1M2O A;  1W1F A;  3LGL A;  3LH0 A;  4WCI A;  1U8R A;  2KR3 A;  4J8O A;  4RTX A;  1D0X A;  3PGG A;  1UE9 A;  2EKO A;  1WJQ A;  1SPK A;  3KBG A;  4ORZ A;  4F04 B;  5FWB A;  1YNZ A;  3HRS A;  1ACM B;  2D0N A;  1RAB B;  2BZ8 A;  2QEX Q;  3CCM Q;  3NTH A;  1CSK A;  1WQ7 A;  4JZ3 A;  4DA4 A;  2X4X A;  2I2L A;  3AT1 B;  5GAN 5;  5LJ3 e;  4QQ6 A;  1BBZ A;  2FO0 A;  1BI2 A;  2DTO A;  4OML A;  4HT9 A;  3OYB A;  1JXO A;  2YDL A;  1N8R C;  2DZ9 A;  3A8G B;  1M90 C;  2LDM A;  3X25 B;  1HK9 A;  3FIF A;  2OTL Q;  4MZM A;  2LX9 A;  1OU8 A;  3UPU A;  2DVJ A;  1WHH A;  2KXC A;  4EMK A;  3LYI A;  4FYY B;  4PLI A;  3I55 Q;  1QWE A;  1ARK A;  2ROL A;  3QXE B;  3CCR Q;  1J3T A;  2KYB A;  2MWP A;  2XD0 A;  3BW1 A;  2DD5 A;  1BYM A;  1JJ2 P;  2H3J A;  4ZNX A;  2KQW A;  4JS4 A;  2LP5 A;  3L2Z A;  2AK5 A;  2R58 A;  5CKD A;  1PG5 B;  4M75 E;  1OUL A;  2KSS A;  1W2B P;  2IIM A;  3EG2 A;  3BE3 A;  4ELY C;  3OYA A;  1UEC A;  3QKJ A;  2JTE A;  2FZK B;  1JJ2 A;  2E1H A;  4XU3 A;  2HMA A;  1VQL A;  4D8D A;  3EFS A;  4KGX B;  1YIJ T;  3FJ5 A;  2BUD A;  2P4T A;  4RTU A;  4BDZ A;  1YIJ A;  1W2B A;  1AWW A;  3MET A;  3UF4 A;  4QQD A;  1KQ2 A;  5HKC A;  1S1N A;  2MK5 A;  2CP0 A;  4AG1 C;  4N0A A;  2CT4 A;  3HHT B;  2X4Y A;  1Q81 C;  2KE9 A;  3DB4 A;  3SWN C;  4GLM A;  3BDU A;  4J83 A;  2DKG A;  4C92 A;  2XID A;  1PM3 A;  3SHW A;  1SRM A;  2K5L A;  3VS3 A;  4RKU E;  1YP5 A;  1GRI A;  1JXM A;  3PNW C;  2O4X B;  4O6J A;  2QA4 T;  5KE2 A;  1YWO A;  2BE9 B;  4TVR A;  1EIF A;  4MDX A;  2HAX A;  2E6Z A;  1KD1 U;  3ME9 A;  2YRV A;  2EAY A;  4DEX A;  1Q7Y C;  3EG9 A;  2F69 A;  5IAY A;  1VQL Q;  1WIE A;  2XIC A;  2Y4X A;  5LJ3 j;  2DXU A;  4NS5 A;  1YIJ Q;  1M1K U;  4PL6 A;  3OS1 A;  2DIL A;  4PFZ A;  3H0H A;  3KUF A;  1JBM A;  1I1J A;  3WVE B;  3I5S A;  4C8Q B;  2D8H A;  3OW2 P;  1R0B G;  4EMG A;  2QAZ A;  2NWM A;  1OX9 A;  1GBQ A;  1X2K A;  4JJD A;  3QBY A;  2RH2 A;  1AWO A;  3SEM A;  1B7T A;  5J26 A;  2D9T A;  5LJ5 h;  1NEB A;  1VYV A;  3RER A;  1TUD A;  4OMO A;  2DFU A;  4PJM A;  5GAM j;  1NYG A;  2ZAE A;  3HTR A;  3OW2 A;  5M9O A;  2EPD A;  3CCL Q;  2DIG A;  4FW2 A;  3ZEH A;  1X6O A;  3I35 A;  1ZA2 B;  3EFO A;  1C1A A;  1M9S A;  2DBM A;  2VV5 A;  3MP1 A;  4XU2 A;  2LRQ A;  5EG2 A;  4C92 B;  3E9G A;  3Q1J A;  4Y28 E;  3PE0 A;  1PSE A;  1VQ6 A;  2P0K A;  1BI0 A;  1JQQ A;  2DEQ A;  1CKB A;  4M77 A;  4RTW A;  4OB3 B;  1QLY A;  1D3B A;  3UA7 A;  2A28 A;  2GQV A;  1KHC A;  2R5M A;  3JAM E;  3GNG A;  3PMT A;  1VQ5 T;  1TG0 A;  3E19 A;  2DXC A;  2M51 A;  3EG9 B;  1HXD A;  5DLQ E;  2ZPG B;  2QK0 A;  3BY7 A;  4M78 G;  2L3R A;  1KC8 U;  2E6N A;  2Y90 A;  3GBQ A;  2QGG A;  1I4K 1;  4PJO C;  2DL3 A;  1FYN A;  5FU7 B;  3M4G A;  1QVF S;  5A0L A;  3A5Z B;  1WJS A;  2RHI A;  3JB9 D;  2M1H A;  1B3Q A;  1M1K R;  1VQ8 T;  2RI2 A;  1Z9Z A;  1B07 A;  2OAW A;  2SEM A;  1FMW A;  3SD4 A;  3VS0 A;  3JCM J;  4NOY A;  2PTK A;  4M77 D;  2KEA A;  1VQ6 Q;  2RQR A;  1G8X A;  3JCM d;  3VS5 A;  1RAH B;  1PHT A;  2PVO B;  4IIM A;  4ESR A;  2DL8 A;  1T0H A;  2RK1 A;  2EYY A;  1P92 A;  3EFO B;  3MEA A;  4NL2 A;  3CCE Q;  2JT4 A;  2K6D A;  5CAI A;  3JB9 H;  1K0X A;  3CBP A;  5EC7 A;  1NPR A;  1UG1 A;  5IT9 E;  3JV3 A;  3FRN A;  4M78 E;  3VRY A;  5C0M A;  2RJD A;  2RM4 A;  1Q82 C;  5IHI A;  3EGD A;  1M2V B;  2QQ9 A;  1D09 B;  3JCM e;  3NTK A;  2DXT A;  4Z02 A;  1K8A U;  2LQN A;  2E64 A;  1H3Z A;  4HCC A;  3LGF A;  1VQM A;  1PKS A;  3V7C A;  1D0Y A;  5I11 A;  4M7D E;  2LC4 A;  3PT9 A;  3VV0 A;  4DQ2 A;  2MMP A;  3ULR B;  3OMG A;  4EPC A;  1QKW A;  4KBM B;  2AKL A;  1ZX6 A;  1ZSG A;  2D1X A;  2KI7 A;  1ZSZ C;  3J80 E;  4IKF A;  2WSC E;  3M55 A;  1BIA A;  3QYH B;  4PLL A;  3G6E A;  1G3W A;  1WHK A;  3TU4 K;  1QWF A;  3A8H B;  1Q86 U;  2G6F X;  1KC8 R;  3KXT A;  4KGZ B;  4HKE A;  5KYW B;  1AT1 B;  2AZV A;  1H64 1;  3F70 A;  2OTJ T;  2JTF A;  1XJW B;  1M3C A;  2A36 A;  1JB0 E;  1WYX A;  4IUV A;  3CCS T;  2DEU A;  4O5V A;  1N27 A;  4OMF B;  3U23 A;  4GLK A;  2PZ1 A;  4F7U A;  4V2S A;  1VQ7 A;  3M0R A;  2XMF A;  1KHI A;  4BE0 A;  4J9I A;  1ZHI A;  4HA8 A;  1YFN A;  2KVQ G;  3OB9 A;  1ZA1 B;  3EH1 A;  3DLM A;  5LJ3 g;  4FW1 A;  2C0T A;  2FRW A;  4EDU A;  4M4Z A;  1VQM Q;  4IUQ A;  1OZ3 A;  1MNE A;  3CME Q;  2WSF E;  5KCH A;  2RHX A;  2HBP A;  2K3B A;  3NPF A;  4XTZ A;  3TRE A;  1SEM A;  4QW2 A;  2EYZ A;  5L23 A;  1UJY A;  5GAN 6;  3HKS A;  3QHS A;  4MZP A;  3G6E Q;  4FCY A;  2JTM A;  2HSE B;  5J39 A;  2C0O A;  2EYX A;  4MML A;  1KD1 C;  3CC2 T;  4HCK A;  3HP9 A;  3CC2 A;  1M3A A;  4KRT A;  2P0Q A;  3LX7 A;  1WHJ A;  1SG5 A;  2XDB A;  1BCM A;  4N4G A;  1N8R R;  5GAM g;  1K8A R;  3M0Q A;  1QVG S;  2E3H A;  3CBM A;  4J9H A;  1M90 R;  1FXX A;  2CSI A;  2AIR B;  3VKI A;  1MMD A;  2V8J A;  3JB9 F;  1GCP A;  1NLP C;  2JOY A;  3M53 A;  3CCQ T;  5FRM A;  1AD5 A;  1VQ7 Q;  1GXI E;  1UFF A;  2EBP A;  1IHW A;  1WXT A;  5GAO r;  1X01 A;  5GJW B;  3CCQ A;  1NG2 A;  1WA7 A;  4E7H A;  3G71 A;  4CC2 A;  5GAN 7;  4M75 B;  3CMA T;  4PFP A;  4M77 F;  1OI1 A;  1LVK A;  3OYE A;  3CMA A;  4C5H A;  4E47 A;  2DK3 A;  2YSQ A;  1Q86 R;  2KXD A;  2CZ0 B;  3VS6 A;  3CC7 Q;  1A0N B;  4HT8 A;  1BIB A;  3D7S B;  2EWN A;  1VUB A;  1OQK A;  1SF9 A;  3JCM h;  4J9F A;  1BK2 A;  1MV3 A;  1YHQ T;  2HKN A;  3URG A;  4JRI A;  1W6X A;  3CC4 T;  2KRS A;  1YHQ A;  4C5E A;  4E7Z A;  3M54 A;  3SB2 A;  2MCN A;  2DA9 A;  2VB6 A;  3NMZ C;  4A4F A;  4RCC A;  1K73 C;  2QEX T;  3CC2 Q;  4J9E A;  2XG8 D;  3CCM T;  4XTV A;  3ASK A;  1WQW A;  3VYG A;  1T0J A;  2QEX A;  3JCM f;  4OVA A;  5AYF A;  2D0Q B;  2DRM A;  5I2S A;  4CC4 B;  1O9S A;  2DAQ A;  1VQ9 A;  2M0Y A;  3G71 Q;  2X51 A;  2OTL T;  4EIK A;  4IIO A;  1UGS B;  4QVC A;  3TSW A;  1HJD A;  1MMA A;  3QYG B;  4BY6 C;  4X34 A;  1TU0 B;  1WHL A;  3PFS A;  3VJP A;  4RUG A;  1AWX A;  2GTO A;  3I55 T;  4EMK C;  2KAF A;  5CQX A;  3EGU A;  3TSZ A;  3EG0 A;  3I55 A;  4PJO G;  1M3B A;  2FEI A;  1K9M U;  3EAE A;  5CKF A;  1AZE A;  3CXC S;  4M7D C;  3M56 A;  2L3Q A;  3RNJ A;  2JM9 A;  2B86 A;  2KMT A;  3CPF A;  1TUC A;  3M59 A;  1Q7Y R;  1X43 A;  4HCB A;  4FIB A;  3DKM A;  2DM1 A;  2A3L A;  4BI8 B;  2LNV A;  4ZN1 A;  1M30 A;  1XTD A;  5I2M A;  1QVF P;  1PC0 A;  2JMA A;  2BKD N;  2EJF A;  3RIR A;  5KYN A;  3S3M A;  5IH2 A;  4OMM A;  2HQE A;  5A2Q E;  5GAM d;  4JPB W;  4R55 A;  5LL6 S;  4D6W A;  2FG0 A;  3JRZ A;  1VQ9 Q;  1UGQ B;  4X9D A;  3I5R A;  4EMH A;  3N5B B;  3OS0 A;  2O4X A;  2QQS A;  2DYB A;  4RTY A;  2JUF A;  2RI5 A;  3UT1 A;  1QVF A;  4BE2 A;  1VQN A;  4J9G A;  1OZ2 A;  5D6Y A;  3TEE A;  4PJO E;  4BAC A;  2YUN A;  2LMJ A;  1NJI C;  4M78 A;  3G1J A;  3RUX A;  1GFC A;  1I5L A;  2CUD A;  2DXB A;  2FYK A;  4P5N A;  4F7U F;  5GAM e;  2EKH A;  1K0S A;  2QG9 B;  2JXB A;  4II1 A;  4E7I A;  4AFQ C;  1YJW A;  4M7A A;  5FLX E;  4KGV B;  1IRX A;  4HXJ A;  1ZBX A;  2IPO B;  3R6N A;  4DBR A;  3QSU A;  2JJ9 A;  1VQL T;  5FU6 B;  4C8Q A;  3M0S A;  4BI3 A;  4ZGJ B;  2J05 A;  3L2W A;  2DTI A;  3OS2 A;  2BIV A;  2XKO C;  2KYM A;  2EW3 A;  2MWO A;  1M5Q 1;  1MGQ A;  3FLG A;  4E7K A;  1K9M R;  2K4Y A;  2V8I A;  4B6M A;  2K3Y A;  2ZPF B;  1QVP A;  4Z88 A;  1G83 A;  4KUD K;  3PTA A;  2IG0 A;  2YLC A;  1VQN Q;  1VA7 A;  3T9N A;  5GAO n;  2AZS A;  2RNA A;  2YUQ A;  4M78 D;  3G7Z A;  4QVZ A;  2XK0 A;  3VS2 A;  2E41 A;  3CCL T;  1VYU A;  2WSE E;  4M7A D;  2LJ1 A;  2QGF B;  3RKY A;  3CCL A;  5FRO A;  2LVM A;  1ABO A;  1YJW Q;  2RJF A;  1M8M A;  3UDC A;  1RAI B;  4F16 A;  2R57 A;  4IUU A;  3PIO A;  4AG2 C;  4L6V 5;  3JCM g;  4C8Q D;  2QXF A;  1TS9 A;  3OYF A;  4WF2 A;  4M78 B;  3QO3 A;  4M77 C;  2V1R A;  2PUK B;  2RK2 A;  5KYU A;  2PUO B;  1NE8 A;  5CKE A;  4Y92 A;  2RF0 A;  1WI7 A;  2FHD A;  4M7A B;  3CD6 A;  1RAG B;  2F5K A;  4LDY A;  2LQ8 A;  2COZ A;  4FSX A;  1VOM A;  1ZUU A;  2AT1 B;  1AWJ A;  5I22 A;  3RMQ A;  5GAN d;  5LJ3 h;  3I56 T;  3O5Z A;  4XTU A;  1NBE B;  3OBW A;  1IO6 A;  4C92 D;  3I56 A;  1CKA A;  3GP8 A;  2DE0 X;  5IHN A;  2W10 A;  2EYQ A;  5HK0 A;  4OB1 B;  2J6F A;  2ZCF B;  1QVG P;  3SDZ A;  4ZTF A;  3OA6 A;  3ER0 A;  5IN1 A;  5GJV B;  4E2F B;  2QI2 A;  2PQW A;  1H3H A;  4KH0 B;  2DF6 A;  3OYJ A;  2HNI A;  5LJ3 f;  3SWN A;  2O01 E;  4OGC A;  1VQ6 T;  1UGR B;  3CCJ A;  2RD1 A;  5GAN e;  5CO7 A;  3VUZ A;  2HSP A;  3MCA B;  4BDY A;  5GAM h;  1TWB A;  1QVG A;  3EHR A;  1YI2 Q;  1Y96 B;  3A8L B;  1JEG A;  1V29 B;  2FVU A;  3CD6 Q;  1M2V A;  4PK4 A;  3CCE T;  1SSF A;  2E10 A;  2NUT A;  2V1Q A;  4IUT A;  1RAF B;  2RQW A;  3CCE A;  2DMO A;  1PD0 A;  3LLR A;  2J06 A;  2KT1 A;  4XU0 A;  2HKQ B;  1LJO A;  2K2V A;  1YJN A;  4MMK A;  5KYU B;  2LJ3 A;  2JS2 A;  1LCK A;  2MI6 A;  3RKW A;  5GAM f;  1KFZ A;  3I56 Q;  1VYT A;  3IQL A;  2YRD A;  2NUP B;  2L3P A;  1MMN A;  2GGR A;  1D0Z A;  2L2P A;  4XQ3 A;  1XQH A;  3PMI A;  1GBR A;  1VQO A;  4FYV B;  3JCM V;  1QMC A;  2EQM A;  4XTW A;  4GY5 A;  4OMQ A;  5KYW A;  5FRN A;  4M7D G;  1Y7X A;  3OBY A;  3JSC A;  1ZQ1 A;  4BE1 A;  1TOV A;  4C0D C;  3CCJ Q;  4LXC A;  2YLB A;  2H8H A;  1PNJ A;  2EQK A;  2CH4 W;  4J6Y A;  4NL3 A;  3ZBD A;  1QCF A;  1PCX A;  1JU5 C;  1OPL A;  1YCY A;  1N9R A;  4M78 F;  1NYF A;  3TVT A;  2YUP A;  3SWN B;  3CXC P;  2O31 A;  1RLQ C;  2LCL A;  1YJN Q;  4M7A F;  2F2X A;  3EGX A;  3P8H A;  4A53 A;  4ZGE B;  2V26 A;  1RI9 A;  2I0N A;  1U5S A;  2QQR A;  3C0C A;  4E6R A;  1KIK A;  4PJL A;  4C8Q F;  2DJQ A;  1IHV A;  2NUT B;  3PVL A;  2OX7 A;  2D6F A;  4JDS A;  3CXC A;  1AOJ A;  1TTH B;  4KT0 E;  2H3E B;  1N8R U;  1VQM T;  1VQO Q;  2DTH A;  1OOT A;  2FRY A;  3CME T;  3OS5 A;  1M90 U;  1NZ9 A;  2EIF A;  2YHT A;  2AHJ B;  1UHC A;  2DL5 A;  1GFD A;  1GCQ A;  3CME A;  2DER A;  5CQY A;  1YN8 A;  2VXE A;  1OV3 A;  2EJ9 A;  1FMV A;  4OMP A;  4E7S A;  5GAN j;  1TH7 A;  3G6E T;  1VQ4 A;  4PJO A;  4A4G A;  2EQJ A;  2XI9 A;  1N5Z A;  1LPL A;  3E9F A;  3QJ6 A;  3CCU A;  2JMC A;  2RQV A;  3MPU B;  2CZ1 B;  2CRE A;  2M9U A;  1R0C B;  4C92 F;  4J6X A;  3MEW A;  4M75 A;  5GAN h;  2E5K A;  2FPE A;  3JCM b;  1RLP C;  3FC3 A;  4DOV A;  2LNH B;  1M4Z A;  5GAO q;  4AFS C;  3V7R A;  1VQ7 T;  2CP7 A;  3E1S A;  2GBQ A;  3M0U A;  1O75 A;  5HY6 A;  4L5G A;  3S6W A;  1ZBJ A;  1VQP A;  1EFN A;  4DOW A;  4BUG A;  2HBW A;  4RTZ A;  4K11 A;  4RCB A;  3V8L A;  3FB9 A;  1B34 B;  4LDV A;  2KBT A;  2CH4 A;  1N6A A;  2RJC A;  5GAN f;  3CC7 T;  3GIB A;  2QDY B;  1WJR A;  3EGX B;  5GAO m;  3CC7 A;  1KSW A;  2JZ2 A;  2K9G A;  3MJX A;  3HSB A;  2O9V A;  1KQS S;  5FW9 A;  1JRI A;  5DY9 A;  4PJO D;  2RN8 A;  1FWZ A;  4B9W A;  2FPD A;  1HSQ A;  7AT1 B;  1Q81 U;  1VQ4 Q;  3S3O A;  4ZGD B;  1AHJ B;  2Z0W A;  3JB9 G;  1MUZ A;  1KK7 A;  1YBY A;  1E6G A;  3CCU Q;  1WXU A;  1X69 A;  1XNI A;  3VYH B;  1YCS B;  4UC4 A;  2RHZ A;  4M75 D;  1YIT T;  1SSH A;  2XU8 A;  2CP6 A;  3UWN A;  4M77 G;  1RAD B;  1YIT A;  2MAM A;  1C0M A;  1M1K C;  2LZ6 B;  2J6K A;  2KT8 A;  4PJO B;  1ZSZ A;  3FEO A;  2LCC A;  2CSQ A;  2LQK A;  4E7L A;  4J7I A;  2DL7 A;  2YT6 A;  1V76 A;  2K2M A;  2GFU A;  2QDL A;  2ESW A;  1Q7Y U;  1Y0M A;  1QQJ A;  3G71 T;  4ZN3 A;  5I21 A;  1VQP Q;  3MP8 A;  4X9C A;  4LD6 A;  3THK A;  5L8R E;  4BB7 A;  3L2R A;  4RTV A;  3MO8 A;  4MDW A;  4C0Z A;  5CKH A;  3JB9 J;  1UHF A;  4ANJ A;  3G4S T;  4FYW B;  2CZ7 B;  2VVK A;  3G4S A;  1ZUK A;  2A0F B;  4JZ4 A;  2DYI A;  1UDL A;  2EFI A;  1G5V A;  4HVV A;  2OJ2 A;  2VC8 A;  2ENM A;  2RPN A;  3C95 A;  4PJJ A;  2D8J A;  4FT2 A;  1X2Q A;  3C4S A;  1MND A;  4M77 E;  1GL5 A;  2RJE A;  2P84 A;  1YIT Q;  4PJN A;  2ECZ A;  4Z89 A;  2JN0 A;  2J7I A;  4CI0 C;  2RQT A;  3QG1 A;  3FDR A;  2VXF A;  2L8D A;  2EQU A;  2K5I A;  4RMO A;  5D6W A;  3OYD A;  5FWC A;  4Z8A A;  1VQ9 T;  2M02 A;  3CCV A;  5A0G A;  2A37 A;  4XK8 E;  1YJ9 A;  4OB2 B;  4XAX B;  1Q81 R;  1WHM A;  2GCX A;  4KH1 B;  1QW1 A;  2EGC A;  4JJC A;  2K79 A;  1KC8 C;  2DET A;  4A63 B;  1NLO C;  1ZSZ B;  3M5A A;  3HFN A;  5ECA A;  1PRM C;  4ME7 A;  3LWI A;  1MHN A;  3G4S Q;  2O2O A;  2HD0 A;  4IUR A;  2XDD A;  2F2W A;  3OYC A;  3DB3 A;  3TQ7 P;  1IGQ A;  5D7U A;  3OYG A;  2SRC A;  2EVR A;  4HCZ A;  1VQK A;  3VUB A;  4BI4 A;  3CEY A;  1R77 A;  5KYX A;  1OEB A;  2YUO A;  4DEY A;  4ATO A;  4C8Q C;  2XHC A;  2K3X A; 
#chains in the Genus database with same CATH homology
 2OI3 A;  2KEA A;  1BU1 A;  2EQI A;  2V1R A;  2RQR A;  4D8K A;  1FMK A;  3VS5 A;  1RUW A;  1PHT A;  1HD3 A;  4Y92 A;  2RF0 A;  2ABL A;  2O9S A;  1WI7 A;  4IIM A;  4ESR A;  2DL8 A;  5IXF A;  1T0H A;  2EYY A;  1AVZ C;  1UUE A;  2JT4 A;  2K6D A;  1ZUU A;  1AWJ A;  2GQI A;  5I22 A;  1K0X A;  2GNC A;  5EC7 A;  1AZG B;  1UG1 A;  2RMO A;  3JV3 A;  3NHN A;  3O5Z A;  2JS0 A;  3VRY A;  2JM8 A;  3KFV A;  1IO6 A;  2MOX A;  1CKA A;  2DL4 A;  5IHI A;  1I0C A;  1W70 A;  1X27 A;  2DE0 X;  5IHN A;  2W10 A;  3EHQ A;  4X1V A;  2J6F A;  2KNB B;  2LQN A;  2RQU A;  5GJV B;  1PKS A;  3VS4 A;  1H3H A;  5I11 A;  2DF6 A;  2CDT A;  3LH5 A;  3ULR B;  1JO8 A;  1QKW A;  4LUE A;  2AKL A;  2LCS A;  4HVU A;  4LN2 A;  1ZX6 A;  1ZSG A;  2D1X A;  2BZY A;  2HSP A;  2J6O A;  1K76 A;  2HDA A;  2ROT A;  1WXB A;  1QWF A;  3EHR A;  1JEG A;  2G6F X;  1UJ0 A;  2LJ0 A;  3REB B;  2AZV A;  1WFW A;  2EGA A;  2ED0 A;  2V1Q A;  1H8K A;  4J9B A;  1QKX A;  2RQW A;  2DMO A;  3EG1 A;  1M3C A;  2A36 A;  2J06 A;  3H41 A;  1MV0 B;  2KT1 A;  1ZLM A;  1WYX A;  2C0I A;  2GTJ A;  1KJW A;  1M27 C;  2PNI A;  3VS7 A;  3U23 A;  2LJ3 A;  2JS2 A;  2PZ1 A;  1LCK A;  2DBK A;  2KRM A;  4J9C A;  1KFZ A;  3M0R A;  2XMF A;  1VYT A;  3IQL A;  4J9I A;  2DNU A;  2L3P A;  1ZUY A;  4AFU C;  2GGR A;  2L2P A;  1GBR A;  1K9A A;  1PWT A;  2C0T A;  2FRW A;  4M4Z A;  2VKN A;  4OMQ A;  1V1C A;  3UA6 A;  1UTI A;  2DLP A;  1NM7 A;  3EG3 A;  2K3B A;  3NPF A;  4GBQ A;  3REA B;  1SEM A;  2H8H A;  1PNJ A;  1E6H A;  5IXB A;  2EYZ A;  5L23 A;  4LUD A;  1UJY A;  2CH4 W;  2LQW A;  2F2V A;  2C0O A;  2EYX A;  1QCF A;  1SHG A;  1X6B A;  4WCI A;  1W1F A;  3VS1 A;  1JU5 C;  1OPL A;  2KR3 A;  4HCK A;  1NYF A;  3TVT A;  2YUP A;  4RTX A;  1UE9 A;  1M3A A;  4KRT A;  1SPK A;  1BB9 A;  2X3X D;  1G2B A;  2P4R A;  2O31 A;  1YNZ A;  4ORZ A;  5FWB A;  2D0N A;  1RLQ C;  2BZ8 A;  2W0Z A;  3M0Q A;  1CSK A;  4J9H A;  4JZ3 A;  2F2X A;  2CSI A;  2K7A A;  1GCP A;  2FO0 A;  1BBZ A;  1NLP C;  1AD5 A;  1RI9 A;  3QWX X;  2I0N A;  4OML A;  1U5S A;  3C0C A;  4E6R A;  1UFF A;  2EBP A;  3I9Q A;  1KIK A;  1JXO A;  1WXT A;  2YDL A;  2DJQ A;  2JW4 A;  5GJW B;  1NG2 A;  1WA7 A;  5IHK A;  4CC2 A;  3PVL A;  2CUB A;  2L3S A;  1AOJ A;  3M0P A;  1OOT A;  2DVJ A;  2FRY A;  2KXC A;  2ED1 A;  2YSQ A;  1K4U S;  2VWF A;  3RBB B;  2KXD A;  3H0F A;  3VS6 A;  1UHC A;  2DL5 A;  1GFD A;  1A0N B;  1GCQ A;  1QWE A;  1ARK A;  2ROL A;  1YN8 A;  2HCK A;  1J3T A;  2KYB A;  1OV3 A;  4OMP A;  2MIO A;  3ZL7 C;  4J9F A;  4ZNX A;  1BK2 A;  1MV3 A;  1N5Z A;  2LP5 A;  2AK5 A;  2JMC A;  1W6X A;  1Y57 A;  2RQV A;  2KRS A;  1PRL C;  3QWY A;  2IIM A;  3EG2 A;  2CRE A;  2MCN A;  2DA9 A;  1UEC A;  3NMZ C;  2JTE A;  4F14 A;  2NUZ A;  4J9E A;  1T3L A;  2E5K A;  2FPE A;  1RLP C;  1T0J A;  2LNH B;  4LE9 A;  4D8D A;  4AFS C;  3FJ5 A;  2DRM A;  3VRZ A;  4RTU A;  2GBQ A;  4HVW A;  3M0U A;  2BZX A;  4CC4 B;  1AWW A;  1ZBJ A;  1EFN A;  3UF4 A;  2HBW A;  4OMN A;  4RTZ A;  2M0Y A;  4FSS A;  4K11 A;  4R0K A;  3PVQ A;  4EIK A;  1H92 A;  1S1N A;  4IIO A;  3TSW A;  1HJD A;  4RTT A;  4AG1 C;  2KBT A;  2CH4 A;  1AEY A;  4RUG A;  1AWX A;  2GTO A;  1YWP A;  2CT4 A;  1E7O A;  2A08 A;  3EGU A;  3TSZ A;  1GCQ C;  2KE9 A;  2KRO A;  3EG0 A;  1KSW A;  2K9G A;  1M3B A;  2O9V A;  2FEI A;  4GLM A;  5FW9 A;  1AZE A;  2LX7 A;  2RN8 A;  2FPD A;  1HSQ A;  3SHW A;  1SRM A;  1Z9Q A;  2L3Q A;  3H0I A;  3VS3 A;  1YP5 A;  1GRI A;  1MUZ A;  1JXM A;  2EGE A;  1T3S A;  2JM9 A;  2B86 A;  2KGT A;  3RNJ A;  1E6G A;  2CT3 A;  1WXU A;  2EYW A;  1X69 A;  1YWO A;  2HEQ A;  1TUC A;  1NEG A;  1YCS B;  1X43 A;  2DX1 A;  1WLP B;  1SSH A;  1UGV A;  2DM1 A;  4CC7 A;  1XOV A;  4DEX A;  2LZ6 B;  2J6K A;  2KT8 A;  1WIE A;  1M30 A;  2JMA A;  2CSQ A;  2DL7 A;  2YT6 A;  1PKT A;  2K2M A;  2QDL A;  5IH2 A;  2ESW A;  4OMM A;  1Y0M A;  4JPB W;  4CC3 A;  2FG0 A;  2DIL A;  1K1Z A;  3THK A;  3H0H A;  1I1J A;  3I5R A;  3I5S A;  1SHF A;  2X3W D;  2FPF A;  1ABQ A;  4RTV A;  2D8H A;  2DYB A;  4RTY A;  1WX6 A;  2NWM A;  1UHF A;  1GBQ A;  4J9D A;  4J9G A;  4AFZ C;  1X2K A;  4JJD A;  2VVK A;  4QT7 A;  1ZUK A;  1AWO A;  4JZ4 A;  3SEM A;  2YUN A;  2LMJ A;  1NEB A;  1VYV A;  1UDL A;  1TUD A;  4OMO A;  4HVV A;  1GFC A;  4F17 A;  2OJ2 A;  1NYG A;  2CUD A;  2EKH A;  1K0S A;  2ENM A;  2RPN A;  2JXB A;  2EPD A;  4AFQ C;  4JJB A;  5HCK A;  1U06 A;  2D8J A;  3I35 A;  4HXJ A;  1X2Q A;  3R6N A;  2DBM A;  1GL5 A;  2L0A A;  2DRK A;  2ECZ A;  3M0S A;  4Z89 A;  3NGP A;  3PE0 A;  2J05 A;  2BTT A;  2J7I A;  1JQQ A;  2RQT A;  1CKB A;  4RTW A;  1OPK A;  1QLY A;  2KYM A;  2EW3 A;  4Z8A A;  5FWC A;  3UA7 A;  1WDX A;  2A28 A;  2A37 A;  2EGC A;  1TG0 A;  4JJC A;  2K79 A;  2M51 A;  1I07 A;  4A63 B;  3A98 A;  4Z88 A;  1G83 A;  1NLO C;  5ECA A;  1VA7 A;  1PRM C;  2AZS A;  2RNA A;  2YUQ A;  3CQT A;  2O2O A;  3GBQ A;  2F2W A;  1U3O A;  2O88 A;  2DL3 A;  3VS2 A;  1FYN A;  1SRL A;  2SRC A;  1X6G A;  3UAT A;  1VYU A;  2EVR A;  2LJ1 A;  4LNP A;  1ABO A;  1B3Q A;  1M8M A;  1OEB A;  4F16 A;  1Z9Z A;  2YUO A;  4DEY A;  4AG2 C;  1B07 A;  2OAW A;  2SEM A;  3VS0 A;  2AKK A;  2KRN A;  3M0T A;  2PTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...