2EQIA

Solution structure of the sh3 domain from phospholipase c, gamma 2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
b'GSSGSSGRTVKALYDYKAKRSDELTFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholipase C, gamma 2
publication title Solution structure of the SH3 domain from Phospholipase C, gamma 2
rcsb
source organism Mus musculus
molecule tags Immune system, hydrolase
total genus 7
structure length 69
sequence length 69
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2eqiA00
4JZ3A 3VS6A 3VS0A 2B86A 2ED0A 2HDAA 3H0FA 3PE0A 2J7IA 2SRCA 2NUZA 1JU5C 1PWTA 1U06A 2DX1A 2M0YA 2XMFA 2I0NA 2JM9A 4AFUC 1ARKA 4JJDA 1CSKA 1Z9QA 2ESWA 2HEQA 1GCQC 1OPLA 2EBPA 1T0HA 1N5ZA 3I35A 1UE9A 2CREA 2QDLA 1B3QA 1OPKA 1WLPB 2L3PA 4CC3A 1SRMA 2CSIA 2EGEA 4RTYA 4CC4B 2J05A 2CDTA 2PNIA 3UF4A 2CUBA 1AEYA 2YSQA 2RF0A 2MCNA 5FWBA 2RPNA 2K3BA 3TSWA 5IHNA 1WDXA 1KJWA 3ULRB 3TSZA 3EG1A 1BK2A 3SHWA 2P4RA 4D8KA 1U5SA 2RQRA 2RQUA 2JT4A 1K0SA 4R0KA 1H8KA 2DL4A 3THKA 2EKHA 1S1NA 2L3SA 2DILA 4JZ4A 2PZ1A 2GQIA 1G2BA 4RTVA 3LH5A 2FPFA 5FW9A 4LUEA 2EPDA 3VS5A 2KYMA 1QKXA 1YN8A 1ZX6A 1JXOA 2NWMA 3EGUA 1T0JA 2L3QA 1X6GA 1JO8A 1QWEA 1NEGA 4CC7A 3KFVA 2GTOA 2DRKA 2ROLA 4Z8AA 2H8HA 2LQNA 1FMKA 2O9VA 1G83A 1HJDA 1VA7A 1JQQA 2LX7A 1GBQA 5IHKA 4Z89A 4AFSC 1GBRA 3ZL7C 2HSPA 3VS3A 1AZGB 1PHTA 3H0HA 1ZUYA 4GBQA 1ZUKA 2RNAA 3I5RA 2KRMA 2DBKA 3UATA 4J9GA 4OMPA 4RTUA 2GNCA 2RN8A 2E5KA 2J6OA 3M0SA 2DLPA 1VYTA 4J9HA 1AZEA 4J9FA 2K9GA 1UG1A 2DVJA 1SEMA 1M8MA 1J3TA 3PVQA 3I9QA 1MV0B 1IO6A 2ENMA 2OJ2A 3EHQA 1UJYA 4D8DA 2J6FA 3QWYA 2LCSA 1GCQA 4J9BA 2CUDA 1YWOA 2DJQA 2KRSA 2HBWA 4WCIA 3M0RA 4X1VA 5ECAA 2F2XA 1Y57A 2LNHB 2RQVA 2C0IA 1SSHA 2BZ8A 1W70A 1CKAA 2EYYA 4HXJA 1K1ZA 3M0QA 1AVZC 1HSQA 1I0CA 1XOVA 2L0AA 1W1FA 1I1JA 2K2MA 3PVLA 4HVWA 4EIKA 4HCKA 2EYZA 1WXBA 1H3HA 1SHGA 2O31A 3M0UA 2JMAA 3M0TA 2EQIA 2D1XA 4A63B 4Z88A 2YUPA 3CQTA 1UECA 1QKWA 4AFZC 1A0NB 5FWCA 2KGTA 1NYGA 1PNJA 2KR3A 2EGAA 2KROA 4RTTA 2DM1A 1JEGA 2RMOA 1OEBA 1NEBA 5HCKA 1CKBA 1U3OA 2FEIA 2CH4W 1OOTA 2O88A 2LJ1A 2DYBA 3O5ZA 2F2WA 1MV3A 3RBBB 2M51A 2KEAA 1NLPC 2DF6A 3UA6A 1M30A 1V1CA 1M3CA 2VWFA 1BBZA 2HCKA 2FRYA 3VS1A 2C0TA 2J06A 1AWXA 2PTKA 2OI3A 1RLQC 2FPDA 4ZNXA 1X6BA 1ZBJA 5IHIA 2YUOA 2W0ZA 2DL5A 2KXDA 3EHRA 3H41A 5IXBA 2KT8A 1UHFA 4KRTA 1LCKA 3C0CA 2X3WD 3TVTA 2D8HA 2A36A 2JMCA 1BB9A 1PRLC 1H92A 2FPEA 3NHNA 2CT4A 3H0IA 1E6HA 3REBB 1NYFA 2EGCA 1K0XA 1UTIA 2C0OA 3NMZC 2JXBA 1ZLMA 4AFQC 1AWOA 2DE0X 4HVVA 3EG2A 4HVUA 3EG3A 4LN2A 4DEYA 1M3BA 1NG2A 2JW4A 1WFWA 4LUDA 1Y0MA 1I07A 1X43A 2JS0A 2GBQA 2L2PA 2LQWA 2LJ0A 2RQTA 1YNZA 1AWWA 2EYXA 3M0PA 2FRWA 2JS2A 2KBTA 1K4US 1E6GA 1E7OA 1PKTA 3VS4A 2BZXA 1ZUUA 1MUZA 2LZ6B 5L23A 1ZSGA 5I11A 1WIEA 4OMQA 2ED1A 2F2VA 1YCSB 2K79A 4OMMA 2AK5A 1QWFA 1UJ0A 2D8JA 2JTEA 2OAWA 1X2QA 2GTJA 1YP5A 1T3LA 1WYXA 3VS7A 1AWJA 3IQLA 3EG0A 1UUEA 1TG0A 1EFNA 2AZVA 1NLOC 2DA9A 1AD5A 1QCFA 2ABLA 1GFCA 1K9AA 3A98A 2KRNA 1PRMC 2DL7A 4RUGA 1BU1A 2CSQA 2A08A 4Y92A 4CC2A 4F16A 2AKKA 4FSSA 2X3XD 2A37A 2DRMA 1RUWA 3I5SA 3VRYA 4JPBW 2SEMA 1X27A 2YT6A 2KE9A 2DL8A 3RNJA 1WI7A 1RI9A 5GJVB 4DEXA 2KYBA 2KXCA 1KFZA 1X2KA 2BTTA 2LP5A 3REAB 4M4ZA 3FJ5A 4ORZA 2FG0A 2O2OA 1RLPC 3UA7A 2YUNA 4IIOA 1UGVA 4ESRA 2VKNA 2DL3A 2DMOA 1B07A 2CH4A 2EVRA 1W6XA 2K6DA 3SEMA 3JV3A 1M3AA 1GFDA 2DBMA 2O9SA 3U23A 5I22A 1TUDA 4RTWA 2MOXA 2V1QA 2IIMA 2KT1A 4J9EA 1FYNA 2AZSA 5IH2A 2YDLA 2FO0A 1GL5A 3QWXX 2V1RA 2W10A 4E6RA 4AG1C 1ABOA 4LE9A 4J9DA 2EW3A 1GRIA 1OV3A 2K7AA 4OMLA 2DNUA 2ECZA 1UHCA 4K11A 2AKLA 1ABQA 4IIMA 4J9IA 1T3SA 4AG2C 1GCPA 4F14A 2BZYA 4JJBA 2GGRA 2D0NA 5GJWB 1UDLA 2LJ3A 1SRLA 4J9CA 2KNBB 2LMJA 1M27C 1SHFA 3NGPA 3VS2A 2CT3A 1TUCA 4GLMA 1WX6A 4RTXA 4QT7A 2EYWA 1WA7A 4JJCA 2G6FX 1QLYA 2J6KA 1K76A 2YUQA 1VYUA 5EC7A 4OMNA 1WXTA 4RTZA 5IXFA 1KIKA 1VYVA 3R6NA 1Z9ZA 2ROTA 1JXMA 1NM7A 3VRZA 1X69A 2JM8A 3NPFA 3GBQA 2RQWA 1WXUA 1AOJA 4LNPA 2A28A 1KSWA 1YWPA 4OMOA 4F17A 1UFFA 2VVKA 1HD3A 2MIOA 1SPKA 1PKSA
chains in the Genus database with same CATH superfamily
3VS0A 2B86A 2E12A 3H0FA 2J7IA 3X20B 3L2UA 4QVCA 8ATCB 1C1AA 2XMFA 1ARKA 3L42A 4BE0A 4JJDA 1CSKA 2LNVA 1WGSA 1Z9QA 2ESWA 1Q86R 1T0HA 1IB8A 3EH1A 1Q86C 3VYHB 3SWNB 2XI9A 5J3BA 1WLPB 1Y96B 3CPWP 3CC4A 2CP7A 4PFPA 1YI2T 3MEVA 1VQ9Q 2OTLQ 2MCNA 1WJSA 2K3BA 5IHNA 4J8OA 2XIDA 2Z0WA 2GQVA 2KVQG 3A8HB 2DD5A 5LJ5d 3EG1A 2P4RA 5GAMj 1M90R 2RQUA 2JT4A 1M90C 4Z02A 1OYXA 1H8KA 3CD6T 2DXBA 1D0ZA 4XTXA 1AHJB 2DILA 1YI2A 2GQIA 3FJPA 4XTZA 1N8RR 5KH6A 2EPDA 1N8RC 1QKXA 2X4JA 2EKOA 4M78F 2NYSA 1IHVA 4BI3A 1X6GA 1RI0A 4N4HA 4CC7A 4Z8AA 3CD6A 2DK3A 4LDXA 1VA7A 3ZL7C 2HSPA 3VS3A 2VC8A 1PHTA 3MEWA 4GBQA 3QSUA 2DBKA 4RTUA 2M1HA 5GAMg 5A2QE 2MAMA 1AZEA 2DAQA 4J9FA 1UG1A 5CKDA 1W4SA 2RI2A 4FYXB 3PNWC 3PVQA 1N27A 5GAN7 3C94A 2OJ2A 3TCJA 1YWOA 1OULA 3I55A 2FVUA 3X25B 4A4HA 1Y57A 2IPOB 2DTIA 2C0IA 3PT9A 1SSHA 2BZ8A 3JSCA 4PL6A 3OY9A 3T9NA 2KDSA 2ZPFB 4F04B 1AVZC 5CKBA 1HSQA 1XOVA 2L0AA 4M75E 1VQKQ 3AT1B 2K2MA 4XU0A 4EIKA 1UGRB 1SHGA 3QZ5B 5GAOp 3M0UA 1RAGB 1VQPQ 1KC8R 1VQ8Q 3RIRA 1VQLA 4PJOE 5GAMf 4J6YA 3OYBA 4OB1B 1KC8C 2YUPA 1R77A 2HKQB 1QKWA 1BI0A 4AFZC 4C5HA 2KGTA 2DZCA 2KR3A 4E7ZA 4RTTA 4MMKA 2XICA 2FB7A 3M55A 1OEBA 4M7DE 3CC2Q 2FEIA 2O88A 2IVWA 1MV3A 4C92D 1V1CA 1M3CA 3CCST 3ZBDA 2HCKA 4BE2A 1Q7YU 2ZPIB 1YITQ 3G6EQ 4ZN1A 1G3SA 3VS1A 3G71A 1AWXA 2JJ9A 5CKFA 2QQ9A 5KYWB 2DEQA 5HK3A 5L8RE 5IHIA 2W0ZA 1Q82U 3L2QA 3H41A 5IXBA 3WXMB 1C6VX 1OX8A 3E1SA 1PRLC 2M16A 1YIJA 3REBB 3RKWA 1K0XA 4M7AF 4NS5A 3JB9D 1AWOA 5I2MA 3RDVA 1M3BA 1NPRA 3P8DA 2AHJB 4B9XA 2MK5A 4LDUA 2GBQA 3GLXA 2L2PA 5KYYA 2RQTA 1YNZA 3CCLT 6AT1B 1VQ6Q 1JRIA 1HK9A 2RJDA 3M0PA 2RA2A 2YLCA 3CCRA 3RESA 3VJPA 5D6WA 5GANj 1K4US 1QQJA 3DKMA 2BZXA 4E7KA 1VQ4T 2PVGB 1MMDA 2XK0A 4F7UE 1N9RA 2PU9B 3G7ZA 5LL6S 2F1LA 5GMKi 3OS5A 3CPFA 1ZBXA 2AK5A 4C92A 3OYMA 2ATCB 1KD1R 4BACA 2OAWA 5EG2A 3HL8A 1KD1C 3MCAB 1YP5A 4EPCA 2M0OA 3CCQT 3IQLA 2E4HA 1VQ4A 4PJOF 1K9MR 4FW1A 2Y4YA 1K9MC 1WQ7A 2DA9A 4UC4A 1VQ9T 2OTLT 3JCMh 3HFOA 2DL7A 4RUGA 2CSQA 4CC2A 3OYDA 1V76A 1X75C 5GANg 1UGQB 3NTKA 2X3XD 3SB2A 3VRYA 1X27A 3ZEHA 5AT1B 5LJ3e 2KE9A 1RABB 1WZOA 3RNJA 3CCUT 4OGEA 2F69A 2KYBA 5GJVB 4DEXA 1PSEA 1OZ3A 3H6ZA 4LDWA 4KT0E 2FG0A 2OTLA 3OYGA 4E2FB 5GMKh 4ESRA 2VKNA 2DL3A 3OS1A 3BE3A 1B07A 1BIAA 2K6DA 4VUBA 1NJIR 1MNEA 2JN0A 1D1AA 1M4ZA 1NJIC 3OMGA 2DBMA 3OS0A 1PC0A 2IIMA 2KT1A 3UWNA 1BI1A 1S72Q 2YDLA 4KUDK 2G3RA 2HMAA 4OVAA 5GANf 1XQHA 3M9QA 2W10A 4AG1C 2CP5A 3QPHA 1GRIA 1OV3A 2K7AA 3PGGA 1W2BP 3G4ST 1UHCA 2LVMA 4IIMA 1HYOA 1GCPA 2GGRA 4L5GA 2LJ3A 2CKKA 2KNBB 3TREA 2LMJA 3RR6A 1YHQT 1SHFA 3OYFA 1WX6A 4BY6C 3V8KA 3KUFA 1EIFA 4JJCA 3V8LA 2R57A 4M78A 1QLYA 1K76A 2CP3A 1QVGS 1FX7A 1Q95G 1WXTA 4OMNA 1QVFA 4F7UF 2RH2A 2E65A 3R6NA 1Z9ZA 3BFMA 2ROTA 1JXMA 1NM7A 2E6ZA 2HQHA 3VRZA 3GBQA 2RQWA 4FT2A 4FL6A 4LNPA 4Q5WA 3E9FA 7AT1B 1KSWA 2E6NA 4ELYC 5HKCA 1VQ8T 4ZTJA 1PKSA 2YRCA 2LQKA 1R0BG 4QKUA 3VS6A 5GAN3 2NUZA 1KK7A 4ZGDB 1PWTA 1U06A 2M0YA 3LWHA 2JM9A 3M54A 4JLGA 1VQKA 4PK4A 4PFOA 2HEQA 2P0QA 1N6AA 3I35A 2CP2A 1Q86U 2CREA 3URGA 1B3QA 1OPKA 4CC3A 1HXDA 4JJNK 2EGEA 1VQPA 1VQ8A 2CDTA 4HKEA 2CUBA 1AEYA 5IN1A 2XDBA 2RF0A 2D0QB 4A53A 2P4TA 2RPNA 1OU8A 1JJ2A 3G6ET 1M1FA 2K4YA 2X9HA 1TSFA 1BK2A 2JZ2A 1DJ7B 1G3WA 5GAOm 5J26A 3CC2A 2KSSA 4X9CA 2K3YA 4R0KA 3THKA 2EKHA 1UB4A 4JZ4A 3ER0A 1ACMB 1YJ9A 2Y4XA 5D6YA 2FPFA 5GAN8 2RHZA 3VS5A 1YITA 2KYMA 4HT8A 1WHKA 1JXOA 3RMQA 2L3QA 1JO8A 3FLGA 2ROLA 2VXFA 2H8HA 2O9VA 2GFAA 2LX7A 1GBQA 4Z89A 4BY6B 2GF7A 3H0HA 2E3IA 2EJGA 2RNAA 3I5RA 5C6SA 1VQ6T 2RN8A 2I2LA 2HQEA 2JOYA 3CCET 3V7CA 1QCOA 1WJRA 2DVJA 4IKFA 4C0DC 1MV0B 3EHQA 1UJYA 4KGXB 4D8DA 3QWYA 2LCSA 2EYQA 1GCQA 4J9BA 1VQ6A 2VGNA 3OQ5A 2DJQA 3CXCS 2DTOA 3DLMA 2QQAA 4JS5A 1OI1A 2LNHB 1FWZA 2COWA 3EFRA 1FMVA 2XDPA 4M7AA 3CC4T 4PJNA 3GOXA 3S6WA 1RAAB 1X6OA 3M0QA 5LJ5h 2MYSA 3JCMP 1W1FA 5IAYA 2HZYA 1YJWQ 1U8RA 5KYUA 1WXBA 2WACA 2JMAA 3M0TA 5AYFA 5A0GA 3CPWA 3JCMe 1KC8U 3OW2A 5FU6C 3OW2P 3MO8A 4C5IA 4FYWB 2EGAA 1K73R 2KROA 4FCYA 2K5LA 4P5NA 1K73C 3WVEB 1VQNQ 4C92C 2KAFA 1NEBA 4J7IA 1U3OA 5LJ3h 2DKGA 1D1CA 3DB4A 2DYBA 1NLPC 3P8HA 3UA6A 3O8VA 1M30A 1TXQA 4C5EA 1YBYA 2O4XA 5GMKe 2A0FB 2YWWA 1U1TA 1ZA1B 4HCCA 2NUPB 2OI3A 1RLQC 1BYMA 4ZNXA 1X6BA 1ZBJA 5KE2A 3M53A 3M4YA 1I5OB 5GAMd 1F1BB 2LT4A 1UHFA 2KT8A 3TVTA 1EX4A 4M77E 5I2SA 5DLQE 4IUVA 2JVVA 3NHNA 3RERA 3H0IA 1NYFA 1UTIA 2K5IA 1WQWA 3I56Q 2E41A 4ZGJB 4AFQC 4C0DB 1S72A 3I55T 4HVUA 4LN2A 2DERA 2PVDB 3J81E 1Y0MA 1I07A 2QK0A 2CZ1B 2ZPHB 5FRMA 1BI3A 4N4IA 1M5Q1 3QYGB 5GAN4 1VQMQ 2EYXA 1KQ2A 1M9SA 2QTXA 3H9NA 1E6GA 5KYYB 1PKTA 3CMAQ 3OYNA 1VQLT 2K3XA 2CP0A 1MUZA 5L23A 5LJ3g 1ZSGA 2K57A 1YCSB 3GNFB 1I8FA 2FZGB 3WVDB 4L6V5 1UJ0A 1BCMA 2D8JA 5FU6B 2DVEA 1X2QA 2GTJA 1KD1U 5GAOn 3EFOA 2HD0A 1QVFS 3EG0A 4C92B 4CI0C 4IURA 1UUEA 3MP6A 1XJWB 2AZVA 1ZA2B 4M78C 3PMTA 1QVPA 2RHYA 1QCFA 1GFCA 1K9AA 2VYTA 3SD4A 1WHMA 2YHTA 3G71T 3CCJQ 3L2VA 1YJNQ 3VUBA 1PRMC 4HCZA 3OB9A 4F16A 3JCMX 1BU1A 1RAIB 2AKKA 1RACB 3GNGA 1RUWA 2IG0A 2NUPA 1KQSP 3I5SA 2P0KA 3E9GA 4JPBW 5CQXA 2SEMA 1ZQ1A 2KQWA 1YJ9Q 2YRVA 5HK0A 4C92G 4E7SA 1YIJT 1TTHB 2O2OA 1RLPC 1VQ5Q 1P92A 3UA7A 3OYKA 2YUNA 1UGVA 3HFNA 1D3BA 4PLLA 4ZN3A 4XU1A 1KHIA 2LCLA 2EVRA 2O01E 1W6XA 3SEMA 2HQXA 2DO3A 1JB0E 2QEXQ 4J7FA 3NTIA 1NJIU 3KBGA 1JJ2S 1GFDA 4DQ2A 3RUXA 4X9DA 3QXEB 1QP2A 2O9SA 4M77F 3U23A 2MOXA 2V1QA 2PQWA 1D1BA 1RL2A 1SG5A 3CCRT 3ME9A 2QQSA 2QA4Q 2DXUA 5M9OA 3QWXX 2DEUA 4C8QD 3BDUA 3JB9G 4MDXA 1ABOA 4LE9A 4J9DA 4PJMA 5DLOA 2ECZA 2QQBA 4K11A 4QQDA 4AG2C 1IREB 2BZYA 5GJWB 4XTWA 1TWBA 2QASA 3CBOA 2GCXA 5GMKm 4HA8A 4PKCC 4GLMA 3CCVQ 4QT7A 3HTRA 3PIOA 2LT1A 1Y7XA 4JS4A 1VYUA 5EC7A 3JCMQ 4DOWA 1UEBA 1KIKA 3CC7Q 2XHCA 1YCYA 2OX7A 1X69A 3OS2A 3HRSA 3NPFA 4C0ZA 1NPPA 4M75F 4DBHA 1M8VA 2ZPBB 4M78B 4A4EA 2VASA 1QW1A 2A28A 5LJ5e 3JB9H 4OB0B 4F17A 5GANd 1LNXA 1UFFA 4J5YA 1HD3A 4QW2A 4XU2A 1SPKA 2E5QA 4BB7A 2ED0A 3EG9A 3FC3A 2AT1B 2VGMA 1JU5C 2XU8A 1VQ7Q 3EH2A 3CCMQ 1M1KU 3X24B 1VQNT 1GCQC 1OPLA 2CYZB 2EBPA 3DB3A 4IUPA 4BDYA 4M7DF 1YJWA 1UE9A 4M78D 5CKHA 2PVOB 4KH0B 4RTYA 4M78G 9ATCB 4CC4B 2QGGA 3QKJA 5GAMe 2LRQA 1MNDA 2VUBA 4M7AC 4N4GA 1PSFA 2X4XA 3QBYA 4C8QA 5FWBA 3TSWA 4B6MA 1VQNA 3CPWS 4D6WA 3ULRB 2EFIA 4LDVA 5CQYA 1Y07A 4JRPA 1K0SA 2XDDA 2Y90A 4HT9A 2CZ7B 4J6XA 3MPUB 4KH1B 3E2UA 4FSXA 4MDWA 1B7TA 1M2VA 2M02A 1B34A 2L3SA 1ZSZA 3EGXA 2GFUA 4RTVA 3LH5A 3OMCA 2MF2A 4LUEA 3FIFA 3UDCA 2EIFA 1YN8A 1WPYA 1Q81U 1Q82R 3E19A 3EGUA 1T0JA 2ZPGB 3I56T 1Q82C 5GMKj 1KQ1A 3M57A 2COYA 2GTOA 2DRKA 1Y71A 2QAZA 1U1SA 3VUZA 1G83A 3MEAA 3OYEA 1W2BA 1YFNA 1IGQA 1IHWA 5IHKA 1ZUYA 1ZUKA 4PJOC 1I5LA 4J9GA 4OMPA 2E5KA 2J6OA 4FT4A 3I56A 4C92E 3M0SA 3JCMg 1UGPB 4BD3A 2LQ8A 2DLPA 2F5KA 3CMAT 4A54A 4J9HA 2MWOA 2K9GA 1SEMA 2OTJQ 1M8MA 1FMWA 2A7YA 5C0MA 1J3TA 3OYAA 3I9QA 1IO6A 2QG9B 4FYYB 1VQMA 2CUDA 1VQKT 3M59A 1TS9A 2QTVA 2KRSA 1MGQA 3TEEA 3D7SB 2EWNA 3VU3C 4OB2B 2R58A 1W70A 3CMAA 1VQPT 3RKXA 1CKAA 3S3OA 2MI6A 4HXJA 4L59A 1K1ZA 1I0CA 3LX7A 2CP6A 1I1JA 4HCBA 2EQUA 3HSBA 4M7AB 4HVWA 4HCKA 1XNIA 2LC4A 3CCJT 2O31A 2FL7A 3JCMf 3CC2T 2EQIA 2D1XA 4DOVA 4Z88A 3NTHA 3LW5E 4TVRA 1RAHB 5FWCA 1VQOQ 5KYUB 2RD1A 3QYHB 1PNJA 1YJ9T 3M5AA 1O75A 2DM1A 2RJFA 2X4YA 2RMOA 3LWIA 4OP0A 1YITT 3CBPA 5HCKA 1CKBA 1VQ5T 2CH4W 3CCJA 4M7AD 1OOTA 4JRKA 1YJNA 3A8OB 3GP8A 2LJ1A 4B9WA 3O5ZA 3RBBB 4M7AG 1M90U 2DF6A 5HY6A 4RCCA 1H3ZA 2RHIA 3MJXA 2VWFA 2FYKA 1QP3A 3V8JA 4BUGA 2QEXT 4EDUA 2NUTA 2KMTA 2DD4A 1N8RU 1VQ5A 5GAOq 2F5TX 5FRNA 2FPDA 2O4XB 2QA4T 2DL5A 3X26B 3CCSQ 3EHRA 4C0GA 1QCNA 3CBMA 2HBPA 4XK8E 3QDRB 2X3WD 3HRTA 2D8HA 2A36A 2JMCA 3M58A 1BB9A 2QEXA 4KUIA 1H92A 4ELZC 4LDYA 2CT4A 4M78E 4M75D 1M2OA 1K8AR 3NMZC 1ZLMA 2DE0X 5GAN2 3EG2A 1K8AC 2X51A 2MMPA 2QA4A 1NG2A 2JW4A 4MZMA 2QYZA 3CCVT 1VOMA 1SKUB 2LX9A 4PJOD 1R0CB 2JS0A 4A4FA 2LQWA 3QJ6A 2MWPA 3OBYA 2FRWA 2RJCA 4N0AA 4PNOA 1E7OA 3JAME 3VS4A 1ZUUA 3GF5A 4LD9K 4DBQA 3CCVA 5CVIA 5FROA 5A0DA 3CCLQ 4PJLA 1WIEA 4OMQA 2F2VA 2DXTA 2AIRB 3OSVA 2KY9A 2K79A 3QDFA 3QIIA 4OMMA 1QWFA 5CIUA 3CC7A 2E1HA 2EAYA 4C5GA 2MPXC 2HL5C 3JB9F 1WYXA 3VS7A 4V2SA 2FHDA 2V8JA 4ANJA 1TG0A 3QO3A 5DY9A 1FXXA 2RK1A 1NLOC 4E7HA 3EFOB 2ABLA 3M4GA 4KBMB 5LJ5j 5FU7C 3CCQQ 3PMIA 1VQ7A 1D0YA 3CCMA 4OB3B 5GAMh 2KRNA 2RB6A 2A08A 4Y92A 3A1PA 3VYGA 2DYIA 1KG1A 4M75A 5A0LA 4FSSA 2DRMA 5KYXA 4OGCA 3S3NA 2WSEE 2YT6A 4F7UB 2DL8A 1RI9A 1RAFB 2KI7A 1KFZA 4EMGA 2LP5A 2ZPEB 3KXTA 4M4ZA 3Q1JA 4PJOA 4ORZA 2CGHA 3NFCA 4IIOA 5D6XA 5D7UA 5GMKl 1S72T 2JNGA 5LJ3j 1BKBA 2DMOA 3A8MB 4IUTA 3CCUQ 3SFMA 3MP8A 3TU4K 4M7DA 4EMKA 1M3AA 1TOVA 1D3BB 1TUDA 4RTWA 2K5FA 3H8ZA 4C8QC 3AHUA 1FYNA 4F7UG 2DIGA 2AZSA 4ZGEB 5LJ5g 4E7IA 2FO0A 1GL5A 4RG8A 4E7LA 2YLBA 4E6RA 2L89A 5LJ3d 3UPUA 2EW3A 3META 1PG5B 4GLKA 1ABQA 2OTJT 1IZ6A 1ZSZC 1QVGA 2E10A 1SF9A 1TUGB 3V7RA 1QVGP 3EAEA 1WNLA 4JJBA 4M7AE 4J9CA 1M27C 2EJ9A 1VIFA 3OYYA 1W2BS 4MZTA 3PIPA 4RTXA 4J6WA 2DPPB 3G4SQ 2EYWA 1WA7A 2CZ0B 3LYIA 3MP1A 2G6FX 1NE8A 1WJQA 4NL3A 2J6KA 3QJYA 2R5MA 2EQKA 3X28B 5IXFA 1WHJA 2CS7A 2OTJA 3LH0A 4MZPA 3L1AA 4OF1A 1YHQQ 1LOJA 2JM8A 3J7AF 1WXUA 5LJ5f 4KGVB 2LCCA 3M56A 4JDSA 1AOJA 4OMOA 3OYIA 5FU7B 2VVKA 2MIOA 4AT1B 3RMSA 3QHSA 1LJOA 2EQJA 4JZ3A 3BY7A 2V8KA 3SWNA 3FEOA 4PLIA 1TH7A 2HDAA 4BI8B 3PE0A 1Y96A 1BI2A 2SRCA 1VQOT 1K9MU 2E70A 2DIQA 3P8BB 3VKIA 2DX1A 2RI3A 2I0NA 3LLRA 4AFUC 3LGLA 5KCOA 2E64A 4PJJA 4F7UA 1N5ZA 4FU6A 3EG9B 4JRIA 2QDLA 3CMEQ 1LVKA 2L3PA 1SRMA 5LJ3f 1KQSA 2CSIA 2J05A 4OMFB 2PNIA 2P0PA 3UF4A 2YSQA 4LD6A 1VQOA 4JRQA 4PFZA 2RJEA 4ZTFA 3RKYA 3JB9I 1MMGA 1WDXA 2RHUA 1KJWA 3TSZA 3HRUA 3SHWA 4D8KA 1MMAA 2D6FA 4C8QB 1U5SA 2RQRA 3UT1A 1PM3A 2DL4A 1JBMA 1S1NA 2VXEA 5I21A 1G5VA 1PD0A 2PZ1A 4NL2A 1G2BA 2CZ6B 5FW9A 3F70A 3C95A 2QI2A 2HL3A 1ZX6A 3G1JA 4AMCA 1MMNA 2NWMA 1M2VB 1B34B 2DJZA 1ZSZB 3EGXB 4QVZA 1TU0B 1QWEA 1NEGA 3KFVA 2H3JA 2E3HA 2LQNA 1WHHA 1FMKA 1HJDA 5KE3A 2NLUA 2YRDA 3CCSA 1JQQA 4C8QG 2HAXA 4R55A 4AFSC 1GBRA 4XTVA 1AZGB 2V26A 3OA6A 4ATOA 5GANh 2HKNA 2C06A 2KRMA 2PUKB 1AT1B 3UATA 2P84A 3JRZA 4XAXB 2GNCA 3CXCA 1VYTA 3J80E 3CXCP 4BI4A 3C4SA 2XD0A 1PD1A 2BIVA 3CEYA 2ENMA 3L2RA 4XTYA 3TQ7P 2J6FA 3JCMb 5CCAA 1PCXA 2HBWA 4WCIA 3CCEQ 3M0RA 4X1VA 4WTOB 5ECAA 1YJWT 2F2XA 1G3TA 2RQVA 4DA4A 1WHLA 5GAOl 1OZ2A 3HKSA 4FYVB 3GIBA 3A5ZB 1H641 1N9SA 2EYYA 3CCLA 3HP9A 4A4KA 1KHCA 1G8XA 2WSCE 2BE9B 1SSFA 3SDZA 4WF2A 3PVLA 5KYNA 2ZGWA 4J83A 2EYZA 1H3HA 2EQMA 3EFSA 4N0AC 2DTHA 4CRIA 3CC4Q 4M77C 4A4GA 4A63B 1QMCA 3CQTA 3PFSA 1UECA 3MKDA 1A0NB 3MEUA 1NYGA 3JB9J 4RCBA 4C0FA 2QDYB 1JEGA 1RADB 2ZAEA 2RK2A 3CCQA 5GAN5 3OYJA 2LDMA 5CAIA 1O9SA 3OW2S 1ZHIA 3ASKA 2RI5A 2LTOA 3OYCA 1XTDA 2F2WA 2M51A 1M1GA 2KEAA 2L3RA 1YI2Q 2BUDA 4Y28E 5KYWA 5IT9E 2R5AA 8AT1B 1Q7YR 1BBZA 4IUQA 5CK9A 1Q7YC 2FRYA 1R8OB 3QG1A 2DFUA 1VQ9A 4DBRA 2PUOB 1VUBA 2C0TA 3OSSC 2FZCB 2J06A 2COZA 2BKDN 4XU3A 2PTKA 2K2VA 3QZ9B 4X34A 5CKEA 2YUOA 3JCMd 3CD6Q 3DLLA 3QUIA 2NUTB 4M75C 2KXDA 3CCUA 4KRTA 1LCKA 3C0CA 3OBWA 4MMLA 3HPWA 3FRNA 4DBFA 1OQKA 2FPEA 3HHTB 1VQMT 1E6HA 2RO0A 3OYLA 2EGCA 2C0OA 2JXBA 4HVVA 3EG3A 4DEYA 1K8AU 3INZA 1WFWA 3C12A 4LUDA 1X43A 2LJ0A 4M7DC 4EMKC 3R6OA 1AWWA 2XG8D 5GAOr 4YTLA 1IRXA 4FW2A 3I55Q 3N5BB 2JS2A 2KBTA 2WSFE 3OYHA 1MHNA 3ZFJA 1IXDA 2LZ6B 5CR2A 2A3LA 5I11A 3G4SA 2ED1A 1QVFP 4M77B 4JLIA 4JUVA 4RKUE 3BDLA 1G3YA 2JTEA 1OU9A 1YHQA 1T3LA 3A8LB 1VQLQ 4E7JA 2X35A 4C8QE 1EZZB 1AWJA 4O6JA 1YJNT 3EGDB 4NOYA 3CMET 3LGFA 2ZCFB 1EFNA 4FIBA 1M1KR 4BE1A 1AD5A 1M1KC 4M77D 1BIBA 1K73U 1VIEA 3A98A 4M77G 2HNIA 4RMOA 2XKOC 2ZZDA 1WHGA 3BW1A 2A37A 1NBEB 3CMEA 2QGFB 1WI7A 2KXCA 2VB6A 1X2KA 2BTTA 3G71Q 2JTFA 4IUUA 3REAB 3FJ5A 3SWNC 4M75B 1JJ2P 1UGSB 5KYXB 3L2ZA 4QQ6A 3PTAA 2EJFA 4II1A 1IGUA 1KQSS 2V8IA 1GXIE 2BE7D 4PJOB 2QXFA 1X01A 2CH4A 5FLXE 3JV3A 2DXCA 2DETA 1YIJQ 3FDRA 1D0XA 4QQGA 2X4WA 5I22A 2OAUA 3FB9A 1Q81R 4J9EA 3G6EA 2B8AA 3V7SA 5IH2A 1Q81C 4BDZA 4M7DB 4EMKB 2H3EB 4M75G 2V1RA 1V29B 3VV0A 1I81A 2QQRA 2L8DA 4C92F 5GANe 4QVDA 1BCOA 4OMLA 1I4K1 2DNUA 2KK4A 5KCHA 2AKLA 4J9IA 4PJOG 1T3SA 3CCRQ 1OX9A 4F14A 3L2WA 2D0NA 3CC7T 3JCMV 1RAEB 1D09B 1UDLA 2HSEB 2FZKB 1SRLA 2RM4A 4KGZB 4XQ3A 4R56A 5DM7R 3NGPA 3VS2A 1C0MA 4Y91A 4M77A 2CT3A 1TUCA 4M7DD 3JCMc 4M7DG 3JCMW 2M9UA 2YUQA 4RG2A 2RHXA 2JTMA 3A8GB 4LXCA 3GPLA 4O5VA 4RTZA 2D9TA 1VYVA 2L5QA 4FM4B 4GY5A 3EGDA 2JUFA 5J39A 5CO7A 2YXYA 3JCMJ 1VQ7T 5GAN6 3CCMT 4XTUA 2VV5A 2DZ9A 1VQ4Q 4EMHA 1YWPA 1LPLA 4C8QF 3CCEA 3S3MA 4KULA 3MHXA 4E47A 4ME7A 1NZ9A
chains in the Genus database with same CATH topology
4JZ3A 3VS6A 3VS0A 2B86A 2ED0A 2HDAA 3H0FA 3PE0A 2J7IA 2SRCA 2NUZA 1JU5C 1PWTA 1U06A 2DX1A 2M0YA 2XMFA 2I0NA 2JM9A 4AFUC 1ARKA 4JJDA 1CSKA 1Z9QA 2ESWA 2HEQA 1GCQC 1OPLA 2EBPA 1T0HA 1N5ZA 3I35A 1UE9A 2CREA 2QDLA 1B3QA 1OPKA 1WLPB 2L3PA 4CC3A 1SRMA 2CSIA 2EGEA 4RTYA 4CC4B 2J05A 2CDTA 2PNIA 3UF4A 2CUBA 1AEYA 2YSQA 2RF0A 2MCNA 5FWBA 2RPNA 2K3BA 3TSWA 5IHNA 1WDXA 1KJWA 3ULRB 3TSZA 3EG1A 1BK2A 3SHWA 2P4RA 4D8KA 1U5SA 2RQRA 2RQUA 2JT4A 1K0SA 4R0KA 1H8KA 2DL4A 3THKA 2EKHA 1S1NA 2L3SA 2DILA 4JZ4A 2PZ1A 2GQIA 1G2BA 4RTVA 3LH5A 2FPFA 5FW9A 4LUEA 2EPDA 3VS5A 2KYMA 1QKXA 1YN8A 1ZX6A 1JXOA 2NWMA 3EGUA 1T0JA 2L3QA 1X6GA 1JO8A 1QWEA 1NEGA 4CC7A 3KFVA 2GTOA 2DRKA 2ROLA 4Z8AA 2H8HA 2LQNA 1FMKA 2O9VA 1G83A 1HJDA 1VA7A 1JQQA 2LX7A 1GBQA 5IHKA 4Z89A 4AFSC 1GBRA 3ZL7C 2HSPA 3VS3A 1AZGB 1PHTA 3H0HA 1ZUYA 4GBQA 1ZUKA 2RNAA 3I5RA 2KRMA 2DBKA 3UATA 4J9GA 4OMPA 4RTUA 2GNCA 2RN8A 2E5KA 2J6OA 3M0SA 2DLPA 1VYTA 4J9HA 1AZEA 4J9FA 2K9GA 1UG1A 2DVJA 1SEMA 1M8MA 1J3TA 3PVQA 3I9QA 1MV0B 1IO6A 2ENMA 2OJ2A 3EHQA 1UJYA 4D8DA 2J6FA 3QWYA 2LCSA 1GCQA 4J9BA 2CUDA 1YWOA 2DJQA 2KRSA 2HBWA 4WCIA 3M0RA 4X1VA 5ECAA 2F2XA 1Y57A 2LNHB 2RQVA 2C0IA 1SSHA 2BZ8A 1W70A 1CKAA 2EYYA 4HXJA 1K1ZA 3M0QA 1AVZC 1HSQA 1I0CA 1XOVA 2L0AA 1W1FA 1I1JA 2K2MA 3PVLA 4HVWA 4EIKA 4HCKA 2EYZA 1WXBA 1H3HA 1SHGA 2O31A 3M0UA 2JMAA 3M0TA 2EQIA 2D1XA 4A63B 4Z88A 2YUPA 3CQTA 1UECA 1QKWA 4AFZC 1A0NB 5FWCA 2KGTA 1NYGA 1PNJA 2KR3A 2EGAA 2KROA 4RTTA 2DM1A 1JEGA 2RMOA 1OEBA 1NEBA 5HCKA 1CKBA 1U3OA 2FEIA 2CH4W 1OOTA 2O88A 2LJ1A 2DYBA 3O5ZA 2F2WA 1MV3A 3RBBB 2M51A 2KEAA 1NLPC 2DF6A 3UA6A 1M30A 1V1CA 1M3CA 2VWFA 1BBZA 2HCKA 2FRYA 3VS1A 2C0TA 2J06A 1AWXA 2PTKA 2OI3A 1RLQC 2FPDA 4ZNXA 1X6BA 1ZBJA 5IHIA 2YUOA 2W0ZA 2DL5A 2KXDA 3EHRA 3H41A 5IXBA 2KT8A 1UHFA 4KRTA 1LCKA 3C0CA 2X3WD 3TVTA 2D8HA 2A36A 2JMCA 1BB9A 1PRLC 1H92A 2FPEA 3NHNA 2CT4A 3H0IA 1E6HA 3REBB 1NYFA 2EGCA 1K0XA 1UTIA 2C0OA 3NMZC 2JXBA 1ZLMA 4AFQC 1AWOA 2DE0X 4HVVA 3EG2A 4HVUA 3EG3A 4LN2A 4DEYA 1M3BA 1NG2A 2JW4A 1WFWA 4LUDA 1Y0MA 1I07A 1X43A 2JS0A 2GBQA 2L2PA 2LQWA 2LJ0A 2RQTA 1YNZA 1AWWA 2EYXA 3M0PA 2FRWA 2JS2A 2KBTA 1K4US 1E6GA 1E7OA 1PKTA 3VS4A 2BZXA 1ZUUA 1MUZA 2LZ6B 5L23A 1ZSGA 5I11A 1WIEA 4OMQA 2ED1A 2F2VA 1YCSB 2K79A 4OMMA 2AK5A 1QWFA 1UJ0A 2D8JA 2JTEA 2OAWA 1X2QA 2GTJA 1YP5A 1T3LA 1WYXA 3VS7A 1AWJA 3IQLA 3EG0A 1UUEA 1TG0A 1EFNA 2AZVA 1NLOC 2DA9A 1AD5A 1QCFA 2ABLA 1GFCA 1K9AA 3A98A 2KRNA 1PRMC 2DL7A 4RUGA 1BU1A 2CSQA 2A08A 4Y92A 4CC2A 4F16A 2AKKA 4FSSA 2X3XD 2A37A 2DRMA 1RUWA 3I5SA 3VRYA 4JPBW 2SEMA 1X27A 2YT6A 2KE9A 2DL8A 3RNJA 1WI7A 1RI9A 5GJVB 4DEXA 2KYBA 2KXCA 1KFZA 1X2KA 2BTTA 2LP5A 3REAB 4M4ZA 3FJ5A 4ORZA 2FG0A 2O2OA 1RLPC 3UA7A 2YUNA 4IIOA 1UGVA 4ESRA 2VKNA 2DL3A 2DMOA 1B07A 2CH4A 2EVRA 1W6XA 2K6DA 3SEMA 3JV3A 1M3AA 1GFDA 2DBMA 2O9SA 3U23A 5I22A 1TUDA 4RTWA 2MOXA 2V1QA 2IIMA 2KT1A 4J9EA 1FYNA 2AZSA 5IH2A 2YDLA 2FO0A 1GL5A 3QWXX 2V1RA 2W10A 4E6RA 4AG1C 1ABOA 4LE9A 4J9DA 2EW3A 1GRIA 1OV3A 2K7AA 4OMLA 2DNUA 2ECZA 1UHCA 4K11A 2AKLA 1ABQA 4IIMA 4J9IA 1T3SA 4AG2C 1GCPA 4F14A 2BZYA 4JJBA 2GGRA 2D0NA 5GJWB 1UDLA 2LJ3A 1SRLA 4J9CA 2KNBB 2LMJA 1M27C 1SHFA 3NGPA 3VS2A 2CT3A 1TUCA 4GLMA 1WX6A 4RTXA 4QT7A 2EYWA 1WA7A 4JJCA 2G6FX 1QLYA 2J6KA 1K76A 2YUQA 1VYUA 5EC7A 4OMNA 1WXTA 4RTZA 5IXFA 1KIKA 1VYVA 3R6NA 1Z9ZA 2ROTA 1JXMA 1NM7A 3VRZA 1X69A 2JM8A 3NPFA 3GBQA 2RQWA 1WXUA 1AOJA 4LNPA 2A28A 1KSWA 1YWPA 4OMOA 4F17A 1UFFA 2VVKA 1HD3A 2MIOA 1SPKA 1PKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZ3 A;  3VS6 A;  3VS0 A;  2B86 A;  2ED0 A;  2HDA A;  3H0F A;  3PE0 A;  2J7I A;  2SRC A;  2NUZ A;  1JU5 C;  1PWT A;  1U06 A;  2DX1 A;  2M0Y A;  2XMF A;  2I0N A;  2JM9 A;  4AFU C;  1ARK A;  4JJD A;  1CSK A;  1Z9Q A;  2ESW A;  2HEQ A;  1GCQ C;  1OPL A;  2EBP A;  1T0H A;  1N5Z A;  3I35 A;  1UE9 A;  2CRE A;  2QDL A;  1B3Q A;  1OPK A;  1WLP B;  2L3P A;  4CC3 A;  1SRM A;  2CSI A;  2EGE A;  4RTY A;  4CC4 B;  2J05 A;  2CDT A;  2PNI A;  3UF4 A;  2CUB A;  1AEY A;  2YSQ A;  2RF0 A;  2MCN A;  5FWB A;  2RPN A;  2K3B A;  3TSW A;  5IHN A;  1WDX A;  1KJW A;  3ULR B;  3TSZ A;  3EG1 A;  1BK2 A;  3SHW A;  2P4R A;  4D8K A;  1U5S A;  2RQR A;  2RQU A;  2JT4 A;  1K0S A;  4R0K A;  1H8K A;  2DL4 A;  3THK A;  2EKH A;  1S1N A;  2L3S A;  2DIL A;  4JZ4 A;  2PZ1 A;  2GQI A;  1G2B A;  4RTV A;  3LH5 A;  2FPF A;  5FW9 A;  4LUE A;  2EPD A;  3VS5 A;  2KYM A;  1QKX A;  1YN8 A;  1ZX6 A;  1JXO A;  2NWM A;  3EGU A;  1T0J A;  2L3Q A;  1X6G A;  1JO8 A;  1QWE A;  1NEG A;  4CC7 A;  3KFV A;  2GTO A;  2DRK A;  2ROL A;  4Z8A A;  2H8H A;  2LQN A;  1FMK A;  2O9V A;  1G83 A;  1HJD A;  1VA7 A;  1JQQ A;  2LX7 A;  1GBQ A;  5IHK A;  4Z89 A;  4AFS C;  1GBR A;  3ZL7 C;  2HSP A;  3VS3 A;  1AZG B;  1PHT A;  3H0H A;  1ZUY A;  4GBQ A;  1ZUK A;  2RNA A;  3I5R A;  2KRM A;  2DBK A;  3UAT A;  4J9G A;  4OMP A;  4RTU A;  2GNC A;  2RN8 A;  2E5K A;  2J6O A;  3M0S A;  2DLP A;  1VYT A;  4J9H A;  1AZE A;  4J9F A;  2K9G A;  1UG1 A;  2DVJ A;  1SEM A;  1M8M A;  1J3T A;  3PVQ A;  3I9Q A;  1MV0 B;  1IO6 A;  2ENM A;  2OJ2 A;  3EHQ A;  1UJY A;  4D8D A;  2J6F A;  3QWY A;  2LCS A;  1GCQ A;  4J9B A;  2CUD A;  1YWO A;  2DJQ A;  2KRS A;  2HBW A;  4WCI A;  3M0R A;  4X1V A;  5ECA A;  2F2X A;  1Y57 A;  2LNH B;  2RQV A;  2C0I A;  1SSH A;  2BZ8 A;  1W70 A;  1CKA A;  2EYY A;  4HXJ A;  1K1Z A;  3M0Q A;  1AVZ C;  1HSQ A;  1I0C A;  1XOV A;  2L0A A;  1W1F A;  1I1J A;  2K2M A;  3PVL A;  4HVW A;  4EIK A;  4HCK A;  2EYZ A;  1WXB A;  1H3H A;  1SHG A;  2O31 A;  3M0U A;  2JMA A;  3M0T A;  2EQI A;  2D1X A;  4A63 B;  4Z88 A;  2YUP A;  3CQT A;  1UEC A;  1QKW A;  4AFZ C;  1A0N B;  5FWC A;  2KGT A;  1NYG A;  1PNJ A;  2KR3 A;  2EGA A;  2KRO A;  4RTT A;  2DM1 A;  1JEG A;  2RMO A;  1OEB A;  1NEB A;  5HCK A;  1CKB A;  1U3O A;  2FEI A;  2CH4 W;  1OOT A;  2O88 A;  2LJ1 A;  2DYB A;  3O5Z A;  2F2W A;  1MV3 A;  3RBB B;  2M51 A;  2KEA A;  1NLP C;  2DF6 A;  3UA6 A;  1M30 A;  1V1C A;  1M3C A;  2VWF A;  1BBZ A;  2HCK A;  2FRY A;  3VS1 A;  2C0T A;  2J06 A;  1AWX A;  2PTK A;  2OI3 A;  1RLQ C;  2FPD A;  4ZNX A;  1X6B A;  1ZBJ A;  5IHI A;  2YUO A;  2W0Z A;  2DL5 A;  2KXD A;  3EHR A;  3H41 A;  5IXB A;  2KT8 A;  1UHF A;  4KRT A;  1LCK A;  3C0C A;  2X3W D;  3TVT A;  2D8H A;  2A36 A;  2JMC A;  1BB9 A;  1PRL C;  1H92 A;  2FPE A;  3NHN A;  2CT4 A;  3H0I A;  1E6H A;  3REB B;  1NYF A;  2EGC A;  1K0X A;  1UTI A;  2C0O A;  3NMZ C;  2JXB A;  1ZLM A;  4AFQ C;  1AWO A;  2DE0 X;  4HVV A;  3EG2 A;  4HVU A;  3EG3 A;  4LN2 A;  4DEY A;  1M3B A;  1NG2 A;  2JW4 A;  1WFW A;  4LUD A;  1Y0M A;  1I07 A;  1X43 A;  2JS0 A;  2GBQ A;  2L2P A;  2LQW A;  2LJ0 A;  2RQT A;  1YNZ A;  1AWW A;  2EYX A;  3M0P A;  2FRW A;  2JS2 A;  2KBT A;  1K4U S;  1E6G A;  1E7O A;  1PKT A;  3VS4 A;  2BZX A;  1ZUU A;  1MUZ A;  2LZ6 B;  5L23 A;  1ZSG A;  5I11 A;  1WIE A;  4OMQ A;  2ED1 A;  2F2V A;  1YCS B;  2K79 A;  4OMM A;  2AK5 A;  1QWF A;  1UJ0 A;  2D8J A;  2JTE A;  2OAW A;  1X2Q A;  2GTJ A;  1YP5 A;  1T3L A;  1WYX A;  3VS7 A;  1AWJ A;  3IQL A;  3EG0 A;  1UUE A;  1TG0 A;  1EFN A;  2AZV A;  1NLO C;  2DA9 A;  1AD5 A;  1QCF A;  2ABL A;  1GFC A;  1K9A A;  3A98 A;  2KRN A;  1PRM C;  2DL7 A;  4RUG A;  1BU1 A;  2CSQ A;  2A08 A;  4Y92 A;  4CC2 A;  4F16 A;  2AKK A;  4FSS A;  2X3X D;  2A37 A;  2DRM A;  1RUW A;  3I5S A;  3VRY A;  4JPB W;  2SEM A;  1X27 A;  2YT6 A;  2KE9 A;  2DL8 A;  3RNJ A;  1WI7 A;  1RI9 A;  5GJV B;  4DEX A;  2KYB A;  2KXC A;  1KFZ A;  1X2K A;  2BTT A;  2LP5 A;  3REA B;  4M4Z A;  3FJ5 A;  4ORZ A;  2FG0 A;  2O2O A;  1RLP C;  3UA7 A;  2YUN A;  4IIO A;  1UGV A;  4ESR A;  2VKN A;  2DL3 A;  2DMO A;  1B07 A;  2CH4 A;  2EVR A;  1W6X A;  2K6D A;  3SEM A;  3JV3 A;  1M3A A;  1GFD A;  2DBM A;  2O9S A;  3U23 A;  5I22 A;  1TUD A;  4RTW A;  2MOX A;  2V1Q A;  2IIM A;  2KT1 A;  4J9E A;  1FYN A;  2AZS A;  5IH2 A;  2YDL A;  2FO0 A;  1GL5 A;  3QWX X;  2V1R A;  2W10 A;  4E6R A;  4AG1 C;  1ABO A;  4LE9 A;  4J9D A;  2EW3 A;  1GRI A;  1OV3 A;  2K7A A;  4OML A;  2DNU A;  2ECZ A;  1UHC A;  4K11 A;  2AKL A;  1ABQ A;  4IIM A;  4J9I A;  1T3S A;  4AG2 C;  1GCP A;  4F14 A;  2BZY A;  4JJB A;  2GGR A;  2D0N A;  5GJW B;  1UDL A;  2LJ3 A;  1SRL A;  4J9C A;  2KNB B;  2LMJ A;  1M27 C;  1SHF A;  3NGP A;  3VS2 A;  2CT3 A;  1TUC A;  4GLM A;  1WX6 A;  4RTX A;  4QT7 A;  2EYW A;  1WA7 A;  4JJC A;  2G6F X;  1QLY A;  2J6K A;  1K76 A;  2YUQ A;  1VYU A;  5EC7 A;  4OMN A;  1WXT A;  4RTZ A;  5IXF A;  1KIK A;  1VYV A;  3R6N A;  1Z9Z A;  2ROT A;  1JXM A;  1NM7 A;  3VRZ A;  1X69 A;  2JM8 A;  3NPF A;  3GBQ A;  2RQW A;  1WXU A;  1AOJ A;  4LNP A;  2A28 A;  1KSW A;  1YWP A;  4OMO A;  4F17 A;  1UFF A;  2VVK A;  1HD3 A;  2MIO A;  1SPK A;  1PKS A; 
#chains in the Genus database with same CATH topology
 3VS0 A;  2B86 A;  2E12 A;  3H0F A;  2J7I A;  3X20 B;  3L2U A;  4QVC A;  8ATC B;  1C1A A;  2XMF A;  1ARK A;  3L42 A;  4BE0 A;  4JJD A;  1CSK A;  2LNV A;  1WGS A;  1Z9Q A;  2ESW A;  1Q86 R;  1T0H A;  1IB8 A;  3EH1 A;  1Q86 C;  3VYH B;  3SWN B;  2XI9 A;  5J3B A;  1WLP B;  1Y96 B;  3CPW P;  3CC4 A;  2CP7 A;  4PFP A;  1YI2 T;  3MEV A;  1VQ9 Q;  2OTL Q;  2MCN A;  1WJS A;  2K3B A;  5IHN A;  4J8O A;  2XID A;  2Z0W A;  2GQV A;  2KVQ G;  3A8H B;  2DD5 A;  5LJ5 d;  3EG1 A;  2P4R A;  5GAM j;  1M90 R;  2RQU A;  2JT4 A;  1M90 C;  4Z02 A;  1OYX A;  1H8K A;  3CD6 T;  2DXB A;  1D0Z A;  4XTX A;  1AHJ B;  2DIL A;  1YI2 A;  2GQI A;  3FJP A;  4XTZ A;  1N8R R;  5KH6 A;  2EPD A;  1N8R C;  1QKX A;  2X4J A;  2EKO A;  4M78 F;  2NYS A;  1IHV A;  4BI3 A;  1X6G A;  1RI0 A;  4N4H A;  4CC7 A;  4Z8A A;  3CD6 A;  2DK3 A;  4LDX A;  1VA7 A;  3ZL7 C;  2HSP A;  3VS3 A;  2VC8 A;  1PHT A;  3MEW A;  4GBQ A;  3QSU A;  2DBK A;  4RTU A;  2M1H A;  5GAM g;  5A2Q E;  2MAM A;  1AZE A;  2DAQ A;  4J9F A;  1UG1 A;  5CKD A;  1W4S A;  2RI2 A;  4FYX B;  3PNW C;  3PVQ A;  1N27 A;  5GAN 7;  3C94 A;  2OJ2 A;  3TCJ A;  1YWO A;  1OUL A;  3I55 A;  2FVU A;  3X25 B;  4A4H A;  1Y57 A;  2IPO B;  2DTI A;  2C0I A;  3PT9 A;  1SSH A;  2BZ8 A;  3JSC A;  4PL6 A;  3OY9 A;  3T9N A;  2KDS A;  2ZPF B;  4F04 B;  1AVZ C;  5CKB A;  1HSQ A;  1XOV A;  2L0A A;  4M75 E;  1VQK Q;  3AT1 B;  2K2M A;  4XU0 A;  4EIK A;  1UGR B;  1SHG A;  3QZ5 B;  5GAO p;  3M0U A;  1RAG B;  1VQP Q;  1KC8 R;  1VQ8 Q;  3RIR A;  1VQL A;  4PJO E;  5GAM f;  4J6Y A;  3OYB A;  4OB1 B;  1KC8 C;  2YUP A;  1R77 A;  2HKQ B;  1QKW A;  1BI0 A;  4AFZ C;  4C5H A;  2KGT A;  2DZC A;  2KR3 A;  4E7Z A;  4RTT A;  4MMK A;  2XIC A;  2FB7 A;  3M55 A;  1OEB A;  4M7D E;  3CC2 Q;  2FEI A;  2O88 A;  2IVW A;  1MV3 A;  4C92 D;  1V1C A;  1M3C A;  3CCS T;  3ZBD A;  2HCK A;  4BE2 A;  1Q7Y U;  2ZPI B;  1YIT Q;  3G6E Q;  4ZN1 A;  1G3S A;  3VS1 A;  3G71 A;  1AWX A;  2JJ9 A;  5CKF A;  2QQ9 A;  5KYW B;  2DEQ A;  5HK3 A;  5L8R E;  5IHI A;  2W0Z A;  1Q82 U;  3L2Q A;  3H41 A;  5IXB A;  3WXM B;  1C6V X;  1OX8 A;  3E1S A;  1PRL C;  2M16 A;  1YIJ A;  3REB B;  3RKW A;  1K0X A;  4M7A F;  4NS5 A;  3JB9 D;  1AWO A;  5I2M A;  3RDV A;  1M3B A;  1NPR A;  3P8D A;  2AHJ B;  4B9X A;  2MK5 A;  4LDU A;  2GBQ A;  3GLX A;  2L2P A;  5KYY A;  2RQT A;  1YNZ A;  3CCL T;  6AT1 B;  1VQ6 Q;  1JRI A;  1HK9 A;  2RJD A;  3M0P A;  2RA2 A;  2YLC A;  3CCR A;  3RES A;  3VJP A;  5D6W A;  5GAN j;  1K4U S;  1QQJ A;  3DKM A;  2BZX A;  4E7K A;  1VQ4 T;  2PVG B;  1MMD A;  2XK0 A;  4F7U E;  1N9R A;  2PU9 B;  3G7Z A;  5LL6 S;  2F1L A;  5GMK i;  3OS5 A;  3CPF A;  1ZBX A;  2AK5 A;  4C92 A;  3OYM A;  2ATC B;  1KD1 R;  4BAC A;  2OAW A;  5EG2 A;  3HL8 A;  1KD1 C;  3MCA B;  1YP5 A;  4EPC A;  2M0O A;  3CCQ T;  3IQL A;  2E4H A;  1VQ4 A;  4PJO F;  1K9M R;  4FW1 A;  2Y4Y A;  1K9M C;  1WQ7 A;  2DA9 A;  4UC4 A;  1VQ9 T;  2OTL T;  3JCM h;  3HFO A;  2DL7 A;  4RUG A;  2CSQ A;  4CC2 A;  3OYD A;  1V76 A;  1X75 C;  5GAN g;  1UGQ B;  3NTK A;  2X3X D;  3SB2 A;  3VRY A;  1X27 A;  3ZEH A;  5AT1 B;  5LJ3 e;  2KE9 A;  1RAB B;  1WZO A;  3RNJ A;  3CCU T;  4OGE A;  2F69 A;  2KYB A;  5GJV B;  4DEX A;  1PSE A;  1OZ3 A;  3H6Z A;  4LDW A;  4KT0 E;  2FG0 A;  2OTL A;  3OYG A;  4E2F B;  5GMK h;  4ESR A;  2VKN A;  2DL3 A;  3OS1 A;  3BE3 A;  1B07 A;  1BIA A;  2K6D A;  4VUB A;  1NJI R;  1MNE A;  2JN0 A;  1D1A A;  1M4Z A;  1NJI C;  3OMG A;  2DBM A;  3OS0 A;  1PC0 A;  2IIM A;  2KT1 A;  3UWN A;  1BI1 A;  1S72 Q;  2YDL A;  4KUD K;  2G3R A;  2HMA A;  4OVA A;  5GAN f;  1XQH A;  3M9Q A;  2W10 A;  4AG1 C;  2CP5 A;  3QPH A;  1GRI A;  1OV3 A;  2K7A A;  3PGG A;  1W2B P;  3G4S T;  1UHC A;  2LVM A;  4IIM A;  1HYO A;  1GCP A;  2GGR A;  4L5G A;  2LJ3 A;  2CKK A;  2KNB B;  3TRE A;  2LMJ A;  3RR6 A;  1YHQ T;  1SHF A;  3OYF A;  1WX6 A;  4BY6 C;  3V8K A;  3KUF A;  1EIF A;  4JJC A;  3V8L A;  2R57 A;  4M78 A;  1QLY A;  1K76 A;  2CP3 A;  1QVG S;  1FX7 A;  1Q95 G;  1WXT A;  4OMN A;  1QVF A;  4F7U F;  2RH2 A;  2E65 A;  3R6N A;  1Z9Z A;  3BFM A;  2ROT A;  1JXM A;  1NM7 A;  2E6Z A;  2HQH A;  3VRZ A;  3GBQ A;  2RQW A;  4FT2 A;  4FL6 A;  4LNP A;  4Q5W A;  3E9F A;  7AT1 B;  1KSW A;  2E6N A;  4ELY C;  5HKC A;  1VQ8 T;  4ZTJ A;  1PKS A;  2YRC A;  2LQK A;  1R0B G;  4QKU A;  3VS6 A;  5GAN 3;  2NUZ A;  1KK7 A;  4ZGD B;  1PWT A;  1U06 A;  2M0Y A;  3LWH A;  2JM9 A;  3M54 A;  4JLG A;  1VQK A;  4PK4 A;  4PFO A;  2HEQ A;  2P0Q A;  1N6A A;  3I35 A;  2CP2 A;  1Q86 U;  2CRE A;  3URG A;  1B3Q A;  1OPK A;  4CC3 A;  1HXD A;  4JJN K;  2EGE A;  1VQP A;  1VQ8 A;  2CDT A;  4HKE A;  2CUB A;  1AEY A;  5IN1 A;  2XDB A;  2RF0 A;  2D0Q B;  4A53 A;  2P4T A;  2RPN A;  1OU8 A;  1JJ2 A;  3G6E T;  1M1F A;  2K4Y A;  2X9H A;  1TSF A;  1BK2 A;  2JZ2 A;  1DJ7 B;  1G3W A;  5GAO m;  5J26 A;  3CC2 A;  2KSS A;  4X9C A;  2K3Y A;  4R0K A;  3THK A;  2EKH A;  1UB4 A;  4JZ4 A;  3ER0 A;  1ACM B;  1YJ9 A;  2Y4X A;  5D6Y A;  2FPF A;  5GAN 8;  2RHZ A;  3VS5 A;  1YIT A;  2KYM A;  4HT8 A;  1WHK A;  1JXO A;  3RMQ A;  2L3Q A;  1JO8 A;  3FLG A;  2ROL A;  2VXF A;  2H8H A;  2O9V A;  2GFA A;  2LX7 A;  1GBQ A;  4Z89 A;  4BY6 B;  2GF7 A;  3H0H A;  2E3I A;  2EJG A;  2RNA A;  3I5R A;  5C6S A;  1VQ6 T;  2RN8 A;  2I2L A;  2HQE A;  2JOY A;  3CCE T;  3V7C A;  1QCO A;  1WJR A;  2DVJ A;  4IKF A;  4C0D C;  1MV0 B;  3EHQ A;  1UJY A;  4KGX B;  4D8D A;  3QWY A;  2LCS A;  2EYQ A;  1GCQ A;  4J9B A;  1VQ6 A;  2VGN A;  3OQ5 A;  2DJQ A;  3CXC S;  2DTO A;  3DLM A;  2QQA A;  4JS5 A;  1OI1 A;  2LNH B;  1FWZ A;  2COW A;  3EFR A;  1FMV A;  2XDP A;  4M7A A;  3CC4 T;  4PJN A;  3GOX A;  3S6W A;  1RAA B;  1X6O A;  3M0Q A;  5LJ5 h;  2MYS A;  3JCM P;  1W1F A;  5IAY A;  2HZY A;  1YJW Q;  1U8R A;  5KYU A;  1WXB A;  2WAC A;  2JMA A;  3M0T A;  5AYF A;  5A0G A;  3CPW A;  3JCM e;  1KC8 U;  3OW2 A;  5FU6 C;  3OW2 P;  3MO8 A;  4C5I A;  4FYW B;  2EGA A;  1K73 R;  2KRO A;  4FCY A;  2K5L A;  4P5N A;  1K73 C;  3WVE B;  1VQN Q;  4C92 C;  2KAF A;  1NEB A;  4J7I A;  1U3O A;  5LJ3 h;  2DKG A;  1D1C A;  3DB4 A;  2DYB A;  1NLP C;  3P8H A;  3UA6 A;  3O8V A;  1M30 A;  1TXQ A;  4C5E A;  1YBY A;  2O4X A;  5GMK e;  2A0F B;  2YWW A;  1U1T A;  1ZA1 B;  4HCC A;  2NUP B;  2OI3 A;  1RLQ C;  1BYM A;  4ZNX A;  1X6B A;  1ZBJ A;  5KE2 A;  3M53 A;  3M4Y A;  1I5O B;  5GAM d;  1F1B B;  2LT4 A;  1UHF A;  2KT8 A;  3TVT A;  1EX4 A;  4M77 E;  5I2S A;  5DLQ E;  4IUV A;  2JVV A;  3NHN A;  3RER A;  3H0I A;  1NYF A;  1UTI A;  2K5I A;  1WQW A;  3I56 Q;  2E41 A;  4ZGJ B;  4AFQ C;  4C0D B;  1S72 A;  3I55 T;  4HVU A;  4LN2 A;  2DER A;  2PVD B;  3J81 E;  1Y0M A;  1I07 A;  2QK0 A;  2CZ1 B;  2ZPH B;  5FRM A;  1BI3 A;  4N4I A;  1M5Q 1;  3QYG B;  5GAN 4;  1VQM Q;  2EYX A;  1KQ2 A;  1M9S A;  2QTX A;  3H9N A;  1E6G A;  5KYY B;  1PKT A;  3CMA Q;  3OYN A;  1VQL T;  2K3X A;  2CP0 A;  1MUZ A;  5L23 A;  5LJ3 g;  1ZSG A;  2K57 A;  1YCS B;  3GNF B;  1I8F A;  2FZG B;  3WVD B;  4L6V 5;  1UJ0 A;  1BCM A;  2D8J A;  5FU6 B;  2DVE A;  1X2Q A;  2GTJ A;  1KD1 U;  5GAO n;  3EFO A;  2HD0 A;  1QVF S;  3EG0 A;  4C92 B;  4CI0 C;  4IUR A;  1UUE A;  3MP6 A;  1XJW B;  2AZV A;  1ZA2 B;  4M78 C;  3PMT A;  1QVP A;  2RHY A;  1QCF A;  1GFC A;  1K9A A;  2VYT A;  3SD4 A;  1WHM A;  2YHT A;  3G71 T;  3CCJ Q;  3L2V A;  1YJN Q;  3VUB A;  1PRM C;  4HCZ A;  3OB9 A;  4F16 A;  3JCM X;  1BU1 A;  1RAI B;  2AKK A;  1RAC B;  3GNG A;  1RUW A;  2IG0 A;  2NUP A;  1KQS P;  3I5S A;  2P0K A;  3E9G A;  4JPB W;  5CQX A;  2SEM A;  1ZQ1 A;  2KQW A;  1YJ9 Q;  2YRV A;  5HK0 A;  4C92 G;  4E7S A;  1YIJ T;  1TTH B;  2O2O A;  1RLP C;  1VQ5 Q;  1P92 A;  3UA7 A;  3OYK A;  2YUN A;  1UGV A;  3HFN A;  1D3B A;  4PLL A;  4ZN3 A;  4XU1 A;  1KHI A;  2LCL A;  2EVR A;  2O01 E;  1W6X A;  3SEM A;  2HQX A;  2DO3 A;  1JB0 E;  2QEX Q;  4J7F A;  3NTI A;  1NJI U;  3KBG A;  1JJ2 S;  1GFD A;  4DQ2 A;  3RUX A;  4X9D A;  3QXE B;  1QP2 A;  2O9S A;  4M77 F;  3U23 A;  2MOX A;  2V1Q A;  2PQW A;  1D1B A;  1RL2 A;  1SG5 A;  3CCR T;  3ME9 A;  2QQS A;  2QA4 Q;  2DXU A;  5M9O A;  3QWX X;  2DEU A;  4C8Q D;  3BDU A;  3JB9 G;  4MDX A;  1ABO A;  4LE9 A;  4J9D A;  4PJM A;  5DLO A;  2ECZ A;  2QQB A;  4K11 A;  4QQD A;  4AG2 C;  1IRE B;  2BZY A;  5GJW B;  4XTW A;  1TWB A;  2QAS A;  3CBO A;  2GCX A;  5GMK m;  4HA8 A;  4PKC C;  4GLM A;  3CCV Q;  4QT7 A;  3HTR A;  3PIO A;  2LT1 A;  1Y7X A;  4JS4 A;  1VYU A;  5EC7 A;  3JCM Q;  4DOW A;  1UEB A;  1KIK A;  3CC7 Q;  2XHC A;  1YCY A;  2OX7 A;  1X69 A;  3OS2 A;  3HRS A;  3NPF A;  4C0Z A;  1NPP A;  4M75 F;  4DBH A;  1M8V A;  2ZPB B;  4M78 B;  4A4E A;  2VAS A;  1QW1 A;  2A28 A;  5LJ5 e;  3JB9 H;  4OB0 B;  4F17 A;  5GAN d;  1LNX A;  1UFF A;  4J5Y A;  1HD3 A;  4QW2 A;  4XU2 A;  1SPK A;  2E5Q A;  4BB7 A;  2ED0 A;  3EG9 A;  3FC3 A;  2AT1 B;  2VGM A;  1JU5 C;  2XU8 A;  1VQ7 Q;  3EH2 A;  3CCM Q;  1M1K U;  3X24 B;  1VQN T;  1GCQ C;  1OPL A;  2CYZ B;  2EBP A;  3DB3 A;  4IUP A;  4BDY A;  4M7D F;  1YJW A;  1UE9 A;  4M78 D;  5CKH A;  2PVO B;  4KH0 B;  4RTY A;  4M78 G;  9ATC B;  4CC4 B;  2QGG A;  3QKJ A;  5GAM e;  2LRQ A;  1MND A;  2VUB A;  4M7A C;  4N4G A;  1PSF A;  2X4X A;  3QBY A;  4C8Q A;  5FWB A;  3TSW A;  4B6M A;  1VQN A;  3CPW S;  4D6W A;  3ULR B;  2EFI A;  4LDV A;  5CQY A;  1Y07 A;  4JRP A;  1K0S A;  2XDD A;  2Y90 A;  4HT9 A;  2CZ7 B;  4J6X A;  3MPU B;  4KH1 B;  3E2U A;  4FSX A;  4MDW A;  1B7T A;  1M2V A;  2M02 A;  1B34 A;  2L3S A;  1ZSZ A;  3EGX A;  2GFU A;  4RTV A;  3LH5 A;  3OMC A;  2MF2 A;  4LUE A;  3FIF A;  3UDC A;  2EIF A;  1YN8 A;  1WPY A;  1Q81 U;  1Q82 R;  3E19 A;  3EGU A;  1T0J A;  2ZPG B;  3I56 T;  1Q82 C;  5GMK j;  1KQ1 A;  3M57 A;  2COY A;  2GTO A;  2DRK A;  1Y71 A;  2QAZ A;  1U1S A;  3VUZ A;  1G83 A;  3MEA A;  3OYE A;  1W2B A;  1YFN A;  1IGQ A;  1IHW A;  5IHK A;  1ZUY A;  1ZUK A;  4PJO C;  1I5L A;  4J9G A;  4OMP A;  2E5K A;  2J6O A;  4FT4 A;  3I56 A;  4C92 E;  3M0S A;  3JCM g;  1UGP B;  4BD3 A;  2LQ8 A;  2DLP A;  2F5K A;  3CMA T;  4A54 A;  4J9H A;  2MWO A;  2K9G A;  1SEM A;  2OTJ Q;  1M8M A;  1FMW A;  2A7Y A;  5C0M A;  1J3T A;  3OYA A;  3I9Q A;  1IO6 A;  2QG9 B;  4FYY B;  1VQM A;  2CUD A;  1VQK T;  3M59 A;  1TS9 A;  2QTV A;  2KRS A;  1MGQ A;  3TEE A;  3D7S B;  2EWN A;  3VU3 C;  4OB2 B;  2R58 A;  1W70 A;  3CMA A;  1VQP T;  3RKX A;  1CKA A;  3S3O A;  2MI6 A;  4HXJ A;  4L59 A;  1K1Z A;  1I0C A;  3LX7 A;  2CP6 A;  1I1J A;  4HCB A;  2EQU A;  3HSB A;  4M7A B;  4HVW A;  4HCK A;  1XNI A;  2LC4 A;  3CCJ T;  2O31 A;  2FL7 A;  3JCM f;  3CC2 T;  2EQI A;  2D1X A;  4DOV A;  4Z88 A;  3NTH A;  3LW5 E;  4TVR A;  1RAH B;  5FWC A;  1VQO Q;  5KYU B;  2RD1 A;  3QYH B;  1PNJ A;  1YJ9 T;  3M5A A;  1O75 A;  2DM1 A;  2RJF A;  2X4Y A;  2RMO A;  3LWI A;  4OP0 A;  1YIT T;  3CBP A;  5HCK A;  1CKB A;  1VQ5 T;  2CH4 W;  3CCJ A;  4M7A D;  1OOT A;  4JRK A;  1YJN A;  3A8O B;  3GP8 A;  2LJ1 A;  4B9W A;  3O5Z A;  3RBB B;  4M7A G;  1M90 U;  2DF6 A;  5HY6 A;  4RCC A;  1H3Z A;  2RHI A;  3MJX A;  2VWF A;  2FYK A;  1QP3 A;  3V8J A;  4BUG A;  2QEX T;  4EDU A;  2NUT A;  2KMT A;  2DD4 A;  1N8R U;  1VQ5 A;  5GAO q;  2F5T X;  5FRN A;  2FPD A;  2O4X B;  2QA4 T;  2DL5 A;  3X26 B;  3CCS Q;  3EHR A;  4C0G A;  1QCN A;  3CBM A;  2HBP A;  4XK8 E;  3QDR B;  2X3W D;  3HRT A;  2D8H A;  2A36 A;  2JMC A;  3M58 A;  1BB9 A;  2QEX A;  4KUI A;  1H92 A;  4ELZ C;  4LDY A;  2CT4 A;  4M78 E;  4M75 D;  1M2O A;  1K8A R;  3NMZ C;  1ZLM A;  2DE0 X;  5GAN 2;  3EG2 A;  1K8A C;  2X51 A;  2MMP A;  2QA4 A;  1NG2 A;  2JW4 A;  4MZM A;  2QYZ A;  3CCV T;  1VOM A;  1SKU B;  2LX9 A;  4PJO D;  1R0C B;  2JS0 A;  4A4F A;  2LQW A;  3QJ6 A;  2MWP A;  3OBY A;  2FRW A;  2RJC A;  4N0A A;  4PNO A;  1E7O A;  3JAM E;  3VS4 A;  1ZUU A;  3GF5 A;  4LD9 K;  4DBQ A;  3CCV A;  5CVI A;  5FRO A;  5A0D A;  3CCL Q;  4PJL A;  1WIE A;  4OMQ A;  2F2V A;  2DXT A;  2AIR B;  3OSV A;  2KY9 A;  2K79 A;  3QDF A;  3QII A;  4OMM A;  1QWF A;  5CIU A;  3CC7 A;  2E1H A;  2EAY A;  4C5G A;  2MPX C;  2HL5 C;  3JB9 F;  1WYX A;  3VS7 A;  4V2S A;  2FHD A;  2V8J A;  4ANJ A;  1TG0 A;  3QO3 A;  5DY9 A;  1FXX A;  2RK1 A;  1NLO C;  4E7H A;  3EFO B;  2ABL A;  3M4G A;  4KBM B;  5LJ5 j;  5FU7 C;  3CCQ Q;  3PMI A;  1VQ7 A;  1D0Y A;  3CCM A;  4OB3 B;  5GAM h;  2KRN A;  2RB6 A;  2A08 A;  4Y92 A;  3A1P A;  3VYG A;  2DYI A;  1KG1 A;  4M75 A;  5A0L A;  4FSS A;  2DRM A;  5KYX A;  4OGC A;  3S3N A;  2WSE E;  2YT6 A;  4F7U B;  2DL8 A;  1RI9 A;  1RAF B;  2KI7 A;  1KFZ A;  4EMG A;  2LP5 A;  2ZPE B;  3KXT A;  4M4Z A;  3Q1J A;  4PJO A;  4ORZ A;  2CGH A;  3NFC A;  4IIO A;  5D6X A;  5D7U A;  5GMK l;  1S72 T;  2JNG A;  5LJ3 j;  1BKB A;  2DMO A;  3A8M B;  4IUT A;  3CCU Q;  3SFM A;  3MP8 A;  3TU4 K;  4M7D A;  4EMK A;  1M3A A;  1TOV A;  1D3B B;  1TUD A;  4RTW A;  2K5F A;  3H8Z A;  4C8Q C;  3AHU A;  1FYN A;  4F7U G;  2DIG A;  2AZS A;  4ZGE B;  5LJ5 g;  4E7I A;  2FO0 A;  1GL5 A;  4RG8 A;  4E7L A;  2YLB A;  4E6R A;  2L89 A;  5LJ3 d;  3UPU A;  2EW3 A;  3MET A;  1PG5 B;  4GLK A;  1ABQ A;  2OTJ T;  1IZ6 A;  1ZSZ C;  1QVG A;  2E10 A;  1SF9 A;  1TUG B;  3V7R A;  1QVG P;  3EAE A;  1WNL A;  4JJB A;  4M7A E;  4J9C A;  1M27 C;  2EJ9 A;  1VIF A;  3OYY A;  1W2B S;  4MZT A;  3PIP A;  4RTX A;  4J6W A;  2DPP B;  3G4S Q;  2EYW A;  1WA7 A;  2CZ0 B;  3LYI A;  3MP1 A;  2G6F X;  1NE8 A;  1WJQ A;  4NL3 A;  2J6K A;  3QJY A;  2R5M A;  2EQK A;  3X28 B;  5IXF A;  1WHJ A;  2CS7 A;  2OTJ A;  3LH0 A;  4MZP A;  3L1A A;  4OF1 A;  1YHQ Q;  1LOJ A;  2JM8 A;  3J7A F;  1WXU A;  5LJ5 f;  4KGV B;  2LCC A;  3M56 A;  4JDS A;  1AOJ A;  4OMO A;  3OYI A;  5FU7 B;  2VVK A;  2MIO A;  4AT1 B;  3RMS A;  3QHS A;  1LJO A;  2EQJ A;  4JZ3 A;  3BY7 A;  2V8K A;  3SWN A;  3FEO A;  4PLI A;  1TH7 A;  2HDA A;  4BI8 B;  3PE0 A;  1Y96 A;  1BI2 A;  2SRC A;  1VQO T;  1K9M U;  2E70 A;  2DIQ A;  3P8B B;  3VKI A;  2DX1 A;  2RI3 A;  2I0N A;  3LLR A;  4AFU C;  3LGL A;  5KCO A;  2E64 A;  4PJJ A;  4F7U A;  1N5Z A;  4FU6 A;  3EG9 B;  4JRI A;  2QDL A;  3CME Q;  1LVK A;  2L3P A;  1SRM A;  5LJ3 f;  1KQS A;  2CSI A;  2J05 A;  4OMF B;  2PNI A;  2P0P A;  3UF4 A;  2YSQ A;  4LD6 A;  1VQO A;  4JRQ A;  4PFZ A;  2RJE A;  4ZTF A;  3RKY A;  3JB9 I;  1MMG A;  1WDX A;  2RHU A;  1KJW A;  3TSZ A;  3HRU A;  3SHW A;  4D8K A;  1MMA A;  2D6F A;  4C8Q B;  1U5S A;  2RQR A;  3UT1 A;  1PM3 A;  2DL4 A;  1JBM A;  1S1N A;  2VXE A;  5I21 A;  1G5V A;  1PD0 A;  2PZ1 A;  4NL2 A;  1G2B A;  2CZ6 B;  5FW9 A;  3F70 A;  3C95 A;  2QI2 A;  2HL3 A;  1ZX6 A;  3G1J A;  4AMC A;  1MMN A;  2NWM A;  1M2V B;  1B34 B;  2DJZ A;  1ZSZ B;  3EGX B;  4QVZ A;  1TU0 B;  1QWE A;  1NEG A;  3KFV A;  2H3J A;  2E3H A;  2LQN A;  1WHH A;  1FMK A;  1HJD A;  5KE3 A;  2NLU A;  2YRD A;  3CCS A;  1JQQ A;  4C8Q G;  2HAX A;  4R55 A;  4AFS C;  1GBR A;  4XTV A;  1AZG B;  2V26 A;  3OA6 A;  4ATO A;  5GAN h;  2HKN A;  2C06 A;  2KRM A;  2PUK B;  1AT1 B;  3UAT A;  2P84 A;  3JRZ A;  4XAX B;  2GNC A;  3CXC A;  1VYT A;  3J80 E;  3CXC P;  4BI4 A;  3C4S A;  2XD0 A;  1PD1 A;  2BIV A;  3CEY A;  2ENM A;  3L2R A;  4XTY A;  3TQ7 P;  2J6F A;  3JCM b;  5CCA A;  1PCX A;  2HBW A;  4WCI A;  3CCE Q;  3M0R A;  4X1V A;  4WTO B;  5ECA A;  1YJW T;  2F2X A;  1G3T A;  2RQV A;  4DA4 A;  1WHL A;  5GAO l;  1OZ2 A;  3HKS A;  4FYV B;  3GIB A;  3A5Z B;  1H64 1;  1N9S A;  2EYY A;  3CCL A;  3HP9 A;  4A4K A;  1KHC A;  1G8X A;  2WSC E;  2BE9 B;  1SSF A;  3SDZ A;  4WF2 A;  3PVL A;  5KYN A;  2ZGW A;  4J83 A;  2EYZ A;  1H3H A;  2EQM A;  3EFS A;  4N0A C;  2DTH A;  4CRI A;  3CC4 Q;  4M77 C;  4A4G A;  4A63 B;  1QMC A;  3CQT A;  3PFS A;  1UEC A;  3MKD A;  1A0N B;  3MEU A;  1NYG A;  3JB9 J;  4RCB A;  4C0F A;  2QDY B;  1JEG A;  1RAD B;  2ZAE A;  2RK2 A;  3CCQ A;  5GAN 5;  3OYJ A;  2LDM A;  5CAI A;  1O9S A;  3OW2 S;  1ZHI A;  3ASK A;  2RI5 A;  2LTO A;  3OYC A;  1XTD A;  2F2W A;  2M51 A;  1M1G A;  2KEA A;  2L3R A;  1YI2 Q;  2BUD A;  4Y28 E;  5KYW A;  5IT9 E;  2R5A A;  8AT1 B;  1Q7Y R;  1BBZ A;  4IUQ A;  5CK9 A;  1Q7Y C;  2FRY A;  1R8O B;  3QG1 A;  2DFU A;  1VQ9 A;  4DBR A;  2PUO B;  1VUB A;  2C0T A;  3OSS C;  2FZC B;  2J06 A;  2COZ A;  2BKD N;  4XU3 A;  2PTK A;  2K2V A;  3QZ9 B;  4X34 A;  5CKE A;  2YUO A;  3JCM d;  3CD6 Q;  3DLL A;  3QUI A;  2NUT B;  4M75 C;  2KXD A;  3CCU A;  4KRT A;  1LCK A;  3C0C A;  3OBW A;  4MML A;  3HPW A;  3FRN A;  4DBF A;  1OQK A;  2FPE A;  3HHT B;  1VQM T;  1E6H A;  2RO0 A;  3OYL A;  2EGC A;  2C0O A;  2JXB A;  4HVV A;  3EG3 A;  4DEY A;  1K8A U;  3INZ A;  1WFW A;  3C12 A;  4LUD A;  1X43 A;  2LJ0 A;  4M7D C;  4EMK C;  3R6O A;  1AWW A;  2XG8 D;  5GAO r;  4YTL A;  1IRX A;  4FW2 A;  3I55 Q;  3N5B B;  2JS2 A;  2KBT A;  2WSF E;  3OYH A;  1MHN A;  3ZFJ A;  1IXD A;  2LZ6 B;  5CR2 A;  2A3L A;  5I11 A;  3G4S A;  2ED1 A;  1QVF P;  4M77 B;  4JLI A;  4JUV A;  4RKU E;  3BDL A;  1G3Y A;  2JTE A;  1OU9 A;  1YHQ A;  1T3L A;  3A8L B;  1VQL Q;  4E7J A;  2X35 A;  4C8Q E;  1EZZ B;  1AWJ A;  4O6J A;  1YJN T;  3EGD B;  4NOY A;  3CME T;  3LGF A;  2ZCF B;  1EFN A;  4FIB A;  1M1K R;  4BE1 A;  1AD5 A;  1M1K C;  4M77 D;  1BIB A;  1K73 U;  1VIE A;  3A98 A;  4M77 G;  2HNI A;  4RMO A;  2XKO C;  2ZZD A;  1WHG A;  3BW1 A;  2A37 A;  1NBE B;  3CME A;  2QGF B;  1WI7 A;  2KXC A;  2VB6 A;  1X2K A;  2BTT A;  3G71 Q;  2JTF A;  4IUU A;  3REA B;  3FJ5 A;  3SWN C;  4M75 B;  1JJ2 P;  1UGS B;  5KYX B;  3L2Z A;  4QQ6 A;  3PTA A;  2EJF A;  4II1 A;  1IGU A;  1KQS S;  2V8I A;  1GXI E;  2BE7 D;  4PJO B;  2QXF A;  1X01 A;  2CH4 A;  5FLX E;  3JV3 A;  2DXC A;  2DET A;  1YIJ Q;  3FDR A;  1D0X A;  4QQG A;  2X4W A;  5I22 A;  2OAU A;  3FB9 A;  1Q81 R;  4J9E A;  3G6E A;  2B8A A;  3V7S A;  5IH2 A;  1Q81 C;  4BDZ A;  4M7D B;  4EMK B;  2H3E B;  4M75 G;  2V1R A;  1V29 B;  3VV0 A;  1I81 A;  2QQR A;  2L8D A;  4C92 F;  5GAN e;  4QVD A;  1BCO A;  4OML A;  1I4K 1;  2DNU A;  2KK4 A;  5KCH A;  2AKL A;  4J9I A;  4PJO G;  1T3S A;  3CCR Q;  1OX9 A;  4F14 A;  3L2W A;  2D0N A;  3CC7 T;  3JCM V;  1RAE B;  1D09 B;  1UDL A;  2HSE B;  2FZK B;  1SRL A;  2RM4 A;  4KGZ B;  4XQ3 A;  4R56 A;  5DM7 R;  3NGP A;  3VS2 A;  1C0M A;  4Y91 A;  4M77 A;  2CT3 A;  1TUC A;  4M7D D;  3JCM c;  4M7D G;  3JCM W;  2M9U A;  2YUQ A;  4RG2 A;  2RHX A;  2JTM A;  3A8G B;  4LXC A;  3GPL A;  4O5V A;  4RTZ A;  2D9T A;  1VYV A;  2L5Q A;  4FM4 B;  4GY5 A;  3EGD A;  2JUF A;  5J39 A;  5CO7 A;  2YXY A;  3JCM J;  1VQ7 T;  5GAN 6;  3CCM T;  4XTU A;  2VV5 A;  2DZ9 A;  1VQ4 Q;  4EMH A;  1YWP A;  1LPL A;  4C8Q F;  3CCE A;  3S3M A;  4KUL A;  3MHX A;  4E47 A;  4ME7 A;  1NZ9 A; 
#chains in the Genus database with same CATH homology
 4JZ3 A;  3VS6 A;  3VS0 A;  2B86 A;  2ED0 A;  2HDA A;  3H0F A;  3PE0 A;  2J7I A;  2SRC A;  2NUZ A;  1JU5 C;  1PWT A;  1U06 A;  2DX1 A;  2M0Y A;  2XMF A;  2I0N A;  2JM9 A;  4AFU C;  1ARK A;  4JJD A;  1CSK A;  1Z9Q A;  2ESW A;  2HEQ A;  1GCQ C;  1OPL A;  2EBP A;  1T0H A;  1N5Z A;  3I35 A;  1UE9 A;  2CRE A;  2QDL A;  1B3Q A;  1OPK A;  1WLP B;  2L3P A;  4CC3 A;  1SRM A;  2CSI A;  2EGE A;  4RTY A;  4CC4 B;  2J05 A;  2CDT A;  2PNI A;  3UF4 A;  2CUB A;  1AEY A;  2YSQ A;  2RF0 A;  2MCN A;  5FWB A;  2RPN A;  2K3B A;  3TSW A;  5IHN A;  1WDX A;  1KJW A;  3ULR B;  3TSZ A;  3EG1 A;  1BK2 A;  3SHW A;  2P4R A;  4D8K A;  1U5S A;  2RQR A;  2RQU A;  2JT4 A;  1K0S A;  4R0K A;  1H8K A;  2DL4 A;  3THK A;  2EKH A;  1S1N A;  2L3S A;  2DIL A;  4JZ4 A;  2PZ1 A;  2GQI A;  1G2B A;  4RTV A;  3LH5 A;  2FPF A;  5FW9 A;  4LUE A;  2EPD A;  3VS5 A;  2KYM A;  1QKX A;  1YN8 A;  1ZX6 A;  1JXO A;  2NWM A;  3EGU A;  1T0J A;  2L3Q A;  1X6G A;  1JO8 A;  1QWE A;  1NEG A;  4CC7 A;  3KFV A;  2GTO A;  2DRK A;  2ROL A;  4Z8A A;  2H8H A;  2LQN A;  1FMK A;  2O9V A;  1G83 A;  1HJD A;  1VA7 A;  1JQQ A;  2LX7 A;  1GBQ A;  5IHK A;  4Z89 A;  4AFS C;  1GBR A;  3ZL7 C;  2HSP A;  3VS3 A;  1AZG B;  1PHT A;  3H0H A;  1ZUY A;  4GBQ A;  1ZUK A;  2RNA A;  3I5R A;  2KRM A;  2DBK A;  3UAT A;  4J9G A;  4OMP A;  4RTU A;  2GNC A;  2RN8 A;  2E5K A;  2J6O A;  3M0S A;  2DLP A;  1VYT A;  4J9H A;  1AZE A;  4J9F A;  2K9G A;  1UG1 A;  2DVJ A;  1SEM A;  1M8M A;  1J3T A;  3PVQ A;  3I9Q A;  1MV0 B;  1IO6 A;  2ENM A;  2OJ2 A;  3EHQ A;  1UJY A;  4D8D A;  2J6F A;  3QWY A;  2LCS A;  1GCQ A;  4J9B A;  2CUD A;  1YWO A;  2DJQ A;  2KRS A;  2HBW A;  4WCI A;  3M0R A;  4X1V A;  5ECA A;  2F2X A;  1Y57 A;  2LNH B;  2RQV A;  2C0I A;  1SSH A;  2BZ8 A;  1W70 A;  1CKA A;  2EYY A;  4HXJ A;  1K1Z A;  3M0Q A;  1AVZ C;  1HSQ A;  1I0C A;  1XOV A;  2L0A A;  1W1F A;  1I1J A;  2K2M A;  3PVL A;  4HVW A;  4EIK A;  4HCK A;  2EYZ A;  1WXB A;  1H3H A;  1SHG A;  2O31 A;  3M0U A;  2JMA A;  3M0T A;  2EQI A;  2D1X A;  4A63 B;  4Z88 A;  2YUP A;  3CQT A;  1UEC A;  1QKW A;  4AFZ C;  1A0N B;  5FWC A;  2KGT A;  1NYG A;  1PNJ A;  2KR3 A;  2EGA A;  2KRO A;  4RTT A;  2DM1 A;  1JEG A;  2RMO A;  1OEB A;  1NEB A;  5HCK A;  1CKB A;  1U3O A;  2FEI A;  2CH4 W;  1OOT A;  2O88 A;  2LJ1 A;  2DYB A;  3O5Z A;  2F2W A;  1MV3 A;  3RBB B;  2M51 A;  2KEA A;  1NLP C;  2DF6 A;  3UA6 A;  1M30 A;  1V1C A;  1M3C A;  2VWF A;  1BBZ A;  2HCK A;  2FRY A;  3VS1 A;  2C0T A;  2J06 A;  1AWX A;  2PTK A;  2OI3 A;  1RLQ C;  2FPD A;  4ZNX A;  1X6B A;  1ZBJ A;  5IHI A;  2YUO A;  2W0Z A;  2DL5 A;  2KXD A;  3EHR A;  3H41 A;  5IXB A;  2KT8 A;  1UHF A;  4KRT A;  1LCK A;  3C0C A;  2X3W D;  3TVT A;  2D8H A;  2A36 A;  2JMC A;  1BB9 A;  1PRL C;  1H92 A;  2FPE A;  3NHN A;  2CT4 A;  3H0I A;  1E6H A;  3REB B;  1NYF A;  2EGC A;  1K0X A;  1UTI A;  2C0O A;  3NMZ C;  2JXB A;  1ZLM A;  4AFQ C;  1AWO A;  2DE0 X;  4HVV A;  3EG2 A;  4HVU A;  3EG3 A;  4LN2 A;  4DEY A;  1M3B A;  1NG2 A;  2JW4 A;  1WFW A;  4LUD A;  1Y0M A;  1I07 A;  1X43 A;  2JS0 A;  2GBQ A;  2L2P A;  2LQW A;  2LJ0 A;  2RQT A;  1YNZ A;  1AWW A;  2EYX A;  3M0P A;  2FRW A;  2JS2 A;  2KBT A;  1K4U S;  1E6G A;  1E7O A;  1PKT A;  3VS4 A;  2BZX A;  1ZUU A;  1MUZ A;  2LZ6 B;  5L23 A;  1ZSG A;  5I11 A;  1WIE A;  4OMQ A;  2ED1 A;  2F2V A;  1YCS B;  2K79 A;  4OMM A;  2AK5 A;  1QWF A;  1UJ0 A;  2D8J A;  2JTE A;  2OAW A;  1X2Q A;  2GTJ A;  1YP5 A;  1T3L A;  1WYX A;  3VS7 A;  1AWJ A;  3IQL A;  3EG0 A;  1UUE A;  1TG0 A;  1EFN A;  2AZV A;  1NLO C;  2DA9 A;  1AD5 A;  1QCF A;  2ABL A;  1GFC A;  1K9A A;  3A98 A;  2KRN A;  1PRM C;  2DL7 A;  4RUG A;  1BU1 A;  2CSQ A;  2A08 A;  4Y92 A;  4CC2 A;  4F16 A;  2AKK A;  4FSS A;  2X3X D;  2A37 A;  2DRM A;  1RUW A;  3I5S A;  3VRY A;  4JPB W;  2SEM A;  1X27 A;  2YT6 A;  2KE9 A;  2DL8 A;  3RNJ A;  1WI7 A;  1RI9 A;  5GJV B;  4DEX A;  2KYB A;  2KXC A;  1KFZ A;  1X2K A;  2BTT A;  2LP5 A;  3REA B;  4M4Z A;  3FJ5 A;  4ORZ A;  2FG0 A;  2O2O A;  1RLP C;  3UA7 A;  2YUN A;  4IIO A;  1UGV A;  4ESR A;  2VKN A;  2DL3 A;  2DMO A;  1B07 A;  2CH4 A;  2EVR A;  1W6X A;  2K6D A;  3SEM A;  3JV3 A;  1M3A A;  1GFD A;  2DBM A;  2O9S A;  3U23 A;  5I22 A;  1TUD A;  4RTW A;  2MOX A;  2V1Q A;  2IIM A;  2KT1 A;  4J9E A;  1FYN A;  2AZS A;  5IH2 A;  2YDL A;  2FO0 A;  1GL5 A;  3QWX X;  2V1R A;  2W10 A;  4E6R A;  4AG1 C;  1ABO A;  4LE9 A;  4J9D A;  2EW3 A;  1GRI A;  1OV3 A;  2K7A A;  4OML A;  2DNU A;  2ECZ A;  1UHC A;  4K11 A;  2AKL A;  1ABQ A;  4IIM A;  4J9I A;  1T3S A;  4AG2 C;  1GCP A;  4F14 A;  2BZY A;  4JJB A;  2GGR A;  2D0N A;  5GJW B;  1UDL A;  2LJ3 A;  1SRL A;  4J9C A;  2KNB B;  2LMJ A;  1M27 C;  1SHF A;  3NGP A;  3VS2 A;  2CT3 A;  1TUC A;  4GLM A;  1WX6 A;  4RTX A;  4QT7 A;  2EYW A;  1WA7 A;  4JJC A;  2G6F X;  1QLY A;  2J6K A;  1K76 A;  2YUQ A;  1VYU A;  5EC7 A;  4OMN A;  1WXT A;  4RTZ A;  5IXF A;  1KIK A;  1VYV A;  3R6N A;  1Z9Z A;  2ROT A;  1JXM A;  1NM7 A;  3VRZ A;  1X69 A;  2JM8 A;  3NPF A;  3GBQ A;  2RQW A;  1WXU A;  1AOJ A;  4LNP A;  2A28 A;  1KSW A;  1YWP A;  4OMO A;  4F17 A;  1UFF A;  2VVK A;  1HD3 A;  2MIO A;  1SPK A;  1PKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...