2ERAA

Recombinant erabutoxin a, s8g mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
RICFNHQGSQPQTTKTCSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERABUTOXIN A
publication title High resolution x-ray analysis of two mutants of a curaremimetic snake toxin
pubmed doi rcsb
source organism Laticauda semifasciata
molecule tags Neurotoxin
total genus 12
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1997-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2eraA00
2CRTA 5DU1A 1TXAA 2ERAA 2L03A 1NTXA 1H0JA 1W6BA 4XJJA 1ABTA 3BT1U 2H64C 1LXHA 2H8UA 1FASA 3EBXA 2HLRA 1LSIA 1HOYA 1CDTA 1LX5B 2MUPA 4P7UA 3VTSA 1PLOA 5EBXA 2MJ4A 1QKDA 1FF4A 1QKEA 2QJBC 1CDQA 1HAJA 2QJAC 4OM5A 1CXNA 1F94A 1KC4A 1XT3A 2H7ZA 2J8BA 3EVSC 3KFDE 1RGJA 1ES7B 1CCQA 2LCRA 1IDGA 2H7ZB 2HLQA 1COEA 4LFTA 1L4WA 4EY8B 1G6MA 1FSCA 3BT2U 1LJZA 1IQ9A 2L5SA 2MJYA 3HH7A 5IMTD 1BXPA 1KXIA 1UG4A 1CHVS 2GOOC 2MUOA 2PJYC 2X8BB 1KTZB 2BHIA 4DO8A 2H64B 1IKCA 1B41B 2ABXA 3KFDI 1KBSA 1MAHF 1FRAA 1VB0A 1CVOA 2QJ9C 2QC1A 4FAOE 2BTXA 3PLCA 1MR6A 1IDIA 1NYUA 1ZADA 2CCXA 1KFHA 2JVEA 1REWC 2N99A 1ONJA 1V6PA 3QB4B 1ERGA 4OM4A 2LA1A 2CTXA 3NH7A 1KL8A 3LAQU 1NTNA 2H62C 2I9BE 1ERAA 2MFAA 4UY2C 6EBXA 1CREA 1YWHA 4AEAA 5IMYC 1CB9A 1TXBA 2JQPA 1S4YA 3NEQA 1I02A 2GOOB 1KBTA 2PJYB 1KBAA 4IYEA 2CRSA 1RL5A 2VLWA 5DO6A 4FAOC 1CTXA 4BIKB 4ZQYA 1BTEA 1LXGA 1QM7A 4RUDA 3U73U 2MHYA 4BDTB 1IK8A 1NEAA 1DRSA 1KU6B 2H62D 1CXOA 2MJ0A 1NXBA 1IDLA 3NDSA 2UWRA 1NORA 1CDRA 1HC9A 1JBDA 1CRFA 1FFJA 2FD6U 3U74U 1HC9B 1TFSA 1M9ZA 1F8UB 4HQPF 2H5FA 2UX2A 1IJCA 1KS6A 1IDHA 1JE9A 3ERAA 1HAAA 1JGKA 2NBTA 5DZ5A 1FSSB 1NYSA 1CODA 1CDSA 2OFSA 1TGXA 4QTIU 2K3GA 2CDXA 3FEVA
chains in the Genus database with same CATH superfamily
2CRTA 5DU1A 1TXAA 2ERAA 2L03A 1NTXA 1H0JA 1W6BA 4XJJA 1ABTA 3BT1U 2H64C 1LXHA 2H8UA 1FASA 3EBXA 2HLRA 1LSIA 1HOYA 1CDTA 1LX5B 2MUPA 4P7UA 3VTSA 1PLOA 5EBXA 2MJ4A 1QKDA 1FF4A 1QKEA 2QJBC 1CDQA 1HAJA 2QJAC 4OM5A 1CXNA 1F94A 1KC4A 1XT3A 2H7ZA 2J8BA 3EVSC 3KFDE 1RGJA 1ES7B 1CCQA 2LCRA 1IDGA 2H7ZB 2HLQA 1COEA 4LFTA 1L4WA 4EY8B 1G6MA 1FSCA 3BT2U 1LJZA 1IQ9A 2L5SA 2MJYA 3HH7A 5IMTD 1BXPA 1KXIA 1UG4A 1CHVS 2GOOC 2MUOA 2PJYC 2X8BB 1KTZB 2BHIA 4DO8A 2H64B 1IKCA 1B41B 2ABXA 3KFDI 1KBSA 1MAHF 1FRAA 1VB0A 1CVOA 2QJ9C 2QC1A 4FAOE 2BTXA 3PLCA 1MR6A 1IDIA 1NYUA 1ZADA 2CCXA 1KFHA 2JVEA 1REWC 2N99A 1ONJA 1V6PA 3QB4B 1ERGA 4OM4A 2LA1A 2CTXA 3NH7A 1KL8A 3LAQU 1NTNA 2H62C 2I9BE 1ERAA 2MFAA 4UY2C 6EBXA 1CREA 1YWHA 4AEAA 5IMYC 1CB9A 1TXBA 2JQPA 1S4YA 3NEQA 1I02A 2GOOB 1KBTA 2PJYB 1KBAA 4IYEA 2CRSA 1RL5A 2VLWA 5DO6A 4FAOC 1CTXA 4BIKB 4KSNA 4ZQYA 1BTEA 1LXGA 1QM7A 4RUDA 3U73U 2MHYA 4BDTB 1IK8A 1NEAA 1DRSA 1KU6B 2H62D 1CXOA 2MJ0A 1NXBA 1IDLA 3NDSA 2UWRA 1NORA 1CDRA 1HC9A 1JBDA 1CRFA 1FFJA 2FD6U 3U74U 1HC9B 1TFSA 1M9ZA 1F8UB 4HQPF 2H5FA 2UX2A 1IJCA 1KS6A 1IDHA 1JE9A 3ERAA 1HAAA 1JGKA 2NBTA 5DZ5A 1FSSB 1NYSA 1CODA 1CDSA 2OFSA 1TGXA 4QTIU 2K3GA 2CDXA 3FEVA
chains in the Genus database with same CATH topology
2CRTA 5DU1A 1TXAA 2ERAA 2L03A 1NTXA 1H0JA 1W6BA 4XJJA 1ABTA 3BT1U 2H64C 1LXHA 2H8UA 1FASA 3EBXA 2HLRA 1LSIA 1HOYA 1CDTA 1LX5B 2MUPA 4P7UA 3VTSA 1PLOA 5EBXA 2MJ4A 1QKDA 1FF4A 1QKEA 2QJBC 1CDQA 1HAJA 2QJAC 4OM5A 1CXNA 1F94A 1KC4A 1XT3A 2H7ZA 2J8BA 3EVSC 3KFDE 1RGJA 1ES7B 1CCQA 2LCRA 1IDGA 2H7ZB 2HLQA 1COEA 4LFTA 1L4WA 4EY8B 1G6MA 1FSCA 3BT2U 1LJZA 1IQ9A 2L5SA 2MJYA 3HH7A 5IMTD 1BXPA 1KXIA 1UG4A 1CHVS 2GOOC 2MUOA 2PJYC 2X8BB 1KTZB 2BHIA 4DO8A 2H64B 1IKCA 1B41B 2ABXA 3KFDI 1KBSA 1MAHF 1FRAA 1VB0A 1CVOA 2QJ9C 2QC1A 4FAOE 2BTXA 3PLCA 1MR6A 1IDIA 1NYUA 1ZADA 2CCXA 1KFHA 2JVEA 1REWC 2N99A 1ONJA 1V6PA 3QB4B 1ERGA 4OM4A 2LA1A 2CTXA 3NH7A 1KL8A 3LAQU 1NTNA 2H62C 2I9BE 1ERAA 2MFAA 4UY2C 6EBXA 1CREA 1YWHA 4AEAA 5IMYC 1CB9A 1TXBA 2JQPA 1S4YA 3NEQA 1I02A 2GOOB 1KBTA 2PJYB 1KBAA 4IYEA 2CRSA 1RL5A 2VLWA 5DO6A 4FAOC 1CTXA 4BIKB 4KSNA 4ZQYA 1BTEA 1LXGA 1QM7A 4RUDA 3U73U 2MHYA 4BDTB 1IK8A 1NEAA 1DRSA 1KU6B 2H62D 1CXOA 2MJ0A 1NXBA 1IDLA 3NDSA 2UWRA 1NORA 1CDRA 1HC9A 1JBDA 1CRFA 1FFJA 2FD6U 3U74U 1HC9B 1TFSA 1M9ZA 1F8UB 4HQPF 2H5FA 2UX2A 1IJCA 1KS6A 1IDHA 1JE9A 3ERAA 1HAAA 1JGKA 2NBTA 5DZ5A 1FSSB 1NYSA 1CODA 1CDSA 2OFSA 1TGXA 4QTIU 2K3GA 2CDXA 3FEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRT A;  5DU1 A;  1TXA A;  2ERA A;  2L03 A;  1NTX A;  1H0J A;  1W6B A;  4XJJ A;  1ABT A;  3BT1 U;  2H64 C;  1LXH A;  2H8U A;  1FAS A;  3EBX A;  2HLR A;  1LSI A;  1HOY A;  1CDT A;  1LX5 B;  2MUP A;  4P7U A;  3VTS A;  1PLO A;  5EBX A;  2MJ4 A;  1QKD A;  1FF4 A;  1QKE A;  2QJB C;  1CDQ A;  1HAJ A;  2QJA C;  4OM5 A;  1CXN A;  1F94 A;  1KC4 A;  1XT3 A;  2H7Z A;  2J8B A;  3EVS C;  3KFD E;  1RGJ A;  1ES7 B;  1CCQ A;  2LCR A;  1IDG A;  2H7Z B;  2HLQ A;  1COE A;  4LFT A;  1L4W A;  4EY8 B;  1G6M A;  1FSC A;  3BT2 U;  1LJZ A;  1IQ9 A;  2L5S A;  2MJY A;  3HH7 A;  5IMT D;  1BXP A;  1KXI A;  1UG4 A;  1CHV S;  2GOO C;  2MUO A;  2PJY C;  2X8B B;  1KTZ B;  2BHI A;  4DO8 A;  2H64 B;  1IKC A;  1B41 B;  2ABX A;  3KFD I;  1KBS A;  1MAH F;  1FRA A;  1VB0 A;  1CVO A;  2QJ9 C;  2QC1 A;  4FAO E;  2BTX A;  3PLC A;  1MR6 A;  1IDI A;  1NYU A;  1ZAD A;  2CCX A;  1KFH A;  2JVE A;  1REW C;  2N99 A;  1ONJ A;  1V6P A;  3QB4 B;  1ERG A;  4OM4 A;  2LA1 A;  2CTX A;  3NH7 A;  1KL8 A;  3LAQ U;  1NTN A;  2H62 C;  2I9B E;  1ERA A;  2MFA A;  4UY2 C;  6EBX A;  1CRE A;  1YWH A;  4AEA A;  5IMY C;  1CB9 A;  1TXB A;  2JQP A;  1S4Y A;  3NEQ A;  1I02 A;  2GOO B;  1KBT A;  2PJY B;  1KBA A;  4IYE A;  2CRS A;  1RL5 A;  2VLW A;  5DO6 A;  4FAO C;  1CTX A;  4BIK B;  4ZQY A;  1BTE A;  1LXG A;  1QM7 A;  4RUD A;  3U73 U;  2MHY A;  4BDT B;  1IK8 A;  1NEA A;  1DRS A;  1KU6 B;  2H62 D;  1CXO A;  2MJ0 A;  1NXB A;  1IDL A;  3NDS A;  2UWR A;  1NOR A;  1CDR A;  1HC9 A;  1JBD A;  1CRF A;  1FFJ A;  2FD6 U;  3U74 U;  1HC9 B;  1TFS A;  1M9Z A;  1F8U B;  4HQP F;  2H5F A;  2UX2 A;  1IJC A;  1KS6 A;  1IDH A;  1JE9 A;  3ERA A;  1HAA A;  1JGK A;  2NBT A;  5DZ5 A;  1FSS B;  1NYS A;  1COD A;  1CDS A;  2OFS A;  1TGX A;  4QTI U;  2K3G A;  2CDX A;  3FEV A; 
#chains in the Genus database with same CATH topology
 2CRT A;  5DU1 A;  1TXA A;  2ERA A;  2L03 A;  1NTX A;  1H0J A;  1W6B A;  4XJJ A;  1ABT A;  3BT1 U;  2H64 C;  1LXH A;  2H8U A;  1FAS A;  3EBX A;  2HLR A;  1LSI A;  1HOY A;  1CDT A;  1LX5 B;  2MUP A;  4P7U A;  3VTS A;  1PLO A;  5EBX A;  2MJ4 A;  1QKD A;  1FF4 A;  1QKE A;  2QJB C;  1CDQ A;  1HAJ A;  2QJA C;  4OM5 A;  1CXN A;  1F94 A;  1KC4 A;  1XT3 A;  2H7Z A;  2J8B A;  3EVS C;  3KFD E;  1RGJ A;  1ES7 B;  1CCQ A;  2LCR A;  1IDG A;  2H7Z B;  2HLQ A;  1COE A;  4LFT A;  1L4W A;  4EY8 B;  1G6M A;  1FSC A;  3BT2 U;  1LJZ A;  1IQ9 A;  2L5S A;  2MJY A;  3HH7 A;  5IMT D;  1BXP A;  1KXI A;  1UG4 A;  1CHV S;  2GOO C;  2MUO A;  2PJY C;  2X8B B;  1KTZ B;  2BHI A;  4DO8 A;  2H64 B;  1IKC A;  1B41 B;  2ABX A;  3KFD I;  1KBS A;  1MAH F;  1FRA A;  1VB0 A;  1CVO A;  2QJ9 C;  2QC1 A;  4FAO E;  2BTX A;  3PLC A;  1MR6 A;  1IDI A;  1NYU A;  1ZAD A;  2CCX A;  1KFH A;  2JVE A;  1REW C;  2N99 A;  1ONJ A;  1V6P A;  3QB4 B;  1ERG A;  4OM4 A;  2LA1 A;  2CTX A;  3NH7 A;  1KL8 A;  3LAQ U;  1NTN A;  2H62 C;  2I9B E;  1ERA A;  2MFA A;  4UY2 C;  6EBX A;  1CRE A;  1YWH A;  4AEA A;  5IMY C;  1CB9 A;  1TXB A;  2JQP A;  1S4Y A;  3NEQ A;  1I02 A;  2GOO B;  1KBT A;  2PJY B;  1KBA A;  4IYE A;  2CRS A;  1RL5 A;  2VLW A;  5DO6 A;  4FAO C;  1CTX A;  4BIK B;  4KSN A;  4ZQY A;  1BTE A;  1LXG A;  1QM7 A;  4RUD A;  3U73 U;  2MHY A;  4BDT B;  1IK8 A;  1NEA A;  1DRS A;  1KU6 B;  2H62 D;  1CXO A;  2MJ0 A;  1NXB A;  1IDL A;  3NDS A;  2UWR A;  1NOR A;  1CDR A;  1HC9 A;  1JBD A;  1CRF A;  1FFJ A;  2FD6 U;  3U74 U;  1HC9 B;  1TFS A;  1M9Z A;  1F8U B;  4HQP F;  2H5F A;  2UX2 A;  1IJC A;  1KS6 A;  1IDH A;  1JE9 A;  3ERA A;  1HAA A;  1JGK A;  2NBT A;  5DZ5 A;  1FSS B;  1NYS A;  1COD A;  1CDS A;  2OFS A;  1TGX A;  4QTI U;  2K3G A;  2CDX A;  3FEV A; 
#chains in the Genus database with same CATH homology
 2CRT A;  5DU1 A;  1TXA A;  2ERA A;  2L03 A;  1NTX A;  1H0J A;  1W6B A;  4XJJ A;  1ABT A;  3BT1 U;  2H64 C;  1LXH A;  2H8U A;  1FAS A;  3EBX A;  2HLR A;  1LSI A;  1HOY A;  1CDT A;  1LX5 B;  2MUP A;  4P7U A;  3VTS A;  1PLO A;  5EBX A;  2MJ4 A;  1QKD A;  1FF4 A;  1QKE A;  2QJB C;  1CDQ A;  1HAJ A;  2QJA C;  4OM5 A;  1CXN A;  1F94 A;  1KC4 A;  1XT3 A;  2H7Z A;  2J8B A;  3EVS C;  3KFD E;  1RGJ A;  1ES7 B;  1CCQ A;  2LCR A;  1IDG A;  2H7Z B;  2HLQ A;  1COE A;  4LFT A;  1L4W A;  4EY8 B;  1G6M A;  1FSC A;  3BT2 U;  1LJZ A;  1IQ9 A;  2L5S A;  2MJY A;  3HH7 A;  5IMT D;  1BXP A;  1KXI A;  1UG4 A;  1CHV S;  2GOO C;  2MUO A;  2PJY C;  2X8B B;  1KTZ B;  2BHI A;  4DO8 A;  2H64 B;  1IKC A;  1B41 B;  2ABX A;  3KFD I;  1KBS A;  1MAH F;  1FRA A;  1VB0 A;  1CVO A;  2QJ9 C;  2QC1 A;  4FAO E;  2BTX A;  3PLC A;  1MR6 A;  1IDI A;  1NYU A;  1ZAD A;  2CCX A;  1KFH A;  2JVE A;  1REW C;  2N99 A;  1ONJ A;  1V6P A;  3QB4 B;  1ERG A;  4OM4 A;  2LA1 A;  2CTX A;  3NH7 A;  1KL8 A;  3LAQ U;  1NTN A;  2H62 C;  2I9B E;  1ERA A;  2MFA A;  4UY2 C;  6EBX A;  1CRE A;  1YWH A;  4AEA A;  5IMY C;  1CB9 A;  1TXB A;  2JQP A;  1S4Y A;  3NEQ A;  1I02 A;  2GOO B;  1KBT A;  2PJY B;  1KBA A;  4IYE A;  2CRS A;  1RL5 A;  2VLW A;  5DO6 A;  4FAO C;  1CTX A;  4BIK B;  4KSN A;  4ZQY A;  1BTE A;  1LXG A;  1QM7 A;  4RUD A;  3U73 U;  2MHY A;  4BDT B;  1IK8 A;  1NEA A;  1DRS A;  1KU6 B;  2H62 D;  1CXO A;  2MJ0 A;  1NXB A;  1IDL A;  3NDS A;  2UWR A;  1NOR A;  1CDR A;  1HC9 A;  1JBD A;  1CRF A;  1FFJ A;  2FD6 U;  3U74 U;  1HC9 B;  1TFS A;  1M9Z A;  1F8U B;  4HQP F;  2H5F A;  2UX2 A;  1IJC A;  1KS6 A;  1IDH A;  1JE9 A;  3ERA A;  1HAA A;  1JGK A;  2NBT A;  5DZ5 A;  1FSS B;  1NYS A;  1COD A;  1CDS A;  2OFS A;  1TGX A;  4QTI U;  2K3G A;  2CDX A;  3FEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...