2ERHA

Crystal structure of the e7_g/im7_g complex; a designed interface between the colicin e7 dnase and the im7 immunity protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
87
structure length
87
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLYVLLEHFVKITEHPDGQDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin E7 immunity protein
publication title Computational Design of a New Hydrogen Bond Network and at Least a 300-fold Specificity Switch at a Protein-Protein Interface.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 34
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2erhA00
1E0HA 2ERHA 2JB0A 2VLNA 1AYIA 2VLQA 1ZNVA 1IMQA 4F37A 1GXHA 2GZIA 3GJNA 7CEIA 1BXIA 1MZ8A 2GZJA 2JBGA 4QKOA 1EMVA 2K5XA 2GZEA 4UHPB 1IMPA 5EW5E 2GYKA 3GKLC 2VLPA 2NO8A 1FR2A 1UNKA 2VLOA 2K0DX 1GXGA 1UJZA 1CEIA 2GZFA 3U43A 2WPTA 2JAZA 2GZGA
chains in the Genus database with same CATH superfamily
4IZ6A 1QRJA 2K0YA 4H2WC 1EOQA 1IUQA 3CCRP 2KODA 3Q20A 3GZMA 3CC7P 1K8AQ 1F80D 4MRTC 1T8KA 3DS3A 1Q86Q 3DS1A 5HGLA 3MGEA 3G6EP 4DG9A 1YJ9P 2Z46A 2CNRA 5HV8A 1M90Q 3DTJA 1GXHA 2OTLP 2MVUA 2LKIA 2N5HA 1VQ7P 2KGEA 1ACPA 2VLOA 5I4TG 2K0DX 2PNGA 3B4QA 1AYIA 4BPGA 1VHNA 1IMQA 4PWVB 4F37A 1DNYA 3I56P 3G1IA 2JGPA 2K2QA 1HQBA 1YITP 2N6ZA 1N8RQ 2EFJA 2K0XA 2PEQA 2JAZA 4U0AA 2M8NA 5HGNA 1M6NA 1L0HA 2FQ2A 4U0FA 2AFDA 3G21A 2KORA 2KGAA 1Q82Q 2PEMA 1X3OA 3CC4P 3H47A 4IPYA 2DGYA 5EJDA 5HGOA 2BUOA 4XFXA 2GYKA 2MR8A 3NY7B 4XROA 1VQ9P 2DNWA 3EJEA 3I55P 3DS0A 2VLNA 4U0CA 2XZ0D 1VQ4P 2PEIA 5KP7B 2FVFA 3CXCO 1MZ8A 2CWOA 4QKOA 1KQSO 1VQMP 5F2NA 1M1KQ 2M8LA 3HZQA 3CCEP 2VLPA 4XFYA 1VQNP 2GZFA 1D1DA 3CCJP 4U0DA 1YIJP 1AUMA 2M5RA 2VLQA 4QNBA 3CPWO 2MVVA 1E6JP 1S72P 2LF4A 2GZJA 3H4EA 2QNWA 3CD6P 2OARA 4H2XC 2MR7A 3GKLC 3WBHA 2EHTA 4PH1A 3E2DA 3G29A 4WYMA 2JQ4A 1E0HA 2K92A 3CCQP 4GR2A 2LMLA 4XRQA 2X2BA 1YJWP 4U0EA 3LRYA 1Q81Q 2L0QA 2MY5A 1UNKA 2GDWA 1GPJA 3H0DA 1L0IA 3G1GA 2ERHA 1JJ2O 1RO2A 1W2BO 1VKUA 2FQ1A 4PH0A 1BXIA 2JBGA 3DS4A 1K9MQ 3LMOA 4XFZA 2JU1A 3NTEA 2L9FA 3CCLP 2KOQA 5HVCA 2NO8A 2KG6A 1RNIA 2LIUA 1KC8Q 2GZGA 3G26A 1YJNP 2CGQA 2FVAA 1DV5A 2GZIA 3GZLA 2PEJA 2L6EA 2Z44A 1VQKP 2AF8A 3P05A 1VQ5P 1UJZA 4HKGA 2LOLA 3OW2O 5KP8B 4COPA 2VSQA 3G71P 5DCKA 4BPFA 2FVEA 2AVAA 4CA3A 2JYGA 1A43A 7CEIA 1QVFO 1EIAA 2N50A 2L22A 2PEKA 3CMEP 5F2KA 1CEIA 1HY8A 3U43A 2WPTA 2XV6A 2FACA 2JB0A 2M8PA 3RG2A 2Z45A 1ZNVA 3CCVP 2JYLA 3GJNA 2FAEA 3DPHA 2LL8A 1EMVA 2L4BA 4UHPB 3CMAP 1IMPA 2K93A 1NQ4A 3CE7A 3G4SP 1K30A 2CG5B 3CCMP 2EIAA 1YI2P 1ZMBA 2FADA 2N6YA 5JPAA 2KG8A 1VQLP 2PEOA 3B5IA 5HGMA 2EHSA 1RO0A 2LTEA 1QVGO 2KW2A 2MD9A 3VRLC 5BS2A 1K73Q 3CC2P 2GDYA 5CZDB 2KWLA 1KD1Q 1KLPA 2LPKA 2ONTA 2BHVA 2KGCA 3CCUP 1BAJA 2MF4A 4M0IA 4R0MA 2FQ0A 2KG9A 1M6EX 2GZEA 5KP6B 1VQ6P 2GDXA 2JO0A 4PXHB 2P9XA 3DS5A 1GXGA 2OTJP 2CQ8A 2AFEA 3M1MA 2XZ1C 2KR5A 2XT1A 1NJIQ 3DS2A 1Q7YQ 3CCSP 2N98A 2QEXP 3G0VA 4COCA 3HYBA 1A8OA 2K5XA 2E1MA 2XXMA 1FR2A 1AF8A 2PENA 2EG5A 4NEOA 2KGDA 3EJDA 1YHQP 2N5IA 1VQOP 2JU2A 4BPHA 2K94A 1OR5A 5BS1A 2LIWA 2KOSA 2KOOA 5F2OA 3EJBA 3RG6C 4U0BA 1VQ8P 1M74A 4H2YC 2QA4P 2KOPA 1Z6MA 4GR6A 5EW5E 2FHSC 1VQPP 2PY8A 3G28A 2ROQA
chains in the Genus database with same CATH topology
1E0HA 2ERHA 2JB0A 2VLNA 1AYIA 2VLQA 1ZNVA 1IMQA 4F37A 1GXHA 2GZIA 3GJNA 7CEIA 1BXIA 1MZ8A 2GZJA 2JBGA 4QKOA 1EMVA 2K5XA 2GZEA 4UHPB 1IMPA 5EW5E 2GYKA 3GKLC 2VLPA 2NO8A 1FR2A 1UNKA 2VLOA 2K0DX 1GXGA 1UJZA 1CEIA 2GZFA 3U43A 2WPTA 2JAZA 2GZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E0H A;  2ERH A;  2JB0 A;  2VLN A;  1AYI A;  2VLQ A;  1ZNV A;  1IMQ A;  4F37 A;  1GXH A;  2GZI A;  3GJN A;  7CEI A;  1BXI A;  1MZ8 A;  2GZJ A;  2JBG A;  4QKO A;  1EMV A;  2K5X A;  2GZE A;  4UHP B;  1IMP A;  5EW5 E;  2GYK A;  3GKL C;  2VLP A;  2NO8 A;  1FR2 A;  1UNK A;  2VLO A;  2K0D X;  1GXG A;  1UJZ A;  1CEI A;  2GZF A;  3U43 A;  2WPT A;  2JAZ A;  2GZG A; 
#chains in the Genus database with same CATH topology
 4IZ6 A;  1QRJ A;  2K0Y A;  4H2W C;  1EOQ A;  1IUQ A;  3CCR P;  2KOD A;  3Q20 A;  3GZM A;  3CC7 P;  1K8A Q;  1F80 D;  4MRT C;  1T8K A;  3DS3 A;  1Q86 Q;  3DS1 A;  5HGL A;  3MGE A;  3G6E P;  4DG9 A;  1YJ9 P;  2Z46 A;  2CNR A;  5HV8 A;  1M90 Q;  3DTJ A;  1GXH A;  2OTL P;  2MVU A;  2LKI A;  2N5H A;  1VQ7 P;  2KGE A;  1ACP A;  2VLO A;  5I4T G;  2K0D X;  2PNG A;  3B4Q A;  1AYI A;  4BPG A;  1VHN A;  1IMQ A;  4PWV B;  4F37 A;  1DNY A;  3I56 P;  3G1I A;  2JGP A;  2K2Q A;  1HQB A;  1YIT P;  2N6Z A;  1N8R Q;  2EFJ A;  2K0X A;  2PEQ A;  2JAZ A;  4U0A A;  2M8N A;  5HGN A;  1M6N A;  1L0H A;  2FQ2 A;  4U0F A;  2AFD A;  3G21 A;  2KOR A;  2KGA A;  1Q82 Q;  2PEM A;  1X3O A;  3CC4 P;  3H47 A;  4IPY A;  2DGY A;  5EJD A;  5HGO A;  2BUO A;  4XFX A;  2GYK A;  2MR8 A;  3NY7 B;  4XRO A;  1VQ9 P;  2DNW A;  3EJE A;  3I55 P;  3DS0 A;  2VLN A;  4U0C A;  2XZ0 D;  1VQ4 P;  2PEI A;  5KP7 B;  2FVF A;  3CXC O;  1MZ8 A;  2CWO A;  4QKO A;  1KQS O;  1VQM P;  5F2N A;  1M1K Q;  2M8L A;  3HZQ A;  3CCE P;  2VLP A;  4XFY A;  1VQN P;  2GZF A;  1D1D A;  3CCJ P;  4U0D A;  1YIJ P;  1AUM A;  2M5R A;  2VLQ A;  4QNB A;  3CPW O;  2MVV A;  1E6J P;  1S72 P;  2LF4 A;  2GZJ A;  3H4E A;  2QNW A;  3CD6 P;  2OAR A;  4H2X C;  2MR7 A;  3GKL C;  3WBH A;  2EHT A;  4PH1 A;  3E2D A;  3G29 A;  4WYM A;  2JQ4 A;  1E0H A;  2K92 A;  3CCQ P;  4GR2 A;  2LML A;  4XRQ A;  2X2B A;  1YJW P;  4U0E A;  3LRY A;  1Q81 Q;  2L0Q A;  2MY5 A;  1UNK A;  2GDW A;  1GPJ A;  3H0D A;  1L0I A;  3G1G A;  2ERH A;  1JJ2 O;  1RO2 A;  1W2B O;  1VKU A;  2FQ1 A;  4PH0 A;  1BXI A;  2JBG A;  3DS4 A;  1K9M Q;  3LMO A;  4XFZ A;  2JU1 A;  3NTE A;  2L9F A;  3CCL P;  2KOQ A;  5HVC A;  2NO8 A;  2KG6 A;  1RNI A;  2LIU A;  1KC8 Q;  2GZG A;  3G26 A;  1YJN P;  2CGQ A;  2FVA A;  1DV5 A;  2GZI A;  3GZL A;  2PEJ A;  2L6E A;  2Z44 A;  1VQK P;  2AF8 A;  3P05 A;  1VQ5 P;  1UJZ A;  4HKG A;  2LOL A;  3OW2 O;  5KP8 B;  4COP A;  2VSQ A;  3G71 P;  5DCK A;  4BPF A;  2FVE A;  2AVA A;  4CA3 A;  2JYG A;  1A43 A;  7CEI A;  1QVF O;  1EIA A;  2N50 A;  2L22 A;  2PEK A;  3CME P;  5F2K A;  1CEI A;  1HY8 A;  3U43 A;  2WPT A;  2XV6 A;  2FAC A;  2JB0 A;  2M8P A;  3RG2 A;  2Z45 A;  1ZNV A;  3CCV P;  2JYL A;  3GJN A;  2FAE A;  3DPH A;  2LL8 A;  1EMV A;  2L4B A;  4UHP B;  3CMA P;  1IMP A;  2K93 A;  1NQ4 A;  3CE7 A;  3G4S P;  1K30 A;  2CG5 B;  3CCM P;  2EIA A;  1YI2 P;  1ZMB A;  2FAD A;  2N6Y A;  5JPA A;  2KG8 A;  1VQL P;  2PEO A;  3B5I A;  5HGM A;  2EHS A;  1RO0 A;  2LTE A;  1QVG O;  2KW2 A;  2MD9 A;  3VRL C;  5BS2 A;  1K73 Q;  3CC2 P;  2GDY A;  5CZD B;  2KWL A;  1KD1 Q;  1KLP A;  2LPK A;  2ONT A;  2BHV A;  2KGC A;  3CCU P;  1BAJ A;  2MF4 A;  4M0I A;  4R0M A;  2FQ0 A;  2KG9 A;  1M6E X;  2GZE A;  5KP6 B;  1VQ6 P;  2GDX A;  2JO0 A;  4PXH B;  2P9X A;  3DS5 A;  1GXG A;  2OTJ P;  2CQ8 A;  2AFE A;  3M1M A;  2XZ1 C;  2KR5 A;  2XT1 A;  1NJI Q;  3DS2 A;  1Q7Y Q;  3CCS P;  2N98 A;  2QEX P;  3G0V A;  4COC A;  3HYB A;  1A8O A;  2K5X A;  2E1M A;  2XXM A;  1FR2 A;  1AF8 A;  2PEN A;  2EG5 A;  4NEO A;  2KGD A;  3EJD A;  1YHQ P;  2N5I A;  1VQO P;  2JU2 A;  4BPH A;  2K94 A;  1OR5 A;  5BS1 A;  2LIW A;  2KOS A;  2KOO A;  5F2O A;  3EJB A;  3RG6 C;  4U0B A;  1VQ8 P;  1M74 A;  4H2Y C;  2QA4 P;  2KOP A;  1Z6M A;  4GR6 A;  5EW5 E;  2FHS C;  1VQP P;  2PY8 A;  3G28 A;  2ROQ A; 
#chains in the Genus database with same CATH homology
 1E0H A;  2ERH A;  2JB0 A;  2VLN A;  1AYI A;  2VLQ A;  1ZNV A;  1IMQ A;  4F37 A;  1GXH A;  2GZI A;  3GJN A;  7CEI A;  1BXI A;  1MZ8 A;  2GZJ A;  2JBG A;  4QKO A;  1EMV A;  2K5X A;  2GZE A;  4UHP B;  1IMP A;  5EW5 E;  2GYK A;  3GKL C;  2VLP A;  2NO8 A;  1FR2 A;  1UNK A;  2VLO A;  2K0D X;  1GXG A;  1UJZ A;  1CEI A;  2GZF A;  3U43 A;  2WPT A;  2JAZ A;  2GZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...