2ERHA

Crystal structure of the e7_g/im7_g complex; a designed interface between the colicin e7 dnase and the im7 immunity protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
87
structure length
87
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLYVLLEHFVKITEHPDGQDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin E7 immunity protein
publication title Computational Design of a New Hydrogen Bond Network and at Least a 300-fold Specificity Switch at a Protein-Protein Interface.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 34
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2erhA00
2VLPA 2VLNA 3GJNA 7CEIA 5EW5E 1MZ8A 2GZGA 2NO8A 3U43A 2JBGA 1GXHA 2K5XA 2GZJA 2GYKA 1BXIA 2JAZA 1CEIA 2VLQA 1UJZA 2JB0A 2WPTA 2ERHA 1AYIA 4F37A 2GZIA 1ZNVA 2GZFA 1FR2A 4QKOA 1GXGA 2GZEA 4UHPB 1E0HA 2VLOA 1IMPA 1IMQA 2K0DX 3GKLC 1UNKA 1EMVA
chains in the Genus database with same CATH superfamily
4DG9A 2LKIA 1RNIA 2Z45A 3RG6C 1Z6MA 1S72P 3G0VA 3H47A 5KP7B 1YJWP 3P05A 5HV8A 2KGAA 1A8OA 1QVFO 2EHSA 2JYGA 3G28A 4F37A 2PY8A 2GZFA 1BAJA 1FR2A 5CZDB 3G1GA 3EJDA 2VLNA 1NQ4A 2CGQA 5DCKA 1M1KQ 2KW2A 4M0IA 1YIJP 3LMOA 2KGCA 3DS0A 2PEOA 5BS1A 3CC2P 2GZIA 4H2XC 3DS2A 5F2OA 3DS4A 2PENA 1HY8A 3HYBA 2OTLP 5EW5E 1IUQA 1K30A 4COPA 2DGYA 2WPTA 2QA4P 2K0XA 4U0CA 5HGOA 1JJ2O 3WBHA 2FQ1A 1Q86Q 1KQSO 2XT1A 3VRLC 3I55P 5HGLA 2GZGA 2QNWA 2NO8A 2GDYA 2GYKA 3I56P 2JAZA 3DS5A 4WYMA 4BPFA 3GZLA 2JO0A 4XROA 2FAEA 2K93A 1F80D 2VLOA 1KC8Q 2P9XA 3GKLC 3CCVP 3B4QA 1EMVA 2JYLA 2K5XA 2AVAA 2KODA 1RO2A 1CEIA 3E2DA 3CCMP 3G71P 2FQ2A 2KG8A 3G26A 2KOQA 3CC7P 1GXGA 2M8NA 2EG5A 3CCJP 4UHPB 1OR5A 2XV6A 1L0HA 3DPHA 7CEIA 3CCEP 2KG9A 2FADA 2JU1A 3G1IA 2K94A 2GZJA 2M5RA 1BXIA 1K8AQ 3CMEP 2ONTA 1UJZA 2FVEA 2QEXP 1ZNVA 2FQ0A 2VSQA 1X3OA 3G4SP 2L6EA 1K9MQ 2KOSA 2L9FA 5EJDA 4NEOA 4R0MA 3NTEA 1D1DA 2XZ1C 5HGNA 4XFYA 2MD9A 1DV5A 1W2BO 1VQ7P 1Q82Q 1VQ6P 1A43A 2K2QA 1QVGO 1VQ9P 3CXCO 4XFXA 1EOQA 3GJNA 1MZ8A 3EJEA 3CE7A 4H2WC 3H4EA 1N8RQ 3CMAP 2GDWA 2MF4A 1YHQP 5F2KA 1AUMA 4U0AA 2N5IA 2L22A 5KP6B 2GDXA 1IMQA 3H0DA 2FACA 2OARA 1VQNP 2KOPA 3U43A 3B5IA 2JBGA 1GXHA 2AFEA 2JQ4A 2JGPA 2PEMA 4BPHA 2JU2A 4GR6A 4IPYA 1Q81Q 1VQLP 2N50A 4QKOA 2PEQA 5F2NA 2BUOA 2LL8A 1VQMP 1QRJA 2CG5B 3CC4P 2LF4A 2LMLA 1T8KA 3HZQA 1ACPA 3MGEA 4U0BA 4MRTC 2XXMA 3CCSP 2CNRA 2AF8A 1RO0A 5BS2A 2BHVA 2EFJA 3DS3A 4U0EA 2N5HA 1E6JP 5JPAA 1DNYA 3CCRP 2L4BA 5I4TG 4BPGA 4U0FA 2CQ8A 2MR8A 2K0YA 4XFZA 3CCLP 2KOOA 2JB0A 3G6EP 2X2BA 2LIWA 2AFDA 1EIAA 1K73Q 1GPJA 1KD1Q 4GR2A 1M6NA 1YJNP 1AF8A 2VLQA 1VKUA 2KR5A 2ERHA 1VQKP 3LRYA 3CCQP 3M1MA 2MVUA 1M74A 2K92A 2PEKA 4PXHB 3CD6P 3CPWO 1KLPA 1UNKA 2MY5A 3DS1A 2CWOA 2ROQA 2FHSC 4QNBA 2KORA 4PH1A 2OTJP 2FVAA 2N98A 3NY7B 3EJBA 2LPKA 2KGEA 2MR7A 1YJ9P 2VLPA 4H2YC 2PEJA 3CCUP 1YI2P 2KWLA 2N6YA 4COCA 1ZMBA 2Z44A 1VQOP 5HVCA 1Q7YQ 2KG6A 2GZEA 3Q20A 4U0DA 1VQ4P 2EHTA 2K0DX 2FVFA 2Z46A 1VQPP 2N6ZA 3GZMA 4IZ6A 2DNWA 3OW2O 4XRQA 1M90Q 1M6EX 2L0QA 1VQ5P 1YITP 2PNGA 5HGMA 1VQ8P 1VHNA 2M8PA 2E1MA 2LIUA 2LOLA 4HKGA 1HQBA 1IMPA 1E0HA 3G21A 4CA3A 2PEIA 5KP8B 3G29A 3DTJA 1NJIQ 2MVVA 2M8LA 1AYIA 4PH0A 2LTEA 3RG2A 1L0IA 2KGDA 2XZ0D 2EIAA 4PWVB
chains in the Genus database with same CATH topology
2VLPA 2VLNA 3GJNA 7CEIA 5EW5E 1MZ8A 2GZGA 2NO8A 3U43A 2JBGA 1GXHA 2K5XA 2GZJA 2GYKA 1BXIA 2JAZA 1CEIA 2VLQA 1UJZA 2JB0A 2WPTA 2ERHA 1AYIA 4F37A 2GZIA 1ZNVA 2GZFA 1FR2A 4QKOA 1GXGA 2GZEA 4UHPB 1E0HA 2VLOA 1IMPA 1IMQA 2K0DX 3GKLC 1UNKA 1EMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLP A;  2VLN A;  3GJN A;  7CEI A;  5EW5 E;  1MZ8 A;  2GZG A;  2NO8 A;  3U43 A;  2JBG A;  1GXH A;  2K5X A;  2GZJ A;  2GYK A;  1BXI A;  2JAZ A;  1CEI A;  2VLQ A;  1UJZ A;  2JB0 A;  2WPT A;  2ERH A;  1AYI A;  4F37 A;  2GZI A;  1ZNV A;  2GZF A;  1FR2 A;  4QKO A;  1GXG A;  2GZE A;  4UHP B;  1E0H A;  2VLO A;  1IMP A;  1IMQ A;  2K0D X;  3GKL C;  1UNK A;  1EMV A; 
#chains in the Genus database with same CATH topology
 4DG9 A;  2LKI A;  1RNI A;  2Z45 A;  3RG6 C;  1Z6M A;  1S72 P;  3G0V A;  3H47 A;  5KP7 B;  1YJW P;  3P05 A;  5HV8 A;  2KGA A;  1A8O A;  1QVF O;  2EHS A;  2JYG A;  3G28 A;  4F37 A;  2PY8 A;  2GZF A;  1BAJ A;  1FR2 A;  5CZD B;  3G1G A;  3EJD A;  2VLN A;  1NQ4 A;  2CGQ A;  5DCK A;  1M1K Q;  2KW2 A;  4M0I A;  1YIJ P;  3LMO A;  2KGC A;  3DS0 A;  2PEO A;  5BS1 A;  3CC2 P;  2GZI A;  4H2X C;  3DS2 A;  5F2O A;  3DS4 A;  2PEN A;  1HY8 A;  3HYB A;  2OTL P;  5EW5 E;  1IUQ A;  1K30 A;  4COP A;  2DGY A;  2WPT A;  2QA4 P;  2K0X A;  4U0C A;  5HGO A;  1JJ2 O;  3WBH A;  2FQ1 A;  1Q86 Q;  1KQS O;  2XT1 A;  3VRL C;  3I55 P;  5HGL A;  2GZG A;  2QNW A;  2NO8 A;  2GDY A;  2GYK A;  3I56 P;  2JAZ A;  3DS5 A;  4WYM A;  4BPF A;  3GZL A;  2JO0 A;  4XRO A;  2FAE A;  2K93 A;  1F80 D;  2VLO A;  1KC8 Q;  2P9X A;  3GKL C;  3CCV P;  3B4Q A;  1EMV A;  2JYL A;  2K5X A;  2AVA A;  2KOD A;  1RO2 A;  1CEI A;  3E2D A;  3CCM P;  3G71 P;  2FQ2 A;  2KG8 A;  3G26 A;  2KOQ A;  3CC7 P;  1GXG A;  2M8N A;  2EG5 A;  3CCJ P;  4UHP B;  1OR5 A;  2XV6 A;  1L0H A;  3DPH A;  7CEI A;  3CCE P;  2KG9 A;  2FAD A;  2JU1 A;  3G1I A;  2K94 A;  2GZJ A;  2M5R A;  1BXI A;  1K8A Q;  3CME P;  2ONT A;  1UJZ A;  2FVE A;  2QEX P;  1ZNV A;  2FQ0 A;  2VSQ A;  1X3O A;  3G4S P;  2L6E A;  1K9M Q;  2KOS A;  2L9F A;  5EJD A;  4NEO A;  4R0M A;  3NTE A;  1D1D A;  2XZ1 C;  5HGN A;  4XFY A;  2MD9 A;  1DV5 A;  1W2B O;  1VQ7 P;  1Q82 Q;  1VQ6 P;  1A43 A;  2K2Q A;  1QVG O;  1VQ9 P;  3CXC O;  4XFX A;  1EOQ A;  3GJN A;  1MZ8 A;  3EJE A;  3CE7 A;  4H2W C;  3H4E A;  1N8R Q;  3CMA P;  2GDW A;  2MF4 A;  1YHQ P;  5F2K A;  1AUM A;  4U0A A;  2N5I A;  2L22 A;  5KP6 B;  2GDX A;  1IMQ A;  3H0D A;  2FAC A;  2OAR A;  1VQN P;  2KOP A;  3U43 A;  3B5I A;  2JBG A;  1GXH A;  2AFE A;  2JQ4 A;  2JGP A;  2PEM A;  4BPH A;  2JU2 A;  4GR6 A;  4IPY A;  1Q81 Q;  1VQL P;  2N50 A;  4QKO A;  2PEQ A;  5F2N A;  2BUO A;  2LL8 A;  1VQM P;  1QRJ A;  2CG5 B;  3CC4 P;  2LF4 A;  2LML A;  1T8K A;  3HZQ A;  1ACP A;  3MGE A;  4U0B A;  4MRT C;  2XXM A;  3CCS P;  2CNR A;  2AF8 A;  1RO0 A;  5BS2 A;  2BHV A;  2EFJ A;  3DS3 A;  4U0E A;  2N5H A;  1E6J P;  5JPA A;  1DNY A;  3CCR P;  2L4B A;  5I4T G;  4BPG A;  4U0F A;  2CQ8 A;  2MR8 A;  2K0Y A;  4XFZ A;  3CCL P;  2KOO A;  2JB0 A;  3G6E P;  2X2B A;  2LIW A;  2AFD A;  1EIA A;  1K73 Q;  1GPJ A;  1KD1 Q;  4GR2 A;  1M6N A;  1YJN P;  1AF8 A;  2VLQ A;  1VKU A;  2KR5 A;  2ERH A;  1VQK P;  3LRY A;  3CCQ P;  3M1M A;  2MVU A;  1M74 A;  2K92 A;  2PEK A;  4PXH B;  3CD6 P;  3CPW O;  1KLP A;  1UNK A;  2MY5 A;  3DS1 A;  2CWO A;  2ROQ A;  2FHS C;  4QNB A;  2KOR A;  4PH1 A;  2OTJ P;  2FVA A;  2N98 A;  3NY7 B;  3EJB A;  2LPK A;  2KGE A;  2MR7 A;  1YJ9 P;  2VLP A;  4H2Y C;  2PEJ A;  3CCU P;  1YI2 P;  2KWL A;  2N6Y A;  4COC A;  1ZMB A;  2Z44 A;  1VQO P;  5HVC A;  1Q7Y Q;  2KG6 A;  2GZE A;  3Q20 A;  4U0D A;  1VQ4 P;  2EHT A;  2K0D X;  2FVF A;  2Z46 A;  1VQP P;  2N6Z A;  3GZM A;  4IZ6 A;  2DNW A;  3OW2 O;  4XRQ A;  1M90 Q;  1M6E X;  2L0Q A;  1VQ5 P;  1YIT P;  2PNG A;  5HGM A;  1VQ8 P;  1VHN A;  2M8P A;  2E1M A;  2LIU A;  2LOL A;  4HKG A;  1HQB A;  1IMP A;  1E0H A;  3G21 A;  4CA3 A;  2PEI A;  5KP8 B;  3G29 A;  3DTJ A;  1NJI Q;  2MVV A;  2M8L A;  1AYI A;  4PH0 A;  2LTE A;  3RG2 A;  1L0I A;  2KGD A;  2XZ0 D;  2EIA A;  4PWV B; 
#chains in the Genus database with same CATH homology
 2VLP A;  2VLN A;  3GJN A;  7CEI A;  5EW5 E;  1MZ8 A;  2GZG A;  2NO8 A;  3U43 A;  2JBG A;  1GXH A;  2K5X A;  2GZJ A;  2GYK A;  1BXI A;  2JAZ A;  1CEI A;  2VLQ A;  1UJZ A;  2JB0 A;  2WPT A;  2ERH A;  1AYI A;  4F37 A;  2GZI A;  1ZNV A;  2GZF A;  1FR2 A;  4QKO A;  1GXG A;  2GZE A;  4UHP B;  1E0H A;  2VLO A;  1IMP A;  1IMQ A;  2K0D X;  3GKL C;  1UNK A;  1EMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...