2ERQA

Crystal structure of vascular apoptosis-inducing protein-1(tetragonal crystal form)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
424
structure length
424
Chain Sequence
SNLTPEQQRYLNAKKYVKLFLVADYIMYLKYGRNLTAVRTRMYDIVNVITPIYHRMNIHVALVGLEIWSNTDKIIVQSSADVTLDLFAKWRATDLLSRKSHDNAQLLTGINFNGPTAGLGYLGGICNTMYSAGIVQDHSKIHHLVAIAMAHEMGHNLGMDHDKDTCTCGTRPCVMAGALSCEASFLFSDCSQKDHREFLIKNMPQCILKKPLKTDVVSPAVCGNYFVEVGEECDCGSPRTCRDPCCDATTCKLRQGAQCAEGLCCDQCRFKGAGTECRAAKDECDMADVCTGRSAECTDRFQRNGQPCKNNNGYCYNGKCPIMADQCIALFGPGATVSQDACFQFNREGNHYGYCRKEQNTKIACEPQDVKCGRLYCFPNSPENKNPCNIYYSPNDEDKGMVLPGTKCADRKACSNGQCVDVTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords vascular apoptosis-inducing protein 1
publication title Crystal structures of VAP1 reveal ADAMs' MDC domain architecture and its unique C-shaped scaffold
pubmed doi rcsb
molecule tags Toxin
total genus 130
structure length 424
sequence length 424
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00200 Disintegrin Disintegrin
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
A PF08516 ADAM_CR ADAM cysteine-rich
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2erqA01
2EROA 1KUHA 2Z2DA 3F19A 5B5OA 5I0LA 4DF9A 1AF0A 1RMZA 3WV1A 2XS3A 3ZVSA 1HFCA 1EAKA 3EDZA 4A7BA 4PKWA 2JSDA 1S4BP 3TVCA 1QJIA 1YOUA 1IAGA 3DL1A 2OW9A 1GXDA 3KEJA 5I2ZA 5BOYA 3HYGA 1UEAA 2MLSA 2OW1A 4I35A 4G9LA 1BKCA 3USNA 5H8XA 1QUAA 3LQ0A 3Q2HA 4FU4A 1QIAA 1XFUA 4H3XA 1KBCA 1UMTA 1C7KA 1MMQA 1JK3A 4AUOA 3KHIA 4H1QA 2X7MA 3O64A 2HU6A 1B3DA 1KUFA 5CZMA 3ZXHA 2D1OA 3AYKA 1KUGA 4H49A 1UTZA 2OXZA 1D8MA 4H82A 3LIRA 4H76A 4PKSA 1HOVA 1OS9A 3LGPA 1D7XA 3KEKA 3LKAA 1XURA 3WV2A 2X3BA 2A8HA 2L0RA 3ELMA 4DPEA 1ND1A 2I47A 2D1NA 1EUBA 1XUDA 3KMCA 4L6TA 5LABA 2OW2A 4FVLA 3TT4A 3WV3A 1JIZA 3SHIA 2AYKA 1CGFA 3L0TA 4Q1LA 2QPJA 5BOTA 3RTTA 2OXWA 3N2VA 3LE9A 2X3AA 3EDHA 1JIWP 1D5JA 5JMYA 4L19A 1AYKA 1IACA 1GE5A 1YQYA 3I7IA 2WO9A 1CIZA 4DD8A 1YCMA 3TSKA 1ROSA 3DWBA 4WKEA 4IJOA 2RJQA 4H84A 3G5CA 1SLMA 2USNA 3RTSA 3HY9A 3LMCA 1L6JA 3AIGA 1FLSA 1MMPA 3DSLA 1K7IA 966CA 2FV9A 2JT5A 1Y0VA 4FXYP 3LUNA 2J83A 1CGEA 1ZVXA 1GKCA 3GBOA 5D1TA 4PKUA 2CKIA 1BKCI 1H71P 3G42A 1PWUA 1PWPA 3LUMA 3F1AA 1BUDA 1CXVA 1IADA 5D3CA 4G0DA 1G49A 1BSWA 3K7NA 1R55A 2SRTA 5D1UA 1QJJA 1MMBA 3HY7A 4GR3A 1BUVM 2W0DA 4PKVA 1OM8A 2RJPA 3U1RA 4L63A 1R1HA 4IN9A 1O0QA 1SATA 456CA 1A86A 1K7GA 1HV5A 3B2ZA 5D2BA 4HX3A 1RM8A 1CK7A 3EHYA 2V4BA 3K7LA 4WK7A 1WNIA 4R3VA 3LJGA 3LJTA 4GR0A 2W12A 1B8YA 2K9CA 1BM6A 4GUYA 3F16A 2WOAA 1PWQA 2PJTA 5I43A 4DV8A 2W13A 3I7GA 3HB2P 1HTDA 2MZHA 1XFVA 2DW2A 3P1VA 4GWMA 1FBLA 3TS4A 3LQBA 1AKLA 3DPEA 4XBHA 1UTTA 1Y93A 1C8TA 830CA 1I76A 1XFWA 1PWVA 1ATLA 4WZVA 1BZSA 4GR8A 1J7NA 3VTGA 4PKQA 1CAQA 2JIHA 3NX7A 4HMAA 4JPAA 1Z3JA 2OVZA 2FV5A 2O36A 5B5PA 4J4MA 1R1IA 1XFZA 1I1IP 1XUCA 2POJA 1PWWA 4XCTA 3DNGA 5D1SA 1JANA 2O3EA 1O0TA 1SRPA 1ZXCA 1JAQA 5L7FA 1ZXVA 3OHOA 1JAPA 1CQRA 4AYKA 3F18A 3F17A 1HFSA 5L79A 4IUWA 2KRJA 3UVCA 5I12A 1OM7A 3B92A 3LILA 1JJ9A 2XS4A 3KRYA 3EHXA 2AIGP 1JKYA 1IAEA 1XFYA 2OY4A 2N8RA 2JT6A 3B8ZA 3EDIA 3VI1A 3LIKA 1OS2A 1Q3AA 1G05A 1GO8P 3V96B 1OO9A 4CTHA 4XM8A 1BQQM 3DPFA 3OHLA 2OY2A 5I3MA 3KWVC 1ZS0A 2E3XA 2W15A 3HDBA 1A85A 3LEAA 1XFXA 2DDYA 1QIBA 1BKCE 3N2UA 1ZTQA 3CKIA 1BIWA 2DW1A 4XM6A 1R54A 4JA1A 4AIGA 2W14A 2MZIA 3EDGA 1MMRA 4GF1A 3KECA 2J0TA 4QKZA 1G9KA 2CLTA 3O2XA 1USNA 2K2GA 3LJZA 4AXQA 5CXAA 1CGLA 3AYUA 4ZR5A 1KUKA 1GO7P 1YP1A 2TCLA 4H30A 1I73A 3LK8A 4FXQA 1IAAA 5BPAA 2Y6DA 3HDAP 2YB9A 4I03A 4GQLA 1OMJA 5D7WA 1JAOA 1ASTA 2Y6CA 1KAPP 1HY7A 1DMTA 2MZEA 1SMPA 4A3WA 1IABA 2DW0A 1ZP5A 1UMSA 4H2EA 4WKIA 4WF6A 2OVXA 2OXUA 4PKTA 1R1JA 4PKRA 2OI0A 1QICA 1Y8JA 2WO8A 1SU3A 1DTHA 3E8RA 4ILWD 5I4OA 2X3CA 4JP4A 2OW0A 1D8FA 4JQGA 4EFSA 4GWNA 4JIJA 1OM6A 4XM7A 1G12A 2JNPA 1GE6A 3KMEA 2DDFA 1JH1A 1G4KA 3Q2GA 1KUIA 3HBVP 1GKDA 1BQOA 1C3IA 4ON1A 3P24A 2ERQA 5CUHA 3BA0A 3F15A 2OZRA 1EB6A 1SLNA 1GE7A 2E2DA 3MA2A 3EWJA 3L0VA 1K7QA 3ZUKA 2MLRA 2ERPA 1FM1A 2YIGA 3HBUP 1MNCA
chains in the Genus database with same CATH superfamily
2EROA 1KUHA 2Z2DA 3F19A 5B5OA 5I0LA 4DF9A 1AF0A 1RMZA 3WV1A 2XS3A 3ZVSA 1HFCA 1EAKA 3EDZA 4A7BA 4PKWA 2JSDA 1S4BP 3TVCA 1QJIA 1YOUA 1IAGA 3DL1A 2OW9A 1GXDA 3KEJA 5I2ZA 5BOYA 3HYGA 1UEAA 2MLSA 2OW1A 4I35A 4G9LA 1BKCA 3USNA 5H8XA 1QUAA 3LQ0A 3Q2HA 4FU4A 1QIAA 1XFUA 4H3XA 1KBCA 1UMTA 1C7KA 1MMQA 1JK3A 4AUOA 3KHIA 4H1QA 2X7MA 3O64A 2HU6A 1B3DA 1KUFA 5CZMA 3ZXHA 2D1OA 3AYKA 1OZ9A 1KUGA 4H49A 1UTZA 2OXZA 1D8MA 4H82A 3LIRA 4H76A 4PKSA 1HOVA 1OS9A 3LGPA 1D7XA 3KEKA 3LKAA 1XURA 3WV2A 2X3BA 2A8HA 2L0RA 3ELMA 4DPEA 1ND1A 2I47A 2D1NA 1EUBA 1XUDA 3KMCA 4L6TA 5LABA 2OW2A 4FVLA 3TT4A 3WV3A 1JIZA 3SHIA 2AYKA 1CGFA 3L0TA 4Q1LA 2QPJA 5BOTA 3RTTA 2OXWA 3N2VA 3LE9A 2X3AA 3EDHA 1JIWP 1D5JA 5JMYA 4L19A 1AYKA 1IACA 1GE5A 1YQYA 3I7IA 2WO9A 1CIZA 4DD8A 1YCMA 3TSKA 1ROSA 3DWBA 4WKEA 4IJOA 2RJQA 4H84A 3G5CA 1SLMA 2USNA 3RTSA 3HY9A 3LMCA 1L6JA 3AIGA 1FLSA 1MMPA 3DSLA 1K7IA 966CA 2FV9A 2JT5A 1Y0VA 4FXYP 3LUNA 2J83A 1CGEA 1ZVXA 1GKCA 3GBOA 5D1TA 4PKUA 2CKIA 1BKCI 1H71P 3G42A 1PWUA 1PWPA 3LUMA 3F1AA 1BUDA 1CXVA 1IADA 5D3CA 4G0DA 1G49A 1BSWA 3K7NA 1R55A 2SRTA 5D1UA 1QJJA 1MMBA 3HY7A 4GR3A 1BUVM 2W0DA 4PKVA 1OM8A 2RJPA 3U1RA 4L63A 4L7AA 1R1HA 4IN9A 1O0QA 1SATA 456CA 1A86A 1K7GA 1HV5A 3B2ZA 5D2BA 4HX3A 1RM8A 1CK7A 3EHYA 3DTIA 2V4BA 3K7LA 4WK7A 1WNIA 4R3VA 3LJGA 3LJTA 4GR0A 1TVIA 2W12A 1B8YA 2K9CA 1BM6A 4GUYA 3F16A 2WOAA 1PWQA 2PJTA 5I43A 4DV8A 2W13A 3I7GA 3HB2P 1HTDA 2MZHA 1XFVA 2DW2A 3P1VA 4GWMA 1FBLA 3TS4A 3LQBA 1AKLA 3DPEA 4XBHA 1UTTA 1Y93A 1C8TA 830CA 1I76A 1XFWA 1PWVA 1ATLA 4WZVA 1XM5A 1BZSA 3DTKA 4GR8A 1J7NA 3VTGA 4PKQA 1CAQA 2JIHA 3NX7A 4HMAA 4JPAA 1Z3JA 2OVZA 2FV5A 2O36A 5B5PA 4J4MA 1R1IA 1XFZA 1I1IP 1XUCA 2POJA 1PWWA 4XCTA 3DNGA 5D1SA 1JANA 2O3EA 1O0TA 1SRPA 1ZXCA 1JAQA 5L7FA 1ZXVA 3OHOA 1JAPA 1CQRA 4AYKA 3F18A 3F17A 1HFSA 5L79A 4IUWA 2KRJA 3UVCA 5I12A 1OM7A 3B92A 3LILA 1JJ9A 2XS4A 3KRYA 3EHXA 2AIGP 1JKYA 1IAEA 1XFYA 2OY4A 2N8RA 2JT6A 3B8ZA 3EDIA 3VI1A 3LIKA 1OS2A 1Q3AA 1G05A 1GO8P 3V96B 1OO9A 4CTHA 4XM8A 1BQQM 3DPFA 3OHLA 2OY2A 5I3MA 3KWVC 1ZS0A 2E3XA 2W15A 3HDBA 1A85A 3LEAA 1XFXA 2DDYA 1QIBA 1BKCE 3N2UA 1ZTQA 3CKIA 1BIWA 2DW1A 4XM6A 1R54A 4JA1A 4AIGA 2W14A 2MZIA 3EDGA 1MMRA 4GF1A 3KECA 2J0TA 4QKZA 1G9KA 2CLTA 3O2XA 1USNA 2K2GA 3LJZA 4AXQA 5CXAA 1CGLA 3AYUA 4ZR5A 1KUKA 1GO7P 1YP1A 2TCLA 4H30A 1I73A 3LK8A 4FXQA 1IAAA 5BPAA 2Y6DA 3HDAP 3DTEA 2YB9A 4I03A 4GQLA 1OMJA 5D7WA 1JAOA 1ASTA 2Y6CA 1KAPP 1HY7A 1DMTA 1XAXA 2MZEA 1SMPA 4A3WA 1IABA 2DW0A 1ZP5A 1UMSA 4H2EA 4WKIA 4WF6A 2OVXA 2OXUA 4PKTA 1R1JA 4PKRA 2OI0A 1QICA 1Y8JA 2WO8A 1SU3A 1DTHA 3E8RA 4ILWD 5I4OA 2X3CA 4JP4A 2OW0A 1D8FA 4JQGA 4EFSA 4GWNA 4JIJA 1OM6A 4XM7A 1G12A 2JNPA 1GE6A 3KMEA 2DDFA 1JH1A 2YUFA 1G4KA 3Q2GA 1KUIA 3HBVP 1GKDA 1BQOA 1C3IA 4ON1A 3P24A 2ERQA 5CUHA 3BA0A 3F15A 2OZRA 1EB6A 1SLNA 1GE7A 2E2DA 3MA2A 3EWJA 3L0VA 1K7QA 3ZUKA 2MLRA 2ERPA 1FM1A 2YIGA 3HBUP 1MNCA
chains in the Genus database with same CATH topology
2EROA 1KUHA 2Z2DA 3F19A 5B5OA 5I0LA 4DF9A 1AF0A 1RMZA 3WV1A 2XS3A 3ZVSA 1HFCA 1EAKA 3EDZA 4A7BA 4PKWA 2JSDA 1S4BP 3TVCA 1QJIA 1YOUA 1IAGA 3DL1A 2OW9A 1GXDA 3KEJA 5I2ZA 5BOYA 3HYGA 1UEAA 2MLSA 2OW1A 4I35A 4G9LA 1BKCA 3USNA 5H8XA 1QUAA 3LQ0A 3Q2HA 4FU4A 1QIAA 1XFUA 4H3XA 1KBCA 1UMTA 1C7KA 1MMQA 1JK3A 4AUOA 3KHIA 4H1QA 2X7MA 3O64A 2HU6A 1B3DA 1KUFA 5CZMA 3ZXHA 2D1OA 3AYKA 1KUGA 4H49A 1UTZA 2OXZA 1D8MA 4H82A 3LIRA 4H76A 4PKSA 1HOVA 1OS9A 3LGPA 1D7XA 3KEKA 3LKAA 1XURA 3WV2A 2X3BA 2A8HA 2L0RA 3ELMA 4DPEA 1ND1A 2I47A 2D1NA 1EUBA 1XUDA 3KMCA 4L6TA 5LABA 2OW2A 4FVLA 3TT4A 3WV3A 1JIZA 3SHIA 2AYKA 1CGFA 3L0TA 4Q1LA 2QPJA 5BOTA 3RTTA 2OXWA 3N2VA 3LE9A 2X3AA 3EDHA 1JIWP 1D5JA 5JMYA 4L19A 1AYKA 1IACA 1GE5A 1YQYA 3I7IA 2WO9A 1CIZA 4DD8A 1YCMA 3TSKA 1ROSA 3DWBA 4WKEA 4IJOA 2RJQA 4H84A 3G5CA 1SLMA 2USNA 3RTSA 3HY9A 3LMCA 1L6JA 3AIGA 1FLSA 1MMPA 3DSLA 1K7IA 966CA 2FV9A 2JT5A 1Y0VA 4FXYP 3LUNA 2J83A 1CGEA 1ZVXA 1GKCA 3GBOA 5D1TA 4PKUA 2CKIA 1BKCI 1H71P 3G42A 1PWUA 1PWPA 3LUMA 3F1AA 1BUDA 1CXVA 1IADA 5D3CA 4G0DA 1G49A 1BSWA 3K7NA 1R55A 2SRTA 5D1UA 1QJJA 1MMBA 3HY7A 4GR3A 1BUVM 2W0DA 4PKVA 1OM8A 2RJPA 3U1RA 4L63A 4L7AA 1R1HA 4IN9A 1O0QA 1SATA 456CA 1A86A 1K7GA 1HV5A 3B2ZA 5D2BA 4HX3A 1RM8A 1CK7A 3EHYA 3DTIA 2V4BA 3K7LA 4WK7A 1WNIA 4R3VA 3LJGA 3LJTA 4GR0A 2W12A 1B8YA 2K9CA 1BM6A 4GUYA 3F16A 2WOAA 1PWQA 2PJTA 5I43A 4DV8A 2W13A 3I7GA 3HB2P 1HTDA 2MZHA 1XFVA 2DW2A 3P1VA 4GWMA 1FBLA 3TS4A 3LQBA 1AKLA 3DPEA 4XBHA 1UTTA 1Y93A 1C8TA 830CA 1I76A 1XFWA 1PWVA 1ATLA 4WZVA 1BZSA 3DTKA 4GR8A 1J7NA 3VTGA 4PKQA 1CAQA 2JIHA 3NX7A 4HMAA 4JPAA 1Z3JA 2OVZA 2FV5A 2O36A 5B5PA 4J4MA 1R1IA 1XFZA 1I1IP 1XUCA 2POJA 1PWWA 4XCTA 3DNGA 5D1SA 1JANA 2O3EA 1O0TA 1SRPA 1ZXCA 1JAQA 5L7FA 1ZXVA 3OHOA 1JAPA 1CQRA 4AYKA 3F18A 3F17A 1HFSA 5L79A 4IUWA 2KRJA 3UVCA 5I12A 1OM7A 3B92A 3LILA 1JJ9A 2XS4A 3KRYA 3EHXA 2AIGP 1JKYA 1IAEA 1XFYA 2OY4A 2N8RA 2JT6A 3B8ZA 3EDIA 3VI1A 3LIKA 1OS2A 1Q3AA 1G05A 1GO8P 3V96B 1OO9A 4CTHA 4XM8A 1BQQM 3DPFA 3OHLA 2OY2A 5I3MA 3KWVC 1ZS0A 2E3XA 2W15A 3HDBA 1A85A 3LEAA 1XFXA 2DDYA 1QIBA 1BKCE 3N2UA 1ZTQA 3CKIA 1BIWA 2DW1A 4XM6A 1R54A 4JA1A 4AIGA 2W14A 2MZIA 3EDGA 1MMRA 4GF1A 3KECA 2J0TA 4QKZA 1G9KA 2CLTA 3O2XA 1USNA 2K2GA 3LJZA 4AXQA 5CXAA 1CGLA 3AYUA 4ZR5A 1KUKA 1GO7P 1YP1A 2TCLA 4H30A 1I73A 3LK8A 4FXQA 1IAAA 5BPAA 2Y6DA 3HDAP 3DTEA 2YB9A 4I03A 4GQLA 1OMJA 5D7WA 1JAOA 1ASTA 2Y6CA 1KAPP 1HY7A 1DMTA 2MZEA 1SMPA 4A3WA 1IABA 2DW0A 1ZP5A 1UMSA 4H2EA 4WKIA 4WF6A 2OVXA 2OXUA 4PKTA 1R1JA 4PKRA 2OI0A 1QICA 1Y8JA 2WO8A 1SU3A 1DTHA 3E8RA 4ILWD 5I4OA 2X3CA 4JP4A 2OW0A 1D8FA 4JQGA 4EFSA 4GWNA 4JIJA 1OM6A 4XM7A 1G12A 2JNPA 1GE6A 3KMEA 2DDFA 1JH1A 2YUFA 1G4KA 3Q2GA 1KUIA 3HBVP 1GKDA 1BQOA 1C3IA 4ON1A 3P24A 2ERQA 5CUHA 3BA0A 3F15A 2OZRA 1EB6A 1SLNA 1GE7A 2E2DA 3MA2A 3EWJA 3L0VA 1K7QA 3ZUKA 2MLRA 2ERPA 1FM1A 2YIGA 3HBUP 1MNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERO A;  1KUH A;  2Z2D A;  3F19 A;  5B5O A;  5I0L A;  4DF9 A;  1AF0 A;  1RMZ A;  3WV1 A;  2XS3 A;  3ZVS A;  1HFC A;  1EAK A;  3EDZ A;  4A7B A;  4PKW A;  2JSD A;  1S4B P;  3TVC A;  1QJI A;  1YOU A;  1IAG A;  3DL1 A;  2OW9 A;  1GXD A;  3KEJ A;  5I2Z A;  5BOY A;  3HYG A;  1UEA A;  2MLS A;  2OW1 A;  4I35 A;  4G9L A;  1BKC A;  3USN A;  5H8X A;  1QUA A;  3LQ0 A;  3Q2H A;  4FU4 A;  1QIA A;  1XFU A;  4H3X A;  1KBC A;  1UMT A;  1C7K A;  1MMQ A;  1JK3 A;  4AUO A;  3KHI A;  4H1Q A;  2X7M A;  3O64 A;  2HU6 A;  1B3D A;  1KUF A;  5CZM A;  3ZXH A;  2D1O A;  3AYK A;  1KUG A;  4H49 A;  1UTZ A;  2OXZ A;  1D8M A;  4H82 A;  3LIR A;  4H76 A;  4PKS A;  1HOV A;  1OS9 A;  3LGP A;  1D7X A;  3KEK A;  3LKA A;  1XUR A;  3WV2 A;  2X3B A;  2A8H A;  2L0R A;  3ELM A;  4DPE A;  1ND1 A;  2I47 A;  2D1N A;  1EUB A;  1XUD A;  3KMC A;  4L6T A;  5LAB A;  2OW2 A;  4FVL A;  3TT4 A;  3WV3 A;  1JIZ A;  3SHI A;  2AYK A;  1CGF A;  3L0T A;  4Q1L A;  2QPJ A;  5BOT A;  3RTT A;  2OXW A;  3N2V A;  3LE9 A;  2X3A A;  3EDH A;  1JIW P;  1D5J A;  5JMY A;  4L19 A;  1AYK A;  1IAC A;  1GE5 A;  1YQY A;  3I7I A;  2WO9 A;  1CIZ A;  4DD8 A;  1YCM A;  3TSK A;  1ROS A;  3DWB A;  4WKE A;  4IJO A;  2RJQ A;  4H84 A;  3G5C A;  1SLM A;  2USN A;  3RTS A;  3HY9 A;  3LMC A;  1L6J A;  3AIG A;  1FLS A;  1MMP A;  3DSL A;  1K7I A;  966C A;  2FV9 A;  2JT5 A;  1Y0V A;  4FXY P;  3LUN A;  2J83 A;  1CGE A;  1ZVX A;  1GKC A;  3GBO A;  5D1T A;  4PKU A;  2CKI A;  1BKC I;  1H71 P;  3G42 A;  1PWU A;  1PWP A;  3LUM A;  3F1A A;  1BUD A;  1CXV A;  1IAD A;  5D3C A;  4G0D A;  1G49 A;  1BSW A;  3K7N A;  1R55 A;  2SRT A;  5D1U A;  1QJJ A;  1MMB A;  3HY7 A;  4GR3 A;  1BUV M;  2W0D A;  4PKV A;  1OM8 A;  2RJP A;  3U1R A;  4L63 A;  1R1H A;  4IN9 A;  1O0Q A;  1SAT A;  456C A;  1A86 A;  1K7G A;  1HV5 A;  3B2Z A;  5D2B A;  4HX3 A;  1RM8 A;  1CK7 A;  3EHY A;  2V4B A;  3K7L A;  4WK7 A;  1WNI A;  4R3V A;  3LJG A;  3LJT A;  4GR0 A;  2W12 A;  1B8Y A;  2K9C A;  1BM6 A;  4GUY A;  3F16 A;  2WOA A;  1PWQ A;  2PJT A;  5I43 A;  4DV8 A;  2W13 A;  3I7G A;  3HB2 P;  1HTD A;  2MZH A;  1XFV A;  2DW2 A;  3P1V A;  4GWM A;  1FBL A;  3TS4 A;  3LQB A;  1AKL A;  3DPE A;  4XBH A;  1UTT A;  1Y93 A;  1C8T A;  830C A;  1I76 A;  1XFW A;  1PWV A;  1ATL A;  4WZV A;  1BZS A;  4GR8 A;  1J7N A;  3VTG A;  4PKQ A;  1CAQ A;  2JIH A;  3NX7 A;  4HMA A;  4JPA A;  1Z3J A;  2OVZ A;  2FV5 A;  2O36 A;  5B5P A;  4J4M A;  1R1I A;  1XFZ A;  1I1I P;  1XUC A;  2POJ A;  1PWW A;  4XCT A;  3DNG A;  5D1S A;  1JAN A;  2O3E A;  1O0T A;  1SRP A;  1ZXC A;  1JAQ A;  5L7F A;  1ZXV A;  3OHO A;  1JAP A;  1CQR A;  4AYK A;  3F18 A;  3F17 A;  1HFS A;  5L79 A;  4IUW A;  2KRJ A;  3UVC A;  5I12 A;  1OM7 A;  3B92 A;  3LIL A;  1JJ9 A;  2XS4 A;  3KRY A;  3EHX A;  2AIG P;  1JKY A;  1IAE A;  1XFY A;  2OY4 A;  2N8R A;  2JT6 A;  3B8Z A;  3EDI A;  3VI1 A;  3LIK A;  1OS2 A;  1Q3A A;  1G05 A;  1GO8 P;  3V96 B;  1OO9 A;  4CTH A;  4XM8 A;  1BQQ M;  3DPF A;  3OHL A;  2OY2 A;  5I3M A;  3KWV C;  1ZS0 A;  2E3X A;  2W15 A;  3HDB A;  1A85 A;  3LEA A;  1XFX A;  2DDY A;  1QIB A;  1BKC E;  3N2U A;  1ZTQ A;  3CKI A;  1BIW A;  2DW1 A;  4XM6 A;  1R54 A;  4JA1 A;  4AIG A;  2W14 A;  2MZI A;  3EDG A;  1MMR A;  4GF1 A;  3KEC A;  2J0T A;  4QKZ A;  1G9K A;  2CLT A;  3O2X A;  1USN A;  2K2G A;  3LJZ A;  4AXQ A;  5CXA A;  1CGL A;  3AYU A;  4ZR5 A;  1KUK A;  1GO7 P;  1YP1 A;  2TCL A;  4H30 A;  1I73 A;  3LK8 A;  4FXQ A;  1IAA A;  5BPA A;  2Y6D A;  3HDA P;  2YB9 A;  4I03 A;  4GQL A;  1OMJ A;  5D7W A;  1JAO A;  1AST A;  2Y6C A;  1KAP P;  1HY7 A;  1DMT A;  2MZE A;  1SMP A;  4A3W A;  1IAB A;  2DW0 A;  1ZP5 A;  1UMS A;  4H2E A;  4WKI A;  4WF6 A;  2OVX A;  2OXU A;  4PKT A;  1R1J A;  4PKR A;  2OI0 A;  1QIC A;  1Y8J A;  2WO8 A;  1SU3 A;  1DTH A;  3E8R A;  4ILW D;  5I4O A;  2X3C A;  4JP4 A;  2OW0 A;  1D8F A;  4JQG A;  4EFS A;  4GWN A;  4JIJ A;  1OM6 A;  4XM7 A;  1G12 A;  2JNP A;  1GE6 A;  3KME A;  2DDF A;  1JH1 A;  1G4K A;  3Q2G A;  1KUI A;  3HBV P;  1GKD A;  1BQO A;  1C3I A;  4ON1 A;  3P24 A;  2ERQ A;  5CUH A;  3BA0 A;  3F15 A;  2OZR A;  1EB6 A;  1SLN A;  1GE7 A;  2E2D A;  3MA2 A;  3EWJ A;  3L0V A;  1K7Q A;  3ZUK A;  2MLR A;  2ERP A;  1FM1 A;  2YIG A;  3HBU P;  1MNC A; 
#chains in the Genus database with same CATH topology
 2ERO A;  1KUH A;  2Z2D A;  3F19 A;  5B5O A;  5I0L A;  4DF9 A;  1AF0 A;  1RMZ A;  3WV1 A;  2XS3 A;  3ZVS A;  1HFC A;  1EAK A;  3EDZ A;  4A7B A;  4PKW A;  2JSD A;  1S4B P;  3TVC A;  1QJI A;  1YOU A;  1IAG A;  3DL1 A;  2OW9 A;  1GXD A;  3KEJ A;  5I2Z A;  5BOY A;  3HYG A;  1UEA A;  2MLS A;  2OW1 A;  4I35 A;  4G9L A;  1BKC A;  3USN A;  5H8X A;  1QUA A;  3LQ0 A;  3Q2H A;  4FU4 A;  1QIA A;  1XFU A;  4H3X A;  1KBC A;  1UMT A;  1C7K A;  1MMQ A;  1JK3 A;  4AUO A;  3KHI A;  4H1Q A;  2X7M A;  3O64 A;  2HU6 A;  1B3D A;  1KUF A;  5CZM A;  3ZXH A;  2D1O A;  3AYK A;  1OZ9 A;  1KUG A;  4H49 A;  1UTZ A;  2OXZ A;  1D8M A;  4H82 A;  3LIR A;  4H76 A;  4PKS A;  1HOV A;  1OS9 A;  3LGP A;  1D7X A;  3KEK A;  3LKA A;  1XUR A;  3WV2 A;  2X3B A;  2A8H A;  2L0R A;  3ELM A;  4DPE A;  1ND1 A;  2I47 A;  2D1N A;  1EUB A;  1XUD A;  3KMC A;  4L6T A;  5LAB A;  2OW2 A;  4FVL A;  3TT4 A;  3WV3 A;  1JIZ A;  3SHI A;  2AYK A;  1CGF A;  3L0T A;  4Q1L A;  2QPJ A;  5BOT A;  3RTT A;  2OXW A;  3N2V A;  3LE9 A;  2X3A A;  3EDH A;  1JIW P;  1D5J A;  5JMY A;  4L19 A;  1AYK A;  1IAC A;  1GE5 A;  1YQY A;  3I7I A;  2WO9 A;  1CIZ A;  4DD8 A;  1YCM A;  3TSK A;  1ROS A;  3DWB A;  4WKE A;  4IJO A;  2RJQ A;  4H84 A;  3G5C A;  1SLM A;  2USN A;  3RTS A;  3HY9 A;  3LMC A;  1L6J A;  3AIG A;  1FLS A;  1MMP A;  3DSL A;  1K7I A;  966C A;  2FV9 A;  2JT5 A;  1Y0V A;  4FXY P;  3LUN A;  2J83 A;  1CGE A;  1ZVX A;  1GKC A;  3GBO A;  5D1T A;  4PKU A;  2CKI A;  1BKC I;  1H71 P;  3G42 A;  1PWU A;  1PWP A;  3LUM A;  3F1A A;  1BUD A;  1CXV A;  1IAD A;  5D3C A;  4G0D A;  1G49 A;  1BSW A;  3K7N A;  1R55 A;  2SRT A;  5D1U A;  1QJJ A;  1MMB A;  3HY7 A;  4GR3 A;  1BUV M;  2W0D A;  4PKV A;  1OM8 A;  2RJP A;  3U1R A;  4L63 A;  4L7A A;  1R1H A;  4IN9 A;  1O0Q A;  1SAT A;  456C A;  1A86 A;  1K7G A;  1HV5 A;  3B2Z A;  5D2B A;  4HX3 A;  1RM8 A;  1CK7 A;  3EHY A;  3DTI A;  2V4B A;  3K7L A;  4WK7 A;  1WNI A;  4R3V A;  3LJG A;  3LJT A;  4GR0 A;  1TVI A;  2W12 A;  1B8Y A;  2K9C A;  1BM6 A;  4GUY A;  3F16 A;  2WOA A;  1PWQ A;  2PJT A;  5I43 A;  4DV8 A;  2W13 A;  3I7G A;  3HB2 P;  1HTD A;  2MZH A;  1XFV A;  2DW2 A;  3P1V A;  4GWM A;  1FBL A;  3TS4 A;  3LQB A;  1AKL A;  3DPE A;  4XBH A;  1UTT A;  1Y93 A;  1C8T A;  830C A;  1I76 A;  1XFW A;  1PWV A;  1ATL A;  4WZV A;  1XM5 A;  1BZS A;  3DTK A;  4GR8 A;  1J7N A;  3VTG A;  4PKQ A;  1CAQ A;  2JIH A;  3NX7 A;  4HMA A;  4JPA A;  1Z3J A;  2OVZ A;  2FV5 A;  2O36 A;  5B5P A;  4J4M A;  1R1I A;  1XFZ A;  1I1I P;  1XUC A;  2POJ A;  1PWW A;  4XCT A;  3DNG A;  5D1S A;  1JAN A;  2O3E A;  1O0T A;  1SRP A;  1ZXC A;  1JAQ A;  5L7F A;  1ZXV A;  3OHO A;  1JAP A;  1CQR A;  4AYK A;  3F18 A;  3F17 A;  1HFS A;  5L79 A;  4IUW A;  2KRJ A;  3UVC A;  5I12 A;  1OM7 A;  3B92 A;  3LIL A;  1JJ9 A;  2XS4 A;  3KRY A;  3EHX A;  2AIG P;  1JKY A;  1IAE A;  1XFY A;  2OY4 A;  2N8R A;  2JT6 A;  3B8Z A;  3EDI A;  3VI1 A;  3LIK A;  1OS2 A;  1Q3A A;  1G05 A;  1GO8 P;  3V96 B;  1OO9 A;  4CTH A;  4XM8 A;  1BQQ M;  3DPF A;  3OHL A;  2OY2 A;  5I3M A;  3KWV C;  1ZS0 A;  2E3X A;  2W15 A;  3HDB A;  1A85 A;  3LEA A;  1XFX A;  2DDY A;  1QIB A;  1BKC E;  3N2U A;  1ZTQ A;  3CKI A;  1BIW A;  2DW1 A;  4XM6 A;  1R54 A;  4JA1 A;  4AIG A;  2W14 A;  2MZI A;  3EDG A;  1MMR A;  4GF1 A;  3KEC A;  2J0T A;  4QKZ A;  1G9K A;  2CLT A;  3O2X A;  1USN A;  2K2G A;  3LJZ A;  4AXQ A;  5CXA A;  1CGL A;  3AYU A;  4ZR5 A;  1KUK A;  1GO7 P;  1YP1 A;  2TCL A;  4H30 A;  1I73 A;  3LK8 A;  4FXQ A;  1IAA A;  5BPA A;  2Y6D A;  3HDA P;  3DTE A;  2YB9 A;  4I03 A;  4GQL A;  1OMJ A;  5D7W A;  1JAO A;  1AST A;  2Y6C A;  1KAP P;  1HY7 A;  1DMT A;  1XAX A;  2MZE A;  1SMP A;  4A3W A;  1IAB A;  2DW0 A;  1ZP5 A;  1UMS A;  4H2E A;  4WKI A;  4WF6 A;  2OVX A;  2OXU A;  4PKT A;  1R1J A;  4PKR A;  2OI0 A;  1QIC A;  1Y8J A;  2WO8 A;  1SU3 A;  1DTH A;  3E8R A;  4ILW D;  5I4O A;  2X3C A;  4JP4 A;  2OW0 A;  1D8F A;  4JQG A;  4EFS A;  4GWN A;  4JIJ A;  1OM6 A;  4XM7 A;  1G12 A;  2JNP A;  1GE6 A;  3KME A;  2DDF A;  1JH1 A;  2YUF A;  1G4K A;  3Q2G A;  1KUI A;  3HBV P;  1GKD A;  1BQO A;  1C3I A;  4ON1 A;  3P24 A;  2ERQ A;  5CUH A;  3BA0 A;  3F15 A;  2OZR A;  1EB6 A;  1SLN A;  1GE7 A;  2E2D A;  3MA2 A;  3EWJ A;  3L0V A;  1K7Q A;  3ZUK A;  2MLR A;  2ERP A;  1FM1 A;  2YIG A;  3HBU P;  1MNC A; 
#chains in the Genus database with same CATH homology
 2ERO A;  1KUH A;  2Z2D A;  3F19 A;  5B5O A;  5I0L A;  4DF9 A;  1AF0 A;  1RMZ A;  3WV1 A;  2XS3 A;  3ZVS A;  1HFC A;  1EAK A;  3EDZ A;  4A7B A;  4PKW A;  2JSD A;  1S4B P;  3TVC A;  1QJI A;  1YOU A;  1IAG A;  3DL1 A;  2OW9 A;  1GXD A;  3KEJ A;  5I2Z A;  5BOY A;  3HYG A;  1UEA A;  2MLS A;  2OW1 A;  4I35 A;  4G9L A;  1BKC A;  3USN A;  5H8X A;  1QUA A;  3LQ0 A;  3Q2H A;  4FU4 A;  1QIA A;  1XFU A;  4H3X A;  1KBC A;  1UMT A;  1C7K A;  1MMQ A;  1JK3 A;  4AUO A;  3KHI A;  4H1Q A;  2X7M A;  3O64 A;  2HU6 A;  1B3D A;  1KUF A;  5CZM A;  3ZXH A;  2D1O A;  3AYK A;  1KUG A;  4H49 A;  1UTZ A;  2OXZ A;  1D8M A;  4H82 A;  3LIR A;  4H76 A;  4PKS A;  1HOV A;  1OS9 A;  3LGP A;  1D7X A;  3KEK A;  3LKA A;  1XUR A;  3WV2 A;  2X3B A;  2A8H A;  2L0R A;  3ELM A;  4DPE A;  1ND1 A;  2I47 A;  2D1N A;  1EUB A;  1XUD A;  3KMC A;  4L6T A;  5LAB A;  2OW2 A;  4FVL A;  3TT4 A;  3WV3 A;  1JIZ A;  3SHI A;  2AYK A;  1CGF A;  3L0T A;  4Q1L A;  2QPJ A;  5BOT A;  3RTT A;  2OXW A;  3N2V A;  3LE9 A;  2X3A A;  3EDH A;  1JIW P;  1D5J A;  5JMY A;  4L19 A;  1AYK A;  1IAC A;  1GE5 A;  1YQY A;  3I7I A;  2WO9 A;  1CIZ A;  4DD8 A;  1YCM A;  3TSK A;  1ROS A;  3DWB A;  4WKE A;  4IJO A;  2RJQ A;  4H84 A;  3G5C A;  1SLM A;  2USN A;  3RTS A;  3HY9 A;  3LMC A;  1L6J A;  3AIG A;  1FLS A;  1MMP A;  3DSL A;  1K7I A;  966C A;  2FV9 A;  2JT5 A;  1Y0V A;  4FXY P;  3LUN A;  2J83 A;  1CGE A;  1ZVX A;  1GKC A;  3GBO A;  5D1T A;  4PKU A;  2CKI A;  1BKC I;  1H71 P;  3G42 A;  1PWU A;  1PWP A;  3LUM A;  3F1A A;  1BUD A;  1CXV A;  1IAD A;  5D3C A;  4G0D A;  1G49 A;  1BSW A;  3K7N A;  1R55 A;  2SRT A;  5D1U A;  1QJJ A;  1MMB A;  3HY7 A;  4GR3 A;  1BUV M;  2W0D A;  4PKV A;  1OM8 A;  2RJP A;  3U1R A;  4L63 A;  4L7A A;  1R1H A;  4IN9 A;  1O0Q A;  1SAT A;  456C A;  1A86 A;  1K7G A;  1HV5 A;  3B2Z A;  5D2B A;  4HX3 A;  1RM8 A;  1CK7 A;  3EHY A;  3DTI A;  2V4B A;  3K7L A;  4WK7 A;  1WNI A;  4R3V A;  3LJG A;  3LJT A;  4GR0 A;  2W12 A;  1B8Y A;  2K9C A;  1BM6 A;  4GUY A;  3F16 A;  2WOA A;  1PWQ A;  2PJT A;  5I43 A;  4DV8 A;  2W13 A;  3I7G A;  3HB2 P;  1HTD A;  2MZH A;  1XFV A;  2DW2 A;  3P1V A;  4GWM A;  1FBL A;  3TS4 A;  3LQB A;  1AKL A;  3DPE A;  4XBH A;  1UTT A;  1Y93 A;  1C8T A;  830C A;  1I76 A;  1XFW A;  1PWV A;  1ATL A;  4WZV A;  1BZS A;  3DTK A;  4GR8 A;  1J7N A;  3VTG A;  4PKQ A;  1CAQ A;  2JIH A;  3NX7 A;  4HMA A;  4JPA A;  1Z3J A;  2OVZ A;  2FV5 A;  2O36 A;  5B5P A;  4J4M A;  1R1I A;  1XFZ A;  1I1I P;  1XUC A;  2POJ A;  1PWW A;  4XCT A;  3DNG A;  5D1S A;  1JAN A;  2O3E A;  1O0T A;  1SRP A;  1ZXC A;  1JAQ A;  5L7F A;  1ZXV A;  3OHO A;  1JAP A;  1CQR A;  4AYK A;  3F18 A;  3F17 A;  1HFS A;  5L79 A;  4IUW A;  2KRJ A;  3UVC A;  5I12 A;  1OM7 A;  3B92 A;  3LIL A;  1JJ9 A;  2XS4 A;  3KRY A;  3EHX A;  2AIG P;  1JKY A;  1IAE A;  1XFY A;  2OY4 A;  2N8R A;  2JT6 A;  3B8Z A;  3EDI A;  3VI1 A;  3LIK A;  1OS2 A;  1Q3A A;  1G05 A;  1GO8 P;  3V96 B;  1OO9 A;  4CTH A;  4XM8 A;  1BQQ M;  3DPF A;  3OHL A;  2OY2 A;  5I3M A;  3KWV C;  1ZS0 A;  2E3X A;  2W15 A;  3HDB A;  1A85 A;  3LEA A;  1XFX A;  2DDY A;  1QIB A;  1BKC E;  3N2U A;  1ZTQ A;  3CKI A;  1BIW A;  2DW1 A;  4XM6 A;  1R54 A;  4JA1 A;  4AIG A;  2W14 A;  2MZI A;  3EDG A;  1MMR A;  4GF1 A;  3KEC A;  2J0T A;  4QKZ A;  1G9K A;  2CLT A;  3O2X A;  1USN A;  2K2G A;  3LJZ A;  4AXQ A;  5CXA A;  1CGL A;  3AYU A;  4ZR5 A;  1KUK A;  1GO7 P;  1YP1 A;  2TCL A;  4H30 A;  1I73 A;  3LK8 A;  4FXQ A;  1IAA A;  5BPA A;  2Y6D A;  3HDA P;  3DTE A;  2YB9 A;  4I03 A;  4GQL A;  1OMJ A;  5D7W A;  1JAO A;  1AST A;  2Y6C A;  1KAP P;  1HY7 A;  1DMT A;  2MZE A;  1SMP A;  4A3W A;  1IAB A;  2DW0 A;  1ZP5 A;  1UMS A;  4H2E A;  4WKI A;  4WF6 A;  2OVX A;  2OXU A;  4PKT A;  1R1J A;  4PKR A;  2OI0 A;  1QIC A;  1Y8J A;  2WO8 A;  1SU3 A;  1DTH A;  3E8R A;  4ILW D;  5I4O A;  2X3C A;  4JP4 A;  2OW0 A;  1D8F A;  4JQG A;  4EFS A;  4GWN A;  4JIJ A;  1OM6 A;  4XM7 A;  1G12 A;  2JNP A;  1GE6 A;  3KME A;  2DDF A;  1JH1 A;  2YUF A;  1G4K A;  3Q2G A;  1KUI A;  3HBV P;  1GKD A;  1BQO A;  1C3I A;  4ON1 A;  3P24 A;  2ERQ A;  5CUH A;  3BA0 A;  3F15 A;  2OZR A;  1EB6 A;  1SLN A;  1GE7 A;  2E2D A;  3MA2 A;  3EWJ A;  3L0V A;  1K7Q A;  3ZUK A;  2MLR A;  2ERP A;  1FM1 A;  2YIG A;  3HBU P;  1MNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...