2ERXA

Crystal structure of diras2 in complex with gdp and inorganic phosphate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
168
Chain Sequence
NDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGSIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of DiRas2
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding protein Di-Ras2
total genus 59
structure length 168
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2erxA00
2AD1A 2VL7A 1ZM7A 4ZDWA 4Q7LA 3DKVA 5DHFA 1OFTA 3LA6A 3P4XA 1N6IA 1R5NA 4A8JC 2WV9A 2FDCA 2HLDD 3EPLA 3TAUA 1Q20A 1XD8A 1NVUQ 5CYOA 3NHAA 3KJIA 3LQQA 2H8KA 3QE0A 1A82A 4CEIB 3DO6A 1BIFA 1GUAA 1VG9B 1JI0A 3I32A 5DLQC 1MT0A 5H70A 2FSGA 2Q3MA 2PMDA 1G5PA 3BERA 4LCBA 4A4DA 2ECKA 2QUZA 1MRNA 5SZHB 1KJYA 3ADKA 4AD8A 2IS6A 2E9SA 3W8RA 5KOYA 2FJUA 2PX3A 5CYPA 2JLZA 2R6DA 1WB9A 4RD0A 5EZ6B 4JL6A 2ZRAA 2J0VA 3AQ4A 3AGQA 3OE7D 4OL0A 1HYQA 2VP4A 3NBFA 3Q7QA 4HAVA 4AY2A 1CF4A 4OBEA 3K70B 1OKKD 1G18A 1S3GA 4JYCA 5CK4A 3T15A 4ASUD 4B32A 4BECA 1XZQA 4H1UA 3TE6A 2BEKA 4Q1FA 2JIZA 1E98A 4P31A 3E1SA 5CM9C 2ZE5A 1T4GA 2WOJA 2WWWA 3FOZA 1SKQA 2MSDB 3A8TA 2J7PA 5JBQA 2QPTA 2ODWA 4Q5IA 3F8TA 1M6NA 3B2EA 5AJWA 2IS4A 2A5JA 5KSOA 1T0JB 1IN4A 5K8TA 2YYZA 4NMMA 4UQOA 1OIVA 2N1BA 3R8FA 4XD7A 4C2TA 4QG7A 2QENA 3W6OA 4L8GA 1KKMA 1YZKA 2JLQA 5DGXA 4FMDF 1QHYA 2CVHA 3SEAA 1P2UA 2X1VA 3GLHE 1FL9A 4YXWA 3TK1A 3VR3A 1S1CA 4H9GA 3UK6A 1N5IA 4C0AC 5JWRA 1E2FA 4Q02A 2R6GA 2GESA 4ASUA 3RS5A 3KQKA 3ASYA 4PPQA 4DSUA 4US2R 3EIHA 4PAMA 1LF5A 2HDNB 2MMGA 2XSZA 3PUYA 2I4IA 2O8CB 1N5LA 1JAHA 1F2UB 3RWOA 1IJEA 4IXNA 2WWHA 4D82A 2ZI7A 1IONA 3CWZA 3T1QA 2QPOA 3P32A 2MMCA 4G5GA 4QFMA 2ZRCA 3AB3A 1HT2E 3IQXA 3LAWA 3KJGA 2ZS7A 3OIYA 2CHGA 3B8HA 2RGEA 2ZYWX 3CW2A 3VU9A 4EFNA 1PLJA 4JL8A 4HUTA 4AG6A 1FX0A 4DRZA 3GLGA 3TGPA 2IF2A 2VSOA 2WTUA 5FOWA 5L3QB 1P2SA 1R7RA 3KXLA 1DE0A 2Z83A 1ONBA 1XFAA 4IOKA 2QBYA 1U8YA 4B3BA 3R9IA 1NMYA 1DAMA 2WKRA 2ZI6A 1G8HA 2AWOA 3EWSA 4D4MA 3WBKA 2J41A 3BJIC 2ZTSA 4DLTA 1Q1EA 1F48A 4JLOA 3DZ8A 4L9SA 4KODA 4YMVA 5GJBA 4UNSA 3QNUA 1R0YA 3V00A 2YOGA 3I5XA 1NBMD 2FFQA 3T5GA 2Q0HA 1FQJA 3GLFA 3WHLA 3T5DA 1N25A 5GJWC 3C8UA 5ANRB 4C2UA 2P67A 1ZNYA 4JZKA 4Q4JA 1HY3A 4JS0A 3PEWA 2BCGY 1G3IA 1KI3A 2QRNA 1RKBA 3A1WA 3Q5DA 3W5JA 1XBTA 2H18A 1SHZA 3B1WA 4NYIR 5TVKA 1HQCA 1PUJA 4Q4HA 1GVNB 4Q4AA 1G16A 2FFHA 3U61B 3EPHA 2XTNA 1SKYB 4WXRA 4ITRC 3R9XA 2DWOA 3A58B 1DAKA 5CJ2A 3ZVLA 3WRXC 2VP5A 3RRMA 1KMHA 2WWXA 1Z0KA 4GI7A 1XJQA 4E22A 3T1OA 5TARA 2TMKA 1TAGA 2AR7A 3VU9B 1E2NA 4XVUA 4HAWA 2V3CC 2O8BB 3N2IA 4I1UA 4TT3D 5G41A 4JL5A 1T3HA 5EJEA 5H68A 4B35A 1Z0AA 3BGWA 3C16C 3VR2A 5FBWB 3FKQA 3IHLA 4GBMA 4PZLA 3EZ7A 3P4YA 2B92A 1BO6A 1RZ3A 2W00A 2YINC 1KO4A 2UKDA 5DH9A 4HZIA 4RD1A 1T0HB 2GJ9A 1D2EA 1YZQA 5FUWA 5JEEA 5FOXA 3ECCA 4JLNA 4G5QA 5FFMA 4ZCLA 3WY9A 4B76A 2XB2A 3C41J 2AXNA 2OESA 4PFSA 3DL0A 4QOSA 3LLMA 1WA5A 2AKAB 4HLUC 5KDDA 1WBBA 2DCUA 2V7QA 4JKYA 4DEXA 1E9CA 1XMSA 2OEPA 5JZVA 4ZKDA 4CRWB 3HU3A 2Q9BA 1ZBDA 2FGKA 2Q3FA 3CH4B 2BMFA 3HR7A 4GOXA 2IXFA 2ZRMA 2RGDA 1MO5A 1ZUNB 1FUKA 2JLVA 1Z3IX 1E3MA 3VAAA 3FWYA 3RS3A 4CEJA 1ESMA 1XTIA 3E70C 3J81k 3N70A 5IK2D 3CF6R 4LHXA 3ZIAA 4EFMA 3E2IA 3AVVA 1TF7A 3PV0A 1RYFA 3QKTA 4F4CA 4JBXA 1R10A 2ZRJA 3L2OB 3BFKA 3EARA 4DLYA 3QKUA 2GKSA 2ZQ5A 4HLUA 1VIAA 2BJVA 1AKYA 3B13B 4MYHA 1LNZA 1OFHA 3HYTA 3TW8B 4GNKA 2GCOB 2NQ2C 2FV8A 2J7PD 3TMKA 3KKOA 1G19A 1N6OA 1ZINA 4ZDIA 1S2MA 2ZYTX 2X19A 1EFTA 1UBEA 3MGCA 2B6HA 3UG7A 5FPTA 5IF9A 1R0WA 1NVXQ 2QU8A 3QKRA 5IK2A 1WDTA 4PAQA 1BOFA 1EX7A 5H1YA 2F55A 5C1BA 2RHDA 3DPUA 4G5RA 3AF1A 3VKGA 1QRAA 2H17A 5JFGA 4ZV4A 1OFIA 5BQ5A 1GITA 2JATA 2C77A 1IAQA 1MABA 1UKZA 3B82A 1DBSA 1CULC 2IW3A 3LV8A 3SYLA 5J4HA 1OH8A 3SQXA 1E99A 1LB1B 3K8YA 5LD2B 2O0KA 4FD2A 5GVRA 4EUNA 4DLSA 2BJWA 2CLCX 5DE3A 1W36D 3FB4A 1QHHB 4NCNA 1NBME 3CNLA 2W2TA 2VP6A 3AF2A 2WJGA 2WVJA 2QMHA 1CR1A 3BB4A 4FMCF 1Z47A 2HYIC 3BAFA 1Z6TA 5DO9A 3TSOA 4DCNA 4MRPA 4PC3A 1NN1A 3AVPA 4M1MA 4C7OA 3MJHA 3PCRB 2ZJ5A 3CF0A 3F5FA 4BRWA 1KJZA 4XSHA 5FOSA 4YMTA 3TIFA 1IBRA 1U0JA 1WP9A 1W7AA 4ILEA 1UEIA 1DVRA 4TSFD 2BBTA 2ZSBA 2ZITA 5CM8B 3U7EB 2QPAA 2F3RA 1T8UA 1TUIA 3EZFA 2ZJZA 3L8YA 1OT3A 3FFAA 4N1AA 2F43B 4CVNA 1A2KC 3LWNA 3EG5A 2P6UA 5FL7A 5JCPA 1ZNZA 3U7FB 4AK9A 1AA9A 1KSFX 1OLOA 2ERYA 3MWLA 2QAGC 2IT1A 2Z5FA 1E1RA 2NZJA 2W0MA 2PEYA 1JPJA 1WCV1 5JWOA 4OI1A 3LO5A 2QNRA 5E3HA 621PA 4JLKA 3ZQ6A 1E2LA 1ZM3A 1Z29A 1RPZA 3W3AA 3QPVA 4M0LA 3ZLJA 121PA 2YOHA 4OYHA 1KI2A 1XPRA 3REFA 2BKUA 1D5CA 3WNBA 4BLOA 2J0QA 1YQTA 4KSBA 1ZU5A 3K9GA 5J4KA 3I3SR 3NBZC 4A0HA 1TQ4A 2PMKA 2ZR7A 3DZDA 3IO3A 2DR3A 3THXB 4D4JA 3BK7A 3DOFA 4NCKA 1X3SA 1NL3A 2QP4A 4I81A 1W2HA 1W49A 4OI0A 2XZLA 3RS7A 1T5LA 2ZRLA 1NBMA 1US8B 4P4SB 4F7WA 2H1LA 3OEED 3B9QA 5JCZA 3PUVA 5GADl 3X2SA 4ON9A 4B71A 1RJ9B 1WF3A 3AP2A 2ODEA 3F0TA 3F3YA 4LHZA 1NG9A 5E7JA 2CLSA 2RGCA 4NYMR 2FE4A 2ZSAA 5JJIA 4V0LA 5BW8A 4A1FA 5C46F 4B2IA 4D0NA 3AKEA 3PITA 4DLXA 3L0OA 4IKEA 1CRPA 3RVBA 4OHWA 3A4NA 3KQLA 2LKDA 4RSGA 3UMRA 2GDJA 4F93B 2QI9C 2IYUA 2OBMA 1ODFA 4PO8A 4KFTA 2W2XA 3KTAA 2FU5C 1ZW6A 2VTKA 2YNMA 4TQ9A 1VCNA 1KAOA 4TZ0A 4TTRA 2CE2X 3FHTA 4Q66C 1ANKA 2G1JA 2GJSA 3QVUA 3KUCA 1TL7C 3U44B 3SN6A 3OIVA 2FOLA 2YJTD 1E1QA 2J59A 1ZAKA 2D2EA 2N42A 4QM6A 1T3LA 5BYKA 3R8CA 3O8DA 5H8WA 3FMPB 4ERNA 2V6IA 2IL1A 1RFLA 1U99A 2B21A 5AJYA 4CF7A 2PJRA 1VECA 4B3XA 3BC1A 4OI2A 4CEHA 1OB2A 5J4YA 1Z6GA 2IYRA 4GT1A 4LK2A 4C9BA 2OAQ1 2FZ4A 1KI6B 2ZUCA 1JEDA 2WAXA 4B44A 3ZD7A 3VR1A 4AKIA 4ZIRA 1Z8FA 3MJRA 1XXHE 5TB5A 2NO0A 1GSIA 3JVUA 4MQBA 3K0FA 1KI7A 1YR8A 4QJ4A 4FW9A 1QBKC 2QZ4A 1T91A 2ZAMA 3ICQB 1H65A 1SVKA 4DSOA 1G6HA 3IBGA 2XTZA 4II7A 4KFRA 3TVDA 4JVSB 2A7QA 2D06A 1Q44A 3KB1A 3D7MA 5KSZA 4ZPXA 1Z08A 2RGAA 2I1QA 4LBZA 4JBWA 4IW3B 1FNMA 3OHMA 2DPXA 4X8OA 3SJAA 1G64A 1WBDA 1TQ2A 3FMFA 3K0AA 5B58C 4R7ZA 3IDQA 5DN6D 4IVPA 4S35A 1F6BA 5AUQA 2Q9AA 1QHIA 4WXPA 1XCPA 1DTSA 3PUWA 4TYQA 1ZU4A 1DARA 3GJ5A 4K46A 2ZS8A 3HU2A 4OKSA 4O3MA 1S9DA 2XNDA 1SXJB 1X6VA 4Q7JB 2JGNA 2XOKD 2FPMA 4AI6A 1S0UA 2VH5R 1DAFA 1IJFA 1G5RA 4K81B 1H8HA 1YRAA 2FEOA 4EPYA 4WW0A 3G0HA 1L2TA 1G8PA 5SZJA 2P0EA 1Z2AA 4Q9KA 1VTKA 5UKDA 1G41A 2ZAOA 1W44A 2A2ZA 3QKSB 2XZOA 4WVFA 5CLLA 1P2VA 2QMOA 4OJKA 1ESNA 1UDXA 5TV2A 4LWZA 2HEIA 2JEOA 3TH5A 1OH7A 2G0NA 4XTRA 1R2QA 1XMJA 2YV5A 1XB2A 2Y8EA 3FE2A 1N0UA 1YRBA 4D2IA 2GJ8A 2FG5A 3AKCA 1HE1C 1P3JA 5J4LA 2RKOA 2YOFA 2IK8A 5DI9A 4DCTA 1GL9B 1BH2A 3BH0A 1VYTA 2D74A 1IOZA 2DY1A 4TLAA 3KTAB 2LCFA 2OBLA 3IPXA 4ABYA 2ZVPX 1QF9A 2ZREA 4IJMA 4IEIA 1AM4D 1LY1A 5C2JB 1CTQA 3Q5EA 3L82B 4OHXA 4BWYA 2ZRKA 3FMOB 3V4FA 3PIRA 2H5EA 2Z43A 4LV6A 3NC0C 2R9VA 1EWQA 2GCOA 4DWJA 1W5SA 4NCJA 4DLWA 3CPEA 3I4LA 1EK0A 2QMUA 4OQXA 2F1RA 3CUEF 3CWQA 2ZRIA 1GNQA 2H16A 1N6RA 1UKYA 4OQMA 3IO5A 5J47A 2GEUA 5L3VA 3CX6A 1Z6XA 3GJ4A 5D3QA 5FL7D 3H84A 5FPKA 1NG1A 3RC3A 4MKIA 1KI9A 3TJZA 3AUXA 2FSFA 2ZI9A 4NU0A 4QNRA 4Z54A 4M9ZA 2VSFA 4AYXA 3EA5A 5FTKA 1Q1BA 2DYKA 3VX3A 4O25A 2O5VA 2GTPA 2HT1A 2RGNA 1I4DD 1L8QA 2BEJA 2KI5A 1QHXA 3CO5A 4NYJR 1OHHD 4BE7B 5CJPA 2V4ZA 1JJ7A 2W6ID 5HE8A 3SQWA 2OO7A 1TX4B 5B2ZA 3UANA 2R65A 3BRWD 1EX6A 4LYJA 2OT3B 3BFVA 1TF2A 3VMFA 4Q1DA 1NKSA 3LXRA 3ND9A 5C4GB 1XX6A 3IEVA 1D6JA 4ZI3A 1K8RA 1KZ7B 1RYHA 4B43A 1P62B 4D80A 2OILA 3FTQA 4OI4A 1BS1A 1SULA 2IYLD 3GFOA 1QDEA 5CK5A 4BRUA 2FH5B 4KVGA 3GJXC 2YWGA 4JYBA 2X8AA 4URYR 4HAZA 4PXAA 4RJLA 2REBA 2JLUA 4C0JA 1WRBA 3EZ6A 721PA 3K9LA 2VO1A 5DN6A 4YONB 3NDBB 2CBZA 3RDPA 4C7OB 1IQPA 1ZUIA 3X1WA 2ORWA 1CR4A 3ND8A 3FHOA 3PEVA 3KQUA 3WRYC 4O2RA 4N3NA 2GXSA 1CJUC 2J0UB 2ZUBA 4E09A 1EFHA 1KO1A 1KK3A 2OZEA 2VA8A 1VHLA 2ZR9A 2ZJ8A 5A4JA 2WSSD 4PQRA 2ZYVX 4ARZB 3GEHA 1MOZA 2JJ8A 2IYQA 4LBWA 4LJ9A 4Z1MD 5FOUA 4JKIA 4Q01A 4BLTA 3TKLA 1OXTA 2ZYUX 4OJQA 4YC7A 2EWWA 4E07A 1Z2CA 3CB4A 4NDZA 2XX3A 4NYJQ 4RCYA 3RSOA 3ZZUA 1PUIA 1UBCA 2V1XA 4IOJA 1T3SA 3QKRB 2GJKA 2XXAB 3SFVA 4DXAA 1P73A 1OHHA 1NN0A 4YDSA 2P3SA 3CBQA 3CKLA 2C2HA 1R5BA 3EXAA 4DT1A 4IEEA 1E2QA 4B75A 5EUQB 3SR0A 4HUQA 4OK6A 4OK5A 1AS2A 4QGHA 2NPFA 5K8IA 3GLFE 4KLZA 4UKDA 4JT2A 1NMXA 4MKFA 4R98A 3X1YA 1QZXA 2QL6A 3VKHA 4C0HA 3FKSA 2O8FB 2CCJA 3IGFA 2IYVA 2QBYB 2PBRA 4B6FA 3DEFA 5BWMA 3GLIB 1KI8A 2GXUA 5L3QA 2QM8A 2PCJA 2WIBA 3CRW1 2W58A 3WYGA 2IYZA 1FX0B 2X77A 3MUFA 4YMWA 1OB5A 4Q7KA 4AKHA 2ONJA 3L0SA 2IXGA 1Q22A 4IVRA 2C9OA 4KITB 4LC1A 2IEYA 1FPMA 3GFPA 2C9CA 2G1KA 2EWVA 4OQLA 3GJ6A 3RC8A 1ZJ6A 3LY5A 4AURA 2YHSA 4LV5B 4TL6A 5JWHA 2O8FA 3R20A 3AVTA 3WYAA 521PA 5EZ5A 5E7MA 1F2UA 1LS1A 4MA4A 4XVRA 1N5JA 5GJCA 3SJBA 3T12A 3X1DA 2VPPA 2OSBA 2WIAA 4EIWA 4DT1B 1G3MA 1G9XA 1R4AA 1Y3AA 1G8FA 421PA 4DDVA 3U5ZB 4PC6A 2SHKA 4DCVA 1XD2B 5TY0A 1KJWA 3WYFA 2G77B 4HLDA 3OIWA 4DUGA 1TMKA 2VP9A 3B78A 2XXAA 1E2DA 4NTZA 1GWNA 4A6PA 2ODBA 1GNPA 1L4YA 1E0KA 4L15A 1U8ZA 4M1OA 5KUTA 4A0FA 4BFSA 3GLIE 3TUIC 1OXXK 2OLJA 1E9FA 1KSJA 4PHFA 2WJIA 3ZGXA 1RC8A 3V9PA 4BFUA 2IBMA 5J5CA 1A4RA 1Y63A 3ZDQA 2JLXA 1Q1QA 5EXPA 5LPNA 1AKEA 4XSGA 1VG1A 3UWKA 2CE7A 1BKDR 1MO6A 3CIOA 1EESA 1W4RA 1YZGA 3HDTA 4XD7D 1KMHB 3A36A 4G5SA 2IUSA 2CXXA 4BUJA 3U3MA 4ZCMA 1KO7A 2DFTA 4QGAA 4LJYA 2IA5A 1A2BA 3AVUA 1S3SA 3EASA 4ESHA 1ZD8A 3WNDA 4GDFA 1YHNA 2C96A 1DS6A 4TWZA 4LSGA 1UF9A 2YVUA 1J70A 3NC1C 2YWEA 4HAYA 2IXEA 3H2YA 4IDNA 1DEKA 3MLEA 4Q4HB 5DIFA 3DVLA 2VHQA 1DO0A 3KQHA 2Z6VA 2RGBA 1GILA 1IN8A 4JIMA 3ADDA 2OCBA 4IOLA 1DAGA 4N0DA 1E2IA 1W36B 2FF7A 1Q3TA 3KXKA 3QXXA 2J7KA 4W5HA 4LPKA 4UNQA 4QM7A 5EP3A 2BOVA 3SJZA 3OEEA 4DDWA 1JR3D 2NO7A 3GJ8A 3K0AB 4PSVA 2QAGB 4HB0A 4NE2A 3U7GA 4PSAA 3R7WB 2MSCB 3OE7A 1U9IA 4TMWA 4GL2A 2ZPTX 3HWSA 1E0AA 2CEAA 4FCVA 4G1UC 3UXMA 3WBJA 2ZJBA 4PTLA 2WSSA 4FCTA 4MGIR 4A0RA 1I4TD 2C03A 3CX8A 3PVSA 1NIPA 4AKGA 3ZZ0A 3A1TA 1EG7A 4P32A 4US1R 3CPJB 4CT4B 4DZZA 2EQBA 1XDBA 1QHGA 1GL7A 1G20E 1KI6A 2C95A 1GIAA 3KFXA 2PT7A 2WOOA 1TTTA 4Z8XA 2O0HA 2A78A 1XTSA 3AGPA 3AV0B 1FUUA 4M53A 2OXRA 5L3RA 1CRQA 1FNNA 2NPIA 3MG9A 1F60A 4X8MA 2ZVQX 2G6BA 2Q3HA 1HUQA 4GPTA 3SS8A 3A1UA 1G3RA 3C5CA 4JVMA 1K6MA 1U0HC 5FTLA 2JJ2D 2ZS9A 3QIAA 1GKYA 5C18A 4RD3A 5EE9A 1Q57A 2ZM5A 5CIWA 4GFDA 3MSXA 5HZHA 2HUPA 3WP1B 2GVDC 3QF7A 4BPBA 4PPFA 2GZHA 3ZIAD 4BFXA 4IDPA 1X8LA 2GILA 4AWXA 1CKEA 3SYKA 5FBQB 1RRGA 5DNYB 1N3BA 2FN4A 1MO3A 4AC9A 2IHBA 3GLHB 5J40A 2CCKA 4O0MA 2OCYC 3EC1A 2C8VA 1G3UA 4Q21A 3P1JA 2EFGA 3KX2A 4FMDB 4URZR 2NIPA 3EPKA 5G40A 3A4LA 1N6NA 3H1TA 2BCJQ 4HZUA 2GEVA 3QY0A 2OM2A 3PFIA 4U02A 3VQTA 2WKQA 4RCZA 1II9A 4TMKA 3ADBA 1G17A 4JSYA 4KBFA 5SZKB 4JJZA 3THYB 5K8UA 3DKPA 1TF5A 4F4JA 3U3RA 1SVWA 4BZXA 4DEYA 2P5TB 1US8A 3GCGA 3T1VA 5LDDC 3KJHA 1K5DA 4M8NE 2IYSA 2QMEA 1M74A 2IS1A 3CRQA 1E0SA 3EW9A 1GNRA 4NL4H 2AD5A 1X86B 3TR5A 1XEWY 4X8HA 1FTNA 1COWA 2ANCA 2F6RA 4GP7A 1R8SA 2ODNA 1VKJA 1E79D 2AXPA 3VHXA 4LUCA 1OSNA 1YE8A 1J8YF 4FMCB 1E1RD 5KTYA 3LBIA 5FTMA 3B1XA 1KIMA 3TVTA 4A2PA 5HKKD 1NF3A 1NY6A 2HF9A 2IYXA 3W6PA 1YZNA 2P2LA 2W83A 3Q3JB 4IDOA 3SDZA 1CS4C 3BOSA 4AKEA 4E03A 3FDIA 1OIWA 1N6PA 4F4IA 1FFHA 1XP8A 3MWJA 3VKWA 1M34E 1NLFA 5FBVB 2P5SA 1XEFA 4RY2A 4FI3C 1W1WA 1DOAA 5FPYA 1SXJE 4QGFA 1CR2A 3K0FB 3I61A 5IDVA 4KV9A 4QHTA 1XPOA 1JAIA 4GMDA 1OW3B 4UXIA 2O8EB 2AX4A 1NJGA 4QHYA 2ORIA 4MRRA 4DDTA 4G3XA 2QQEA 4M4SA 4Q4LA 4MGZR 5L3SA 2NO1A 4LYFA 1CJTC 1JNYA 4C0KA 4A36A 2ZRHA 2BV3A 2OE2A 4KFUA 3TW4A 5LB2A 2V1UA 2FEMA 3G82C 5B57C 5B30A 1ZCBA 1JALA 2C5LA 3PG5A 4O2LA 5AUNB 3ZVMA 2VHCA 1Q1ZA 1ZRHA 2HF8A 4M1SA 4RZ2A 1JR3A 4PC2A 2DFLA 3AVXA 1HURA 1GDDA 4MRSA 1J90A 4JLBA 4V02A 4HLCA 4DHEA 3ICEA 3LX5A 2KBFA 3BH6A 3H86A 1D8TA 3FVQA 1HH4A 1W0KA 1MABB 2KBEA 4YLGA 2DWPA 1VCMA 4DKXA 4B48A 1H8HD 2CJWA 4LBVA 5FOVA 1T9HA 2PL3A 3QUSA 1ZCAA 1JR6A 5FL3A 1GTVA 4KFSA 2C78A 2OFXA 4ZCIA 1XWIA 2XOKA 4KHZA 2DWQA 1OV4A 2UVQA 1U2RA 1FTSA 3QQ5A 2EYQA 2F1HA 4LYAA 1AZSC 1GRQA 4MKHA 4EJSB 4I4LA 4DDUA 3I73A 1M8PA 3EWAA 3MD0A 1XEXB 2ZJOA 1XMVA 3AF0A 3AEZA 3GEIA 3GFTA 2GK6A 4LC0A 5KO2A 3KKQA 4RFSB 2BMDA 1XZPA 1N0WA 3IKJA 1TADA 2PCLA 4XVQA 1YR6A 3N5CA 3NH9A 2XB4A 3HYRA 1KDRA 1UBFA 1D2NA 3JVVA 4NYIQ 4BQSA 3V4RA 4NBSA 3A4MA 1TPZA 3KQNA 2F1IA 1UFQA 1EGAA 1E9BA 2OUKA 2YZ2A 1XNJA 3K9HA 4XH9B 3P20A 1U98A 4QXAA 4MUBA 3X1ZA 3FFBA 2FFBA 3JZMA 3W3ZB 5CB6A 1QG4A 2QTVB 2QT0A 3ZVNA 2W6JD 4LBYA 2C99A 3EIEA 821PA 3B1VA 3QOFA 1G6OA 2J87A 1TU3A 4D6PA 4UXJA 3DOEA 3THWB 1CEEA 2IYYA 3PJRA 1E79A 2D2FA 1QHNA 1CIPA 1E2PA 3SI7A 2QORA 2VF7A 3W9YA 4CGZA 3U3JA 4A9AA 1DAHA 2VEDA 4HAXA 4MITA 2BKEA 4Q9JA 3CF2A 1EFCA 2QAGA 2B8WA 4PZYA 4WAUA 3H0KA 1DG1G 1AQYA 1G7CA 3AVOA 5G3YA 3TAHA 1VG8A 3OFNA 5JECA 2CK3D 2L0XA 2EFCB 4BLQA 1WQ1R 5DI3A 3AKDA 5EUMA 2DHRA 2XJ9A 3C4JA 1I2DA 1QVAA 1XTQA 2IS2A 4PHGA 4Q1CA 3FPAA 2O8DB 4EQ6A 1HE8B 1CU1A 2OXCA 2QA5A 5AUOB 3NDPA 2XNDD 4D25A 3ZH9B 4LY6A 5EE1A 4D0LB 4QKQA 4LHWA 3W8NA 3FKSD 4G0NA 5SZIA 5G53C 3T35A 4ARZA 2GRJA 4HI0E 5EXXA 1I4LD 2BM1A 1P9WA 2GCPA 1UAAA 3L43A 4ZKEA 2O8BA 1XPUA 5FUYA 3BORA 3D31A 4IDQA 2F3TA 1IM2A 2AWNA 2AL7A 4V0MA 3CLVA 2PH1A 2W0SA 1QHHA 2BMEA 4XWAA 1NN5A 5KYKA 4US0R 3SU8A 3TQFA 5HCIA 3W34A 4FMBB 4NH0A 4Q4AB 4URWR 2G9NA 1E2KA 4M1TA 4Q48A 2JJ1D 4DLZA 1CP2A 5CITA 2IWRA 1UDWA 4TZ6A 5KPJA 4OQFA 1AIPA 2GXAA 4HSEA 1ZC3A 1EFRA 4B3DA 5BN5A 3QG1A 2AN9A 2OAP1 5E95A 2VF8A 1W4AA 4D26A 3S1AA 1P5ZB 2ZRFA 4M9SA 4W5JA 3RS2A 2HJGA 1F3OA 3K0EA 4M2LA 3NTUA 2OHFA 3GQBA 4Y0VA 1VCOA 5D3MA 3MWKA 2PT5A 2J1LA 4KXFB 5F3WB 1TEXA 4Q1AA 5CIQA 1YJ5A 5EQTA 3RRYA 1NY5A 3AVYA 8OHMA 3TUJC 2FSIA 3OESA 3EX7C 2HJVA 4PC7A 3JZAA 3LDAA 1NI3A 4RVCA 2GBLA 1SKYE 2WWIA 1YKSA 1OYYA 2IUTA 4JLAA 4RZ3A 2PLFA 5F98A 3WHKA 2PLRA 1DELA 1EWRA 1OFUX 2XEXA 3B5JA 4J0QA 5KDOA 4RD4A 1GAJA 3K0CC 3REGA 3GLGB 2ZRDA 3LBHA 3HPRA 2JJ1A 2QQ0A 5J4VA 4QJ5A 1E2EA 2E1RA 3TRFA 4D0GA 5JHHB 5JI3E 3GLIA 2FA9A 4GP6A 4HB2A 3QBTA 2PZFA 3ZVRA 3DDCA 5G3ZA 1VIYA 2J3EA 4I1OA 1ZD9A 2N46A 1ZVQA 3W6NA 1GG2A 2ZROA 3TR0A 2RH5A 1E9AA 1ZMXA 3SYNA 2QGNA 4PO1A 4H1VA 3UIEA 4JLJA 2VP2A 2GETA 3IHWA 4LGMA 1HQYE 2ZETA 3THOA 1KSHA 4XOIA 5FPHA 5IRCD 3U60B 2VHTA 5CDFE 1E69A 1LV7A 4D81A 4Z1MA 2F7SA 3Q7PA 3I5YA 1R0ZA 3IILA 4OK3A 3KKMA 2VQSA 1CBUA 4C0BA 3I62A 5IT5A 5KPDA 1ZIOA 5HR5A 1E32A 2V7QD 2A3RA 4TLDA 4GZLA 2VP0A 2FSHA 2KB0A 3QXJA 1D9ZA 1G8YA 3B1ZA 3ZS9A 1N6KA 4PQFA 3EAQA 4M22A 4D4LA 5HZKA 1IN6A 3L0PA 1W0JD 2WHXA 3QPUA 2IF0A 1KY2A 1NVWQ 2NZ8A 4Q19A 3CNNA 4RKEA 2ZU0C 4UJ5A 1SXJC 1SZPA 2J0UA 3T06B 4M9XA 2IC5A 2ZI4A 1E4YA 2GZAA 1Z22A 4HDCA 1PVOA 3D3QA 4C4PA 1WXQA 3SNHA 4A92A 5LB4A 4TT3A 1AZTA 3FYHA 1MH1A 1L7VC 1G21E 1NP6A 1SVLA 3PUXA 1Z6AA 3RAPR 1UPTA 1XCMA 3RS0A 4G01B 2ZI3A 4W5WA 4E5UA 4V0NA 1M2OB 1Z0JA 2NTYC 3BB3A 3VFDA 4PHHA 2ZSEA 3QEOA 2XZPA 2ZIAA 4CT5A 2O0JA 4DC9A 4L5BA 3LRPA 3S1AB 3E5HA 3LVRE 3LQRA 5JEDA 2WPDA 1KNQA 3AF4A 2GHIA 1R8QA 4L9WA 3BFXA 3U2QA 5K8LA 3LNCA 4URUR 5FOTA 5FUXA 1NNEA 3OEHA 2DFKB 2NMVA 2XITA 1G7TA 4LJ5A 1M7GA 2QE7D 5BXQC 4FWIB 3ZD6A 1OXSC 3LW8A 4KU4A 3UG6A 1BYUA 4KBGA 2CCGA 4C30A 1XMIA 3QENA 1AS3A 4XWOA 1HEIA 3OFND 3ONWA 3NH6A 3U4QB 2R6CA 3RRNA 2PJZA 3K09A 2ZJ2A 4MH0R 3ASZA 5EP1A 1X1RA 5C4MA 1IY0A 2EFHB 4S2EA 1OIXA 5DYIA 2BMJA 2PZEA 5HE9A 1Z5ZA 1ZM2A 2O8CA 1ZP6A 3QXCA 4JMPA 4MGKR 1FMLA 3MRSA 4OHZA 2V55B 3SC3A 3DMNA 4EJSA 1B0UA 4Q9IA 4Q18A 2AK3A 1E9SA 2H7VA 1YR7A 3RS4A 1P9RA 2JASA 3RANA 5DISB 4MKGA 1G291 5E7IA 1T6NA 2AK2A 2RB4A 3EZ2A 2WAYA 5KNBA 4LRWA 4Q47A 4YDHB 2A5DA 4PPNA 2ATVA 1Z0DA 4BFZA 1FOEB 2QTHA 4KYIB 3KKNA 4FWTA 1QG2A 4BFVA 1RVDA 1LW7A 3MCAA 2GXQA 1IY1A 4NPHA 1Q3HA 4NYMQ 4Q7MB 1J7KA 2ANBA 3LFUA 1UBGA 2J9RA 3OF5A 1GKUB 4RD2A 4BLSA 1XTRA 3IPYA 1DAIA 4HEJA 4WOPA 4DSTA 1SVMA 2VBCA 2ZEJA 4D4KA 1XEWX 2VSXA 5JLJA 3AH8A 1OJLA 2J5XA 4GMXA 2OG2A 4P4SA 4IRUB 3B6EA 2HT6A 1SVIA 4UNPA 4Q1BA 1LFDB 4TMVA 5KU1A 3THXA 5FUVA 4IHQA 4LPSA 1ZM9A 3LXXA 2RGXA 4RZXA 2O8EA 2AKYA 2VIIA 4RFSA 5CB8A 2QG6A 2VHJA 3BS4A 3MMPA 3LBNA 1OYWA 1XEXA 4BFYA 1H8EA 2H92A 2YKGA 4LJ4A 1W4BA 4TYWA 4MGYR 5EXSA 2J0SA 1YVDA 4RFVA 5M04A 3RWMB 1R6BX 1P61B 5EXTA 5FBLB 3TBKA 4DVGA 3QSYA 1CR0A 3VNVA 3BD9A 1S8FA 1I2MA 1KO5A 3HU1A 3WP0A 3CONA 2A5FA 1G3QA 3K1JA 2ZSFA 4HDQB 2OLKA 1NLYA 1Q21A 2GK7A 3VX4A 4AG5A 3KDSE 3QG5A 2O52A 4KCGA 2R8RA 2KWIA 3A6PC 1NMZA 3RNLA 4NHOA 4ZIRB 1VCIA 3KB2A 5TXGA 4KAXA 4BFTA 1E2MA 4HYYA 3NBYC 4Z51A 1W46A 4WZAE 1SXJD 1WMSA 2PEZA 4CEHB 3Q8XB 4W9MC 5LBIA 2GZDA 2ZUDA 4EFLA 3AKYA 2WMNB 1P2TA 1S1MA 1E9RA 1BYIA 2QAJA 5L3SB 2G3YA 4OHYA 2R44A 2HCJB 4TYPA 3THYA 4JLPA 3CR8A 3AVQA 4DIDA 3CRVA 2OFWA 4PC1A 3QF4A 2IWHA 1EXMA 4EPWA 3NG1A 5AWFC 2JLSA 4LOAA 5JMTA 1C1YA 2XGJA 2YWFA 2JDID 1E96A 1A7JA 2GJAA 3SOPA 4B6EA 4BZPA 3U3KA 1CJVC 4EAQA 2W6IA 2D7CA 3DM9B 1E9DA 1YU9A 2ERXA 3EC2A 3HPQA 4F91B 2D7DA 4P33A 1QVRA 2FGJA 2QT1A 5DYGA 1PLKA 2A5YB 2VLIA 4JSTA 1JR3E 1T5IA 1IXSB 4EKDA 2QEQA 3QVVA 2ORVA 3DMDA 4W7SA 1PV4A 1E6CA 1YR9A 1NIJA 3OZXA 4UNRA 3LX8A 1ZNWA 1FP7A 1RJ9A 1V5WA 4CDGA 3Q9LA 4A2WA 2HXSA 3GJ0A 4KLNA 1E2JA 2Q6TA 3L8ZA 3BH7A 3B1YA 1HTWA 1W48A 3PUZA 4Q03A 1P6XA 1JXMA 2RCNA 3K9NA 4PPGA 3WXMA 4ACBA 3TQCA 4TYNA 4B3CA 2WPDD 2XTMA 3ADCA 4V0ME 3QXSA 3UWOA 1L4UA 2Z4RA 4DIEA 3IIMA 1X8JA 2ZI5A 2R62A 4HATA 4POAA 1QHSA 4R2IA 4YXWD 4LYHA 3LH5A 4NCIA 5EP2A 2JDIA 3BXZA 4V03A 1IN7A 4Q9HA 3W5IA 4CEJB 1W4CA 2Q9CA 1EFUA 4HZUB 4N0EA 2BBWA 1JB1A 2B7CA 1CJMA 3ZZTA 3TSZA 1E9EA 4YQFA 1G8GA 3UATA 4Z8YA 3C15C 2EFDB 3AM1A 2C98A 4CW7A 2ZE6A 1XRJA 5KNCA 3W90A 2CL6X 3UMSA 3QJYA 3WMFA 1UJ2A 221PA 2XNSA 3R7WA 1NJFA 4KJZA 4M1WA 5FR2A 2BVNA 2WJVA 4QBGB 5HCNA 1W36C 4P3YA 2A30A 2D4HA 5F2EA 2AFIE 3HP1A 1X1SA 3AP1A 4NCHA 4IFEA 3KJEA 4IDHA 4KVAA 1NVVQ 1YZTA 1RE0A 1XJ0A 1J8MF 4M9QA 1FZQA 3WMGA 2WWGA 2WICA 1JQJC 1KI4A 2BIFA 1E2GA 1KO8A 4QL3A 4ESVA 2ATXA 4PSKA 4FCWA 4TL7A 4P0TA 2WJJA 2W2VA 4V0OA 3AUYA 3SFZA 1JPNA 5JJLA 4UJ3A 4MYTA 4I99A 3D8BA 5JJKA 1UKVY 2FPLA 4B2PA 2B8TA 2BBOA 3VR5A 3B9PA 2ZRPA 3QBVA 1NLZA 3U4QA 1D9XA 2OCAA 2V54A 3AF3A 1NVVR 2OCPA 4RZUA 4B74A 1KZGB 1N2CE 4X8LA 1W5TA 5JI2E 4LJ8A 4Q9LA 5BN4A 1P9NA 4MUAA 1XXHB 4LDJA 5JSZA 4DCSA 1AS0A 3CRRA 6Q21A 4EPRA 1MRSA 4PHTA 4MDFA 4JJKA 2ZRNA 1XTKA 1MO4A 1E1QD 1VYVA 2WJYA 5E4FA 4K8OA 2ZRGA 1AJEA 2W6JA 4CYMA 2E87A 2WWYA 3FHCB 4MRVA 4TLBA 4HAUA 2CMKA 4FINA 4GOJA 1VDZA 3CZQA 4MYUA 4NP6A 3GLFB 3VNUA 1M1YE 2H57A 3M1IA 3GEEA 1TEVA 2HCBA 2ZSDA 4HLQB 4AIIA 1P7CA 5TMPA 3VR4A 4BZQA 1OH5A 3T34A 2HYDA 1II8B 1R5OA 3KKPA 4RKFA 5A0FA 4C0SA 2JAQA 1XD9A 4DB2A 1ZC4A 1E2HA 2GNOA 2JLRA 3X1XA 1A5TA 1OF1A 3I8SA 3VTKA 1RW4A 1UM8A 4EDHA 4BASA 4A8JA 1OXVA 4ZO4A 1KK1A 1N5KA 3T1TA 1C4OA 1JECA 2IYTA 2REXB 1GFIA 3PXGA 3O8CA 4KO8A 3RSLA 2QN6A 2X2FA 5KNDA 2Z4SA 3CRMA 4WBSA 2EW1A 5KSPA 3UKDA 3WMEA 5JRJA 1II0A 3NHBA 4ZDKA 2WBLC 2WZQA 3BBPA 2R6AA 3LD9A 4HUQB 1DO2A 1KKLA 4PZZA 1P75A 3RYTC 1HV8A 4PX9A 2JCSA 5B64A 3U6BA 2CNWD 2LKCA 3CZPA 3CM0A 4XTCS 4YMSA 1VMAA 4B3FX 3U6KA 3BB1A 3SHFA 4UXHA 5JS7A 1OKKA 3SBEA 1XD2A 1OXUA 1S4QA 1GRRA 5FPSA 4MDEA 3NKVA 5DHAA 1GL6A 2QROA 4U5XA 2GF0A 2A9KA 3CX7A 3ETLA 2WJHA 4JVNA 1YZUA 4V0KA 5FR1A 3Q85A 3MFYA 4QBFA 1X8KA 3ZS8A 3GP8A 4XIGS 1LF0A 4NKRA 2D62A 1LS6A 1LTQA 4JLMA 3M0EA 4BLPA 2GEDA 3GJ3A 2VYFA 3IIKA 4JLVA 3G5UA 2VHUA 3KL4A 4NZYA 5P21A 2CL7X 3P26A 1AN0A 4WIAA 4C3ZA 2BBSA 3CPHA 3U3OA 1U94A 4PANA 4GRAA 4P4TA 1UADA 3BE4A 4DSNA 1AK2A 2GVZC 1G5TA 1G4AE 2QM7A 4RD6A 1ETUA 5GJVC 4PQYA 4HB3A 4DCUA 3M6AA 4MRNA 2OFOA 1KMQA 1BMFA 4LZZA 4TMZA 1UEJA 3MAAC 3NEYA 2FX3A 2IYWA 1ZD1A 3K09C 4KSCA 2R6FA 2WMOB 1XF9A 1JEEA 4BEJA 5JHGB 1NSTA 1Z28A 2D3WA 5BYJA 2P6RA 2RHMA 4ACAA 4B3GA 4JVLA 4YMUA 4JT4A 4Q4JB 1JJVA 3GJ7A 3RRZA 2IEZA 4OHVA 2EVWX 1MR3F 1OPXA 2V8OA 1GKIA 4M1KA 4LHVA 1ELOA 3LVQE 3A1VA 2RGGA 1VPLA 2XAUA 2CDNA 3T61A 4QC2A 1DADA 4QJ3A 1U8AA 1W0JA 1XTJA 2JIZD 4EPVA 2WSMA 2GA8A 1RRFA 1RIFA 3C7KA 3VHLB 2KSQA 2GAOA 4BLRA 1WE2A 1UKEA 1M7BA 1DPFA 4C0QC 3LLUA 4CIDA 3SBDA 2VRWA 1XXHA 4FIDA 4A6XA 3KXIA 2RMKA 4GOKA 1KK2A 3NWJA 5AR1A 1KK0A 1KTVA 3KUDA 4QRHA 2BHRA 2Z0MA 5FI1B 4A82A 3OEHD 3K0SA 2J45A 2FPKA 3GMTA 1KDPA 2C9YA 2GBLC 4FXPA 1TUEA 4Y0AA 1NKTA 1AQUA 1OE0A 1W0KD 2ZE8A 1AGPA 1COWD 3TSWA 4ZI2A 5KSYA 4Q1EA 1KSGA 1YZLA 2P65A 4U00A 3K0CA 3MWYW 2QSYA 1IHUA 4TLEA 4TTQA 4B2LA 2ZJAA 3NXSA 3GLGE 4A15A 3L0IB 2DB3A 2DBYA 3N2EA 4B73A 4Q00A 1Z07A 2I3BA 3TLXA 4EQ6B 2O8DA 1Q12A 2F9LA 1NSFA 3K70C 2BWJA 1FQKA 1SGWA 4KYUA 5L8VA 1DG3A 2PX0A 3EPJA 1DAEA 1CJKC 1G1MA 2CL0X 1U9IC 2ZU6A 2I1VB 4DLRA 5ELXA 5HKKA 2GWHA 1KGDA 1R0XA 4M21A 1IXZA 1MKYA 1M7HA 3BIFA 2PZGA 2FNAA 2BM0A 2NOAA 2OBNA 2BDTA 2HXYA 4I1VA 1E94E 4PR0A 2J46A 2V6JA 2JLYA 4LJ6A 3CR7A 2G83A 4B47A 3THWA 1KAGA 4DJTA 1J99A 2AFHE 1RRCA 2ZXUA 3Q72A 4QNMA 3VR6A 3ZJYA 2IX3A 2GF9A 1E4VA 4QGGA 3RHFA 2X2EA 3M4YA 1S96A 3O8BA 1VG0B 3OIUA 4LJAA 3KZ1E 1HT1E 4TLCA 3QI2A 4TTPA 5A5GA 4A8JB 4TL8A 3KFVA 1ZUHA 3B60A 2WWFA 3R9WA 2AHOA 4DLUA 4HDOB 4EPTA 2NG1A 3NEJA 1KDTA 1V43A 5FBRB 2K5UA 5F9HA 2QY9A 4TMTA 3HJNA 1II8A 2CVFA 4R71A 5GVSA 1N0VC 1P60A 1SXJA 1F2TA 5FI0B 2EYUA 4R9UC 4TSFA 4AYTA 1GRNA 1K5GA 1D2MA 5D3MB 5DSZA 5KHOC 2KJQA 5EP4A 3TUZC 3D6TB 1E0JA 3LW7A 3NBXX 4B34A 5HPYB 1KDOA 2R2AA 3EZ9A 4XJXA 5EE3A 4C0LA 1PZNA 4QBIA 2CHQA 4DBLC 2ZJYA 4P4UA 2ZRBA 1ZYUA 5EE5B 2C04A 2JJ2A 5JS8A 4WZBE 1GP2A 4TYYA 2CJWB 3AP3A 4CEIA 1TU4A 2UZ3A 4QBHA 2F1JA 3O8RA 2G88A 1NRJB 3CNOA 3I1FA 4TQUS 1T8TA 3AVWA 4DB4A 1GOTA 2YC4C 5JSZB 1IN5A 1W47A 5FH9A 4ZDJA 1U90A 1W2GA 3QEJA 2YWHA 4B33A 3QF4B 4UNNA 2FFAA 4PAOA 4CZ2A 3A1SA 2CK3A 1TQ6A 1N6HA 1Q0UA 5AJZA 3QKSA 2G0TA 3NIBA 1G7RA 4MYCA 4BGDA 1PLLA 3FMIA 1CLUA 1Z06A 4A2QA 3PEYA 4LHYA 4EPXA 4KI0A 4TN1A 3K70D 1F5NA 4JBYA 1S9HA 1MV5A 4JLDA 2JA1A 3FGNA 4FN5A 2NO9A 3EA0A 1EFRD 1U0LA 5AJVB 3WNCA 3QPWA 3IUYA 3U7HB 1P4SA 2A5GA 2RAPA 2QGZA 1SVOA 2FWRA 2EFEB 2ZANA 3I72A 4OQNA 4URVR 1Z6YA 4R2HA 2REOA 4TMXA 3TNFA 3ZYCA 4DLVA 4PO9A 5DI3B 5AJXA 1JXOA 5EE0A 4URXR 1BMFD 3HR8A 1KYIA 2FZLA 4IXMA 2IUUA 1Z83A 1G7SA 4GSYA 3SJCA 1B23P 4A0GA 3DHWC 5AK0A 1HA3A 1J2JA 1VHTA 1H8ED 5FTJA 1Z63A 5AUPB 2QP9X 1IY2A 4XWKA 1JQLB 2QRZA 5CDFA 3C5HA 4LI0A 2ASEA 2WKPA 2B7BA 3SHWA 1PJRA 1RRPA 4BEBA 4F38A 3PENA 5LD2C 1FP6A 1CXZA 2UZIR 2ONKA 2V9PA 3C14C 2FMXA 3B85A 3PEUA 1XU4A 1KNXA 1FMJA 1KOFA 3RABA 1XJCA 5F9FA 1VYUA 1F2TB 3DM5A 1OH6A 1Z0IA 2ZR0A 1NN3A 2CHVA 4NONA 2Q21A 2MSEB 2QE7A 1SHKA 2KE5A 4WZ6A 3RLFA 1XCGB 3QXHA 1KI1A 1O87A 3A37A 2HV8A 3GPLA 1TNDA 4TQAA 2XSZD 1A1VA 1ZM4A 2CNWA 5HTKA 1IXRC 1ZIPA 3PR1A 3I92A 2RGNC 3UPUA 3P27A 2WM9B 4IOMA 3I8XA 4I1SA 1C9KA 2XJ4A 5IHPA 2NGRA 1ZNXA 3ZQJA 3U44A 1FW6A 2HLDA 1KY3A 3SZRA 3B7GA 4G5OA 1GZSA 1GM5A 4DUGD 3CH5A 4HB4A 3IEUA 4EJSC 3OAAD 2CLDX 3GLHA 4TL9A 4LX0A 2ZE7A 3O47A 4WA7A 1KHTA 2JLWA 2P6NA 2YC2C 5FTNA 1O3YA 5BN3A 1P72A 5KDLA 1SVSA 4IVQA 4L4UA 2LWIA 3H4MA 2IHYA 2F43A 1U81A 1SQ5A 1LVGA 3IBYA 4U7DA 1AGRA 2EU8A 3IQWA 4LV8B 4BFWA 1G4UR 3IIJA 2OV2A 1N6LA 2NO6A 4AYWA 2F9MA 3SE0A 3BWDD 4L16A 4M1YA 4QHSA 2BC9A 3NVAA 1Z0FA 4LJ7A 3GD7A 2QP3A 1JBKA 4IFBA 2DFNA 2QTFA 3K53A 2GAAA 3PQCA 1TQDA 3EIQA 5CLQA 2GCNA 4GZMA 2QSZA 4F92B 5TDHA 5JRZA 3OAAA 3UMFA
chains in the Genus database with same CATH superfamily
4KPUB 4RHYA 3VTAA 2O2IA 4QXRA 3A9VA 3WLQA 4D4GA 1QONA 5FTWA 1OFTA 3UHAA 2J9GA 4FKMA 1R5NA 4L02A 4ENVA 1UUFA 3HB5X 3KV1A 5IDYA 3J81A 2FDCA 3NM4A 2XADA 1DJPA 2B94A 4GM1A 3QPDA 4YWJA 3TAUA 2JK1A 2PFSA 3CLRC 4BNYA 2ZAGA 3HCEA 3GRYA 4MNTA 1Q0TA 3KJIA 4GI1A 1NNUA 1A82A 1TLLA 2FQXA 4I5DA 4P36A 4EH1A 1JI0A 1JKJB 1OV6A 3FLMA 4IQ8A 3I32A 3LO8A 1MT0A 5H70A 3UZUA 3PQ4A 2J9FA 4PRZA 1O08A 2H4FA 2PMDA 1H1TA 3E61A 4LCBA 5AJTA 3HP7A 4R6WA 3W77A 4AD8A 1KJYA 2DQYA 1KPHA 3FTNA 4YJ2A 3DZFA 1V4NA 1LDMA 2FJUA 2PX3A 3KC2A 5CYPA 4QT4A 5EZ6B 5AVXA 4B45A 2ID4A 2X0RA 1HDRA 2BN4A 3AQ4A 3IOMA 4PSCA 3KCQA 1F51E 1Y82A 4Y2RA 4H2DA 3OE7D 5AYVA 1ZHOA 4DREA 1WAMA 2B1IA 1XTPA 3P5BA 2WMYA 4AY2A 2Q07A 3DE6X 1OAAA 4RGQA 1FDWA 3QFCA 3LT5A 1CF4A 1WUKS 3KJXA 4OBEA 3K70B 1CD5A 4B32A 5LPNA 1DU4A 1SC1A 1T3ZA 1BX0A 1Q17A 2JIZA 2AN5A 1YJQA 4BAUA 3GRAA 3OQBA 4X6XA 1TUBA 4JKOA 1H23A 1DBVO 3F1LA 5KJFA 2Q46A 3FOZA 1E5VA 3ACBA 3KR0A 3OY7A 5JXIA 4LXIA 1JQEA 2XWBF 3CPSA 1FEZA 3D6HA 3H18A 1JL3A 2VNIA 3PPVA 4Q5IA 2ZJ6A 3EVBA 3K2EA 5JZ9A 1E2UA 1UT8A 1QVWA 3OHPA 4DQDA 1KJJA 4QDZA 4DLBA 1IPFA 2YYZA 5G0SA 1RI3A 1OIVA 4QUIA 4RWEA 5A7GA 2HA2A 4MQ5A 4DF3A 4MGHA 3PDJA 4L8GA 1T3GA 3IR7A 5KTNA 1QHYA 2BFMA 2CVHA 1G38A 5SYAA 1ONPA 1QH9A 3NX4A 1FL9A 4PU0A 4TWRA 3S2IA 4ALJA 3HV2A 1NJSA 4H9GA 3OM0A 3T7SA 2FCRA 2EERA 1QOQB 2JFGA 3TLZA 2C7OA 4BMPB 4YVFA 4BMSA 3VZCA 1LI4A 4UW9A 5EJ7A 2UZAA 3KQKA 2JKVA 4HN9A 4PPQA 4KOEC 4US2R 4J0GA 5TMEA 1HTBA 1HWYA 2XSZA 4M8LA 3AEUA 3PUYA 1JWAB 2A1TS 4C7MA 1R1DA 1F2UB 1I10A 3GRKA 5D7BA 2QMQA 5AVKA 3ZCUA 1O97D 3MJDA 4KG7A 1I6WA 5CD1A 5CB4A 3AI7A 3T1QA 1Y98A 3H7IA 3N3BC 4G5GA 5AVQA 1PHPA 2AA3A 2C00A 2ZRCA 3AB3A 1LQ2A 2WYWA 4R1OA 2VDOB 3MW8A 4BL5A 1KMCA 2D5AA 2ZS7A 3OIYA 1IY8A 1TCBA 1OASA 3BTVA 3GGSA 3B8HA 2RGEA 4KH1A 2NU6A 3VU9A 1R4MB 5LLSA 1PLJA 4JL8A 4AQDA 3D3JA 4QYMA 4Q9AA 4DRZA 1PTJA 3TGPA 5CB0A 2AC2A 5K51A 1TU0A 2WTUA 5FOWA 3QVJA 5GIOE 3KXLA 1QP8A 3NZEA 3WRWA 3WGUA 1A7AA 5IKXA 1C0KA 2EL7A 5C1OA 4U0KA 5L95A 1DAMA 1XKTA 4LZPA 3IAUA 4CG2A 2WKRA 2BSQA 1ENPA 1Z12A 2ZI6A 3BA1A 1NXQA 4D4MA 1MORA 3GXOA 4HN4B 1B2LA 1Q1EA 4JLOA 1UC4B 3DTYA 4Z86A 2QVXX 1DRWA 1R0YA 2GZ3A 5E2AA 3EEOA 3I5XA 1YR2A 2FFQA 4WPGA 1H2YA 2XMBA 5D87A 2A7XA 1WZUA 4FHDA 2RD2A 1N25A 1DB3A 3WV4A 1FJ2A 3C8UA 4M0EA 1GQQA 3I76A 1KORA 4JZKA 3ZXIA 2AVDA 4FFVA 2IZZA 1GPMA 3ROXA 4CCYA 5ILOA 4DR7B 3B70A 1ZH2A 2BCGY 3QVOA 3L6RA 1H5UA 1RKBA 2NN3C 2BMVA 4IXWA 4Y6RA 5KX5A 3KPUA 3KZCA 1XBTA 2ZJ0A 5FA6A 5C9ZA 1W29A 1UZUA 4ZK2A 1K7YA 2C54A 1D2HA 3GAFA 5TVKA 3HVUA 3RTGA 2Z6AA 3FNIA 4CLEA 2CLKB 3W5BA 4WZZA 1GVNB 3BUSA 2HHJA 3L7CA 1DRKA 2QOEA 3EPHA 3JQ8A 1SKYB 3A3YA 1K0UA 5IFKA 5BSFA 2DWOA 4TRJA 1FDIA 4XJTA 1A9XB 3ZVLA 4C2BA 1Q1GA 2VP5A 4N65A 1DCKA 1Z0KA 3HJGA 4ZTZB 1PE0A 2Y66A 4ZJUA 4K1LA 5JS2A 1A2QA 2YXEA 2O0MA 3H5WA 1NUQA 5HJEA 4MP3A 4Y6GB 4C4YA 2HFKA 3SYMA 1A9XA 4H3VA 5G41A 3SDSA 1MEOA 5EJEA 2B25A 3EFEA 1TAUA 4QELA 3CCFA 4AKSA 3BGWA 4AF7A 3K2IA 3KQMA 1XF1A 2QUIA 4TVSA 4GLJA 4PZLA 1BO6A 1RZ3A 5JRDS 3W5HA 3CT4A 4CV1A 3LK7A 2UKDA 3QLJA 3CG0A 2QRKA 3M3HA 1ZZEA 1FP4B 1QO9A 4EF5A 4XJSA 1RPTA 1K8XB 2G36A 1D2EA 1Z8DA 4C08A 3PR2B 5JEEA 5H80A 1RAIA 3RW9A 1X94A 3P9ZA 2DR2A 5HYVA 4B76A 1U2QA 3C41J 1QFXA 2OESA 3IVGA 3M6MD 1XYVA 5JDIA 5KNLA 5IMBA 4FLMA 3L0CA 3ZLBA 1HZZC 4FBGA 5IKOA 4EITA 2HCTA 5KDDA 2AE2A 4PN7A 2GI4A 4V1CI 2V7QA 1OREA 2FYTA 2ZIVB 2YQZA 1K6XA 2BLLA 2YXBA 3E6AA 3L49A 3OD5A 1PN3A 2WTAA 5FF9A 1TM2A 4K3UA 1P19A 5JMWA 3TZ6A 2OZLB 5BSUA 4CRWB 4NCAA 1ZBDA 2Q3FA 3HR7A 5E9AA 1OX4B 1KQNA 4KACA 2PPVA 1V4VA 1TMGE 1U1CA 1YZVA 2RGDA 5CH5A 3TQSA 1TTHA 1GO2A 1UOEA 2AZDA 3AUFA 3FOWA 1RJDA 5C8YB 2JLVA 1Z3IX 4OBXA 1OY1A 1VB5A 4PN3A 1C8LA 4O4JA 4F6RA 1RD4A 5CB4F 1LLDA 3HLTA 2QN1A 4IV8A 4D9JA 5EEHA 1JIQA 1VE3A 4P2BA 3N70A 3NJRA 4XSVA 2ZTLA 3RADC 4CM8A 5J5AA 4FFBA 4C5CA 4EFMA 2WG1A 3PV0A 3EE6A 4H6XA 4N49A 4NULA 4XUEA 5CNMA 1QUFA 3QRWA 1R10A 2BKAA 4AMYA 1A8HA 1RWWA 1SN7A 4HNGA 4IIBA 3NHZA 2EZUA 3C3EA 4RLFA 3BWEA 2XXBA 3AEKB 1M75A 4XGIA 3VDRA 2PU7A 4AM8A 4B3HA 2QUHA 2F3QA 3BWCA 5DNVA 1V11B 3QFHA 3WNVA 4AIRA 3BWYA 5EMJA 5T57A 4Q05A 5K0SA 4QYIB 2GCOB 4JOSA 3VXKA 3HVKA 1JQAA 4QYWA 3RROA 3ZCQA 4EG5A 3R40A 3ZJ5A 1N6OA 1ZINA 4P93A 3OTOB 5IJ0A 3L0DA 2C97A 5J2TA 3BGIA 1YTUA 4F9EA 1EFTA 1EWKA 1UBEA 2B6HA 3IDAA 2BFDA 2JNWA 3AHGA 4QDJA 4XPIB 3UG7A 1EB9A 1N1GA 1U7UA 1YNOA 1ZEJA 3A9RA 4ZOLB 2X41A 1MQ8B 2AOTB 5H1YA 2F55A 1R6UA 4I50F 1JDPA 3I6MA 3DP7A 2J85A 3LKVA 3Q3GE 4G5RA 2G72A 1QRAA 4ZV4A 1GPNA 5BQ5A 2G5GX 2I78A 1CULC 1BEEA 2JEYA 2XDWA 4WOBA 1H22A 1UH5A 2F2TA 3D8SA 5DHPA 4OIFA 1Q7EA 2O0KA 4FD2A 5GVRA 2VUIB 2CLCX 4YHBA 4K9SA 4BTLA 2HL6A 4RVSA 3GROA 1E6MA 1GUDA 2VP6A 4UATA 3HBLA 4LKOA 4GQAA 2WVJA 2QMHA 3BB4A 4W4TA 4FMCF 1VJCA 1Z47A 2ECOA 4ZV7A 3GBSA 1E3WB 3DBLA 2D7JA 1B8UA 1MJFA 4LRXA 3DZHA 3ZC3A 2QRVA 3AWIA 4EUHA 5J1SB 2JLAA 1JSCA 2QTNA 4M1MA 4KR7A 5K3OA 4CL0A 3DMFA 3F5FA 2EC5A 5BOSA 5A5DA 1WP9A 3RGWS 1UEIA 1RKVA 1DVRA 2QTBA 1EAYA 1UXOA 4W8OA 3ONEA 5CNKA 3J7TA 4B4KA 2MSWA 4AAYA 2A0YA 2QPAA 4K40A 5JU6A 1T8UA 1VIVA 2M98A 2ZJZA 1OT3A 3FFAA 1RQ7A 3L8YA 3MTEA 3QE2A 1UBMS 3LWNA 4N1AA 3VR2D 4LFBB 1VE9A 2EJCA 5FL7A 4N6OA 4ZZ0A 4UPDA 1I36A 1Z7GA 3K7EA 3GOHA 5LQSA 4C04A 5F4ZA 3MTQA 3PQ7A 3T41A 4Y0NA 4CKYA 4OQQA 1V9SA 4IMJB 3BE8A 2AV6A 2OHVA 3LECA 3IH5A 4R2JA 3BRSA 5FLXA 1IRIA 3ELYA 1UWLA 1L3CA 2QNRA 3KAKA 5HIMA 5L7YA 3W8EA 4A0QA 1TGYA 621PA 3BCUA 3VPGA 4JLKA 2X7HA 1E2LA 2I54A 3R9KA 2Q2VA 4RANA 4OGGA 4EY3A 1KXJA 4D92A 1QCDA 4TGLA 2YOHA 1ITZA 5TQVA 3WZLA 4E30A 4WACA 5IYZA 3D54D 1B0ZA 1SVUA 2W9XA 3DOOA 4BLOA 4CLOA 3K9QO 5HK8A 4KSBA 3GELA 4Y6PA 1ZU5A 3LPLA 5J4KA 2YNMC 2QXTA 3FX2A 3I3SR 3NBZC 3DZDA 3ZWBA 4BNLA 2V6GA 5JYDA 5LQUA 3HMQA 1NUAA 1Z3CA 1C3JA 2R86A 4U7PB 4B4WA 2H1OA 2GBPA 4JYAB 4NCKA 3AUSA 3FVTA 3OT1A 1X3SA 1NL3A 5DLEA 2ILTA 2XR1A 4ZP1A 3RKUA 3ZU4A 4BO0A 1C7QA 1OZGA 2SICE 3RS7A 2Z5VA 3PQ8A 4F2WA 1UPAA 2ZRLA 1NBMA 1US8B 1Z4QA 4OHMA 1Z25A 4LCJA 3DAFA 3KT3A 5E2BA 1TCCA 2GRUA 1XYYA 3EDYA 3X2SA 1IAVA 4MUGA 4MHTA 2H3EA 1WEKA 1WF3A 2HDHA 3D6FA 3AP2A 3CO0S 4UMDA 1NG9A 2LR0A 5E7JA 4X85A 5DCUA 2RGCA 4NYMR 3FM9A 5IXJA 1JEAA 2HUNA 3HK2A 5JJIA 3ZDCA 5C46F 4A1FA 2G4CA 4IKEA 1M34A 5BMVF 4L8WB 3A4NA 3VI3B 1HLGA 1FZTA 3G0GA 1EFDN 2R5WA 2CNDA 1ODFA 1LX6A 4RA9B 4GD3Q 1YQXA 3WDKA 3MMSA 4F60A 3OUUA 1G5FA 2YNMA 1D1PA 4REQB 5ALRA 2AB0A 3FHTA 3P2KA 3FDZB 4QWMA 3DZIA 5EIWA 3FPBA 3GG2A 2GBIA 1NF2A 3QVUA 3R3UA 1MB3A 4Q37A 4QQFA 3V2HA 3FUUA 3ZK8A 1B0PA 2JFUA 4LY3A 4YO7A 3U44B 3ZW8A 1YD7A 4NE7A 4RV9A 4O33A 2QIPA 2J59A 3H7AA 2ADFA 1MOSA 1PDOA 1NTRA 2NT4A 4D79A 3OLYA 4QM6A 4GIBA 5H83A 4EI2A 5BYKA 2V7GA 2HHHB 1JA9A 3IDFA 4C4ZA 3JZFA 3WI7A 1RFLA 2BFEB 1UJ4A 5F12A 3KTDA 4F3TA 5THQA 3E9RA 2AJLI 2OKGA 3F6YA 4OI2A 3U17A 1OB2A 3UAVA 1D07A 1XDDA 3H1PA 3T5MA 2PKQO 4GT1A 4C9BA 3UWMA 4LSWA 3AW8A 3HFJA 4EHNA 2Z58A 1ZI8A 4MA0A 3IE1A 2WAMA 2BEWA 2VWQA 2XHEA 3R3ZA 4M86A 1TKAA 5CFPA 1U3FA 3DGFC 2ZZKA 1PJ3A 1UJBA 3HYLA 1G8JA 3MTBA 4EW6A 3EC7A 2X23A 5EJMA 1IATA 3TFQA 4BLWA 4X63A 5CVDA 4QJ4A 4NBRA 2YZGA 1M6VA 3NNDA 5F2OA 4UM9D 3JQ7B 1QTQA 4RV5A 2IHJA 4DDKA 4ECEA 3IBGA 4II7A 2XTZA 4KFRA 1L4MA 1CV2A 2H31A 3VR6A 1X87A 4PR3A 2D06A 4RPIA 1VGQA 3SLKA 1XNRB 1SC9A 4ZPXA 4R8MA 2IH2A 1JG6A 5E8JA 2PS1A 5LMUB 3R5JA 4OHKA 1FNMA 3OHMA 2DPXA 4ZTBA 5GOTA 3SJAA 4BIIA 3DZBA 1H85A 1TQ2A 3FMFA 3G68A 3K0AA 4KR0A 4XYBA 1VBKA 1JQKA 1QF6A 1QMGA 1EP1B 4UCQA 2ODQA 3DNPA 4F97A 5DN6D 4ENRA 1V6SA 1F6BA 1QHIA 4DC0A 5JZBA 1XCPA 3ABQB 4OHUA 2Q4OA 1S9DA 2V97A 1DMSA 1YIDA 2WPNA 2L17A 4JJFA 4HNTA 3ZGNA 1V1RA 4Q7JB 1NU8A 2WR8A 2A1UA 3PJDA 3DW1X 4N54A 4FE4A 1MQ9A 4K81B 2H2GA 1H8HA 1S8AA 1QR6A 1Y6QA 1NE7A 2UDPA 1LRLA 3QE4A 3QLTA 4XQ9A 5LKRA 1EXNA 1ZI6A 1A9RA 3NR2A 1L2TA 1G59A 1GV0A 4E4TA 1WD7A 4OQ4A 1C1DB 3K9BA 3N28A 2H0QA 5UKDA 2PNJA 1KTIA 3SCZA 3O4FA 1W8DA 2PD3A 3T7TA 2GN4A 1DLIA 1UDXA 1W8IA 2XF2A 2HEIA 3TH5A 5KMGA 5EJ4A 1W75A 3PQFA 4MVJG 3WWCA 4CDNA 1K7EB 1VHWA 4WMLA 3QX8A 1XB2A 2Z8ZA 3VR3D 2IOFK 3FE2A 4O08A 5IUNC 1L3IA 5J2UF 1P3JA 4X54A 2YOFA 1ENYA 4AMZA 2YXDA 1IWOA 1QF7A 3IKLA 3VC7A 1BH2A 2XZTA 2HYIC 4B3RB 1NJ6A 1R0KA 2D74A 3OOHA 4GSLA 2AMYA 3KTAB 4KAJA 5KVVA 5D00A 2LCFA 4KXLA 2SCUB 3OA2A 1QF9A 2ZREA 4HWKA 2AXQA 5C2JB 2F8LA 1NW3A 4JSRA 4EBFA 4FZVA 4ZZIA 2OV3A 3DOUA 3PHHA 4BDSA 3M1AA 3V4FA 3O9ZA 5AVSA 2Z43A 1FFXA 3NHFA 5BR1A 2R9VA 1CUSA 5FHQA 3A3KA 4OP1A 2UVDA 1EWQA 3KD2A 5CP8A 2GCOA 3IT0A 1C9DB 1N2EA 2BDUA 2PGIA 3EQ6A 3WO0A 5FV7A 4WN9B 4PNZA 4YJFB 2QX6A 2CVZA 1RQXA 3CPEA 3KFLA 4K7JA 5JSKA 3WL7A 1EK0A 4OHBA 5CXUA 2PUCA 4FI3F 5JOQA 3CXRA 3CUEF 7YASA 1MGOA 1GNQA 5CGQB 1N6RA 1SG0A 3HJUA 5ALTA 3C1TA 2D54A 3IO5A 1CDEA 2P2YA 5ALOA 3AC0A 5EIBC 5L3VA 4MV4A 3ZGVA 1ZH4A 2JG3A 1Z6XA 3DD1A 3B1JA 5D3QA 4DIUA 1UDCA 1FJXA 2WD7B 3WJ2A 5LC1A 4AS2A 5K4HA 5LOVF 2PGJA 4MKIA 1Y8ZA 4EB3A 1KI9A 4QG3A 3UF0A 5LQAA 4Z54A 5A4MS 2VSFA 1NVFA 3F6SA 3LPDA 4AYXA 2DHEA 1UJ6A 3R23A 4O25A 1YQQA 3C6XA 4CM9D 1FMFA 1RRKA 4EF4A 2PK3A 1PT8A 1U1FA 3LIIA 1OHHD 4ER7A 1XVLA 5AXDA 3ML1A 5SY9A 4D42A 1T6ZA 1XIVA 2Y1WA 3NAZA 3TBFA 5BORA 5B2ZA 2LDBA 3BRWD 3W9SA 4B4VA 1GA4A 1YB6A 4F1KA 3CLTD 2GM4A 3PC7A 5K0BA 1E5LA 1TF2A 5I7VA 2DP4E 4Q1DA 5C4GB 3DOJA 1XX6A 3IEVA 1CUIA 4A26A 1C2TA 1P62B 1CB0A 3D5QA 3P9RA 5C7IO 2RHLA 1SULA 4MJLA 4YEDA 2IYLD 3AZPA 1QDEA 2V6FA 2CXQA 1DT5A 3GNTA 3GPIA 3GJXC 5K0FA 2YWGA 3THRA 3M3PA 4BP3A 1ZOSA 2ACKA 2Q0SA 3IKTA 1QOZA 4PXAA 4RJLA 1JSZA 1NI4B 3H5LA 4ZODA 4C0JA 5BPHA 4C4OA 2JLUA 3RYHB 3A2NA 2CYBA 3VO2A 5F78A 1A5AB 3UICA 1NVAA 3B12A 4QTUB 721PA 1RYMA 2X2OA 3FTPA 4NH4A 3DV0A 3RDPA 1WXDA 1C0IA 3JASA 4JP3A 4WK6A 3X1WA 2QS9A 1EDZA 2C7PA 1CR4A 3PEVA 3H1BA 3ORFA 4IRXA 2NXJA 5ALIA 1BWSA 2V59A 1CJUC 4YPOA 4E70A 4BB0A 5MGNA 1A4UA 5CEEA 5ER6A 4YP0A 1EFHA 4W9NC 4A2CA 1YOVB 4P6VF 4ZGBA 4MAAA 2HOQA 2O23A 5EYPB 1CPYA 4R9SA 4PQRA 2H2HA 2ZYVX 5B58T 2GZSA 3CZMA 3JWEA 3W5CA 4XCVA 3HCCA 2LW7A 2XIJA 2R8EA 4BMZA 4Q6BA 2PKCA 4QO7A 4QASA 3SM9A 5D2CA 1VP9A 5I4IA 2NTEA 3EPRA 4JKIA 4KIJA 3EWIA 3N39C 4Q01A 1I32A 5LVAA 1HE5A 3E4DA 4P3KA 2WJ3A 4E07A 4NDZA 1EDDA 4YQZA 4F8EA 3QMPA 3D2CA 2V1XA 1FFEA 1UBCA 4IOJA 1T3SA 3LC7O 4F5DA 4GEKA 3PFKA 1P73A 1PJCA 1NN0A 4ZZ1A 5IAKA 3WGJA 1H4SA 1YRHA 5KOJB 5D6NA 3NWOA 5EC8A 5CX1A 2XUDA 3X0DA 4DT1A 4ZYYA 4DWOA 3K16A 1QQ5A 3ZKWB 5EUQB 4DMKA 3A9TA 4EW2A 2NPFA 3OLCX 1AS2A 2CUTA 2FSVC 3IVMA 4NR0A 5YASA 1JH8A 1PR6A 5K8IA 1WNFA 3SEQA 2PLAA 4IDEA 1NMXA 1QZXA 3PA6A 3FKSA 1ODSA 2FETA 3RIHA 4YJDA 2CCJA 5CCDA 3TSCA 3USZA 4KQ6A 2O5RA 4XE5A 1U80A 4O63O 4L8FA 2XUQA 4UE3S 4B6FA 3PQDA 3FTDA 5BMVB 3GLIB 1UMDA 2IHVA 3P2YA 2QM8A 1B2RA 3X2EA 2WIBA 2W58A 3I28A 3CBGA 1HZJA 5DULA 1EJBA 4W1RA 4K9NA 3WYGA 1QP7A 2AGVA 2X77A 3CSSA 5L53A 4AKHA 1E1CB 2ONJA 2PWYA 2IXGA 1Q22A 2VRNA 2C9OA 1YOBA 2W2NA 2WHYA 2VDWA 3TLYA 4CKXA 4F2DA 1JKMA 1FPMA 2FMFA 1NRWA 1SCNE 3UH0A 3VSEA 1MUUA 2QTAA 2WTEA 2YZNA 3JX9A 3TAXA 2BF7A 1JU9A 1ZJ6A 2IDKA 2YVLA 3LY5A 3QUTA 4LV5B 4IQGA 1V26A 4RDCA 4AURA 2HO5A 4BVLA 1V41E 2IE0A 3NHJA 1MNAA 2D00A 2WUVA 4DV3B 1F2UA 4KUGA 1LS1A 4LX8A 2H3HA 1L7DA 1N5JA 3T12A 3X1DA 4HPWA 4MRAA 3UBMA 2I7XA 1G3MA 3IAS1 3UK7A 3VDQA 4N5DA 4PC6A 3DZJA 2IKSA 2Y1EA 3CN9A 3L8HA 4OCZA 3ON5A 1NQUA 4HLDA 4DUGA 1TMKA 2R25B 2FAXA 1Y9JA 2YMMA 3B78A 2XXAA 4R40A 2ODBA 1GNPA 1L4YA 1A88A 4KXWA 3GBPA 2RSLA 5EWLA 1OXXK 1KC1A 4D8WA 1NX6A 4YJGA 5L7WA 2HSJA 1SUIA 3C3WA 2G08A 1V7CA 3OO1A 5AW4A 2XUIA 2NX2A 1WKCA 2Q28A 1Y0BA 1RC8A 1SB9A 1H0HA 2IBMA 5J5CA 1GQSA 3P0FA 3LQYA 3R3HA 1B26A 4INZA 3KUUA 1Y63A 2EP8A 3FIJA 5FA8A 3ZY3A 5BO5A 3JYHA 3ZDQA 4RSMA 1SK8A 3ZCSA 2JLXA 3CEMA 1L4BA 1CJBA 1X15A 2A9VA 2P8JA 3DLIA 3UWKA 1HFJA 1VG1A 4JBLA 2CE7A 3WV5A 1BKDR 1P0IA 1VA5A 1DFGA 2DERA 3MXOA 1KEEB 2WLTA 3A36A 1IRXA 1P4HA 3GD5A 1BAPA 1QCCA 4BUJA 1KO7A 2DFTA 2NNWB 2XUPA 3FPHA 1XGKA 1T6YA 3TN7A 5B3KA 3EASA 4DJ5X 4GOND 2VF5X 4G4GA 4H35A 2D5BA 2R751 2IQ5A 4JELA 3ZGLA 3V8VA 4HAYA 3GIWA 4CDRA 2YXNA 1XQVA 3A6EA 3UAXA 4Z9FA 1KOGA 4NDNE 2MR6A 5BW6B 3DVLA 3AY7A 4MVYA 1DO0A 3KQYA 5BSEA 5DP2A 1JWBB 1X14A 1E1MA 3ADDA 1HETA 1O96B 1YCDA 1JQDA 1CB7A 1SCUA 1AE1A 1DAGA 4FKZA 4GI5A 4IOLA 1MQAA 4X9XA 1XQWA 3SSAA 2V96A 4INJA 3UWSA 3ZNOA 1S89A 1E1KA 4E15A 1W36B 4N9WA 4CM3A 1PW7A 2FF7A 2E4WA 3QXXA 4TTAA 4KZPA 3UHFA 3GT0A 3HNPA 4LPKA 4UNQA 5DBHX 5E3IA 4KK3A 5A05A 1CZUA 3VMMA 2X6TA 3LRXA 4UOEA 4KKXB 4DDWA 4O2BB 3USES 4BVGA 4KIFA 3ZY5A 3RB8A 4NE2A 1Z7YA 1AOXA 2RHRA 4HGRA 3R74A 3NONA 4HVTA 2MSCB 1T13A 1U9IA 4TMWA 3UJDA 4CLRA 4I1PA 3LY9A 5TT1A 4NPAA 1USIA 1GNVA 1KZ4A 4FCVA 4G1UC 1SUDA 4PAGA 3VUEA 4GW3A 3LPAA 4HPJB 4D46A 3T9BA 5I3CA 4PTLA 2G71A 4FCTA 4DXHA 2C03A 4N7JA 5IWCA 1NIPA 3MJFA 3D0OA 2M9MA 1EGMB 3IP3A 2XMQA 3CPJB 2EQBA 5EINA 5DX8A 2B8NA 4Z99A 2WU1A 2R7MA 3GYGA 1G20E 1LSJA 2C95A 3MOIA 4L3OA 2PT7A 4QARA 3HUDA 4Z8XA 2P9QA 1GU7A 1XTSA 2O2GA 2OXRA 5L3RA 1FNNA 3PGLA 1SQ6A 4OQDA 3PDUA 2PQ2A 2ZVQX 2G4LA 3D59A 10MHA 2Q3HA 1JHVA 2WIGA 3K0HA 3A1UA 1BOOA 4RY0A 4JVMA 2ZCJA 4B09A 4I8IA 4EA9A 1F2VA 1KVRA 1XXLA 2E4VA 3EMKA 2HRQA 2JJ2D 3C7AA 4JEUA 5C18A 1LBHA 2JFZA 2ZM5A 1GCIA 2CXSA 5CIWA 5HZHA 4JP1A 4D45A 4I3GA 1Z82A 3IDSA 3IP8A 3DQPA 3A04A 2VJYA 3LUGA 3LQ1A 1CKEA 4AWXA 1QTIA 1SJ9A 3GUCA 3SLRA 5MN4A 4AC9A 1F8YA 1CEYA 4K0KB 3TIXB 4JI3B 3F7NA 2OCYC 4RCVA 3D6MA 2C8VA 2JFNA 1O58A 1SVNA 4FMDB 3OQNA 3VA7A 2JI4A 5I7WA 3EPKA 4AF6A 3ZBPA 3HBFA 1QK4A 4KK4A 1GZ6A 2BCJQ 2IV7A 4G97A 3DNMA 3M83A 4YRBA 1TKBA 3SC2A 1TK3A 5IEBA 2DWUA 2VPIA 4J2TA 5G0VA 3VQTA 1BHSA 2WUFA 3W5VA 2Y2VA 4JSYA 5I8PA 4DARA 1EQ2A 3U0BA 4D74A 2OAGA 4F4JA 3N3AC 4KXNA 3EVNA 2Q4RA 5HMMA 2GZ1A 1NUPA 1PJ8A 3F4LA 3I45A 4WLUA 2HD4A 3WTCA 2IYSA 2PWAA 2QMEA 2Z9BA 1AX9A 2VYVD 3CRQA 3M9LA 1XKXA 3EW9A 3PC2A 5C8YF 3VSAA 5GOZA 1BS9A 2Y0DA 3IKVA 1CZOA 4NENA 1COWA 2GZMA 1CUDA 3O8NA 1GYQA 5AI9A 2FZVA 4I5EA 3BIWA 4R0NA 1AUPA 1Y8QA 3KLPX 5D86A 3KOMA 3NTLA 4NV1A 4Y6OA 1WW8A 3LBIA 3GW8A 3JY6A 3B1XA 1KIMA 1X1EA 3OFVA 1OA1A 1XVUA 1TDJA 1CHNA 5J63A 3SLGA 3VH2A 1NY6A 2IYXA 4DTCA 3BXGA 5IPFA 2ZG6A 3Q3JB 1WPGA 3GUHA 4ZAXA 3IOBA 5IMSA 3R6LA 2GPTA 3OM8A 1OI7A 4IJ6A 4LXYA 4MA5A 4MUJA 4ETNA 2WJZB 5B2FA 3RV3A 3IUJA 1LBEA 4E03A 1V0JA 2OZKA 5IUKC 5A02A 2CFRA 1MFPA 4LZNA 1LPOA 4FYWA 4TSKA 4U6NA 3HYSA 2H7YA 4HNAB 4QD3A 3TSAA 3ZV7A 4D98A 3IDOA 4UTXA 3A1DA 3H9JA 4RY2A 5ELLA 4FI3C 3L7JA 1W1WA 1XLTC 3UMBA 4RF2A 1JFFB 2NZ2A 3OKAA 1UBNA 2FPIA 4CIWA 4EVRA 4QT0A 2QRLA 1ZSVA 3FUXA 4KV9A 4EHBA 1XPOA 3IA2A 3KWLA 2O8EB 1NJGA 4B6SA 2H59A 3BMOA 5K05A 2QQEA 4M4SA 1D1QA 1U04A 3RD5A 3ICVA 5IASA 1CJTC 2PKEA 3LC0A 2R84A 2XYQA 1PGPA 1FLDA 3MTJA 4LY9A 5KQLA 3K71B 2BV3A 4KFUA 9MHTA 5LB2A 3MLBA 2FEMA 5KWSA 3A14A 4NJEA 4R81A 1EM8B 1BCSA 3G82C 1CQZA 3OZRA 1KE2A 2PQ0A 1ZCBA 2HRBA 4L5CA 4EP1A 4HAOA 1THTA 2FHPA 2YJNA 1ZRHA 1HDCA 3AUUA 1FDRA 1JR3A 2Q1WA 3NHUA 4RZ2A 4Y1EA 4Z6KA 4YCSA 4D02A 5LYJA 1Y6GA 1Z4IA 3AVXA 2CDAA 3NNSA 2G80A 2E21A 2CDCA 3AOEA 4EY4A 1P4AA 3FCAA 2B98A 5AH0A 1U0EA 3AILA 2E5FA 4N6NA 6ADHA 3U62A 1RHRA 3LU1A 1M2KA 2ID9A 1I1OA 3LX5A 2RFLA 2XMPA 3FVQA 1HH4A 3N58A 4FOLA 3W8DA 5HFAA 1W0KA 1T2UA 2IYFA 1VCMA 5T6MA 4IMIB 4UEQA 4B4OA 4B48A 2ZB3A 3LJKA 1I6KA 5LYJF 2AI1A 1JR6A 1ZN2A 4WINA 1W4LA 1RJWA 2GD6A 5EWJA 3WL8A 2H1SA 1K7XB 1LJLA 5K9ZA 2DWQA 2CHUA 4TUYB 4GLOA 3COWA 1F0PA 1GGKA 3E0XA 1G60A 1EP9A 2FDRA 2F1HA 3I2KA 4OAQA 3I5AA 1PD0A 4LJKA 5REQB 4JI2B 1M8PA 2AG5A 5AW5A 1XEXB 3FPCA 4HQNA 3AF0A 1SG9A 1GNSA 2EGUA 3CYFA 4LC0A 2QLLA 3GEMA 2CSXA 1H2RS 1N0WA 3K0KA 3IKJA 3KKEA 4KXMA 4RABA 1Y9AA 2PCLA 2JCYA 3QNWA 2UYHA 1U1DA 3HN6A 3N5CA 3H4VA 3GFQA 5F4BA 4KWTA 3EXG1 4C01A 3HYRA 3HKCB 3IAAA 3OPYA 1G9SA 3CGWA 3DVSX 3HACA 4IEFB 1PX0A 4RADA 4AF8A 4YYZA 1D4FA 2AFRA 4CM4B 5AM0A 1QZ3A 4ZXPA 1J9GA 1GLNA 1UXIA 2HNBA 3G3EA 4MUBA 1E3DA 1WHSB 3RO7A 2FFBA 2J0EA 2GTIA 2WFZA 4DMGA 3OIGA 3ZWMA 2QTVB 1Z56C 3PHLA 4RPGA 5DKFA 5TGZA 5IX8A 2HMVA 3R5HA 4NBNA 1DRVA 2W4IA 4UXJA 2CJFA 5TLSA 2B9EA 5DGIA 2IYYA 4KR3A 1E79A 5AQ1A 1QHNA 2VPYA 4ETIA 4YUVA 2QORA 2VF7A 3K6RA 1MB2A 3U3JA 4NNJA 4N40A 1DAHA 4MITA 1ID1A 2BKEA 3ZKWA 4BQQA 2YV4A 4IQ4A 1EFCA 2ABWA 3LCUA 3OZEA 2B8WA 4XDGA 1P91A 1RP1A 3H0KA 4AJ4A 1CF2O 1DG1G 1AQYA 3GOQA 3TAHA 2HH9A 2C84A 4X90A 1YL5A 2OB1A 2YQ4A 3IXMA 4UARA 5TC4A 3X1JA 5HM6A 5DNEA 4BLQA 1TM7E 2CNLA 2NUAA 4FYKA 5DI3A 4DG8A 2GHTA 2Y1KA 3N53A 2A67A 5ADWA 1U0BB 5C80A 1T1EA 3FPAA 3FFTA 3OQHA 4EQ6A 3KVYA 2PPLA 1IMJA 2VVTA 4DV6B 5EE1A 1OXMA 2DBZA 2PIDA 3RVKA 4QKQA 4MKRA 1UIRA 5SZIA 2H5JA 2FPRA 5G53C 2H8GA 2JEZA 2PY6A 4ESOA 1NM5C 6AT1A 4I3HA 3HE3A 1SC3A 4Y6LA 1JDTA 4DNQA 3R7NA 1FFGA 3RJ9A 2ZM6B 5ITSA 2AIRA 1WDKA 1XU7A 1HTTA 1NBIA 4CU2A 2B1JA 5C81A 4TPKA 4F0JA 1ZN9A 3PNOA 2BL4A 1A98A 3O8QB 2N3ZA 1JRLA 3DCIA 3EB9A 1F38A 4OREX 3VZBA 3MMXA 3NVMB 1Q11A 4GL4A 5F7ZA 2HHCA 2VCEA 5KYKA 5BV8A 1H66A 4H7FA 4I9HA 3TQFA 1HKHA 4Y2JA 2ISSD 2P3OA 5HCIA 5A5VA 1M8JA 2F9FA 2Q1XA 3C7TA 4Q48A 4EECA 1EGHA 4EWLA 1Q0HA 1UBOS 2PR2A 2RK6A 5U4QA 1QTNA 1UDWA 1UBTS 1V9CA 2JAHA 3GVHA 5HM8A 2FPPB 2WJAA 1SOAA 2PL9A 4QEKA 1ZC3A 3FCEA 1N2BA 4CCYB 3I1IA 4DOMA 2GXAA 1DXOA 3GGOA 3GEGA 1H2XA 2VJPA 3OBBA 4KQHA 2VF8A 3NYIA 4N8EA 5JXWA 3J7AC 3EH2A 2IV3A 4IHAA 3AUAA 2A86A 2MT9A 5FLYA 3WLTA 2ZDGA 3NTUA 1AKMA 2PUWA 3EEQA 4XYMA 2EW2A 3O93A 3W2TA 3FCUB 4ANFA 5B2EA 3L92A 1IHPA 3OESA 3EX7C 1TYEB 1ZA1A 4YIHA 2I6FA 1NI3A 4PM4A 2I8CA 3KOWA 2GBLA 3LHFA 5J2UB 4BHTA 1YKSA 1OYYA 2Q5OA 4REOA 3C4VA 2P40A 3Q0TA 4YP9A 2GR9A 1RZUA 1K8ZB 2XA9A 1EWRA 3B5JA 3HUFA 4MVWA 4ZA2A 3T3PB 5EHZA 3H3JA 3M81A 5KQSA 3BL8A 3EZGA 2I4RA 5EPOA 3SQOA 7REQB 3HPRA 5JARA 1SOVA 1QZTA 3ED5A 3S55A 4QJ5A 3IBCA 3KVVA 3R3YA 1E2EA 1UMDB 4L0CA 5KTOA 3GLIA 3ECSA 2H00A 3P8ZA 5FO1A 1TO1E 4DM7A 4XVCA 3PNLA 3RJTA 5GTDA 2PGDA 2PZAA 5G3ZA 3V8PA 1ZD9A 4BX0A 2C5AA 2Z2JA 1ZVQA 3FWPA 3WGHA 4DW8A 4ZJZA 5LMCA 3ZI4A 2RH5A 2D6FA 1N7GA 4PO1A 2PKQP 3ZOKA 4AQYB 1GQRA 1GXSB 1ISHA 1BQEA 2ZETA 2BTQA 1KSHA 1RAEA 3R5XA 3UXHA 2F00A 1BJTA 2FLKA 2VHTA 4GX5A 1KERA 1LV7A 4KKVA 1NPDA 4Z1MA 5C3UA 3EWNA 1R0ZA 4OK3A 3EUEA 2UUA