2ERYA

The crystal structure of the ras related protein rras2 (rras2) in the gdp bound state
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
171
structure length
167
Chain Sequence
SMQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the Ras related protein RRas2 (RRAS2) in the GDP bound state
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-related protein R-Ras2
total genus 60
structure length 167
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2eryA00
1CR2A 3DDCA 4MGZR 3KUCA 5LB4A 4MDEA 4MQBA 1QBKC 2QUZA 2F1HA 1EFUA 3L82B 2QT0A 4PSKA 2IT1A 4JL5A 1AQYA 2C99A 3VTKA 4TL8A 3LWNA 4RD3A 1IONA 3R9XA 4UNRA 1S3GA 3AH8A 2PL3A 4IJMA 1OH5A 1T3HA 2YOHA 3CH4B 3HP1A 4N1AA 3REGA 2XZOA 1E1RD 1VCOA 2BEJA 1ZM4A 5DI9A 5FL7A 5K8UA 2WBLC 2XNDD 3QEJA 3W6OA 5FBQB 2ZRMA 3VR6A 4AK9A 3ICEA 1L8QA 2YV5A 2ZAOA 1OIWA 4M4SA 4M9QA 2AR7A 4PTLA 3R8FA 1WDTA 3MFYA 4PO9A 3GJ4A 4KXFB 1IBRA 1XD8A 1CJMA 2WV9A 2R2AA 3CM0A 4ASUA 3A36A 4DSTA 3OEEA 2NPFA 4B74A 4X8LA 2O8BA 2FF7A 2GK6A 1WE2A 2ZSDA 4QJ5A 3CX8A 1E69A 3TSZA 2W6JA 2DB3A 3NKVA 4NL4H 4LWZA 3FHOA 2QP9X 4YONB 4C0KA 1E2DA 4IDOA 1YRBA 2HUPA 2WJHA 3BOSA 4GMDA 3MJRA 4DLRA 5C1BA 4B3BA 4NYJQ 2FGJA 3PXGA 5L8VA 4OJKA 4NZYA 1E2JA 3U4QB 2JGNA 4AKGA 1S3SA 1XFAA 2XSZA 4HAZA 421PA 2VIIA 2OXCA 4NTZA 2CL6X 3ADCA 1NP6A 2NO1A 2O8DB 4LY6A 1L4YA 1DOAA 3L8YA 5C4MA 1NY6A 2JASA 3ZD6A 3EXAA 3W3AA 3MD0A 4PQFA 4PC3A 5FOTA 3EWAA 2MSCB 1WBBA 2CE2X 3QQ5A 2ZS9A 3QPUA 1P6XA 2XX3A 4QKQA 2ATXA 2XJ4A 2BCJQ 1FMLA 2C9CA 3BFVA 4QJ3A 1M2OB 4OK6A 1P2VA 1XTQA 3L0IB 3RDPA 3EW9A 3B1ZA 2GAAA 3KUDA 1ZC3A 2JJ2D 2OZEA 2VF8A 4DT1B 3QXHA 4ARZB 1E9EA 3PUYA 1XMJA 1NLYA 1TX4B 1ZUHA 2QAJA 3LFUA 4D81A 3NG1A 4BEJA 1IY2A 4AI6A 1D9ZA 4YMWA 3BAFA 3T5GA 3WYGA 5JRJA 3ZVRA 1AK2A 3FDIA 4XD7D 1YKSA 3MWLA 4MYHA 4D82A 4HYYA 2IEZA 4P31A 2F1IA 1WQ1R 1V43A 1XCGB 4FIDA 3SE0A 1CEEA 3DZ8A 4V0NA 3DMDA 4TMKA 4OI2A 1EWQA 2B7BA 3LRPA 4HZIA 4PC6A 1HT1E 1KDTA 3TLXA 1CF4A 1DE0A 1F6BA 2N46A 1G3QA 4DLUA 2AFHE 2L0XA 3QPWA 2CK3D 4JS0A 4DSUA 1HUQA 3SU8A 1SKYB 1Z8FA 4CVNA 1OB5A 5FR1A 5JFGA 1GM5A 3EC2A 1HT2E 3AKDA 2ZS8A 1I2DA 2G9NA 4LYAA 2OLKA 2ZS7A 4L15A 5HCNA 5JLJA 2Z4SA 4B6FA 2GHIA 3THWB 1KI7A 1VCIA 3GLGB 5JRZA 3LLMA 2H92A 1KJYA 1P3JA 2YZ2A 4JLVA 3NIBA 1T9HA 3EZ6A 1EFRA 2F43B 4LJ5A 1KO1A 4TMVA 4JLBA 1OHHA 4JL8A 4O2LA 1HH4A 1R10A 2O5VA 8OHMA 1W36B 2ZRGA 2ZJAA 3VKGA 1W7AA 1JALA 2QN6A 1R0ZA 2GEVA 4DCSA 3KXKA 1Z6AA 3NH9A 4Q1AA 2CNWD 3LXRA 2N42A 4JLMA 4BFZA 3U7GA 3W3ZB 5FBVB 3RWMB 1KDRA 4ACBA 1A4RA 1GDDA 4PX9A 4RD0A 5DSZA 5G40A 3X1WA 4Q4AA 4DIDA 1KSJA 5KPDA 3D3QA 2P67A 2VYFA 4I1UA 2DFNA 4B6EA 3K0AB 2FEOA 2WJIA 4RD2A 2PEYA 3OIUA 4R71A 2WJGA 3TVTA 4Y0VA 1R5OA 4MH0R 2RH5A 4HLDA 1P7CA 3OF5A 3WBKA 1Q20A 3KJHA 3K0CC 5EE3A 3RRMA 4CDGA 5KU1A 5G53C 4BZQA 2DFTA 3CF2A 4TQUS 4XIGS 5B30A 2ZETA 2O8BB 3HYTA 5EXTA 1KI3A 3OEHA 1JEDA 2V4ZA 2IYSA 3K9LA 1EX6A 1JQJC 3X2SA 3KTAB 2Z6VA 3RRNA 3T5DA 4YMSA 5JSZB 5EUQB 4MDFA 3DO6A 1TQ4A 3DVLA 5H70A 1IQPA 3AP1A 4K8OA 4Q7JB 1JAIA 1S1CA 3FGNA 2OFXA 3I5XA 2ZI9A 3RS0A 3TR0A 4HUTA 2V3CC 4G01B 4W7SA 4QBIA 5BN4A 1AIPA 4HDOB 3CUEF 1E2LA 4KITB 4AC9A 4US1R 3LD9A 3MRSA 2OESA 4XSHA 3GP8A 2KSQA 1IJEA 3C5HA 2QTHA 1VDZA 5E95A 2I3BA 5DHAA 2A7QA 5AR1A 3O8RA 5G3YA 2ZUDA 4D26A 2RGBA 1BIFA 4QOSA 1Q1BA 1Q1QA 3ND9A 1JB1A 2QP4A 2QGZA 3PQCA 2J3EA 2BMJA 4QJ4A 4BEBA 3FFBA 3U7FB 1XPOA 1OXUA 4P33A 4X8HA 3QXCA 4A0HA 1DARA 1RZ3A 2JJ1D 3I61A 1G4UR 1VG1A 3C7KA 2HYIC 4IEIA 2J59A 2NIPA 4M1KA 5EUMA 2BKUA 2ZR7A 1NNEA 2FH5B 1KMHB 2NOAA 2QTVB 2REOA 5FPHA 4M8NE 4B76A 4DDUA 4ZDKA 1ZNYA 2GBLA 2WWWA 2GVDC 3FE2A 1XPRA 1D9XA 1E96A 2JJ8A 4IEEA 5FH9A 3ADBA 2V6IA 3ASZA 4OQLA 3M1IA 3OIVA 3BB1A 4NCNA 2ZRNA 1DBSA 1P9RA 4JYCA 2JLRA 2FMXA 3TNFA 1X3SA 2FG5A 1G4AE 5CYPA 1AZSC 1N6KA 3THYB 2C95A 3A6PC 5FBLB 2J7PD 4LC1A 1M6NA 3KTAA 3DKVA 5FBWB 3O8CA 4RZXA 3R7WB 4AIIA 5E3HA 4CIDA 4EJSA 2A5FA 1W36D 2MMGA 2NO7A 1G64A 4KCGA 3FHTA 3Q7QA 3KZ1E 5LBIA 3QPVA 1GG2A 3QKSB 2JLWA 1DAIA 2WJVA 3Q9LA 1JPNA 3MWJA 2FPLA 2DFLA 3VNUA 3TKLA 3IEVA 2KWIA 3TVDA 3X1ZA 1NJFA 3DOFA 4V0LA 4DLVA 3SQXA 2CL7X 4LHZA 4IKEA 2WPDD 1JXMA 1B23P 2EW1A 2IS2A 2HF9A 2I4IA 4EFNA 3GLFA 4L16A 1W0KD 1NBMA 2C2HA 2VHTA 4MKHA 3WRXC 4MRPA 4P3YA 5KSOA 4BLOA 1T8TA 3VR5A 2E1RA 4XVUA 4I81A 4UNPA 2ZIAA 4C0HA 1OH8A 4QHTA 1M1YE 2OCPA 4CEHB 1EGAA 1GKUB 2WWYA 1G17A 2RGGA 4UXIA 1OPXA 3CF0A 2XITA 3SFZA 1FMJA 1ANKA 4Z8YA 2IX3A 5J4VA 1NG9A 4QNMA 4TLEA 4TZ0A 4A2QA 4PSAA 3DZDA 1FW6A 5HE8A 1XZPA 3LH5A 5F9HA 4DDTA 1UAAA 1XEFA 2QM7A 3W5JA 3B7GA 5CB8A 2ZE8A 1P2TA 3MSXA 4GP6A 1XXHB 3HPQA 1XXHA 2BJVA 1EG7A 4WBSA 1TAGA 3HU1A 3T35A 5EE9A 4AG6A 2OUKA 1Z2CA 4NMMA 1TQDA 3T15A 1US8B 1R0WA 3T1OA 2WOOA 6Q21A 5KUTA 2VEDA 3VMFA 4Q9HA 2VO1A 1AN0A 1SVWA 1C1YA 2QMOA 4MKGA 3QY0A 4MGYR 3M6AA 2DFKB 5TXGA 4II7A 2HJGA 2CLCX 3EZFA 3ONWA 1ESMA 1GZSA 2ORIA 1YR7A 4QBHA 1IAQA 4MRRA 4JLPA 3ECCA 4YDHB 3UIEA 1FOEB 3U6BA 4TMXA 3S1AA 2BKEA 2IXFA 4B34A 4BE7B 3N70A 1II8A 3LDAA 2JLVA 2QE7A 4O2RA 4RD4A 2D06A 3SBEA 4C7OA 4BLQA 3CIOA 3W9YA 2BMEA 4W5WA 4B2PA 2EFCB 2E87A 4URYR 2BJWA 1R8SA 2J0UB 1CP2A 4GNKA 3TE6A 1ZIPA 5FOSA 1UJ2A 4U00A 1CJUC 5B58C 2J5XA 1QHXA 2BIFA 2YWHA 5TMPA 2Z0MA 3D8BA 1MR3F 3CRQA 4BLTA 3ZLJA 3OZXA 2WHXA 4JVSB 1GNPA 3SJZA 1E79A 2OT3B 5KPJA 4LX0A 4D4KA 2ZI3A 4HB4A 3BXZA 4TL7A 4O0MA 4B2IA 2DWOA 2ZYVX 3AF4A 3BFKA 2FFHA 1MABB 3PV0A 4HUQB 1W0JA 2ZJBA 1CRQA 2RGEA 1Z08A 2VSXA 2WJYA 4QHYA 3GFTA 5SZHB 4IXNA 4ESHA 1U81A 1D6JA 1IM2A 4M21A 4MUAA 4ZPXA 3IIMA 2PJRA 2HXSA 3P4YA 4B3CA 1GP2A 4FW9A 3GPLA 4FCTA 4IVPA 1CJVC 3VU9B 1S2MA 1E9BA 4KVAA 1JPJA 4EPWA 4MUBA 2NZ8A 2ZI4A 3NBFA 4DLYA 5DGXA 3BK7A 2FOLA 3GJ3A 4Q4HA 1OJLA 4E09A 3KQNA 1EXMA 3BH7A 3CX7A 2BBSA 3PIRA 4EPXA 1KK1A 2DBYA 4URZR 821PA 3U60B 2ZSEA 3N5CA 1DS6A 4Q9KA 1S96A 4JBWA 1JR3A 1C9KA 3RS7A 3WNCA 1ZCBA 2B7CA 3B82A 1RW4A 3UG6A 2F3RA 5CM9C 1MRSA 1N5KA 1TU3A 3EPJA 1VYTA 3EA0A 3I1FA 2GJ9A 2ANBA 2OHFA 2AN9A 2QSYA 3FVQA 3SHFA 3TJZA 2BCGY 2CHVA 1YE8A 1ESNA 2IYZA 3SZRA 1EESA 2QGNA 1IHUA 1TNDA 1CBUA 1ZYUA 2X2FA 1G9XA 2D7DA 3LXXA 1DAHA 2J41A 5M04A 5DN6A 1I4TD 3RANA 2O8EA 2O8CB 5FOVA 2P5TB 3B13B 3A4MA 5JEEA 1XRJA 2GILA 2QQ0A 2XTZA 3K09C 1LF0A 1BMFA 3U5ZB 3QF7A 4NONA 2AWOA 4RD6A 1NBME 4ILEA 1G7CA 3EA5A 3GLFB 5L3RA 1HY3A 1T3SA 2ZRLA 4A2PA 4Q1BA 1WBDA 1X8JA 2Q6TA 4UXJA 3VX4A 1BYUA 2PMKA 1YZLA 2ZJ2A 4HZUB 1VG9B 4C3ZA 4EPVA 3FMFA 1LNZA 1X8LA 2A5YB 3D6TB 2WSSD 3OFND 4ARZA 3OAAD 3L43A 2ODNA 5DYGA 2OAP1 5D3MA 1D2MA 1Z6XA 1KK2A 3K0AA 2Y8EA 4BFTA 2WKQA 4LHYA 5JS7A 2GDJA 4LC0A 2RGNC 2CE7A 5FPYA 2DCUA 3PEWA 1KAGA 1NSFA 1LFDB 4PPNA 4Q66C 3DL0A 4JKYA 3HYRA 5JJLA 1IXRC 1HYQA 3O47A 4NCJA 4I1VA 1E2GA 1PLLA 2GRJA 2RGXA 1KKMA 1Q1EA 2BWJA 3H4MA 5J4HA 1M74A 3TMKA 3SHWA 2IUUA 4DCVA 4AD8A 2R6DA 1U0HC 1N6RA 1ZUNB 2DPXA 3RVBA 4Q5IA 1NVUQ 4RY2A 121PA 5J40A 1PUJA 4B71A 5KHOC 1US8A 1K8RA 4AYXA 3CW2A 2P6RA 2WWIA 2H17A 1VTKA 1UBGA 2VHCA 4RD1A 1Z5ZA 3O8BA 4F7WA 1F60A 3B9PA 4XVQA 1HA3A 2IUSA 5L3SA 2JEOA 4M1WA 4US2R 3PUWA 1Z2AA 3OE7A 4YC7A 1TEVA 2E9SA 4JLDA 4TT3A 2KJQA 4CEIB 3KQHA 4PAMA 3K53A 4Z8XA 4GOJA 1O3YA 1Z22A 5J5CA 3BRWD 1KOFA 5J4KA 1H65A 4AKIA 3QKTA 2Q21A 2ZRDA 4NCHA 4F4IA 1QDEA 2DR3A 4CT4B 4ZCIA 1DPFA 1Z0IA 3QVVA 2NPIA 4CRWB 2FV8A 3QKUA 3PITA 5H68A 3BIFA 2YKGA 1NVXQ 1U98A 2XOKA 4ZV4A 3AVTA 1OFIA 1G7RA 2J87A 1E0SA 3WNBA 4B73A 4DLWA 2FU5C 3REFA 4WAUA 1GSIA 3AV0B 4PHFA 4LYHA 1J8YF 5J4LA 4XWKA 2IUTA 2JLXA 1SGWA 1XMIA 1R8QA 1IY0A 2ANCA 2G6BA 5F9FA 1U8AA 1VG8A 1JR3E 2PMDA 1KO8A 1V5WA 4EUNA 1LY1A 3IPYA 1MO5A 3GJ5A 1IJFA 3H86A 4DB2A 3QF4B 2ZROA 2P65A 5FTMA 3IBYA 5EXXA 3FMOB 4LI0A 1E0JA 3JVVA 2ZXUA 3IKJA 5TY0A 3JZMA 4QC2A 1R5BA 4EDHA 2ZRJA 3IQXA 3K70B 4ZO4A 5JCZA 1M34E 2WMOB 4FCWA 4PHTA 5CIQA 1TF5A 2AHOA 2OSBA 4MYTA 3TH5A 3QENA 1GTVA 1XP8A 1R0XA 1X86B 1W47A 2GCOA 5AUOB 1KNXA 1E1RA 2WWXA 1GL9B 1RYHA 2WICA 5BXQC 5FL7D 2ZJ8A 4KSBA 1MRNA 2KBEA 4A0RA 5GVSA 3VHXA 4IDNA 1ZJ6A 2NQ2C 3ZQJA 1GRQA 1J70A 1R7RA 1Z28A 2R6AA 1E4YA 4H1VA 1UPTA 2WTUA 3I5YA 2O8CA 5KOYA 1XTJA 4EKDA 4F93B 4Q9IA 4G5SA 1E6CA 3UMSA 1HQCA 3EIQA 3KB1A 4D80A 3KFVA 1G291 1EFHA 1SZPA 1LF5A 4FINA 5BYKA 3U6KA 2IHBA 1TMKA 2OBNA 4QBFA 4ASUD 2FN4A 4RZ2A 3ZZ0A 4PC2A 1UFQA 4BLPA 5HKKA 4HLQB 4Q19A 3V00A 2MMCA 4DCTA 5HR5A 3CZQA 1XJCA 3KJIA 1B0UA 4F4JA 1GITA 2W6JD 4EQ6A 1EX7A 3CO5A 3EWSA 4LOAA 4TSFA 3Q5DA 4GL2A 4JVNA 1OFHA 5ANRB 2G83A 3AVUA 3HU2A 4GZMA 2ODBA 4B75A 2AFIE 4DLTA 5CB6A 1GKIA 2BMDA 4G5RA 2XSZD 3KFXA 3IO3A 4MYUA 1KGDA 2PZEA 4KFRA 4Q1EA 4WZAE 5FTKA 3CH5A 3FFAA 4RCYA 3QKRA 3RRYA 1MH1A 4BQSA 3CZPA 1VHLA 1YR6A 2YOGA 1Z6YA 1AJEA 3FMIA 4AWXA 3RSLA 3LO5A 4XWOA 5JWOA 4GRAA 2AK3A 2ZRAA 1CR4A 2ZITA 4AG5A 2R65A 4QL3A 2ORVA 3P1JA 4U5XA 1T0JB 3K09A 5FBRB 2G77B 2O0JA 3V4FA 2JJ2A 5BWMA 3X1XA 1W49A 1RJ9A 3U3KA 4URWR 4M9XA 4M22A 4BZPA 5FUWA 5KTYA 2AXPA 1GNQA 2QPOA 4MRSA 1Y3AA 1XD9A 1T91A 4HAVA 3ZS9A 1YJ5A 4XD7A 3UWKA 1FP7A 3AVQA 1XJQA 1IN7A 1KK0A 5SZJA 1HTWA 4C7OB 4DCUA 3AF0A 1H8EA 1JNYA 3AVXA 5CLLA 3U3OA 4ZI3A 1OFUX 1ZNWA 2ERXA 3EAQA 2H8KA 5AWFC 2YYZA 3VKWA 2DYKA 2F3TA 4GP7A 2D2FA 2R6FA 4EJSC 4CF7A 3RS4A 3Q8XB 2IF0A 3A8TA 2ONKA 2O8FB 2WKRA 1D8TA 1S0UA 5KSZA 2GJ8A 1L7VC 4Q03A 2R8RA 3LX8A 4FMDF 1CLUA 2R62A 4B3FX 4GOXA 2ZSFA 4KV9A 2ERYA 4M0LA 2IHYA 1KJWA 1RFLA 2XTMA 1AKEA 3PUVA 2REXB 1ZNXA 4HUQA 1A1VA 4EPTA 1RVDA 1WB9A 4DSNA 1KKLA 3UATA 3C16C 4NYMR 5F98A 1DELA 4ERNA 1EFRD 1PLJA 4LBVA 4X8MA 2ZREA 2RHDA 1YZQA 1Q3HA 3B1VA 5FR2A 4PSVA 3LX5A 4ACAA 3V4RA 1UF9A 3AM1A 4UJ5A 5HTKA 1AA9A 2Q9CA 5CLQA 4LJYA 2QMUA 1S9HA 3QXXA 2XGJA 4A82A 1WCV1 4MYCA 3K0EA 3ZQ6A 2GZAA 1CRPA 2HXYA 3PFIA 1QHHB 2H57A 4LJAA 5TV2A 4TZ6A 1YQTA 2J0SA 2XXAB 3TIFA 2ZSBA 2XXAA 1E99A 3JVUA 1MO3A 5D3QA 3P4XA 3ETLA 5L3VA 3TUJC 4B3GA 4U02A 4DEYA 1G3MA 2ASEA 3IBGA 2FX3A 2GTPA 1G6HA 4DDVA 1G8PA 4UNQA 3A58B 2A30A 4RSGA 4YDSA 2JCSA 3I92A 3HWSA 3QNUA 1UKZA 1J7KA 3GLIA 2HV8A 2IYXA 1KDPA 3OEHD 4Q1FA 3BJIC 4HAUA 4A0FA 1Z6TA 2V55B 4DDWA 1Z07A 3QOFA 1UM8A 2PH1A 5JI2E 1NJGA 3WMFA 5FOUA 3T61A 3KKOA 3CKLA 4JLAA 2Q0HA 4A0GA 3CNLA 2JATA 3VQTA 5K8IA 2CCKA 3CX6A 1SVIA 2CL0X 1J8MF 3MUFA 3R20A 4JSYA 5DO9A 1OF1A 5HZHA 4C2UA 2ZYUX 4GZLA 1YZUA 1NIPA 1X8KA 5LD2C 3U44A 1GKYA 1Z3IX 3SNHA 2GZHA 3FKSD 3RLFA 5J4YA 3KKPA 4JT4A 4A6PA 2W6IA 2KB0A 1VKJA 2NO6A 3DM5A 4JSTA 3THWA 3ZIAD 4D4MA 3AP3A 4ZKDA 5EE0A 3KQKA 2VP2A 4KLZA 2QNRA 3GFPA 2JJ1A 1ZMXA 4KAXA 4RFSA 3HU3A 1GRNA 3UMRA 2HJVA 2IYYA 4E5UA 1E94E 3E1SA 2GEUA 1R4AA 2ZTSA 2XTNA 1ZU4A 4Z1MD 4BLSA 1N6IA 4HDQB 1XEXA 3HDTA 4GFDA 2ZRBA 2B21A 1KAOA 3AGQA 5TARA 4GDFA 3LAWA 3Q5EA 4NU0A 4NDZA 2WOJA 3MGCA 5DI3A 4I1OA 3P32A 4P4UA 4WXRA 5IT5A 5CITA 5JS8A 2C98A 5F3WB 2OM2A 4NYIQ 2XZPA 2XJ9A 3W8RA 2J7PA 1IN8A 1W44A 3SJCA 3TRFA 2FA9A 1OLOA 4Q4JB 3B5JA 5J47A 3GLGE 1FP6A 4PO1A 4W9MC 3HR7A 3IILA 4MKFA 4RFVA 3EPLA 1E4VA 1NN0A 1WRBA 2IW3A 2W2XA 3EZ2A 4N3NA 1OFTA 3CNNA 1ZC4A 2GNOA 2OEPA 3PCRB 1W4CA 4O25A 2P5SA 3AUXA 1ZU5A 1E0AA 4IVRA 3FPAA 3DOEA 1YZKA 3CRW1 1LS6A 3BWDD 1QZXA 3LV8A 1K5DA 4B48A 4A2WA 1PLKA 5JHGB 1VECA 2PEZA 1X6VA 5JJIA 1KO5A 3TUZC 1KSGA 2DHRA 2F55A 2BBTA 5FFMA 5KNDA 2C04A 1SQ5A 1W0KA 1NBMD 4N0EA 1GOTA 2FZLA 3WY9A 2HT6A 1SKYE 3BH6A 4LPKA 3B1WA 4NHOA 3GJ7A 4FI3C 1Z0AA 2ZJOA 1P72A 2ATVA 4RFSB 4YXWD 2RGDA 3BB4A 4X8OA 1CR1A 1SXJE 2CCJA 2OBMA 1BH2A 1NY5A 4RZ3A 5EP2A 5GADl 1OB2A 4QM7A 1T8UA 1GNRA 3NTUA 5IK2A 5EXSA 3P27A 4LRWA 2AWNA 4DEXA 2ZE5A 4Q1DA 4WIAA 2JDID 5TB5A 3TSOA 4MKIA 3SEAA 3VU9A 3BORA 4PXAA 4A8JC 1P73A 1AZTA 3W8NA 4E22A 3ASYA 5SZIA 2V1XA 1A82A 2ZYWX 5FI1B 2BEKA 3GLHA 3MWKA 4OQXA 4RZUA 2V8OA 4ZDJA 5E7MA 4DLXA 3GLIB 2PZGA 4PPGA 1KZGB 4EAQA 1SXJB 1HV8A 3U2QA 3B8HA 3RC8A 5CDFE 2GK7A 1CU1A 4LV6A 2B8TA 3TAUA 2EQBA 1R0YA 5KSYA 3AUYA 4OBEA 4BASA 1XTIA 3EPHA 4C4PA 4A4DA 3BS4A 4LJ8A 2VP4A 3ZGXA 4PANA 1KNQA 2YC4C 4JLNA 2P3SA 5BN3A 2A5GA 2ZJYA 1H8HA 2D74A 2BBWA 4EJSB 3CWZA 5DI3B 1E1QD 3K0CA 3ZS8A 5FTLA 2QE7D 3SFVA 1OSNA 5EZ5A 2QA5A 2F6RA 3TBKA 2IXEA 1VYUA 3RC3A 4A8JB 1Z6GA 3QBVA 2FSGA 1G16A 4POAA 1E9FA 2NTYC 1Z29A 1II9A 2UKDA 1QG4A 1TUIA 2QRNA 3B6EA 2OLJA 4ITRC 1NMZA 4AKEA 4URUR 4L9SA 1FNMA 2D7CA 3FWYA 1F2UB 3K0FB 1F2UA 3QF4A 4JJKA 2VP5A 4OQMA 1OW3B 3KKMA 4BWYA 3RSOA 3GEHA 3I3SR 4A36A 3LY5A 2ZRHA 5H8WA 3D7MA 2QSZA 3NBYC 2D2EA 4KLNA 3MMPA 1OXXK 4PAQA 2QP3A 1E2FA 4F92B 4FWIB 2XB2A 2EWVA 2FSFA 4WXPA 3CB4A 5JJKA 2IS4A 3ZZUA 5FUYA 2WSMA 2ODEA 1BS1A 4QG7A 1AS2A 1COWA 2TMKA 3NVAA 1OKKA 2GAOA 2H1LA 3LQRA 4BFUA 2O0HA 2BMFA 4RVCA 2ZR9A 4B44A 1GRRA 1T3LA 1L4UA 2A5JA 1CTQA 5E7JA 4BECA 1DAEA 3TW4A 1IY1A 1UDXA 1U94A 2IYTA 3WP1B 3SR0A 1E2KA 4TLCA 4C0LA 2CEAA 2OV2A 1NN1A 2V54A 2PLRA 2G3YA 5B64A 3WMGA 4OQNA 1UBFA 2IYQA 2EFHB 1PZNA 4TYNA 2K5UA 3QG5A 4B33A 4YMUA 4P32A 2GJKA 1JR3D 2AK2A 2PCLA 4LZZA 3VR4A 3AB3A 3UKDA 1BOFA 1YZGA 2A78A 1ZD9A 2HDNB 3QSYA 4TQ9A 2OILA 4LHWA 3BC1A 4V03A 3OESA 4KBFA 4Z54A 4DBLC 2MSEB 4DKXA 4D6PA 4C0JA 1P62B 2Q9AA 3NH6A 4B2LA 3K9HA 2XB4A 4O3MA 1PVOA 1G3UA 1ELOA 4D4LA 2VPPA 2FDCA 1IN5A 1E2MA 1SXJA 4Q4HB 1SXJC 2FSIA 4D0LB 3K0FA 2F9MA 1XEWX 4KODA 2QBYB 4IFBA 2QZ4A 2ZQ5A 4NCKA 2PT7A 3S1AB 4DSOA 1F5NA 4JLOA 3TR5A 3IDQA 4EFLA 2VTKA 4Q9JA 3ZZTA 2J0VA 1G7SA 2RMKA 1U0LA 3EZ7A 1BMFD 3R9WA 2OE2A 2FNAA 2QAGC 2JLQA 4TMTA 2EFGA 1N5IA 2OG2A 3RS2A 3SQWA 1OH7A 1NG1A 5AJYA 3RNLA 1KI6A 3L0SA 1LVGA 2A2ZA 5FTJA 2AX4A 3FHCB 3IIJA 3OHMA 3ND8A 2GWHA 5CDFA 4ABYA 3LVQE 2ODWA 4C2TA 4UNNA 4D0NA 2WWHA 3RWOA 3KKNA 4ON9A 2WSSA 1U2RA 1ZW6A 2V7QA 2BOVA 4LBYA 1UBEA 1ETUA 2WIAA 2CHQA 4US0R 3PUZA 4BFWA 5EXPA 1JR6A 3GQBA 3KL4A 1RIFA 4R2IA 4AURA 5AJZA 4GPTA 1KO7A 2G88A 3GJ0A 3NDBB 2CCGA 3ZD7A 1FPMA 1ONBA 4NYIR 4UJ3A 1XCMA 1MV5A 4DVGA 2WKPA 1E9AA 1SHZA 1NI3A 3TGPA 4KU4A 1W4RA 3GJXC 1G21E 3J81k 3CWQA 4BFSA 5KNCA 1G18A 5KYKA 4F91B 5D3MB 1NLFA 4Q01A 1I4LD 1N6HA 1OYWA 4PZLA 3ZH9B 3GLGA 2CLDX 3OE7D 5IDVA 4OHXA 2WWFA 2JA1A 3LQQA 3CR7A 3IHWA 2BM1A 1UKVY 4LV8B 1F2TA 3K9GA 3MCAA 2ZUBA 2WWGA 3BB3A 2BVNA 3LBNA 4LV5B 4LK2A 5DHFA 4EPYA 2P0EA 1G8GA 2VSFA 5FTNA 2IS6A 2VP9A 1EK0A 5TDHA 3LBHA 4C9BA 1GUAA 2XOKD 3BFXA 4FCVA 4TTPA 3QI2A 2DWPA 4L8GA 1AGPA 2H16A 3EZ9A 2CVHA 1VIYA 2W2VA 4K46A 1XXHE 1FZQA 1KHTA 4Q02A 3UWOA 1FUKA 4HAWA 1G19A 1TTTA 3C14C 3GJ6A 3R9IA 2SHKA 2VHQA 5JWHA 3QIAA 5C18A 3KXIA 4HLCA 2ZEJA 4ESVA 4TWZA 1TADA 4M1OA 2VSOA 2XAUA 3THOA 3VKHA 1U9IC 4MITA 1U9IA 1YVDA 3AVOA 3K8YA 5DIFA 5DE3A 4LPSA 5EP4A 5JI3E 4AKHA 1HQYE 1YZTA 3AF1A 5BW8A 2AXNA 4TYPA 2IL1A 1P61B 4PPFA 1NVVR 1KTVA 3FTQA 2G0NA 4I1SA 2FE4A 4PQYA 4MRNA 1HURA 4RKEA 5HE9A 2NO0A 3W5IA 1P4SA 4DHEA 4A15A 1N0VC 2QROA 2FJUA 2YNMA 5HZKA 1G7TA 1XCPA 1AGRA 3K70D 4QGAA 1IN4A 4XTRA 5A0FA 3AQ4A 4Q21A 721PA 1YR9A 3AKEA 2CVFA 4CEIA 1G1MA 2FFBA 2RB4A 3JZAA 3SJBA 3VFDA 3RAPR 2VA8A 2AL7A 3AVVA 2FFQA 2WIBA 1D2NA 4NKRA 4C30A 1PUIA 2QT1A 2C9OA 3A1UA 3IGFA 4OK3A 5AUQA 1YU9A 2J1LA 1KSHA 3A1WA 1D5CA 3WYFA 4E07A 2W00A 1CR0A 5ELXA 2RAPA 1XU4A 1K5GA 1U8ZA 3UMFA 2QENA 2JIZD 3IO5A 4TLDA 4FMCB 1OE0A 4LSGA 1N6LA 2PBRA 2QL6A 2ZRKA 3FKQA 3HJNA 3T1VA 1ZD8A 2KE5A 2G0TA 1XX6A 1BKDR 4M53A 5C46F 1VHTA 1Q21A 3CRRA 2WM9B 4TYQA 1KI9A 1S9DA 2QM8A 5HKKD 2X2EA 3N2EA 1ZBDA 3QG1A 1NN3A 4UKDA 1KDOA 1EFCA 2LWIA 4FMBB 1ZD1A 2GJAA 4C0AC 2FGKA 3NHBA 4TSFD 3F8TA 4DUGD 4JT2A 5B57C 1ZM9A 1F3OA 4PFSA 3CBQA 1WA5A 3G0HA 2OCAA 5BQ5A 2J0QA 4B32A 4PHHA 1E2EA 2IS1A 4LHVA 4IOJA 2O52A 2RGNA 4OI1A 1OXTA 4GI7A 3AEZA 2C8VA 4XJXA 3ZVMA 1QF9A 3B60A 4FD2A 1N5LA 1DAKA 3X1YA 3VAAA 1KYIA 2VBCA 2OCBA 4KFTA 1N0WA 4OHZA 4RJLA 5AJVB 4W5HA 2C78A 1UEIA 2B8WA 2IYLD 4DLSA 2UVQA 4IW3B 4D0GA 1EFTA 1FFHA 1N0UA 2W0MA 4Q4JA 1DAFA 3T06B 1FTSA 1XDBA 1S1MA 3NWJA 4V0KA 4TN1A 4DWJA 3GEEA 3HPRA 1Q12A 4H1UA 3NXSA 4HSEA 3IPXA 1A7JA 2O8DA 1II0A 2G1JA 1IXSB 3VNVA 1FQJA 1U90A 4YQFA 2NG1A 1SVMA 1SVOA 2BV3A 2CXXA 1AM4D 3BERA 2QI9C 1WXQA 4FN5A 1F2TB 1UKEA 3HR8A 2QORA 5HCIA 3C5CA 3IUYA 4OHWA 3SI7A 5KDOA 1Q0UA 3CONA 1TU4A 2HLDD 1MO4A 3WRYC 4YMVA 3GLIE 4CEJA 1Z0KA 4HATA 4JJZA 1JXOA 2UZ3A 3F5FA 4KBGA 4Q9LA 4DLZA 1KI4A 1J2JA 1H8ED 3C8UA 4P4TA 1TL7C 2V1UA 5L3QA 3A4NA 3AVYA 1P9WA 2ZU6A 1KIMA 1HEIA 4IDQA 4PZYA 3FOZA 4DRZA 1NKSA 2IXGA 2CJWA 4CEHA 2CJWB 3E2IA 3N2IA 5DLQC 3TW8B 5JWRA 4BLRA 2CMKA 2J9RA 3H1TA 2C9YA 2RGAA 3EIEA 1YZNA 4BUJA 2PCJA 1VCNA 1Z0FA 2A5DA 3AGPA 4BRWA 1G8HA 3W6NA 2YWFA 4PQRA 2P6NA 2O0KA 4JMPA 2OCYC 3BD9A 1NL3A 4GBMA 2C96A 3QE0A 5AUPB 1VPLA 2CHGA 2XNDA 4QHSA 3VR2A 4KHZA 3UPUA 2X77A 3BH0A 1CIPA 3QXSA 5JHHB 1W4BA 2PJZA 2F1RA 3I4LA 3AVPA 1W5TA 4I4LA 1TF2A 3IEUA 2Q3FA 2GCOB 4ZI2A 4DT1A 3THXA 2PZFA 4F38A 4RKFA 3THXB 5IF9A 1RC8A 1NVVQ 4KFSA 4OI4A 4KYIB 1FQKA 1Z0JA 1I4DD 3UG7A 1XNJA 3OEED 3MJHA 1GIAA 2Q9BA 2O8FA 1UDWA 3AKYA 1A2BA 3H0KA 4Q00A 2VHUA 1E9CA 2YVUA 4C0QC 4HB2A 3AKCA 4XOIA 3KB2A 1Q1ZA 3MAAC 4CGZA 4BZXA 4NBSA 2ZR0A 4L4UA 3WBJA 1II8B 2Z83A 5H1YA 4LYFA 1LV7A 3THYA 4KVGA 2MSDB 2IYUA 4WA7A 3BE4A 4ZCMA 1J99A 2WZQA 4IHQA 4NE2A 3AF3A 1DTSA 4IVQA 5A4JA 1CULC 5IHPA 4KI0A 2J46A 2IYWA 2ORWA 2GETA 1NVWQ 1R2QA 2OAQ1 2HCJB 4HAXA 1NMXA 4P4SB 1JBKA 1TF7A 4P4SA 4LDJA 5FUVA 5FUXA 1TUEA 3E5HA 5L3QB 3T1QA 1JEEA 3G82C 1E0KA 3PEUA 1XD2A 3WXMA 3KJEA 1XMSA 5JECA 3B2EA 2FFAA 3PENA 4TL6A 4D25A 1SHKA 2F7SA 4KO8A 4CZ2A 2GZDA 4TTQA 4LUCA 2EYQA 1J90A 3QJYA 1DAMA 5G3ZA 2GXAA 3CF6R 5HPYB 1HE1C 4G5QA 3F0TA 2R9VA 1W4AA 3LW7A 2V6JA 4LJ7A 4HZUA 5GVRA 3KJGA 1MT0A 1G3IA 1RRFA 5CM8B 4OI0A 1G8FA 4QM6A 4V0ME 1XTRA 3WYAA 2A3RA 3FKSA 2EU8A 1U99A 1VCMA 1KMHA 1WP9A 3LLUA 221PA 1ZAKA 2ZRFA 2W6ID 3X1DA 3AP2A 3SYNA 1GFIA 5UKDA 2Q3HA 3W34A 2NMVA 2W2TA 4IOMA 1KI8A 3ZIAA 1XMVA 2BHRA 1NRJB 4LHXA 4FMCF 4TL9A 4CT5A 3WP0A 3G5UA 1M7BA 1OXSC 2CK3A 1W1WA 2GXSA 2H7VA 2YWGA 3ZYCA 4CYMA 2B92A 1QHGA 2VP6A 4Z1MA 3ZDQA 1W36C 3VHLB 4PAOA 3U3JA 1Y63A 5BN5A 1KO4A 1NMYA 3A37A 4Q7LA 5CYOA 5GJVC 4EQ6B 1JJ7A 1CJKC 1L2TA 1WMSA 1DO0A 1FNNA 3GLHB 2IF2A 4NCIA 3IQWA 1BYIA 5FI0B 2ZSAA 1XTSA 5G41A 4HB3A 1OHHD 2AD1A 2HYDA 2QQEA 3CLVA 5EQTA 3VR3A 621PA 4IDHA 1G41A 2YC2C 4Q18A 1N3BA 4B3DA 4A9AA 3UK6A 2GCPA 2A9KA 5CK4A 4PC7A 3R8CA 1X1SA 1NIJA 2CNWA 1G5RA 3SDZA 2IA5A 1OIXA 3K0SA 2CLSA 3OIWA 4V0OA 1JECA 4CEJB 1EWRA 3I62A 2GESA 4LBZA 5JBQA 4Q4LA 3WHKA 3ICQB 1TPZA 4Q7KA 4TYYA 4AYTA 1T6NA 2PT5A 5GJBA 2VQSA 1IN6A 2RCNA 4TMWA 1XBTA 1MOZA 4B3XA 4CW7A 5IRCD 3GMTA 1DAGA 1KSFX 1XPUA 3MWYW 4NYJR 4MA4A 1RJ9B 2HF8A 3B1XA 1CXZA 1UEJA 3SC3A 3PJRA 3LW8A 4AY2A 2DWQA 1XZQA 2G1KA 1F48A 5DISB 3RHFA 2YHSA 3V9PA 1XEXB 4YXWA 2IWHA 1NN5A 1GL6A 5FPSA 1TQ2A 1QHIA 1ZINA 3SYLA 3K9NA 2ZVQX 1DO2A 3EC1A 4N0DA 4BPBA 1M7GA 4R7ZA 3Q3JB 2X19A 1JQLB 2GXQA 3I8XA 4A1FA 5IK2D 2FZ4A 1E9RA 1NF3A 1ODFA 2AKAB 1S8FA 1Q22A 2B6HA 2CDNA 3UANA 1ZM2A 3R7WA 5JEDA 1M7HA 2JDIA 5GJCA 1SVLA 3TQCA 5L3SB 3AF2A 3SBDA 2I1QA 4HLUC 1T4GA 4LJ9A 4QXAA 5KDDA 3D31A 4JVMA 3TUIC 1DADA 3KDSE 5KNBA 3PR1A 1AQUA 2YWEA 3SJAA 1U8YA 4MRVA 2F43A 3TQFA 1R6BX 2N1BA 2VHJA 4KYUA 1TQ6A 1T5LA 2WVJA 4XWAA 4C0SA 2I1VB 2WJJA 4GSYA 4WZ6A 2IEYA 1RE0A 4OYHA 4DB4A 2OO7A 1UKYA 4D2IA 5AUNB 4FXPA 4Q48A 5TVKA 3ZVLA 2HT1A 4JLKA 1P5ZB 4V0MA 3CRMA 3CR8A 1JI0A 2RGCA 3U44B 2C77A 2ZI7A 2GKSA 2JLSA 2OFWA 3DHWC 4JZKA 1H8HD 1XF9A 4I99A 2LCFA 2QMEA 4HEJA 1E1QA 2WAXA 3M4YA 2BDTA 3P20A 2W83A 2O8EB 1E2HA 1OIVA 4Q1CA 1NSTA 5FPKA 3C41J 1KY2A 2ZPTX 1ZIOA 4Y0AA 1MABA 3B1YA 1GVNB 2QPAA 4HDCA 2VLIA 4LBWA 2XZLA 1XJ0A 3VX3A 1CJTC 1DEKA 1VMAA 2VRWA 3B85A 3KQUA 3C15C 2XEXA 2FSHA 1JJVA 3LNCA 4PHGA 4QFMA 1RRGA 1E2PA 4GMXA 2IYRA 4B35A 4UQOA 2F1JA 2R6GA 1RRCA 1XEWY 1E3MA 2ECKA 1LTQA 1A2KC 4KFUA 4OQFA 5K8LA 3GCGA 2GA8A 2KI5A 2QPTA 1RRPA 4XSGA 2C5LA 3FB4A 1YHNA 3O8DA 5E4FA 4WZBE 3MG9A 1SULA 3NHAA 1COWD 2GEDA 4OKSA 3QEOA 4A6XA 2VF7A 1OKKD 2ZE6A 4NP6A 4JBXA 4EFMA 3U7EB 2GF0A 3ZVNA 3KQLA 1FL9A 5DYIA 2WPDA 4QGFA 4FMDB 4LCBA 4GT1A 3U7HB 1LS1A 1MKYA 4JBYA 1Z83A 2QU8A 4LJ6A 4LYJA 3DPUA 1KI1A 4NH0A 4MGKR 5CJ2A 5CK5A 3EARA 4M1SA 4HB0A 3GJ8A 3FYHA 1WF3A 5P21A 1P2SA 1T5IA 2UZIR 5FOXA 1AKYA 2C03A 2W58A 2QRZA 5F2EA 1ZCAA 2OFOA 4QGHA 4WW0A 3WHLA 1KK3A 4TLAA 5DNYB 1XB2A 1KMQA 4JVLA 4URXR 4K81B 2JLZA 5JSZA 1FUUA 3NC1C 2EFEB 1ZRHA 2NZJA 2RKOA 3I73A 2QY9A 4M1MA 3EPKA 1G3RA 2IC5A 4OHVA 1LB1B 1G6OA 1Z0DA 4IDPA 1JAHA 4D4JA 1N25A 3CRVA 3UXMA 2EYUA 1E2IA 2R44A 4IFEA 1UBCA 2LKCA 1Z63A 1SXJD 4G3XA 4QRHA 4OJQA 3NDPA 521PA 2NO9A 4P0TA 3LVRE 3A4LA 4DIEA 3ADKA 1W48A 4PZZA 1DG1G 2BM0A 5KDLA 1GAJA 1GWNA 3GD7A 2FPKA 4L5BA 2YINC 3IIKA 2EVWX 3QUSA 3GLHE 4M9SA 3U3MA 1R5NA 2ZE7A 3F3YA 5AJXA 2ZJZA 4C0BA 4M1TA 1FX0A 4IXMA 4YLGA 2IWRA 5A5GA 1YRAA 5AJWA 2D3WA 3QKSA 2J7KA 1OYYA 3SOPA 4DC9A 1T0HB 1I2MA 5JCPA 1D2EA 2NGRA 4FWTA 5LPNA 1G8YA 2H5EA 1W46A 3FMPB 5CIWA 4DCNA 1NKTA 2REBA 3RYTC 5EP3A 5C4GB 1E9DA 1KY3A 3CPEA 4EPRA 1QHYA 1P60A 2GBLC 2V7QD 2J45A 2D4HA 4URVR 4W5JA 4OL0A 5B2ZA 1OH6A 1MO6A 3U61B 4UXHA 3GLFE 4ZIRA 1S4QA 1IXZA 1PJRA 5EP1A 4TQAA 2D62A 1BO6A 1ZM7A 1E79D 1DVRA 4TYWA 2ZYTX 1OT3A 3SS8A 3CPJB 2CBZA 1KZ7B 2R6CA 4ZKEA 1P2UA 5LB2A 2AKYA 1PV4A 4OK5A 5BYJA 1W0JD 2QAGB 2ZANA 1ZNZA 2ZI5A 3NC0C 3MLEA 3AVWA 3CPHA 1QRAA 4BFVA 3B78A 3NBXX 4U7DA 4JLJA 2F9LA 3IHLA 3QBTA 3C4JA 2KBFA 1CKEA 5KSPA 2Z43A 5JMTA 1E2NA 3I72A 3Q85A 3Q72A 1ZVQA 4MGIR 4WOPA 1OV4A 4G1UC 1VYVA 4HAYA 4PO8A 2QTFA 2OBLA 3QXJA 3TSWA 5LDDC 1CS4C 2DY1A 1P9NA 4PR0A 2QMHA 5FPTA 4AYWA 1E98A 5KO2A 4TMZA 4H9GA 2JAQA 5JZVA 2HEIA 4Z51A 1RKBA 1SVKA 4R9UC 1HE8B 1E2QA 3GEIA 4OHYA 2H18A 2EFDB 1QHNA 5LD2B 2WMNB 1KI2A 3OIYA 2VP0A 4NPHA 3LA6A 3GFOA 4QBGB 2ZAMA 3DMNA 1K6MA 2V9PA 4L9WA 4EIWA 1XWIA 5FOWA 5CJPA 1N2CE 4WVFA 4JL6A 3PG5A 1IOZA 4KSCA 3TAHA 1SKQA 2EWWA 1Q57A 3L0OA 4A92A 2PX0A 4HLUA 2YOFA 2ZI6A 3NBZC 1KI6B 2J0UA 3RS5A 1G5TA 2ZRCA 4G5OA 3WMEA 2XNSA 5DN6D 4XTCS 3KKQA 3KXLA 1FX0B 1Q3TA 1QVRA 3EIHA 3QVUA 4IOLA 4Q47A 3RS3A 3L8ZA 2Z5FA 3B9QA 2ZVPX 4A8JA 3RRZA 3L2OB 1W5SA 3BGWA 2FEMA 1G20E 3VR1A 4YMTA 4PPQA 3U3RA 3DEFA 4NYMQ 4LGMA 2Q3MA 2VH5R 4PC1A 4XH9B 2BBOA 3KX2A 4DJTA 1RYFA 2HCBA 3H2YA 3H84A 1A5TA 4ZCLA 2QEQA 4IOKA 2QBYA 2ZUCA 2ZRIA 2W0SA 1E9SA 1E32A 2YJTD 5EJEA 2OXRA 3A1VA 1G5PA 2ZM5A 2LKDA 2BC9A 3T12A 1ZUIA 1O87A 4DZZA 3NEYA 2JLYA 2RHMA 2JIZA 3OFNA 3E70C 5SZKB 3OAAA 2GCNA 2GF9A 4ZDWA 5K8TA 2IYVA 3ZJYA 1UADA 4JIMA 4JKIA 3U4QA 1QG2A 1VIAA 3BBPA 3I8SA 1XTKA 1M8PA 2ZU0C 3T1TA 1X1RA 2VL7A 4BFXA 3NEJA 2FPMA 3PVSA 4UNSA 2QAGA 3EG5A 1TEXA 4E03A 3A1SA 3M0EA 4BGDA 5AK0A 3K1JA 3DKPA 3QKRB 4QNRA 4S35A 2X1VA 4DUGA 3CNOA 4DXAA 1AS3A 3W90A 5EE1A 3Q7PA 3LBIA 4F4CA 1C4OA 2IK8A 3SYKA 4R2HA 4BFYA 2GVZC 1YR8A 3ADDA 4G0NA 2GJSA 1ZM3A 2WAYA 1QHSA 1ZP6A 4TT3D 2JLUA 3T34A 5EZ6B 1P75A 5FL3A 3P26A 2PX3A 2ZJ5A 1GILA 3A1TA 3L0PA 4HI0E 1W2GA 1KJZA 1N6OA 4R98A 4XVRA 1Q44A 1QVAA 1Z06A 2P6UA 1GL7A 4BRUA 4ZDIA 3SN6A 1W2HA 1FTNA 2AD5A 3W6PA 1NLZA 1SVSA 5EE5B 3WNDA 1N5JA 3EX7C 1QHHA 3I32A 4GOKA 1DG3A 1Z47A 4M1YA 1VG0B 4M2LA 1OXVA 4Q7MB 5DH9A 2GXUA 4RCZA 4ZIRB 1N6NA 2Z4RA 2PLFA 3EASA 2FWRA 2P2LA 4G5GA 4IRUB 1U0JA 3PEVA 4JYBA 4KJZA 4V02A 5E7IA 1RPZA 4LJ4A 1N6PA 3K70C 4TTRA 3RABA 5GJWC 2X8AA 4J0QA 2ZRPA 3PEYA 2IBMA 4QGGA 3TK1A 3DM9B 1AS0A 4B43A 2ONJA 2QG6A 4B47A 4M9ZA 5C2JB 2HLDA 1LW7A 3PUXA 4Q4AB 4S2EA 4TLBA 1XD2B
chains in the Genus database with same CATH superfamily
4JC0A 1UC4B 2I7TA 1N2CB 4MGZR 3MMSA 4I55B 3DYVA 4X3PA 3O93A 1CJSA 3TNLA 5ALFA 2ZBQA 4JL5A 3JYHA 4G09A 4KWEA 4TL8A 1WOYA 4I7EA 1IONA 1MUUA 1K4YA 3R9XA 1S3GA 3AH8A 4JBHA 3LUAA 5AXAA 4RTJA 3MOSA 5JAQA 2EKLA 3BUSA 3EXHA 3GDWA 2WFLB 1CUUA 2GFQA 4DYHA 5CDYA 3WMWA 3TE7A 3S1SA 3MJCA 3PS9A 2Q5FA 2VG8A 1M5RA 2UZ1B 3ZE0B 3PUIA 1DOHA 4H1HA 4TS3A 3RSQA 4EVSA 1NDQA 5MGNA 2YV2A 4FR5A 4HXGA 5J23A 2VDRB 2ZUVA 5EQFA 1L5NA 3QTTA 3VR4H 4B4WA 2VAPA 1HT3A 1OI7A 2CBXA 2ZAOA 4RTNA 5AW6A 1OIWA 4J3NA 2AR7A 4BNMA 1B26A 4D46A 2WABA 2NACA 2N0SA 3D6AA 3GJ4A 4K6CA 3KU1A 1IBRA 2P2NA 2OXFA 1CJMA 3C3JA 3L8DA 4KWCA 2BONA 1C3OA 1NOIA 3KLBA 3H2SA 4IDFA 4BPRA 3U7IA 3DTVA 1FP1D 3GH3A 3OEEA 1EIWA 1SMKA 3O8QB 4B74A 3U9LA 1FFWA 1WE2A 2ZSDA 1YBHA 1E69A 3DEKA 1YA4A 1MAHA 3NKVA 4QJ5A 3ZCRA 3CLTD 4TT8A 3F47A 5FLEX 5CYFA 2C4VA 2QP9X 4YONB 4C0KA 4Y1GA 4G0QA 2R97A 2O7SA 4Z4GA 2BFDA 2VUTA 3AINA 3SQDA 1Z45A 1NW9B 3QMVA 4X66B 1YMVA 1FDTA 4WY5A 2ILVA 4PGMA 2E89A 2OY0A 1EFVB 2JGNA 1S3SA 1FDSA 2WQZA 1GSHA 4AKGA 2XSZA 2AQKA 3RFVA 5LBTA 2BLLA 4R6XA 4RPJA 4B46A 3WK6A 1UUFA 4NTZA 3SS7X 4CKWB 2CL6X 4N3CA 3C6MA 3OTIA 1NP6A 2NO1A 3RKUA 1N4AA 4C1BA 2XY4A 1GCAA 3IRVA 1DOAA 3L8YA 4X62B 3AFGA 1NY6A 4WPGA 3TXXA 2VPXA 3X1JA 2JASA 2ASVA 5C35A 4I50F 1YAJA 3LRTA 5ALIA 2CMDA 3C1UA 3EVCA 2NYVA 5FOTA 5CCXA 1I6WA 5CRIA 1WBBA 4MHTA 1RI4A 2B61A 2ZS9A 3QQ5A 1QP8A 1X7DA 1XTPA 2XX3A 2NUAA 5PGMA 2V9ZA 5ULLA 1B2LA 2BCJQ 4QJ3A 1M2OB 1MCZA 4V1CB 4RTLA 1P2VA 3IRUA 1W5BA 3K1ZA 1KGSA 3EW9A 4Y2PA 3RDPA 3OQNA 4IJVA 3V3TA 1J2UA 4NBRA 1P1FA 3QXHA 4QT0A 1JZSA 1U8UA 3A1FA 2A35A 2BI4A 2QAJA 1UK9A 3USES 1T0PA 4BEJA 2FEPA 3ETNA 2HQBA 3G5AA 1NXXA 3H2JA 1D9ZA 4J9VA 4YMWA 1TU0A 5HEKA 3WYGA 3ZVRA 1ULSA 2H59A 3JALA 3HGTA 4XD7D 1CZLA 3OQMA 1YKSA 2HK9A 1K66A 3AR8A 3I05A 1UM9B 1L8OA 4GX2A 2IEZA 1PFKA 4P31A 4RKWA 3SQOA 5DYTA 1XCGB 3W04A 1YC2A 5BNTA 3P5SA 2WF9A 3ICPA 3V7YA 4JDUA 1UXIA 1J2TA 2VT7A 4V0NA 3GBSA 5FEMA 4DF3A 3KETA 3O9VA 3GHYA 4OI2A 3MD9A 1E6LA 3BRQA 4M76B 4HPXB 4FT4A 4PC6A 2IV2X 1IEXA 4OQ4A 1PNVA 3KWMA 1IEVA 4ZYTA 1MC1A 1PL7A 1RYEA 2JH8A 2D13A 3EZGA 3JQGB 1G3QA 1RBZA 4KIGA 3FH0A 4RHUA 3UXEA 3KYIB 2L0XA 2VNHA 3DNFA 3U62A 1TA0A 1HUQA 1Z7BA 3PXUA 4ESEA 1P5RA 4IDGA 4Z9FA 3KOYA 3V1LA 1YVEI 3IR5A 1OB5A 5F3WB 3R3ZA 5JFGA 2OLEA 4ICIA 3CCCA 3EC2A 1HT2E 4CI0B 2ZS8A 5ADHA 2O0LA 4R5HA 1E6KA 2PZMA 1FFXA 2ZS7A 1VZ3A 3UAOA 5HCNA 5F51A 3S68A 2GHIA 4Q7EA 1KI7A 1HNZB 1VCIA 3NIDB 3GELA 3GLGB 1E5QA 2ACKA 4CV3A 3N7TA 3WFJA 3WL6A 1EQUA 3PJFA 4C4YA 3NIBA 4E51A 1EFRA 1KO1A 1T13A 1GSOA 2Z6QA 4HNRA 2R25B 2O5VA 1Q14A 1K75A 4CMEA 1RP1A 4OXQA 2ZRGA 2ZJAA 4BNJA 1C7EA 1RZVA 1R0ZA 1H05A 1T36A 2ZB7A 4W5QA 5ALXA 3IBTA 1Y3IA 3EXHB 2CNWD 2PRKA 3KLMX 3LXRA 1KQOA 4RZHA 2Z95A 1YDEA 4KDEA 4O1HA 3RWMB 1RBYA 1Y8CA 1A4RA 1ECPA 4PX9A 4C2AA 4ZZ1A 5K03A 3X1WA 4H16A 1P74A 3KLNA 3FJYA 3G3EA 1SUWA 1WLSA 3FPBA 3U4IA 5F21A 5ALHA 1UMBB 3SSAA 4F6RB 5JZSA 4AW9A 4ZOQI 2NZ2A 2YUTA 4RXTA 3ZDDA 3E8XA 1EEHA 1HMPA 3SYRA 3HCCA 3O5AA 4FGLA 3C24A 3WBFA 4X85A 3QU7A 4HYQA 3A9CA 3HC7A 3KJHA 6AT1A 1XN1A 4CDGA 3H97A 1GG9A 3PD7A 4UW9A 4D8XA 3UV6A 5CA1F 3GYBA 1H9CA 5AVQA 4TQUS 1M2GA 3PGKA 4L9AA 1O5IA 3O2JA 5DYNA 5ILGA 1CY0A 1KI3A 1ZGBA 3CLHA 1JEDA 2AJCA 4JBGA 5BN5B 2JAPA 4DUZB 4BBJA 1EX6A 1VPVA 3HR4A 2NXNA 5LL6P 5LP6F 2C29D 2Z6VA 1J4AA 4BFCA 3T5DA 1C80A 4QUBA 4WL0A 1A9OA 2Q5EA 3AP1A 4QYXA 4XFKA 4Q7JB 2OFXA 1MU0A 4V1CI 2ZI9A 4R05A 4CT0A 4EHAA 3BD7A 3I5MA 1P7VA 4PYMA 3QU9A 3L0DA 3DL4A 5CURA 2OENG 2XNHA 3C45A 4G01B 1R37A 4TTTS 3TZHA 4UATA 3UXYA 3ZHTA 5BN4A 2O8NA 4RV4A 4US1R 3ONNA 3S55A 4M87A 4DCJA 4AL4A 4KL8S 4KXXA 3MRSA 1DBRA 1JHPA 4EY3A 1G5IA 1Q15A 4TGLA 3IDSA 2BFAA 5E95A 1DOZA 1U7WA 1Y7HA 1Y5NA 5DHAA 2ZIXB 1H1TA 4BNKA 4EG0A 3PFCA 1JB1A 3QA9A 4UMFA 1R8YA 4WVLA 4GLBA 2BMWA 4K5QA 3ETEA 1VHJA 4H0CA 3QXCA 4FPXA 1DARA 1PJZA 1RWMA 5KTSA 3JVDA 3Q4GA 5ELLA 3TCNA 5FI3A 3QEKA 4D3YA 2QX9A 2HYIC 5K5EA 4L1KA 3ZV3A 4FB4A 4M1KA 5LSAA 4QTYA 1LBQA 2BKUA 2CV2A 1DQNA 2VRCD 1KMHB 2VZ8A 4OG2A 4XWTA 4IFIA 1L7NA 4TTVA 5KINB 2REOA 4ZTBA 4ZDKA 2VJKA 2WWWA 1R0BA 2GVDC 3FE2A 4MWTA 1CC1S 1D9XA 1T9KA 5DULA 4BZZA 4DZRA 4IP0A 7GPBA 2P91A 4EGFA 2Y93A 1VXRA 1CY8A 2XOEA 2CDRA 1XP5A 2HCTA 2XW6A 4MW4A 2LXNA 3IAFA 1TZ2A 4X7RA 5HX7A 2JLRA 3CZCA 4JJIA 3RYCB 2N47A 5IM5A 4B83A 4RGQA 3DEJA 3DWGA 1K7YA 2QUAA 2QZ9A 5AT1A 1C50A 1N7JA 2IH5A 1UK8A 3T95A 4RZXA 2J6CA 4OLHA 2ZIFA 1S5PA 1U2GC 4AIIA 4AZWA 1W36D 3N9IA 3VGJA 2DPLA 4PX5A 3ZEIA 3NAGA 2ZYIA 3MWJA 4E31A 4PONA 5DBEX 4RVOA 5C7LO 3D7NA 3CLKA 4ZGWA 4PEVA 5JO9A 4GE3A 3MCUA 2FMHA 3X1ZA 1NJFA 4RHCA 4I9UA 1MA0A 4V0LA 4W9NA 4C6TA 2QK4A 3DQQA 4QUDA 2EZ4A 4YTEA 1ZGGA 2P8SA 3HBMA 3LM8A 2I4IA 5K05A 3CIFA 3SY8A 1A95A 2D7JA 3MJSA 3GLFA 3NJ4A 1JQDA 3KU4A 1SIOA 2C2HA 2VHTA 4MKHA 3WRXC 1GCIA 4WE3A 1U0GA 1YIAA 3ANTA 4P3YA 2DQYA 4TXNA 4XGKA 1F0KA 1MTZA 2WFMA 4BLOA 4KGXA 1BDMA 5CNMA 3OU6A 1JTFA 2F8TA 4O4JA 3D7RA 4UEQA 3GDGA 4I81A 3DDOA 1C8LA 2ZIAA 3FPLA 3K8OE 1QP0A 3V32A 1OH8A 3CLRD 1C2YA 1FFBA 4YV1A 5KTTA 3GCDA 1GU0A 1JG1A 4GF5A 3TTVA 3T99A 1Y9ZA 4INPA 4O2BA 5JD6A 1GKUB 2PR7A 2B30A 4MS3A 1J1UA 2RGGA 1A8PA 1T1JA 3QFFA 4MQUA 2XITA 2ICAA 3E61A 4N0QA 1XQ9A 2CXUA 5AW7A 4Z8YA 2BRUC 5BWBA 2R7NA 2WHYA 4RK5A 1WHSB 1BKYA 3UW3A 1H85A 2WYUA 2JIDA 4AU1A 4HDNB 3LPDA 3R5HA 3NEPX 4KDCA 2ZIUB 2Q1SA 4F1WA 2BM9A 5T57A 3RIEA 5HKAA 3P2EA 3GNLA 2BEVA 4HJRA 2Z57A 4HX5A 4DRXB 2I6SA 3ZCSA 4MXDA 3WYBA 3RC1A 3ZHVA 4EI9A 2NU6B 2ZE8A 4G4SP 3GLUA 3H2GA 1XXHA 2RDMA 4FJ2A 3T35A 1JKJB 1H3NA 1RQGA 2PL1A 1ZITA 2Q5QA 3FA2A 4KWTA 1XCBA 4B81A 4C4OA 3ZZ1A 2E4UA 2WK1A 2X2PA 3FMVA 3VMFA 3PFFA 1SVWA 2ZIWB 2G17A 2WIFA 1E5TA 3QY0A 1VKZA 2XV1A 3BYZA 4GGMX 2A33A 2DFKB 1YU6A 2CLCX 3EZFA 1KYWA 4PG7A 4TVKA 3QYFA 2ORIA 4QBHA 3Q1LA 4KQFA 2PKQP 3JXEA 5E2BA 2R1TA 1C9YA 3ECCA 3LKBA 1FOEB 4CDRA 3NAZA 4X6YA 3GCXA 5HQJA 2BKEA 5BQOA 3NPMA 1TAUA 5JS1A 2GMWA 1U28C 3LDAA 3A9WA 1PS9A 2NSDA 2QE7A 3KEGA 4RD4A 4QYSA 2D06A 4G4JA 4H08A 1H6DA 1GTG1 1RLMA 3LJKA 5AYVA 1RFGE 2BMEA 3PXEA 4X41A 3RSHA 2BJWA 2HQOA 4J7UA 2ZBEA 4RF2A 4JP1A 3QNMA 3RBVA 3JQAA 2J5XA 5B58C 3ZXSA 3H42B 3ENZA 3U1VA 1CNEA 3A4TA 1MR3F 3T0FA 4S12A 3WWZA 3SJZA 2OT3B 4A27A 3OM1A 1SVNA 5AOCA 1ZRSA 5L95A 4RESA 4KZKA 5IH3A 4FZRA 2OECA 3KL2A 3V2HA 1WSWA 2BEWB 3KQYA 3WZMA 4TL7A 4O0MA 2JS7A 2IDKA 3MELA 3OPXA 4Q7QA 2FFHA 3C7CB 1BVUA 3PV0A 1HC7A 3F78A 2ZJBA 4HUQB 3RADC 1EUDA 2RGEA 2Q5OA 3JR7A 4MVWA 3VDNB 5SZHB 5T64A 3C70A 2HIMA 2ZPAA 4XQEA 3S2YA 1MH9A 2PJRA 3ICVA 2OCKA 3P4YA 4FHZA 5CXUA 3CKKA 4QFCA 4IZHA 2JCYA 2H52A 2HA4A 4N01A 3WLIA 3ER8A 5C5DA 2DTDA 1JPJA 4YHBA 5CG2A 1XRRA 4FC7A 2NZ8A 3NS7A 3GVXA 1ENPA 4KB5A 3ZLVA 3UJ7A 3LLVA 1SU4A 3AEKB 4LJRA 2E1PA 1OJLA 2EBFX 4X60A 5CH8A 4DXDA 4RETA 1N8NA 2X5NA 2YIJA 2QTVA 4DOMA 3NOQA 2WIDA 4AJ9A 3G2NA 821PA 3N2NA 2YJ5A 2ZSEA 4U2KA 1PR4A 2G72A 3BRSA 3PX2A 4Q9KA 4JBWA 4Y6QA 5ERYA 4E46A 2WMYA 3R6TA 4F60A 1M1NB 1ZCBA 1KBQA 1POXA 1Y37A 1RW4A 1GT91 3UG6A 2O2JA 4ID9A 2VDQB 1N5KA 3JAWA 3W79A 2QW8A 4GWLA 2Y1CA 3NALA 1J0CA 1UPUA 3IVCA 2ANBA 3Q3GE 5FBZA 4ZHQB 1XLTA 1ICIA 3FVQA 4R9SA 4ND8A 3VTFA 1HZZA 3QXGA 1ZL0A 3HBAA 2CHVA 4X61A 1X7GA 1ESNA 1V95A 2OVBA 1EESA 4FW8A 1P29A 3WMXA 5EUBA 1QZUA 2O3SA 2OZLA 3SIRA 2BTEA 3RM3A 3X3HA 4RJTA 1LQTA 4YVFA 4BNTA 2PVSA 1V2HE 3G1TA 1J07A 3L8CA 3SEFA 1C81A 1HDZA 3SAJA 3PGJA 5M04A 1CY6A 2BFMA 4P7FA 2NSHA 4NICA 3T0GA 2O8CB 1H2XA 5K6AA 3A4MA 3TS1A 2PU5A 1AHIA 4K9NA 4MULA 3UMJA 4M8KA 2EZTA 1LF0A 1N7GA 1FK8A 2AOXA 4RVSA 2YS7A 4CIWA 2JIRA 3PC7A 3GLFB 1TXGA 2ZSJA 2B35A 2ZRLA 3AL2A 1QOQB 1R18A 3D6UA 3IE2A 3IUPA 1G63A 4L28A 4Q1BA 4MVJH 2D5AA 5FLXA 4TOIA 4WBNB 1Z6ZA 3OEWA 4UXJA 2YN4A 3OURA 4R1TA 1SQ0A 5EHQA 5DCYA 3CN7A 1YZLA 4I4TA 4HZUB 1VG9B 2GM4A 3NT2A 1W76A 3KYCA 4YFVA 4KR9A 2KQUA 3ASVA 1EGHA 1M2VA 2JVJA 3O82A 2AN5A 4L5JA 4DV0B 5ITWA 3OAAD 1X15A 3DR5A 1LU9A 2OAP1 4HNHA 4BMDA 5FV7A 5HUJA 3P9NA 1KK2A 3QVGA 3ZCTA 3K0AA 4BV2A 4G0MA 3W5AA 2WKQA 1A69A 3EA4A 4GVPA 4MV5A 2O2CA 1U7XA 4UDYX 1O0SA 4YUYA 6REQA 3QFHA 4BJ3A 3AR6A 3OCCA 2YXLA 1OLXA 2FHSA 1H2AS 2R79A 4BO3A 4Y6OA 5E2IA 4W8OA 3DL0A 3LIPA 3TVYA 3A2KA 5B3AA 1IXRC 1J06A 1HYQA 3SGLA 3G0OA 1XQ1A 4XYBA 2NSLA 3CUKA 3KPVA 1YBVA 4DCVA 4ZMRA 1ZUNB 4NARA 4HEHA 3BTOA 4E2ZA 3DOCA 1DMRA 3QVTA 4IHJA 2AA3A 5J40A 3PZRA 1CY4A 1K8RA 3CW2A 3W2EA 1L4EA 1H1LA 2H17A 3NC4A 1EB8A 1Q84A 2I7DA 3O8BA 1WBJB 1HA3A 3QBJA 1QLJA 1OTXA 1Z2AA 3OE7A 5F3RA 4P82A 4JLDA 5E9AA 2KJQA 5BMVA 3KQHA 4B6PA 3N05A 4CEIB 2HMTA 4ZEOA 5HUHA 3R4VA 4WTOA 5THKA 4ZYXA 1D8AA 1KOFA 2DMRA 1M8FA 1T10A 3WZLA 4HQOA 4O6VA 1JG4A 2Q21A 2GBFA 3LY7A 4F4IA 2DR3A 2Y92A 3PPWA 1SUPA 1UINA 2G9VA 5A4IS 3QVVA 1JAZA 2HRBA 2FWBA 2AGVA 3QKUA 3PITA 4FONA 4JU9A 3P71T 1CSEE 3WGTA 5FWXA 2YKGA 2XOKA 3AVTA 2IE8A 1NVTA 2CSUA 4FYHA 3DZIA 1E2BA 1G7RA 1BXRB 3AEQB 4XWWA 4GOOD 3K6JA 1DBVO 1V4VA 3O4JA 3BD6A 4KXQA 4DLWA 1GCGA 3OICA 2BZGA 2XCUA 1U1EA 1HFKA 4WAUA 4PHFA 3KBBA 5ITVA 1J8YF 1SGWA 1XMIA 2H00A 2HLPA 2I6TA 2G6BA 3U4AA 1VG8A 2Z04A 3RLIA 1NYTA 2PMDA 1KO8A 3F2VA 4EUNA 5KWIA 1C0IA 1Z0ZA 1FNBA 5JARA 3GJ5A 2WP0A 2QDKA 3PJDA 1A5ZA 5A71A 3UHJA 1SBTA 2REQB 3PUHA 2P65A 3PNVA 4J94A 4N41A 2W2KA 4F9GA 3FMOB 2ZXUA 2D2VA 3IKJA 3W1WA 3DHVA 1JXQA 2Q46A 1JBQA 1S01A 4RQAA 2FEAA 4FYYA 1WMEA 3WB9A 4EDHA 2YNMD 2ZRJA 4M0EA 3K70B 3FIJA 1YFZA 2EC5A 5JCZA 2N75A 4FCWA 2C92A 3WSTA 4PHTA 1L3IA 4YR9A 4INJA 5NLLA 4LRSB 5H9VA 3EXFA 3WRVA 2AHOA 4DMUB 1LZKA 3GBVA 5BT8A 3Q8MA 2ZP1A 2P75A 3ZEAA 5B1EA 1PZMA 2IDJA 1Z74A 5GQSA 3SIPA 4BWVA 1POWA 1V1MB 4UTRA 3DLBA 1GL9B 1B14A 4RADA 1LDYA 1HRDA 4YJHB 3WXBA 3TLJA 3JPYA 1MFPA 2CDAA 2DPHA 3CUUA 1UBOS 3DXYA 3HKDB 2OC9A 3ORQA 3B52X 5DPMA 4A0RA 2Z3VA 5C81A 5GVSA 2HADA 1NUAA 5BQPA 1EFDN 1KC1A 4UAUA 2AC2A 3RVRA 4TN5A 4AMGA 6NULA 3K8ZA 3I5YA 3CE9A 4OFZA 4ZCRA 4F93B 1GPKA 2EW8A 5BSGA 2CXSA 1E6CA 5AM2A 3KB1A 4R81A 6CHYA 2C4HA 3QUTA 1EFHA 1SZPA 4BO8A 3WGUA 4JR0A 4WXEA 2Q6KA 4AZ0B 4OIFA 2QXUA 2FN4A 1ECCA 5L6LB 3RNOA 4HDMB 1ENOA 2OAEA 4TV8F 2V4MA 4HLQB 4PZAA 5IUJC 4DCTA 1T9DA 1O2DA 1XJCA 4F4JA 4KR2A 2C7PA 1FTYA 3MMZA 3QSGA 3EWSA 4TSFA 2PLWA 2WTXA 3DZBA 5F1OA 4DG8A 1GN9A 3U4GA 5DM0A 5AVJA 4CKEA 1N8SA 1OFHA 1OLUB 2VF2A 1NXPA 3DWFA 2G83A 4HHEA 5CJJA 2QVLA 3HU2A 4CE6A 1NR1A 3OQIA 2ZW9A 1KR2A 2EFYA 2X3UA 2AYXA 4IMRA 1BFDA 2JI4A 3NNSA 4UEOA 3SLRA 2BMDA 4E7OA 2ARKA 2XSZD 3HCDA 3KPYA 3HYLA 3IO3A 3KFXA 1KGDA 3BSFA 4HD8A 4L73A 1QZ3A 2AMYA 2XZDA 2DRIA 2GWRA 4XUEA 3FFAA 4LI3X 2E5WA 4L3OA 3TMYA 3KTDA 4P3NA 4BQSA 4GBJA 1VHLA 4L0MA 3C3MA 3TTSA 4MVJE 1AJEA 2XVXA 4HVTA 1OZGA 5AVRA 4XOUA 3IUJA 5D85A 3LO5A 4AJ4A 4GRAA 2AK3A 1CR4A 1DJLA 2FMIA 2GPAA 2ZITA 4NSNA 3HJCA 4N4AA 4MW9A 2ORVA 4YCBA 4EF6A 1U7DA 2O23A 4GSLA 4U5XA 3GT7A 3V48A 1SVUA 4IHJB 3M70A 3WKEA 4IRXA 3N53A 4OEHA 1AOXA 3MTQA 2HMUA 4W7HA 3QU2A 1YGYA 1L5HA 4ARUA 3EQ9A 4KO2S 3OI7A 4M9XA 3PTZA 3I9LA 3C6KA 4LJKA 4XA8A 2H2FA 2WLTA 4AY6A 2DKNA 1Q7CA 3AY0A 4PFJA 3W5DA 4K88A 5B6PA 5TPZD 2XQVA 4PQEA 2C31A 4D5EA 4Q93A 1GNQA 1KVRA 1XD9A 2QR2A 2ON6A 3ZS9A 4NMLA 4XD7A 5C31A 2QW0X 2J3HA 7REQA 2P35A 3CEJA 1R1DA 4L7QA 5E0KB 5U4QA 3SZLA 3DLHA 1CUYA 5KAPA 1IN7A 4C7OB 5DXFA 3WDMA 2FRVA 3L8FA 4DCUA 4FEEA 3LFHA 1H8EA 2EJUA 1JNYA 2QTZA 4P2GA 3U3OA 5KCZA 2NUPA 2ERXA 4B80A 3WGNA 2Z9CA 5K99A 1CUEA 5CCBA 2F3TA 2Q4RA 1GV1A 3IVRA 3Q8XB 4CM8A 1W19A 3JRWA 1U2ZA 5IWCA 3KOMA 4DJJA 1YWGO 4DC1A 4ZYUA 4ZU3A 4OQYA 2OXTA 3GPDG 3C6YA 4XB6B 2AUTA 3LX8A 2ODTX 2B4YA 4FMDF 3NHRA 2DETA 4GOXA 3AETA 4L5CA 4RVUA 2ERYA 1L5OA 1GR1A 1UH5A 2X41A 3I9KA 1RFLA 4X7MA 1ZN7A 3SC2B 3SICE 3O7MA 1A1VA 1EXWA 2VH1A 3DAPA 4FX5A 2GERA 3S2IA 1WB9A 1QH8B 3HVUA 4FHFA 4RQUA 1UK7A 3HNPA 3G2MA 1RYMA 3IOBA 1SM4A 1UT6A 4NYMR 2FR1A 3M33A 2GRUA 1TYZA 3LC0A 2AZTA 1ZOOA 1NBOA 3KQVA 4P22A 2IEAA 1PLJA 4KOAA 4X6UA 5LQUA 1FA9A 4QDTA 4B7XA 2R4UA 2G08A 2XUKA 4LG1A 4EUFA 2PUAA 4QODA 4XASA 3GUUA 3ZBUA 4ACAA 3FWPA 2V6MA 3AOEA 4WQMA 1GYPA 4Y6SA 5TRTA 4ZJPA 4KQHA 3OQHA 1LI5A 5A9SB 1PKEA 3ZBPA 3O4VA 1G2PA 3QMPA 4RQTA 4YAIA 5CLQA 3UPDA 4XZ3A 1M76A 2H1RA 5ALUA 4DREA 2D5BA 5DZSA 2H51A 4KX3A 3RF7A 1TTQB 4A82A 5C8DA 1OLSB 3P0RA 1K0FA 3FBGA 4J03A 1OFUA 1GNVA 4H17A 2IJGX 2ZBPA 4KPFC 3ZQ6A 1M67A 4LY9A 4FYWA 2ZPUA 1TW2A 3QQPA 2GEFA 4FE7A 1YQQA 1ORWA 1QHHB 4GPD1 4WECA 4R31A 4TZ6A 1B6RA 2XXAB 2QTBA 2WT4A 4V2UA 2BP7A 1V4NA 1DCKA 1MO3A 4IMJB 5D3QA 3ETLA 1XZDA 3KD3A 3TUJC 1NYRA 4DEYA 3IBGA 3B51X 3BL6A 2W8ZA 3DE1X 2FX3A 2CNKA 3I9MA 1O96B 5JAOA 2V0GA 1V1RA 2A30A 1DHRA 5JANA 3KPUA 3RHTA 3GZNA 1QLWA 3I92A 3L41A 1U3WA 1B4DA 1UKZA 2VWPA 3GLIA 3P2YA 1KDPA 1VI5A 2OHHA 4NJMA 4Q1FA 2W2LD 3BJIC 1WJGA 3H5IA 3OC6A 2FAXA 3FPGA 4OH1A 1R16A 5FO1A 3X0DA 4FKMA 3EVAA 3WMFA 3U4MA 3CKLA 1VJDA 4JLAA 4B7ZA 1U8TA 1C9MA 1IZYA 3RE1A 2AN1A 4OGGA 5K8IA 4BO1A 4HC4A 4EECA 2CL0X 4ZOCA 1J8MF 2CL5A 1NAIA 1EAYA 2COUA 3MUFA 3R20A 5DO9A 5IC5A 3CVWA 1OF1A 2O1EA 1MB3A 3T6KA 2VDLB 1PFVA 3UT6A 4C2UA 3WLPA 2PS3A 4JGBA 4Y2RA 4DMLA 4GZLA 1ISRA 1UBTS 1CJCA 2CNBA 4JJ6A 3UWMA 5LD2C 3FCSB 2VH2A 5IHXA 2YX1A 1JJIA 3SNHA 5JXJA 2GI4A 2XUIA 1FSZA 3FKSD 1XZMA 3E03A 2R00C 4OLJA 4P53A 1JSZA 2PHZA 3KKPA 5SY4A 3TX6A 5ALLA 2W6IA 4OMDA 2KB0A 1Y8ZA 4OJTA 2NO6A 4JSTA 3A1NA 1X1AA 3ZGNA 3VPGA 4D4MA 4F1KA 4ZKDA 2VP2A 3GFPA 1L5HB 2RD2A 1DIOB 1ZMXA 2JAOA 3JD2A 3KV1A 2VZLA 5AHKA 3WLTA 5C8VA 1U3FA 4NU6A 5DBFA 3GEPA 4F5ZA 4E5UA 2R1TB 3E1SA 4RNCA 4K0KB 2XAAA 3ENNA 4UVHA 3CUYA 1R4AA 1Q5PA 3ECSA 2I22A 4YCJA 2O2SA 3U40A 4Z1MD 2YL2A 4A1OA 5DNDA 3V8PA 3CLRC 4E3WA 3NBKA 3BX1A 4GFDA 1FTWA 4O8ZA 3AW9A 2ZRBA 3MOGA 4BYGA 4BX8A 3AGQA 1AO0A 2VR1A 3M6VA 3LAWA 4RY9A 4WK6A 5TARA 3U09A 5EIEA 2VUUA 2JGMA 5D1HA 4CTJA 4MVJG 2QUHA 4WXRA 3BJRA 2PRIA 5LYJB 1HDEA 1EWVA 2XJ9A 3HO8A 3W8RA 3L8HA 4LGVA 3SJCA 2BF4A 1MDBA 2J30A 4JEMA 3VM6A 4MR9B 1LUAA 1N2ZA 4LF9B 3B5EA 1FP6A 5AOVA 2VDUE 2VZEA 3HR7A 4RFVA 5L6MB 5DJ5A 1NN0A 3HXKA 4U9HS 1VLJA 3EZ2A 1KYTA 4QFDA 1PNRA 1E1CA 1OFTA 1ZC4A 4M36A 2GDZA 5KKCA 1SHLA 3KKKA 3PCRB 2ATIA 2FYTA 4O25A 4ENPA 1IJKA 3AUXA 1ZU5A 2XBUA 2CZQA 3STVA 1G20A 4TXLA 2HEGA 3SOZA 5HOQA 2JFYA 2CV0A 3BWDD 4ER5A 2JNWA 1PTKA 1K5DA 2GOYA 2XMGA 3ONFA 5DOVA 4CLXA 2AG5A 4BN5A 1U3TA 3ESRA 4IKPA 2HNAA 5DXAA 4WBNA 2CW5A 2PEZA 1X6VA 4BIMA 1KO5A 2BBTA 1PWYE 4L9RA 1SQ5A 3T9AA 1YA8A 2Y76A 4B84A 3TLGA 4DA0A 3STHA 1GOTA 1DP4A 4MJXA 2FZLA 3WY9A 1USUA 1SKYE 3BH6A 3H6HA 1TZCA 5ALSA 4CPDA 1TO6A 4JJ8A 1J6UA 5F2NA 4RFSB 4B45A 2AF3C 1AK9A 1ZI6A 2RGDA 1M1NA 3EVNA 2QB5A 3F96A 3PP8A 5JASA 3D5TA 4UHBA 2IOFA 3VU3A 3DHNA 4L50A 1NY5A 2C5AA 5FWNA 1X2BA 3EOBI 4N5MA 1YNSA 2QDXA 3LZ6A 3QYPA 1XMPA 2JVKA 5AW5A 5ICMA 3AIIA 5HGJA 1IFXA 3M4JA 5F78A 5IK2A 1YBMA 4XM1A 5EFOA 4HXFB 2ZE5A 5TB5A 5A0VA 2JDID 3AJRA 1PJ4A 2VHYA 5CA0A 4PN3A 1A04A 2V0NA 1CUXA 4RTRA 4MOWA 1HOXA 2HREA 1UPBA 2EZ8A 5DVZA 2R00A 1U1GA 2BEKA 2AFHA 1RIIA 4IIHA 1IBKB 4RZUA 4ZAXA 4AIRA 1KVQA 2A9PA 3Q11A 4TKVB 5BR1A 1G5FA 1KPIA 3LRXA 1Y81A 3U2QA 3T5PA 3ZY4A 4OHOA 2JCGA 3MQ4A 1K97A 3IJPA 3MFQA 4NX2A 1ZH8A 3E3AA 4WHMA 4QJBA 3GGSA 5KSYA 3JWJA 1NRXA 1TT5A 5LNK1 4IF4A 3EHEA 2ZWPA 3Q0EA 3DO5A 1VCHA 4HNSA 4H7DA 1JP7A 2RJ3A 3F6PA 3TL6A 4EGAA 4QZVA 1XDWA 4U2BA 4JWTA 3NW9A 3ZGXA 4PANA 2AXEA 4A5SA 1KNQA 2UDPA 1TO2E 2YWXA 2O48X 2P3SA 1PJCA 2A5GA 3WNZA 1H8HA 5T8KA 3TIXB 2ADFA 5DI3B 1PP4A 4OKNA 1E1LA 1E1QD 5FTLA 2M6LA 2AZMA 1KRWA 3PFKA 3BTUA 5EZ5A 4C6HA 4ZI7B 3FW1A 4INOA 3R7BA 2F6RA 3U7QA 5BMVF 4MMXB 4JC4A 3TBKA 4IIUA 4A8JB 1K0UA 3HBJA 4E0BA 2O5CA 2AUMA 3AESA 1V7CA 3BIWA 5COBA 1G16A 1VE7A 4EHLA 3AIMA 5BV1A 3EE6A 1Q7BA 1VPWA 1Z29A 1II9A 3JQAD 3SKVA 2JFQA 8ADHA 2IBTA 4R3WA 2OLJA 4ITRC 1NMZA 1LBHA 2FPRA 3PFHA 1A88A 1QFYA 1FNMA 2VCEA 3GC6A 1F2UB 3BK1A 1TRKA 3OM8A 3IYLW 3QF4A 4OQMA 4A36A 2HF2A 3RSOA 4A8TA 3L6RA 2I34A 3IMFA 2XCOA 3PJEA 2DQ4A 3R74A 2AN4A 1W85B 2NZVG 1I80A 1N4DA 1TM2A 3MMPA 4NZ9A 2Q6VA 4BBPA 1DEHA 3I9V6 1JDUA 4PLYA 2FSFA 2JLAA 4BO2A 3CB4A 3PWZA 1KFEB 2IS4A 4X3CA 2XIQA 3M49A 2GBPA 1SNYA 4XCVA 3DL7A 2TMKA 5B1YA 1Y7LA 1DXHA 1KRXA 4W1QA 4O4HF 1IB0A 1UBHS 2BMFA 2H4HA 4AY4A 2ZR9A 3AZQA 4JOCA 4N7RA 3HBLA 3I64A 3P19A 4B44A 4EJMA 5KOJA 1GA4A 2B8EA 1W59A 2IQIA 3DFZA 2R6JA 4ZVVA 3WLEA 5D6OA 4BECA 2R5WA 5T4HA 2P9BA 1XK7A 3C4VA 3SYTA 4ARBA 2XVAA 4TLCA 4JN6B 2X4IA 3LX6A 4XYMA 4EP1A 2XF8A 1VBKA 3PQ5A 2DAPA 2OV2A 2RBGA 1OA1A 4LN1A 1RABA 1Y4AE 2VDOB 3H5RA 2V54A 2A92A 2G3YA 1R6AA 5AQ1A 2IYQA 1ECBA 4QSHA 3I6BA 4TYNA 1SFRA 4K9RA 4J1TC 3TCKA 3H87A 2VHVA 5HOEA 1JR3D 2AK2A 3WL3A 4BE9A 5HF5A 5K6TA 2A1UB 4YRBA 4GLJA 3NKLA 1UMCA 4UCXA 1GLVA 5GGYA 1HFEL 1MAWA 1W0CA 1LWOA 2YJ6A 3E5NA 3I34X 3I01M 3QSYA 1LW6E 4TQ9A 4RYDA 4V03A 1YQXA 1GPMA 2CJXA 4DBLC 4DKXA 2O14A 5HG0A 1HOTA 1ZW1A 1DJQA 4C0JA 4D6PA 1IPFA 4XVCA 2Q9AA 2G28A 1AK1A 1NXWA 3R5FA 5KX5A 5JU6A 5CUQA 2I80A 5CFPA 3UK1A 1G3UA 5BPHA 2PKYX 1JX6A 4UFNA 3M4XA 2GA9A 4D4LA 2VPPA 3M6WA 4Q4HB 1E2MA 3AUTA 4DFDA 2XWBF 5JISA 4Y2SA 4D0LB 3G2HA 3T7KA 3K0FA 3RFXA 2QBYB 3EFOB 2ZJ3A 4IFBA 1XYYA 1YRHA 2ZQ5A 3LSYA 3LPCA 4NCKA 3LPMA 4IGIA 4L8FA 4YRZA 2V7GA 3FUCA 1E7SA 3IDQA 1OZ0A 4QEDA 1EDZA 3VSCA 2B34A 1NVGA 2J0VA 4HDNA 4YJFA 3AQIA 2OE2A 3PE3A 2FNAA 2JLQA 4TMTA 3RS2A 3SQWA 3K8QA 3IUNA 1NG1A 1LPSA 4G4GA 2DQZA 2EKDA 1IVSA 3BF7A 5AJYA 1KE1A 3F6BX 3BWXA 3RNLA 1WXEA 4JHXA 3TPCA 5GIOE 5HJ7A 2A2ZA 3R0QA 2IW1A 5I4CA 1PVVA 4R3NA 2VWHA 2AX4A 3FHCB 4TSKA 3ZD9A 1U2GA 1VRWA 4BS9A 3MWFA 3ND8A 4W82A 1PYGA 5CX4A 4AG3A 3WNVA 4R8SA 4D0NA 2PSHA 2AW5A 1ESZA 2WWHA 3FGZA 3ZV5A 3TW6A 4TV9A 4BQQA 3F5DA 4Z99A 5HK8A 1F4PA 4TKVA 3SJ7A 1KJJA 1UBEA 1IHDA 1KKUA 1AN9A 2OP0A 3PNMA 4FFWA 4K6OA 1P8JA 5JCOC 1D5WA 4BFWA 3LF2A 4ETIA 4W9NC 1N78A 3HKCB 2PVCA 1JR6A 3PRKE 4G97A 3A31A 1YCHA 2Q3JA 2ZTUA 3ZWVA 4Z9AA 4CV2A 1JHRA 4ZT3A 2QVCA 3M82A 4GPTA 2G88A 1ID1A 1KO7A 1QDUA 1WSBA 1RQXA 2W22A 2Q5CA 2CCGA 5I9LA 3GIDA 5F1YA 1EX1A 1L7AA 1UOEA 3PHHA 4CF5A 4EENA 3WSWA 5A4AA 5LLDA 4J2TA 3L7BA 3SBOA 1RRVA 2ZFUA 3AX6A 4P5DA 4DUPA 1PTJC 3L84A 1Y3FE 1DDOA 2IEIA 3W2FA 4HXEB 2HLNA 4AMUA 3ZLUA 4AN0A 2XWJI 1PDOA 1ID8A 1FB5A 1PT5A 1AGYA 1CUZA 3F98A 5A2QA 1NLFA 2BE7A 1JDPA 4Q01A 3W7VA 1BWSA 4FWBA 3ZH9B