2ERYA

The crystal structure of the ras related protein rras2 (rras2) in the gdp bound state
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
171
structure length
167
Chain Sequence
SMQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein R-Ras2
publication title The crystal structure of the Ras related protein RRas2 (RRAS2) in the GDP bound state
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 60
structure length 167
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2eryA00
1KDTA 1NN0A 2PCJA 4TL6A 1U0JA 2DBYA 1XCGB 3I5XA 1NY5A 1X86B 1Y63A 2ONKA 3L8YA 4HUTA 3ZQJA 4A8JA 1XBTA 1HT2E 1XXHB 1JAIA 1JECA 5DE3A 1WCV1 1ZU5A 3THXA 4OHXA 3B60A 3LRPA 4TQ9A 1VG9B 1YZKA 4C9BA 5FOVA 4IRUB 2IYLD 4QBHA 5DYIA 1E2IA 1G1MA 4NP6A 3V4RA 1G5RA 4P4SA 1X8LA 2JEOA 2CJWA 4DUGA 1H8ED 2XSZA 1EFRA 2AN9A 4U00A 1GKYA 3QXJA 4KLZA 2ZRLA 4DSOA 4G0NA 4A8JC 3TSOA 4EJSB 1KKLA 3TJZA 1YVDA 1OSNA 2QL6A 4N0DA 1T4GA 5GADl 1XZQA 3TSWA 1QF9A 2XX3A 2AD5A 2P5TB 1LF0A 2JLYA 3CR8A 1E2FA 3PUYA 4G01B 4MYTA 4GOJA 2WIBA 1Y3AA 2ZROA 1OHHA 1LB1B 1E2NA 1PLKA 3FFBA 1W7AA 2RGEA 2F1JA 2G0NA 2V55B 3K9NA 3TE6A 3NEYA 3C16C 1S3SA 3X1DA 1P61B 3V4FA 1G7RA 1OH8A 3RSOA 5F2EA 1NI3A 2V7QD 4DB2A 3LV8A 4NCKA 5FL7D 2PCLA 5EP2A 1OKKD 1LTQA 1R0XA 1ANKA 3IQWA 4MUBA 3Q5DA 1ZD9A 3QBTA 2PX0A 5CIQA 1R10A 4MYUA 1EWRA 4Q5IA 1GAJA 4ZPXA 2WPDD 3PEVA 3JZMA 4OQFA 2IUTA 1UADA 2YWFA 2HLDA 4ESHA 3DMDA 3LBNA 4IOJA 4ASUA 3B9QA 2IHBA 5EE0A 3JVUA 4JVLA 3VNVA 3ECCA 3M0EA 2G1JA 3CX8A 5FTKA 4ZKEA 1P2SA 4MITA 621PA 3B1XA 1XEWY 5A0FA 1YU9A 1AQUA 1T0HB 2C2HA 4JVNA 2BMJA 3LD9A 1TMKA 2W83A 3EZFA 4M1OA 3I73A 3AF1A 3FMIA 3IQXA 4DVGA 4C0BA 4O3MA 1QHHA 1NKSA 1D9ZA 3N2EA 5EXXA 2EYQA 2PL3A 3T15A 3VR4A 3LLMA 1BMFA 3RLFA 1E4VA 5J4VA 2QBYA 5FBLB 5FBVB 1JR3E 2P6UA 4D4JA 1NMZA 1NN1A 3L0OA 2C96A 3NC0C 1LW7A 4B71A 2WMNB 3ZLJA 1R5OA 4D81A 1ZM2A 3B1VA 2O0JA 4IEEA 4HZUB 1Z2CA 3GEEA 2A7QA 4JLKA 4MYCA 1GNRA 2Z4RA 4Q4LA 3AGQA 5JHGB 2C8VA 3D31A 4JYBA 1XCMA 3WBKA 1RC8A 5JI3E 2Z4SA 1FUUA 4CEIA 3U60B 3SYKA 3U4QA 1KNXA 4Q00A 2ZRJA 4G5GA 3D6TB 4MDEA 2O52A 3UMFA 4Q7MB 4XVRA 3B8HA 4URXR 1B0UA 1H65A 2QTVB 4JLJA 4AC9A 2GEUA 2CDNA 5FPHA 3QF4B 4P3YA 1RPZA 3CW2A 1YR9A 1AGRA 1XU4A 4ZCIA 2J0QA 2XTZA 2ORIA 4LOAA 4DLUA 3K9LA 4MQBA 2VO1A 4KYIB 4WZAE 3A4MA 4EQ6A 1DE0A 3U6BA 4US0R 3SR0A 1GRNA 1OXVA 2JLSA 2X2EA 4B6EA 1FNMA 3FPAA 4M1MA 2XNDA 3BB1A 3AP3A 1KI6B 5JSZA 2B6HA 1KY3A 4L15A 4QBIA 3MSXA 4I81A 2H5EA 2A30A 2PEYA 3P4XA 5HZHA 2F43B 1F2UB 3CX7A 1DAEA 1E2GA 1Q12A 2UZIR 4QHSA 1E98A 3TSZA 3UPUA 1XTRA 4UNPA 5AUOB 4Y0AA 1QHYA 1YRAA 4RD0A 4FMCF 4TYNA 1EK0A 2IYQA 4J0QA 4GP6A 2CL0X 4ON9A 5DH9A 3SHWA 4A36A 4RD4A 1L4YA 2OCPA 3K0AA 3VAAA 1N6OA 1GZSA 4RJLA 5SZIA 4CDGA 1E0JA 4UKDA 4JLOA 2Z6VA 2I1QA 2CNWA 3QJYA 521PA 1NG9A 1TX4B 5DHAA 2XJ9A 3BERA 1G4UR 2FPKA 2GVZC 4LHZA 3SFZA 2QG6A 2JJ1A 1FQKA 1NJGA 1IXRC 2DFNA 1XD2B 4JLDA 3A58B 3CZPA 3ZZTA 5AJYA 1ONBA 4Q1EA 5AWFC 3FMOB 1G3IA 2HEIA 4URVR 5G41A 2IBMA 3GJ6A 3U61B 5LDDC 4MKIA 5M04A 3PUZA 1CS4C 4IVQA 1E9BA 2WAYA 1HV8A 3EPJA 1FUKA 4DT1B 2VHCA 2IW3A 2ZRKA 4HLUA 3P4YA 1VYVA 4IVRA 4URZR 1KI4A 1R5BA 2C99A 3BRWD 1K5DA 4JLAA 3UG7A 4DHEA 1AS0A 4EUNA 5C18A 4LYFA 2WHXA 4CEJA 1M7HA 3BBPA 5FTJA 5BYKA 1JPJA 3GFPA 5HKKA 3THYB 2NIPA 4TQAA 2HT6A 1FTSA 3ZVLA 3PIRA 1E2HA 2BKUA 2C04A 1FP6A 1RIFA 2OM2A 1SVLA 2IS1A 5DYGA 1ZCBA 2NOAA 4P4UA 5KDLA 4HLUC 4DWJA 5CM8B 1NG1A 4F38A 1SVOA 1G7SA 1UDWA 2ZRNA 4UXIA 4IVPA 3FMFA 4A9AA 1I4TD 3AVTA 2GDJA 3SE0A 2YOGA 2QUZA 2ZR7A 3H4MA 2QORA 1ZJ6A 1U9IA 1JXOA 4RZ3A 1AKEA 3W6PA 3NIBA 5EE3A 4AWXA 3A37A 1BH2A 1KI2A 1J8MF 2PJRA 4KAXA 3SJZA 4A92A 3QKRB 3SS8A 4B2IA 2BBTA 2ZSFA 3ZD7A 4LV5B 1AZTA 1R5NA 3HPQA 1OW3B 4YDSA 3B13B 1KMHA 2QU8A 4LHXA 4C0AC 1CKEA 3QVUA 4FXPA 3GFOA 5KO2A 5B57C 3CRVA 2O8CB 1A5TA 2O8EA 1U9IC 1AJEA 1G8PA 4TL7A 3W34A 4N0EA 4II7A 1Z28A 4NPHA 4NL4H 5JJIA 1GP2A 1OF1A 1IY0A 2VLIA 4WBSA 2ZU6A 3PUWA 4HDOB 4TL8A 4W5JA 5BN5A 4LC0A 3GFTA 4DLRA 3CO5A 4NBSA 2QI9C 4CEHA 3TRFA 1E32A 4OHZA 1UPTA 5E7IA 3QPUA 2IT1A 2PH1A 4Q66C 4HAUA 4BRUA 1MO3A 1P75A 4R2HA 1KI3A 3X1XA 4Q1FA 2CK3D 1KTVA 2RGDA 2JIZA 2ZYTX 4IJMA 3SJAA 1Z6TA 3SBEA 1NBMD 3K53A 2J7KA 2CLCX 1YKSA 1CJKC 1Z0AA 3H84A 2EWWA 4U5XA 2GCNA 4CRWB 1JEEA 4LYJA 1WQ1R 2MSCB 3HU1A 5JJLA 2JDIA 1IBRA 2C95A 2GCPA 2RH5A 4TLBA 5CJPA 4ZDWA 3GLFA 4GMDA 5H1YA 5JI2E 3FMPB 4MGIR 1E3MA 1ZRHA 1VHLA 2GA8A 4OK6A 4F4IA 1SXJC 1X8JA 1YJ5A 3GEHA 3RS2A 1U2RA 2ZR0A 3SYLA 2KI5A 2ZSBA 4UJ5A 3U3OA 1KYIA 1UAAA 1W36D 3B1WA 2XSZD 1EFRD 3C4JA 3KTAB 4XOIA 3DEFA 3WP0A 4HSEA 4PSVA 4BFTA 1IAQA 3HDTA 4I1UA 3VHXA 4FMDB 2ZAMA 3L0SA 4MUAA 3REGA 3U44B 1KJZA 2YHSA 4OYHA 3LX8A 5DN6A 2OESA 1ZIOA 2JATA 1N0UA 4KVGA 4B3BA 2XB2A 1Q0UA 1QHGA 4DDWA 4A2PA 2ZI4A 1FX0A 1KK1A 4HATA 2YZ2A 2ZI9A 3UK6A 2BEJA 2DR3A 2GKSA 1OHHD 3JZAA 3RWOA 3TR5A 2P3SA 5L3VA 5B64A 1U99A 2WWHA 3D8BA 2R2AA 5FUWA 2PZFA 5H68A 4NHOA 2WPDA 3IO5A 3NEJA 3FHTA 2Z83A 2FGKA 2IS4A 2ZRFA 1OXXK 2YKGA 5HCIA 5B30A 2CCKA 5L3QB 4O0MA 3THXB 3QI2A 4RD2A 4AD8A 3K70C 1GKUB 1Z47A 3A1VA 1OIXA 2HLDD 4GOXA 3TVTA 4P4SB 1AA9A 4ACBA 4BPBA 1S9DA 1G8YA 3CIOA 2ZS8A 2H16A 3V9PA 3ZIAD 1ZMXA 3DZDA 4RY2A 2AKYA 4TMZA 3QG5A 2D06A 3LNCA 1P3JA 5EP3A 3HU3A 1G8FA 1TTTA 1XNJA 2N1BA 1NY6A 2BIFA 4URUR 4OBEA 4URYR 4GSYA 1E0AA 2PBRA 1U8ZA 1GL9B 3LX5A 4EFLA 2KB0A 1E2QA 1YR6A 1FNNA 4QJ4A 4H9GA 3T12A 3J81k 3CR7A 4FCWA 4MRRA 421PA 4F7WA 3UANA 1W4CA 1P9RA 1E2KA 4ARZA 4HEJA 4LBWA 3I32A 1BMFD 4LC1A 1E0KA 1BYUA 1G3RA 2X19A 4P33A 1FMLA 2TMKA 4TTQA 2CL6X 1ZNYA 4M1WA 4L5BA 1MRNA 2WIAA 2QTFA 3LA6A 4ERNA 2HT1A 3AF2A 4YQFA 1GSIA 1G16A 2O8FA 1XEFA 3O47A 4KBFA 3HU2A 4LYHA 4MGYR 4KI0A 2WWWA 2C98A 2EW1A 2ZREA 1E2PA 2ZE7A 4PQRA 4NYMQ 2BOVA 4P4TA 2F3TA 1KK2A 1J99A 3ZJYA 2C9CA 4DXAA 1D6JA 3GJ5A 1NNEA 4Q48A 1OB5A 3VNUA 2Q6TA 1II9A 4PANA 3QEOA 1MH1A 2OLKA 1WB9A 3E1SA 4B3FX 3W9YA 4E5UA 3WY9A 2F1IA 1PLJA 4KYUA 3RC8A 3RC3A 4Z1MA 5J40A 2G0TA 5J4YA 3EPKA 2R6GA 4QGAA 1QHHB 1Q20A 1QVRA 1YZNA 4LCBA 5LB2A 3UIEA 4DCTA 4JLVA 2QMEA 2G88A 2IXFA 3AQ4A 2FN4A 3GLHE 5IK2A 2ZVPX 4BFWA 3B2EA 4LV8B 1P73A 3S1AA 2XNDD 4HAXA 1JI0A 3VR3A 1HQYE 5LD2B 3ZD6A 4XH9B 2GBLA 1TL7C 1OB2A 2ZJ8A 2WBLC 1OIVA 2CVHA 2J5XA 4EDHA 4BFYA 1CRPA 5SZJA 3BS4A 1Z2AA 3TAUA 5JLJA 1UKVY 2GZDA 4LK2A 3BH0A 1LNZA 1M34E 1EX6A 1U0HC 3LWNA 2IYUA 2EWVA 2YWGA 3OESA 4Q01A 3RS7A 4HUQB 1P6XA 1SZPA 3EWAA 1I4LD 5AJWA 2GRJA 3KX2A 2FOLA 3GLIA 3KJGA 2ZJAA 3CH5A 4ZI2A 5C46F 2V1UA 2N42A 1G8HA 1S2MA 3ZYCA 5CB8A 3AVYA 2CNWD 1KDOA 5KUTA 5ELXA 3LAWA 1W0KA 2VPPA 1DG1G 2MSEB 2JJ1D 4KODA 1A1VA 4Z8YA 2XNSA 4TQUS 3IGFA 4EQ6B 2ZUCA 1J90A 1E2EA 1W5TA 4HAVA 4QGHA 4ESVA 5FOWA 3MGCA 1J8YF 1E96A 3FWYA 1VHTA 3A4NA 2Q3FA 3U6KA 3D7MA 1Q57A 4RFSB 5TB5A 1N25A 1CULC 3T5DA 4D80A 2R6FA 1TAGA 2J45A 5E3HA 1F2TA 3AVQA 2L0XA 2ZIAA 1RJ9A 2OUKA 1VDZA 5JSZB 2F6RA 3X1ZA 4Q4HB 3QKUA 2BKEA 3QE0A 2EQBA 4DLVA 1AS3A 3WMEA 4EPTA 1GVNB 3X1YA 1TQDA 3ETLA 5FR1A 2D7CA 5JRJA 4YMVA 1MRSA 1ZM9A 1G9XA 1O87A 4IOKA 4BFSA 1BYIA 1DAIA 1KJWA 1YHNA 4D26A 2ZEJA 3KB1A 3I8SA 1JXMA 1TQ4A 4GFDA 4LPSA 4KSCA 3WYGA 3OF5A 2FFAA 4LBYA 5DLQC 1Q1EA 4Q4AA 3LFUA 1GM5A 1NLYA 3KB2A 1NRJB 2F7SA 3VU9B 1OXUA 5HKKD 1KO1A 2V3CC 1Z8FA 4GNKA 4YXWA 5FH9A 3D3QA 4OI2A 4FMBB 5FPYA 1PVOA 4JBWA 1HTWA 4B6FA 4LJ7A 1JR6A 1XTSA 2WWIA 3PCRB 4DCVA 3C8UA 1QZXA 2XXAB 3MUFA 5DO9A 1XWIA 4MRPA 3QIAA 3VR2A 5JCZA 4JT4A 3ICQB 4S2EA 3ADBA 3ZDQA 2GXSA 1FZQA 1W4RA 2GCOA 2NPIA 3PITA 3RRZA 1SHKA 2JLWA 2VQSA 2D74A 2V54A 3CWQA 2ORVA 3W3ZB 2CLDX 4BEBA 4JZKA 4D82A 3TMKA 4ZCLA 2GEDA 2E1RA 2J0UA 1V43A 3FKQA 2AK2A 2QP4A 2AK3A 2CMKA 2NG1A 3AVUA 2QAGC 3I4LA 2NQ2C 3P32A 5AR1A 1VMAA 2V9PA 1KSGA 2OLJA 2VTKA 4BEJA 1KO4A 1ODFA 5FPSA 4YLGA 3FYHA 3Q5EA 5DI3A 4QFMA 1TEXA 1VYUA 2J0SA 4D0GA 4DLSA 3OEEA 1RYFA 5CYPA 2ATXA 1NIPA 3NBFA 1MV5A 5G3YA 1KJYA 4M1TA 1D2MA 3MWLA 1ZUIA 3DPUA 4ZV4A 4HB4A 1RFLA 4DSTA 2ZJZA 4TLAA 2JIZD 4W5WA 1SXJD 4XJXA 5KSZA 3KQNA 1BOFA 3DKVA 3IDQA 2C9OA 4TMTA 1E99A 2VSXA 2WAXA 2GXQA 1IONA 1XJCA 4QBFA 3DM5A 2DY1A 4A0FA 5JZVA 2NPFA 2JDID 2ZI3A 2OBNA 2ZANA 3WMGA 3WYFA 1N6RA 4PSKA 2ZSDA 6Q21A 2P0EA 1ZBDA 1E0SA 3RWMB 1R0WA 1UDXA 1XPRA 1KI9A 1N5KA 2IWHA 1G5TA 1N0VC 1W4BA 4V03A 2IYTA 5G3ZA 5F9FA 2QMHA 5L8VA 1SHZA 3C41J 1UBCA 1SULA 4WZBE 4WZ6A 5CLQA 1NJFA 1TUIA 1GNQA 2VF8A 2BMDA 4QM7A 2IF2A 4NDZA 4Q02A 5KPJA 1E79D 2VP4A 3GLHB 4DCSA 2GJKA 5IDVA 5AJXA 1OV4A 2H7VA 2ZUBA 4KJZA 2A5JA 3K9HA 1A2KC 2BHRA 3OEHD 5DN6D 1IN8A 4ZDJA 4RD6A 3KXLA 3IIJA 1XEXA 4LUCA 1MT0A 2Q3MA 4QC2A 5C4GB 3R7WA 1M7GA 3K70D 1Z63A 3OHMA 3EX7C 1WBBA 4RZ2A 5KNBA 3K0SA 3A36A 4M22A 2PMKA 1BS1A 1VPLA 2WJVA 1UM8A 2J0VA 2X77A 2FZ4A 3KKNA 3ZIAA 4PTLA 4GBMA 2VHJA 3TIFA 2H8KA 1ZNWA 2V4ZA 3U7FB 1DO0A 4BWYA 5LBIA 2ANCA 4ZIRA 1TUEA 3V00A 4Q03A 4L4UA 2ZUDA 2F55A 2YV5A 2ZRGA 4F4JA 2DCUA 3PV0A 1IHUA 4TTRA 2I1VB 3IUYA 1TF2A 4M1YA 2SHKA 2P65A 2GNOA 3CM0A 4O2LA 3P26A 4AI6A 3FKSA 3R8CA 4DRZA 3EC1A 4DEXA 2ODEA 3NVAA 4L9SA 3I92A 4Z54A 2BVNA 5JMTA 1P5ZB 5JECA 1PUJA 3SI7A 2Q21A 5UKDA 5JWHA 2P67A 4PSAA 4YC7A 1HQCA 3NH6A 2R44A 4C3ZA 5KSYA 2IS2A 2VSFA 3BH6A 3HR7A 4Q9LA 4U02A 1VKJA 2FG5A 3KXKA 2FX3A 1ESMA 5IF9A 1KK0A 5TARA 4LWZA 3U3RA 3SN6A 2B21A 4B3XA 3BIFA 1T5LA 1ELOA 2GZHA 1JEDA 2D2EA 3VHLB 1G6HA 4QL3A 4TMWA 2ZM5A 4XTRA 1RKBA 4QOSA 2J1LA 4R71A 2K5UA 4JJZA 3T1TA 4LJ4A 3GLGE 5KTYA 1VCNA 4JS0A 3O8DA 2DWQA 2YWHA 1ZD1A 1US8B 1VYTA 4Z1MD 3TQCA 1EFHA 2FSGA 1XEWX 2GESA 2ZVQX 3BJIC 4TLDA 4FW9A 1W47A 1KO8A 2W0SA 1MABA 4RCZA 2OSBA 2Y8EA 4NYIR 2B7CA 3RANA 4ARZB 2J59A 1WXQA 2C77A 1P2UA 1U81A 2W0MA 2NGRA 2KBEA 5FOSA 1Q22A 1HUQA 1B23P 4UNNA 4DCNA 5IK2D 1WBDA 1HA3A 1NBME 2EFDB 2I4IA 3KFXA 2EVWX 1M74A 1F3OA 2HUPA 1EWQA 2JLXA 4B3GA 3DOEA 3IKJA 1FMJA 5G53C 1IXSB 3T1VA 3M6AA 3U3MA 3UXMA 1OT3A 3WBJA 4BFZA 2D4HA 1ZYUA 3CKLA 4M4SA 2J7PA 2HYDA 4YMWA 4O25A 1YQTA 3CRRA 1GKIA 1KDPA 2WZQA 4POAA 1QHNA 3EZ7A 3P27A 5EXPA 2HJVA 3FVQA 3FOZA 4D0NA 4AIIA 3IBGA 4DEYA 3TQFA 2ZI7A 4QM6A 3QG1A 3B6EA 2FSHA 5HE9A 2W00A 3N70A 5DSZA 3IIKA 2VHTA 3SEAA 1IOZA 1OH7A 4GPTA 1G7TA 2NO9A 1R4AA 2WJHA 3CPEA 1CRQA 5IT5A 2JA1A 3B85A 5EUQB 2YC2C 2IUSA 5TVKA 4B43A 1UBGA 3UMSA 1TU3A 2D3WA 1DVRA 3AVWA 2FWRA 3IIMA 3SFVA 1NSTA 1W0KD 4PZYA 2WTUA 3RVBA 3VR1A 3T35A 1KKMA 3A1TA 3BB4A 4MRSA 4HAWA 2MMCA 5KYKA 2GJAA 4KV9A 2BMEA 3C5HA 2FEOA 4C0JA 4DLTA 4ZDIA 4F92B 3QEJA 4W7SA 3U5ZB 2NMVA 4HLDA 2O8BA 1N6LA 4F91B 5JRZA 4TMXA 4BZPA 4AYWA 4CYMA 4B2PA 4PO8A 2NO0A 2IYVA 5A5GA 1E6CA 3RAPR 1OJLA 3DDCA 1OFIA 3BFKA 2JASA 2Q9BA 3RS0A 2MMGA 5EUMA 4DSUA 3JVVA 2P6RA 2QQEA 1A7JA 4M9SA 2C5LA 1HH4A 1T91A 8OHMA 1MO6A 4DDUA 3OAAA 3NKVA 1ZC4A 4EFNA 2LKCA 5JS7A 2V8OA 3BD9A 4H1VA 2H1LA 4FMDF 2XZLA 1YR8A 3DHWC 3ND8A 4JSTA 3ADDA 2W2TA 3RRYA 4A82A 3MFYA 3T06B 4XWAA 1NVVQ 4U7DA 1TPZA 3K0FB 4YXWD 2ZU0C 3AUYA 3ZVMA 5FOTA 1T8UA 2GAAA 4AKHA 4OI1A 1M6NA 4Q4JA 2PLFA 3EPHA 1DG3A 2QRZA 3GJ3A 3CNOA 5D3MB 4YONB 5KSPA 4JKIA 2XJ4A 1XTJA 5CB6A 3TR0A 4W9MC 2E9SA 3F3YA 1WF3A 3W6OA 3GPLA 4HB2A 3CZQA 4QGFA 2RGNA 4OQMA 2Q3HA 1XD9A 2AXNA 3L2OB 2X1VA 2HXSA 3CF6R 1E2MA 2REOA 2O8DB 1XXHA 1E69A 2KBFA 4PAMA 3MRSA 4A0GA 1OFTA 4GI7A 5CYOA 2R9VA 5DI9A 3U7EB 2OAP1 3ICEA 3X2SA 1L4UA 4PPQA 3H0KA 2ZITA 1R0ZA 4KCGA 1Z22A 2ASEA 3AKYA 2WKQA 2CHVA 4NZYA 4PAQA 4Q4AB 4JLBA 2RGNC 5E4FA 1G291 3GMTA 2VP0A 4GOKA 2GJSA 4EJSA 1KZGB 4FWIB 4ZCMA 1SXJA 1Z0DA 3AF0A 3OEED 2UZ3A 2VP6A 2V6JA 2CCGA 5KNCA 4B75A 3Q8XB 5JFGA 2W2XA 2IXGA 5K8TA 2J87A 2I3BA 1GFIA 4NU0A 2ZE6A 2AFHE 1GNPA 1D5CA 3GJ8A 2N46A 1CR4A 3ZGXA 2G9NA 4PZLA 1Z6XA 2YWEA 1X1SA 1BKDR 4EJSC 3W6NA 2GCOB 4DLYA 2IYRA 3KZ1E 2PZGA 2UVQA 4BLQA 3CNNA 1W5SA 4AYXA 2ZYVX 3R8FA 4R9UC 4UQOA 4IHQA 4ACAA 3A1WA 4LHYA 3GLGB 1NLZA 1FL9A 3KJIA 4CT5A 1FTNA 1SGWA 1E79A 3O8BA 5AJZA 3EXAA 5L3SB 3OEHA 2REBA 4PHHA 3T1QA 5FI1B 1VTKA 1GDDA 1HE1C 3GQBA 3O8RA 3C14C 1XX6A 4V0OA 1E9AA 1HT1E 1II8B 2AX4A 3ASZA 2FPLA 2W6IA 2BBSA 5FBQB 2ZRDA 1N5LA 4IEIA 3PG5A 4BE7B 3IEVA 2BC9A 2DB3A 2OFWA 3HYRA 1RRFA 3MLEA 4BRWA 4O2RA 1XP8A 1N5JA 2F1HA 4MYHA 1XJ0A 3EIHA 1MO4A 1OFHA 3KQHA 1KHTA 4B44A 2XTMA 4A8JB 2CHGA 1P60A 2GEVA 3HPRA 1S1MA 1A2BA 3LVQE 3WRXC 3TGPA 1SVKA 3WYAA 1KIMA 2OXCA 2QTHA 2WSMA 3T61A 2IYZA 4C0KA 3MCAA 4UNRA 2ZQ5A 1Q1ZA 2HCBA 3RRNA 2WWXA 3THOA 4PPFA 2YVUA 2VP2A 2OAQ1 1UBEA 2CJWB 1G19A 3CB4A 1W36B 5BW8A 4HZUA 4PO9A 4KO8A 1F5NA 1S3GA 5HTKA 3R20A 3Q3JB 4B3CA 4Q7LA 4B3DA 5BXQC 1S96A 2ZRPA 4B35A 1G21E 2IUUA 1X1RA 4C0LA 3G5UA 1MO5A 3UMRA 1RVDA 2HCJB 1DO2A 1CBUA 2QAJA 4X8MA 3NHAA 5K8UA 4E09A 3E70C 3DZ8A 4Q9KA 2WV9A 1EFTA 1SVMA 5AJVB 3KFVA 4C2UA 3QF4A 3VFDA 221PA 2H17A 2AFIE 4JL8A 3FKSD 3K0CC 5FUVA 3H1TA 2RGAA 2ZYWX 1QRAA 3VKHA 4HYYA 3TBKA 4QGGA 4IOMA 4TYQA 4CIDA 2E87A 1W1WA 3TUJC 3ZH9B 3Q7PA 2JJ2A 4M0LA 1IY2A 1K6MA 4OQXA 2WKPA 3OFND 2A5FA 4OK3A 2FNAA 2ZS9A 5TY0A 3CRMA 1KI6A 4FINA 3VQTA 4PPNA 2QY9A 2ZJBA 1T5IA 2Q9CA 4DIEA 1J2JA 5HZKA 4KFUA 3KKQA 4MDFA 3PR1A 2DWPA 2F43A 1F2UA 2NTYC 2Z43A 4IFBA 3QENA 2ODBA 3EA5A 3NBXX 4W5HA 2VP5A 4G1UC 3RABA 1U98A 4ZIRB 1KSHA 3WNCA 3F5FA 1TF5A 4JL6A 4DLXA 3T5GA 4CW7A 5P21A 4A0HA 5LPNA 3CBQA 5DIFA 1WRBA 4LJYA 1RRPA 2QEQA 2KE5A 3W8NA 3MD0A 4OHWA 4GP7A 1KI8A 3R9IA 1NLFA 4IDPA 3RS4A 4IKEA 3WNDA 2QBYB 2HJGA 2VHQA 3ZZ0A 1AQYA 4KBGA 5GJVC 4MKGA 4URWR 1DAHA 1IJEA 3PEWA 5FOUA 2NZ8A 2RGCA 2X2FA 1XRJA 1XD2A 3QY0A 3PFIA 1IQPA 1CJVC 3NDPA 1Z6YA 1SXJE 2ZRBA 2CEAA 4PQFA 3R9WA 2BJVA 4V0MA 4KVAA 1RRGA 4F4CA 2IC5A 3SZRA 3WMFA 2QT0A 4RSGA 3RYTC 1VG8A 3IHLA 4DZZA 1XD8A 3W8RA 3Q72A 4CEIB 1L7VC 2CHQA 3U4QB 4AKGA 1UKZA 3GLFE 1KAOA 2FGJA 2J7PD 5EP1A 1RYHA 4DT1A 3QKSA 2LKDA 4I1OA 2FDCA 1JJ7A 1LY1A 4FD2A 3RS3A 3FTQA 1BO6A 2G1KA 1P9NA 2R62A 4QNMA 5KNDA 4US2R 1CJTC 4FIDA 2G77B 1ZUHA 2PT5A 1OE0A 4KITB 2YYZA 3NH9A 2YINC 4RZUA 2JLZA 3MWKA 3TW4A 4D4MA 4WIAA 3THYA 1IM2A 4X8HA 1CTQA 3SQWA 2IYYA 5KSOA 2B8TA 4PO1A 5FR2A 4IDQA 3U3KA 2BWJA 1NMXA 1QDEA 1G8GA 5EE9A 2QENA 1R7RA 4IDHA 3VMFA 5JBQA 4WW0A 4HAYA 4B76A 2ZXUA 5AUNB 4PX9A 2BM0A 3K8YA 4DSNA 4KFSA 3G0HA 5KU1A 2XTNA 4R7ZA 3QSYA 4A1FA 5TMPA 3MMPA 4RCYA 1E1RA 2GAOA 4C0SA 1SQ5A 1G64A 2HDNB 3SBDA 2YOFA 2ZRHA 4DC9A 4KHZA 2WMOB 4BZXA 2HV8A 4JSYA 2RB4A 3QKRA 5JS8A 1P9WA 1X3SA 2VBCA 4XD7D 5SZKB 4FN5A 1XMIA 2WICA 1G41A 4HLQB 1NL3A 1GWNA 1N3BA 3CPJB 4NYJQ 1HEIA 3CNLA 3K0AB 4LJ5A 3LLUA 121PA 3K9GA 4DKXA 2O8CA 2QM8A 4LJAA 1G6OA 4ZKDA 3CPHA 3K09A 3PXGA 5JHHB 3OAAD 3C5CA 4OI0A 2GK7A 3I5YA 1GRRA 3KUCA 1ZU4A 5KHOC 1CJMA 4NE2A 3KKPA 1ZCAA 4BUJA 2FEMA 2AWNA 2ORWA 4JLPA 1R2QA 4JVSB 5IRCD 3GJXC 4Q19A 3H86A 4ITRC 3OIUA 1LFDB 3VX4A 1JR3A 3U2QA 4B73A 5F9HA 1LS1A 2QAGA 3GCGA 3LO5A 4M1SA 4MKHA 3K09C 2PZEA 2VIIA 2KJQA 3VTKA 4XVUA 1T3SA 4TSFA 4IOLA 1JAHA 1GUAA 5EXSA 1M8PA 1Z6AA 5FUXA 2X8AA 1E2JA 1XTIA 1N5IA 5E7MA 4IDOA 1OXTA 2O8BB 3K1JA 1OIWA 3RNLA 2WM9B 1FQJA 2DPXA 4LJ9A 2DHRA 3QBVA 1KZ7B 1P72A 2W6JA 2W2VA 3SQXA 4CZ2A 2A78A 1SKYE 1IN5A 3I1FA 5FI0B 4CEJB 2DWOA 1LV7A 1A4RA 2C9YA 3OIYA 4WXRA 3KQUA 2WWGA 3VR6A 1XZPA 1KSJA 1C9KA 4DJTA 2BBWA 3R9XA 3TVDA 1XPOA 1YZTA 3SYNA 3MG9A 2CL7X 1I2MA 2PMDA 1H8HD 3F0TA 3KTAA 5DNYB 1EG7A 4PC2A 4LX0A 3ZS9A 4BLRA 5BQ5A 2XITA 3U44A 4G5OA 2P2LA 4JL5A 3UKDA 4LJ6A 2VP9A 1YZLA 3BC1A 3KJEA 1LVGA 2F3RA 3BFVA 1T3LA 3HR8A 4OHVA 1SVIA 2R6AA 2B8WA 3B82A 4UXJA 3NXSA 1D2NA 1ZNZA 2BBOA 1OFUX 3LQQA 1WP9A 4N3NA 3L43A 1G3MA 4JT2A 4GT1A 1AM4D 1KMHB 2ODNA 4US1R 3BAFA 2QMOA 2GXUA 2YNMA 5C2JB 3AKCA 1P2TA 1XTQA 2O8EB 5JCPA 1NVUQ 2RHDA 1VG0B 1KMQA 3P1JA 3AKDA 1IY1A 3BOSA 1NVXQ 3AKEA 1HURA 1DADA 3B1YA 4D4LA 3L82B 3SNHA 5L3QA 4UJ3A 4V0ME 4LHVA 3M1IA 3LDAA 1W48A 2VA8A 4V0LA 4K81B 4HI0E 3K0EA 2VH5R 1JJVA 1N6NA 1UF9A 3QXCA 3E2IA 1UKYA 4MGZR 3TLXA 3BH7A 2AL7A 2QSYA 1S0UA 4P0TA 2EFHB 1G17A 4ZDKA 4CEHB 2LWIA 5F3WB 2G83A 4AY2A 1Z6GA 821PA 1CU1A 2UKDA 3C7KA 3VKWA 3GLIE 1L8QA 1F48A 3AF4A 2VF7A 4LV6A 5IHPA 4QJ3A 2W6ID 1SXJB 1AK2A 2GK6A 1Z83A 2F9MA 3BORA 1D2EA 1TADA 4P31A 4AURA 4V02A 5TXGA 3BFXA 1R8SA 1U94A 1FOEB 4HDCA 4I1SA 4R2IA 5ANRB 2ZI6A 2IEZA 4B34A 2QRNA 1JQJC 1Z06A 4LYAA 3N5CA 3BB3A 1NP6A 1W36C 2OFXA 3GLFB 5BN3A 1E1QA 3PUVA 1CP2A 1DAGA 2FFQA 2OHFA 3HJNA 3CF2A 1XMSA 1IJFA 4JYCA 4TMVA 1BIFA 5FOXA 4BFVA 4LBZA 1GITA 2P5SA 4C2TA 3AM1A 4EIWA 4ILEA 1ESNA 4JKYA 1HE8B 3PVSA 3OIVA 3DMNA 2IA5A 4TZ0A 2KWIA 4UXHA 3OE7D 4WXPA 4Z8XA 1W44A 5J5CA 1GIAA 1K5GA 5FUYA 2ZRIA 4IFEA 3FB4A 1FW6A 2AD1A 3ADKA 4I99A 4GL2A 4Q9JA 1GL6A 1SKQA 4RFVA 1OYWA 1AGPA 1Z07A 3KXIA 4G5SA 2ZJ5A 1I4DD 2IXEA 1XPUA 4M1KA 4LY6A 5D3QA 3UWKA 1W4AA 2WJIA 3MJRA 4M9QA 1OH5A 2FV8A 4BECA 2WKRA 3ASYA 1FX0B 3LXRA 2J46A 2OO7A 4G3XA 3TK1A 5KDOA 1S4QA 3K70B 4OL0A 3LH5A 1UKEA 1KO7A 4DBLC 2WSSA 3OFNA 1HYQA 4Q7KA 2H18A 5EJEA 1Q3TA 1M1YE 1NIJA 1RE0A 1W2GA 1ZIPA 4HB0A 4N1AA 4PC1A 3TW8B 4CVNA 3PJRA 3KDSE 1CIPA 2QGNA 4RKEA 5DHFA 2JJ2D 5FBRB 5FTNA 1F60A 3VX3A 5J4HA 4BZQA 3AV0B 4KXFB 1CR0A 1NMYA 4AK9A 2DFKB 2ERXA 4EPWA 2XOKD 3RSLA 1AIPA 2ZJ2A 5AUQA 1KOFA 3B7GA 5BYJA 4NKRA 2ZE8A 3QXHA 1E9DA 2ERYA 1Q1QA 2FH5B 4QRHA 4PQYA 3KQLA 4C7OA 3H2YA 4QKQA 3U7HB 1YE8A 3M4YA 3CONA 2DYKA 3FE2A 5HCNA 5CITA 4PXAA 3O8CA 2JLUA 2NO7A 1QVAA 1VIYA 2HF9A 2WJGA 5FPKA 1AS2A 2GZAA 2C78A 3GJ7A 3L0IB 2QQ0A 2VYFA 1KSFX 3AUXA 4HUQA 4HB3A 5LD2C 1Z0IA 2Z5FA 4GZMA 2FFHA 4X8OA 3AEZA 3SJBA 2FPMA 5BN4A 4NYIQ 3KKOA 1T6NA 3I8XA 1VCIA 5K8IA 1ZM4A 2VRWA 1E9EA 2IHYA 3TUZC 4B48A 2BV3A 1N6PA 1NKTA 4A2QA 4CGZA 2BMFA 3SC3A 4K8OA 4JBYA 4DB4A 1ZNXA 2VL7A 4C4PA 5J4KA 5EZ6B 3WHLA 2NO1A 4BLPA 2QZ4A 3FDIA 5HR5A 2OV2A 2Q0HA 1SKYB 2QGZA 2Z0MA 1R6BX 3EZ9A 2ZTSA 4E07A 4TT3D 4PC3A 5KOYA 4RFSA 4TZ6A 4RD3A 1KY2A 2O8FB 1C1YA 1EGAA 2KSQA 4LJ8A 4CF7A 4OQNA 1QG2A 2XZPA 4OK5A 3AGPA 2QPAA 3FHCB 4GRAA 1YZGA 3KJHA 3UATA 1GILA 4I4LA 2A5YB 4Q4HA 4QNRA 4TL9A 3WHKA 3I62A 2CCJA 3EIQA 3GP8A 2ZRAA 4L9WA 1MKYA 1XMVA 3U7GA 5JWOA 2BEKA 3IBYA 2ZE5A 1OLOA 2DFLA 4I1VA 1M7BA 2ATVA 3AP2A 1V5WA 2IYSA 2JCSA 3GJ4A 2OCYC 3PQCA 2OEPA 1A82A 2QE7A 3VU9A 1ZW6A 2ZJYA 1RRCA 4EAQA 2GVDC 4NH0A 2AKAB 3EIEA 3B9PA 4DCUA 1GRQA 5G40A 1P2VA 1U0LA 2ZS7A 2GF0A 3S1AB 2NO6A 4PHGA 1F6BA 3GJ0A 3L0PA 4QBGB 3TAHA 1YRBA 2PEZA 4D0LB 5EQTA 4Q1AA 1DS6A 4RZXA 5EP4A 4C0QC 4V0NA 3THWA 5HPYB 4XTCS 2RCNA 3LY5A 3QKTA 4LHWA 1W0JD 4C0HA 2XXAA 1FP7A 4XD7A 4DLWA 1NF3A 3A1UA 3BWDD 1E1RD 1G3UA 2ONJA 2VSOA 3VR5A 3I61A 1G5PA 1CEEA 1WMSA 1ETUA 4FWTA 3G82C 4HDQB 2R8RA 3X1WA 1MR3F 2AXPA 2REXB 2QM7A 1S8FA 2XAUA 4YMTA 2MSDB 1EFUA 3GEIA 3RS5A 1QHIA 3GLIB 3QKSB 4TYPA 2IL1A 2A5GA 4JMPA 4ZO4A 3PEUA 1KGDA 1VCOA 4MKFA 4TTPA 2VEDA 5F98A 2OILA 4LGMA 4Q18A 3SHFA 2FF7A 1ZUNB 1LS6A 3DKPA 1TEVA 3I3SR 4D2IA 2CVFA 2XGJA 4KLNA 4MA4A 2RAPA 4OQLA 2RGBA 1XTKA 3NWJA 1IN6A 3AF3A 3NHBA 1KI1A 3EA0A 2WVJA 4BLOA 4EKDA 2ZJOA 4MGKR 1ZVQA 4X8LA 3REFA 2QN6A 2J3EA 3TKLA 3ZVNA 1NVWQ 1GOTA 4LZZA 1TU4A 1COWA 1UEIA 1HY3A 2PX3A 3EG5A 3W5IA 4Z51A 2H57A 2FU5C 1JR3D 4DLZA 2JLRA 1F2TB 4C30A 1ZC3A 1RJ9B 3ONWA 2OCBA 3T1OA 4TSFD 3QF7A 4UNQA 2YC4C 1YZUA 1NVVR 2IYWA 4BQSA 4GMXA 4PFSA 2FSIA 4HZIA 2AHOA 4YMUA 2FE4A 3CWZA 1JALA 2R65A 5CDFA 4RKFA 4RVCA 4JVMA 4TLEA 4Y0VA 2A2ZA 2OFOA 1FFHA 3IPXA 2WWYA 2W6JD 3AVPA 2PT7A 3B1ZA 2P6NA 2CE7A 3IEUA 2Q9AA 3Q7QA 1VIAA 4FMCB 2AR7A 1H8HA 3AVXA 3HP1A 3B5JA 2QROA 2WJYA 4DDVA 2YJTD 3AH8A 1N6HA 2AWOA 4XSHA 5EZ5A 5C1BA 2QSZA 4QHTA 3QUSA 5FPTA 3RDPA 4TYYA 3NBZC 1VCMA 1O3YA 3DL0A 1Z5ZA 2RHMA 4TMKA 1XDBA 3GLHA 1CR2A 2D62A 2CLSA 4RD1A 1UFQA 3F8TA 3OZXA 5J4LA 2FMXA 2HYIC 1U90A 1ZAKA 1C4OA 4OKSA 5E95A 1PUIA 1CF4A 4PZZA 5CJ2A 2QAGB 2IS6A 1CLUA 1W46A 4AYTA 2D2FA 2F1RA 4Q47A 4LSGA 4IW3B 4FCVA 4TWZA 4E22A 4HLCA 1UBFA 1AZSC 2EFGA 4XIGS 2IK8A 4EPXA 5FTLA 3NBYC 2GXAA 4BLTA 2OCAA 1JB1A 1R8QA 1T0JB 2J0UB 1DAKA 2O5VA 4IXNA 4YMSA 4PC7A 5FTMA 3PENA 3LBHA 5C4MA 1KO5A 4PR0A 2RKOA 4XWKA 1X8KA 1H8EA 1P7CA 1VG1A 3WRYC 2ZSAA 2D7DA 2DFTA 4G5RA 4A2WA 5DI3B 3SDZA 2ZYUX 1XCPA 1Z0KA 2XB4A 2HF8A 1DPFA 4DUGD 3B78A 4OHYA 4A0RA 1T9HA 1IN4A 1CJUC 3IHWA 2JAQA 1YR7A 2OXRA 2ZRMA 2BDTA 1UJ2A 2BCJQ 4TN1A 4B74A 1E9SA 1XF9A 3BE4A 5DISB 1EFCA 1N0WA 4LI0A 3TUIC 4Q9HA 2V1XA 4WA7A 2R6CA 1PJRA 1JPNA 4P32A 5H8WA 2J41A 1MOZA 1OYYA 3UWOA 2WOOA 1ZP6A 2GTPA 2OBLA 2ZR9A 1W49A 3E5HA 2XEXA 2A9KA 2QP3A 4QG7A 5CK5A 3LW8A 5L3RA 2V7QA 3IILA 5FL7A 721PA 1E1QD 1K8RA 1OKKA 3GD7A 3OE7A 3QVVA 4JIMA 5EXTA 3T34A 1Q21A 3CUEF 5CIWA 2FSFA 1XB2A 4M9XA 1ZM7A 1N6KA 2EFEB 4M2LA 4M9ZA 2GF9A 3KL4A 1JQLB 2IX3A 4A15A 3K0CA 4QXAA 1AKYA 1DOAA 2CXXA 4PHTA 3A1SA 2O0HA 4BGDA 3C15C 4PAOA 4B32A 3UG6A 2ECKA 4AKIA 1P4SA 3QXXA 1SVWA 1VECA 3MJHA 4B33A 2ZPTX 3EASA 3LBIA 4G5QA 4MH0R 3EAQA 3W90A 3QNUA 3EWSA 4IDNA 4L16A 5GVSA 1R0YA 1I2DA 1P62B 1PLLA 1TF7A 4BLSA 4ASUD 3DO6A 4XSGA 1II0A 3ZS8A 5B58C 1Z29A 3FHOA 4D25A 2RGGA 2RMKA 4BFUA 1XEXB 4KSBA 1CR1A 1J70A 4ZI3A 1DAMA 3LQRA 3R7WB 2PJZA 1QG4A 2H92A 2B7BA 1US8A 3PUXA 4M53A 2A3RA 2WSSD 1N6IA 1WDTA 1JNYA 3SU8A 3ZVRA 3CF0A 2XOKA 4QJ5A 4OI4A 1E2DA 2WJJA 1EESA 3NTUA 4KFTA 4Q7JB 3RRMA 2QMUA 5B2ZA 1NN5A 1TNDA 3DVLA 5A4JA 2FA9A 4LDJA 5HE8A 1Z0JA 2IWRA 4F93B 1GTVA 2G3YA 3AVOA 1G4AE 5FL3A 1WE2A 1N2CE 2IF0A 1M2OB 3KUDA 4PHFA 1XXHE 5DGXA 1S1CA 1T3HA 4NCIA 1OPXA 2O0KA 2HXYA 5CDFE 4ABYA 1SVSA 3AP1A 2JGNA 4JLMA 4NYMR 5KDDA 1ZD8A 3L8ZA 4L8GA 1RW4A 4PPGA 4JJKA 2ZSEA 3QXSA 1Q44A 3HYTA 5FFMA 1XJQA 4LRWA 4EPVA 3A6PC 2JJ8A 1Z3IX 1W2HA 4NCHA 4TT3A 3ND9A 1TQ6A 1IXZA 2BM1A 2FFBA 5GJCA 1XMJA 1G7CA 2YOHA 4KFRA 4EPRA 3VKGA 2OG2A 3W5JA 1T8TA 2EU8A 3HWSA 1FPMA 3CLVA 4AG6A 5AK0A 2CBZA 4E03A 4TLCA 4JBXA 5CM9C 1E4YA 3PEYA 3BXZA 3CRW1 2GJ9A 4B47A 3EARA 3QPWA 5GVRA 5BWMA 5J47A 3MWJA 5GJWC 3WP1B 4C7OB 4YDHB 2BCGY 2VHUA 2QT1A 3QOFA 4XWOA 3EW9A 3KKMA 3I72A 2C03A 3Q9LA 5FBWB 2RGXA 3EZ2A 2IYXA 4NCNA 1E94E 1E2LA 3FFAA 1DARA 1DEKA 1G3QA 3ZZUA 1G20E 2QPTA 2GHIA 4PC6A 5KPDA 3CRQA 4V0KA 1G18A 2GBLC 2JLQA 3EPLA 4D4KA 4D6PA 1U8YA 1DTSA 1MABB 1NN3A 2GJ8A 4KU4A 1E9CA 2QE7D 2OZEA 2ANBA 2WOJA 4H1UA 2QA5A 1GG2A 3QQ5A 4GZLA 4BASA 4DIDA 1W0JA 1JBKA 3DOFA 2F9LA 3EZ6A 3K0FA 4JLNA 4M21A 2V6IA 1L2TA 1Q1BA 1J7KA 5JEEA 4QHYA 1QBKC 2XZOA 5CLLA 1CXZA 5LB4A 2JLVA 3KQKA 2OT3B 4MRVA 2EFCB 3P20A 3MWYW 5D3MA 2J9RA 4DDTA 5JWRA 4WVFA 3U3JA 3OIWA 5SZHB 1KNQA 4AKEA 5JEDA 3BK7A 2OBMA 2CE2X 1KI7A 1D8TA 1WA5A 1S9HA 2ZI5A 1KAGA 4UNSA 1OH6A 2ZRCA 4A6XA 4NONA 2O8DA 4WAUA 2GETA 5H70A 4A6PA 4TYWA 1PZNA 3AVVA 1DAFA 1IN7A 4A4DA 5GJBA 2QPOA 3LXXA 2NZJA 4OJQA 4Q1BA 2IEYA 3ADCA 3A8TA 3ZQ6A 4FI3C 1RZ3A 2GWHA 3Q85A 4NYJR 3DM9B 4EPYA 3FGNA 1Q3HA 4GDFA 5K8LA 2W58A 1E9FA 2G6BA 3IPYA 2ODWA 4Q1CA 4CT4B 1COWD 4OJKA 2EYUA 2QP9X 2QNRA 3W3AA 1XFAA 4Q21A 4NTZA 1DELA 1ZM3A 1AN0A 3LW7A 2BJWA 3THWB 1Z08A 4B2LA 3A4LA 2GILA 5AUPB 4NMMA 4Q1DA 2PLRA 3EC2A 4BFXA 3WXMA 1DBSA 1OXSC 3QPVA 1E9RA 2B92A 3SOPA 4R98A 3CX6A 4IXMA 1EX7A 4AG5A 2A5DA 3MAAC 4MRNA 5TV2A 3TNFA 5TDHA 1UEJA 2WWFA 1YZQA 4K46A 4EFMA 1ZINA 3N2IA 2R6DA 1X6VA 3GLGA 2ZETA 4HAZA 1D9XA 1GL7A 5EE5B 4FCTA 4S35A 1QHSA 4LPKA 3NDBB 1QHXA 1Z0FA 3SJCA 1KDRA 3BGWA 1LF5A 3AB3A 1KK3A 3CH4B 4M8NE 3TH5A 3WNBA 3NC1C 3IO3A 5L3SA 4NCJA 4WOPA 1TQ2A 5JJKA 2FZLA 1EXMA 1PV4A 3RHFA 4Q4JB 2FJUA 5EE1A 1II8A 2CK3A 4XVQA 1U8AA 4LBVA 5E7JA 1NBMA 5CK4A 1NSFA 3LVRE 4Q9IA 2LCFA 2OE2A 2ZAOA 3NG1A
chains in the Genus database with same CATH superfamily
3EQ8A 4W5NA 2PCJA 3RAGA 1OLXA 1X0XA 2EGHA 3V8NA 4E33A 2QU7A 4ENWA 1XCGB 1NUHA 2LVBA 1O96B 4N12A 1NY5A 1X86B 1Y7TA 1DUIA 5B1EA 4ZHQA 3EVEA 1XTPA 4X20B 1UXOA 2IYAA 1U28A 4CODB 1JECA 1RLUA 4KW7A 5DE3A 4AJ4A 1WCV1 2RDMA 1QP4A 4OHXA 2O1WA 3FW1A 3B53X 5B3AA 3IULA 4DG8A 4YA6A 1Y3HA 4QBHA 1E2IA 1M5UA 4OFBA 1NBOA 1NMSA 2X0RA 3MWEB 4Z9XA 5I4IA 2AJTA 1DUVG 1ITZA 1U3GA 5HEKA 1EFRA 3E05A 1QRUA 4U00A 4UM7A 2JBAB 2A7XA 3QXJA 4IPTA 4KLZA 4YJ2B 5H7XA 4DSOA 1C7EA 5DYWA 5KJ1A 3I6ZA 2F8LA 2GAJA 1KJJA 3CZRA 3H5OA 3PFKA 4IZIA 2XBLA 4CU5A 3IAS6 4F84A 5GADl 3FCOA 1Z15A 2I91A 4PSCA 3S1SA 2VAXA 3QHAA 5I9TA 2CDBA 3TSWA 1GTG1 5AHXA 5DN9A 2P5TB 5F77A 1LF0A 2JLYA 3DT9A 2EP8A 1YF3A 1E2FA 1IXKA 4G01B 4GX2A 1JHOA 1UZLA 1FBTA 3DXFA 3HQ4O 4FDAA 4GOJA 4BNDB 1Y3AA 2Q3CA 3DC7A 1GUZA 3J80A 4MAMA 1IAVA 3G2HA 4FYKA 4LMAA 4KIUA 4ZQEA 1PLKA 3E1KA 3NVMB 3V7YA 2R8EA 2V55B 2G0NA 3DMPA 4H27A 4O5AA 4F0JA 1P1IA 3G0OA 2JHAA 4PZAA 4BUCA 4JOBA 1C3LA 1UPUA 1S3SA 3C16C 1KVUA 1QYIA 4WJLA 2WSIA 3V4FA 5K8VA 3AR3A 1ZI6A 1W85A 3H7IA 3RSOA 1OY1A 2V97A 1CZRA 2Q1YA 4CLDA 1J42A 2F8MA 5EP2A 3RC7A 2QVBA 3BCRA 2PX6A 4MUBA 1D2HA 3Q5DA 3QBTA 3VJMA 2GPAA 4MPDA 4Q5IA 3VRHA 2B8NA 1N7HA 1U9YA 2OOKA 3OT5A 3Q2KA 9ABPA 1QYRA 2HNAA 2HLDA 3E5RA 2DF8A 3NWOA 3SSMA 5AI0A 4LF9B 4K6KA 2JI9A 3EOZA 3LBNA 4QPNA 2RHOA 1QJ4A 3KLPX 4R2MA 4YAWA 1BROA 4H7HA 4QRIA 3UOAB 4IHJF 4BP9A 4XOUA 2R4QA 621PA 2WY2D 2VHYA 4GE3A 4JJ7A 3FRIA 2YFYA 4N7JA 4R2LA 5BRAA 1PR6A 3EZYA 3D2CA 2XMSA 1E0DA 2PFGA 3JRNA 1QH9A 4BBZA 3OQJA 5BOSB 1UM9A 3OX2A 1D9ZA 3ORQA 3UKOA 3PYMA 2PL3A 3NOOA 4AS1A 1ZWKA 4CKEA 2RFLA 3D54D 1E4VA 1KP9A 3BPSA 1CUXA 3FI9A 3AOEC 1QH1B 3FCUB 5EKDA 3D59A 4H3SA 4NU5A 5DASA 4YAKA 5FBVB 2XW6A 1CJBA 3L8MA 3TF5A 5FBKA 1JRLA 3MPUA 4FGSA 3NC0C 1LW7A 4B71A 5BSKA 4PLCA 1IWOA 4ZZ1A 3NASA 4C0WA 5K09A 2ZBFA 1EIWA 3VUEA 3A6KA 4DIOA 3B1VA 1J5EB 2O0JA 2QD2A 4BV8A 1QIEA 4MYCA 1SXGA 2R86A 1GGKA 4JYPA 3TL6A 3GWZA 3LHSA 4G23A 1LJUA 3ORSA 3DT6A 3M5DA 4JYBA 5CX1A 4AULA 4BZZA 5WRFA 5G0TA 4Q00A 4B31A 4CM9A 5LMZA 4J76A 1XALA 4KYVA 3D6TB 1VB3A 3VAYA 3PFFA 3P2IA 5JO9A 5KYUA 4B40A 2D2IA 4TZTA 3CYFA 5E6RA 1PNVA 1G98A 1KZYC 2QD4A 4GD3Q 2QTVB 4RWZA 4AC9A 2J3DA 2GEUA 5FADA 2K2QB 5LZ9A 1TKBA 5FKJA 1RPZA 3CW2A 2VJAA 3OA2A 1AGRA 4H35A 4LHEA 1LJLA 2AEJA 4UVEA 5GV7A 3S2SA 2DWUA 3I34X 1U0BB 4LJSA 4PLVA 2XZDA 1PFGA 2SBTA 2AFHA 2QX4A 2WG1A 1SJ9A 2MT9A 2WHQA 2H2DA 1GEEA 2H65A 3F3KA 4KYIB 4CUZA 1WZ2A 1GRNA 1OXVA 1T5DX 2X2EA 1R12A 1VHQA 2HO5A 3FPAA 2OCKA 4N6GA 4EO7A 4N49A 1OX4B 2JLBA 2XNDA 3A1DA 2XMZA 1YWGO 1KI6B 3NM4A 3UWDA 4YAJA 1UBJS 1JFTA 3BXPA 1T9KA 4C04A 3VNAA 1KY3A 1OI2A 1T2EA 2J3QA 2J9FA 2WU8A 1XRQA 3KHKA 3MSXA 4HXYA 5L7WA 3QW4B 1MC8A 1JV2B 1TYAE 1YIOA 2V03A 2A30A 3P4XA 4O5OA 1CQJB 2H5LA 3LG2A 5KJFA 5ALJA 1P74A 1QQ6A 1X38A 2GTIA 1S2GA 3CX7A 1E2GA 4E31A 2WIDA 5LA6B 1SUAA 2RGYA 5AUOB 5IT0A 4Y0AA 3AL0C 1QHYA 1NV8A 2SCUA 2I6GA 3ILSA 1ZSVA 4FMCF 3TRKA 4TYNA 1YCDA 2JIQA 4QOIA 2OCIA 1DEXA 3L8FA 2CL0X 4HR7A 4A36A 4RD4A 5I7VA 1RIIA 4QUBA 1J0DA 1N6OA 1GZSA 1MPXA 4RJLA 4CDGA 1IPHA 2CYCA 1IN1A 1A8UA 4E13A 3D6UA 4D3XA 4F5WA 5J1SB 1FQWA 3E48A 3ZNOA 3I83A 1TX4B 4ABTA 3QFTA 4HX2A 5DHAA 3PX7A 2O2YA 2BPOA 3BERA 3LIIA 4EBFA 1DKOA 4M37A 4UM9B 4BCBA 2JG3A 3WLRA 2RCYA 2PRIA 4FHFA 2PH5A 3IV9A 3PRJA 4Y2TA 3A58B 3TOVA 4GKVA 1W75A 1KH2A 2O2CA 1X39A 3ZU3A 1C3XA 1ONBA 3WWCA 1MAHA 2CXHA 4DRYA 4RTQA 4RK1A 2AVNA 3A6FA 4Q1EA 5AWFC 1QWOA 2JB9A 2H7YA 4NZPA 2HEIA 5G41A 2PBFA 1CRLA 2IBMA 3GJ6A 3TJRA 2XHZA 2YRXA 3IP1A 2GM5A 2I5PO 1FUKA 4LRXA 3QLVC 3IPCA 4Q6WA 1A9SA 3LECA 4EWLA 1UJ5A 2NYUA 3HLYA 2YV2A 2AF4C 2XYVA 3KXPA 3M1LA 5GZ6A 3BEOA 3QJGA 1O0CA 1KI4A 2C99A 3BRWD 4JLAA 5SY6A 2ZRQA 5BV1A 2HMSA 4X60A 4DMFA 4EUNA 4IKOA 5C18A 2WHXA 4CEJA 4O33A 2GK4A 1GQYA 5FTJA 4YRPA 4NBRA 5BYKA 3GFPA 3CRNA 2HT6A 1UC9A 1XAJA 2FEKA 3TIGA 4PGMA 2Q7OE 1JDBB 2BKUA 1Z4OA 1GQOA 1CUAA 1FP6A 3EGXA 1PT8A 3T9EA 2UUAB 5T4BA 2AFIA 2NOAA 4DWJA 2JGEA 4HLUC 4DLBA 2PZKA 4HBZA 4BAZA 1VC2A 1IEWA 1N4AA 4F38A 2V45A 4XVCA 5F21A 1Y6ZA 2VSYA 3AI7A 1GTJ1 4D9CA 4EJ6A 5BXYA 2F1OA 4QECA 1ZN7A 3MF4A 3JQCA 2Q3LA 3BYZA 3RUAA 4A9AA 2PS9A 3F5SA 5JYDA 4Y9UA 4DCPA 2QORA 4PN7A 5I5EA 1U3CA 3SZOA 3T3NA 4RZ3A 1AKEA 3RU2A 2RE8A 1YQUA 1JXQA 1A9TA 3SVLA 5EE3A 4AWXA 1QS0A 1Z4KA 2VRNA 1BH2A 5LZ8A 1KI2A 1J8MF 2ID9A 5I47A 2QG4A 3PDIB 5IBCA 1M6HA 1P44A 1WF6A 1VP3A 1X13A 3CB2A 3CVJA 3SS8A 3TLZA 4QEKA 2A9QA 3UVEA 4CNBA 4EYOA 1R5NA 9ATCA 8ADHA 2B4QA 2ZB3A 3HPQA 3QTTA 5DHPA 1OW3B 3VR2D 3B13B 1T8WA 1KMHA 2H4FA 5ENDA 3HXQA 1EXDA 3F7TA 3ISJA 2BRUC 4I5IA 1PBNA 1XMQB 1H2AS 3OY2A 5KYXA 2O8EA 1AJEA 2L42A 3W34A 3C1UA 4KMMA 4II7A 4PZPA 4O29A 3ENVA 4L2IB 1JXAA 2QV0A 4NAVA 1IY0A 4ZGWA 1UAYA 2Q62A 4REQA 1TC1A 2BP7B 4Y9SA 3L18A 5DYNA 1XG5A 4KXVA 1N92A 4W5JA 1NW6A 4LC0A 5A4IS 3OWOA 4HH1A 5C8YB 1EM8A 1TUBA 3QPBA 5B6PA 1L1FA 2QVCA 1X19A 5AW0A 5FRDA 2C9BA 2AEFA 2P9TA 3QPUA 4FEGA 1A5SB 1CP3A 2PX8A 4Q66C 3UFBA 3D1LA 4OXXA 4FHCA 4KVZA 3VZDA 1WEHA 2C4WA 3QU4A 3X1XA 1Y7IA 1LSSA 1PR4A 4Q1FA 2A92A 2FMFA 4DCJA 2RGDA 4IJMA 3SJAA 2X0FA 1SHTX 2G0AA 2AMLA 3EDQA 1NBMD 5AW4A 3MD9A 2YY5A 2J7KA 2CLCX 3KBOA 4MARA 3ACDA 2PT9A 4KR7A 1TVKB 1XHLA 1YKSA 3OJ0A 4MW7A 4U5XA 2XA1A 1RZRD 4MA5A 4MPTA 1F2DA 1WQ1R 3UK0A 7REQA 3HU1A 1RP1A 4YRIA 2QJTA 2GCPA 1JDJA 3FSEA 4TLBA 2CXQA 3DUFB 3AEQA 2Y4NA 3HY6A 4GMDA 4KR2A 3RVDA 3VZSA 5KTOA 1J8VA 1GHTA 1RMQA 1Y9ZA 4DNFA 4P22A 3QWAA 3HYCA 1ZRHA 5K0ZA 4F4IA 2EW8A 2G4LA 4H7IA 4UHJA 2RHJA 3SKXA 1SXJC 4KQCA 1YJ5A 4UU0A 3RS2A 2C7OA 4RBNA 3RVLA 4GGMX 1WLYA 3R9XB 2E6UX 4UJ5A 1SM4A 3S68A 4XWWA 2FW6A 4M9UA 1W36D 3WVNA 3G49A 1RBYA 1YU6A 3WP0A 4P36A 4LI3X 2GZRA 2X42A 4KEAA 4PSVA 3QELA 4WZAB 4BFTA 3MC1A 1HE2A 4P3OA 2QYSA 3L0SA 1KR5A 3RRJA 1PX0A 1ABEA 1T8PA 3T7EA 2FRXA 4O2BF 4OYHA 4ZOQI 2OESA 1I94B 4B3BA 1M8GA 3KJFA 1QHGA 3O4JA 4KNWA 1PJCA 3DOUA 4E2FA 2COUA 2RK6A 2IZ1A 1SAYA 2YZ2A 4WNIA 3UK6A 4Z4QA 3RWOA 2PXAA 5L3VA 2P3SA 1F4PA 2YRWA 4WFQA 1U63A 3P8ZA 4GM4A 1U8UA 3QP9A 4RDIA 5F1OA 5AK5A 1T4CB 2R2AA 3DULA 2PZFA 3O7MA 4AB1A 1MEEA 1WCIA 3PXUA 2IU3A 3R23A 1VJ5A 4IDDA 2QRMA 3TLYA 1CZUA 1RMTA 1M1UA 1NXTA 2A86A 3ER6A 1N8KA 4WLVA 5BORA 1K86A 3D4LA 5HCIA 5B30A 2XUOA 2CCKA 5CT6A 2C29D 2VUSA 3PC6A 4IMPA 4CF3A 4RD2A 4E5PA 3T5TA 3HE3A 1KEVA 1GKUB 3UAVA 1LXCA 4GOXA 4JBHA 3MGAA 4S0XA 4DV0B 5EIXA 2K6GA 3E9NA 3ZIAD 4R8SA 3BWEA 3JQAB 2FSVA 3DZDA 2AKYA 4M0PA 3QG5A 3ZDAA 3PQ5A 5CJJA 1TB4A 3LNCA 5D01A 4KO1S 5IN5A 3VBEA 4BO1A 4BNWA 1F7UA 3I01A 3J7TA 2B78A 1GGJA 1YOVB 1T26A 5THQA 4RIHA 1W35A 5JJ5A 4OBEA 1YRWA 3QKWA 1U8ZA 1YGYA 1GL9B 1WDMA 2KB0A 3AETA 1W1UA 4QFDA 4TRJA 3RSHA 8GPBA 1N7JA 4QTYA 2GNPA 3J81k 5EWMA 3DLBA 3CR7A 421PA 1KJNA 2DU8A 3ZWOA 1WUTA 2BSXA 3PNMA 2V9CA 5CA0A 5GZ1A 4FYPA 1P0MA 4R84A 4GEKA 5BN3B 4PRZA 1BYUA 3G23A 2FWAA 1WTAA 3ZY5A 2O14A 3F2VA 5EGNA 3LUKA 3M9WA 1KGSA 2NYVA 2QRHA 2ECOA 5DK6A 4TTQA 2QB5A 1V96A 3LVBA 4L5BA 2R751 1SD1A 2QTFA 4I66A 3UB3A 1WU8A 1A95A 2O8FA 3R5XA 1I32A 4RUKA 1ESEA 3RVMA 1KEEB 3L9WA 1NATA 2ZREA 2ZE7A 2BOVA 3VI3B 4JOSA 5LQNA 1RWBA 1OXMA 1W94A 2OQRA 5HZMA 2EZ8A 1NNEA 4Q48A 4JP2A 1OB5A 3GLKA 1II9A 2VOJA 4H59A 3QEOA 1JEQB 4LCEA 1WB9A 4XPIA 1PNOA 3TW0A 4E5UA 3PWTA 3VSBA 4I50A 2F1IA 2R48A 1XDZA 4QUGA 4OVKA 5K8CA 3IJ5A 1PLJA 3QPAA 4MPPA 3ZWMA 4Z1MA 2IOFK 3NKFA 3DCIA 1QX3A 1Y7HA 1R9NA 1E5VA 1RTKA 3WQQA 4D3FA 3F73A 1RLOA 1Q20A 1QVRA 1YZNA 5HJEA 1Y6RA 2VHXA 2WJ3A 1KBZA 2XPCA 3RT9A 4DCTA 4RMHA 1EVIA 1C9YA 3N9IA 4LFCB 3ZKWA 4CLOA 4X62B 2W6QA 1OLUB 4YTEA 3BIJA 1AK9A 3D4OA 3KB6A 3Q6MA 3OQ6A 4FUQA 4M8LA 4WT7A 1OLSB 4LV8B 1N1EA 3LZCA 3S1AA 4HAXA 2MR6A 3S29A 5IBPA 7MHTA 1T2VA 4HDSB 1RJDA 2PS3A 4XH9B 4RJJA 3RW9A 1ZK3A 3AEUB 1YFZA 3H16A 3L7NA 2CVHA 4J07A 5JCXA 4Y6QA 4BFYA 3LO8A 3BS4A 3PT5A 2OENG 1XCOA 1E4EB 1UKVY 4BVJA 1GQRA 2AZMA 2FCAA 2QTMA 3IB6A 4LK2A 3WYBA 2WVAA 3ISVA 3WRWA 3HXOA 4BN5A 2Q5JA 1F0NA 4N5HX 3PXXA 1M34E 2VT3A 3HCEA 1EX6A 3HGQA 5CX1B 1L9KA 3I28A 1XUOA 1O95C 2F9FA 1FTQA 2QRLA 4O1HA 4Q01A 4RC9A 3T7RA 4HUQB 1H4QA 1P6XA 2YZNA 1P7VA 1P4JA 4KMRA 5FUBA 1Z2NX 4EJMA 1QRRA 2D5IA 3DPIA 5JSYA 1M1XB 2GRJA 2W6OA 3KX2A 5I7FA 5LKAA 2HNBA 1WSAA 2IP4A 5E6RB 2FI1A 2ISSD 4ZI2A 4M7WA 3N05A 5H3CA 3JX9A 5ALGA 1S2MA 3L7OA 5LR6A 1NPTO 3OWHA 1R9JA 3HA5A 1ZUNA 5CB8A 2ZSHA 5C32A 2HK6A 3K0BA 2MTBA 2YXBA 5ELXA 1CEYA 3DS8A 4AO7A 1NSYA 1W0KA 1PSWA 3I53A 1NWHA 2JJ1D 2R25B 1DIBA 2IGTA 4Z8YA 5AVKA 4ATNA 5EJ2A 1A1VA 3IGFA 1LSOA 4EQ6A 1J90A 1W5TA 4URHA 4EQ6B 5CCEA 2IITA 2P69A 3LC2O 5F3DA 1BQ3A 1QAOA 2XI4A 3FWYA 2OY0A 1RM0A 4C4RA 3RYCA 1Q57A 4XDYA 3FD8A 1PWYE 1MIOA 5FV7A 1S2DA 4D80A 5CB4B 3AV3A 2B37A 5E3HA 4MVJD 1F2TA 1P29A 1JW9B 2XKBA 4ARBA 1T6BY 4X94A 1RPNA 4Q4HB 5LP1A 1J0AA 4YEDA 4GR5A 1JJBA 2EQBA 4DLVA 1AS3A 5BWLA 3X1YA 1TQDA 3ETLA 3SZLA 2YVLA 3SYTA 1Y80A 1MRSA 3FCAA 4CL0A 1G9XA 4CNQA 1DAIA 2FR8C 3EG9B 1IBKB 5COAA 4D26A 1DZIA 3GO4A 4LWPA 2LZ0A 1OVGA 4GNRA 4X6YA 2Q4TA 1IK4A 5E8RA 4GRDA 4K9NA 4LBYA 3QPCA 5ED0A 4OLAA 1Q1EA 4I7EA 1XK6A 5IFKA 3OE4A 4UE2A 2F7SA 4PYNA 3VU9B 1CVIA 4GGPA 3K2BA 2A4KA 3NI2A 1DBIA 5JO0A 3OZGA 4KXQA 4L95C 3LXUX 4K3VA 5K3CA 3WGOA 1NX6A 4LSWA 4LRYA 2R5WA 3Q10A 5FH9A 3MGGA 4FMBB 5FPYA 1PVOA 4RKWA 3D8RA 1EHYA 4B6FA 1EQUA 4PIMA 4FHGA 2EJCA 2V7VA 5CUQA 5AK6A 3TQQA 3TZKA 2WWIA 4B6QA 2WG2A 1KXJA 3OQ1A 3NCHA 1WABA 1Y34E 3C8UA 4LE2A 4DCVA 5T57A 3DG9A 2XXAB 1ULZA 3NP7A 2CLIB 4I2NA 4MI3A 5DGDA 5DO9A 3U13A 1TJ3A 1RC1A 3E82A 2YXPX 2VWQA 2VDOB 4I55A 4YDRA 4FGKA 1NW9B 1KU6A 1LEHA 1W4RA 1T6ZA 3HJUA 4XJSA 5EIFA 3RK4A 1XN4A 5CCDA 2GCOA 3CXRA 3L6BA 1E5QA 1SHKA 2EWMA 2Y05A 1NVKA 4IIJB 4B09A 1NURA 4DNPA 3CWQA 1E58A 4F8EA 4UFNA 4BEBA 3C6ZA 3DTNA 2CD7A 4L8YA 3DBLA 3TMKA 4RF3A 2IV7A 5ILQA 2ZJ3A 3O1IC 1SH7A 1H9CA 4UAUA 1NM5A 4XASA 3T6KA 3A6HA 2FUCA 1S3FA 3AFMA 3GNTA 4DBVO 1Y8CA 3VKUA 4IIGA 2V5VA 3I09A 1OFGA 2B69A 1TO1E 3KZOA 4UHHA 3TB6A 4D43A 1J20A 2FLKA 5MFZA 4UBOA 3E7FA 5FPSA 3WXMA 3VYVA 1Q14A 5TQ0A 1FYDA 2X4DA 4YP6A 3I9MA 4XIFA 1D6SA 4IIUA 1ISRA 4YJHB 2M1ZA 4KQGA 2IVFA 3EGXB 3FWZA 3IAM1 4M83A 4D0GA 4DLSA 4E6PA 2FW8A 5CYPA 5KTSA 3CINA 1BE6A 3CVVA 1KYWA 3NBFA 2PBLA 2WHPA 3ZI4A 1O97C 1Q15A 2A9FA 4LX8A 5HRAA 1DT3A 2DBZA 5M29A 4M1TA 1HNXB 5JG7A 3FOAA 5AMXA 4RH0A 3KOOA 1YMVA 3LQYA 3ZZNA 2JIZD 4XJXA 1SXJD 3FJ1A 1BOFA 4KOAA 1SZCA 3IDQA 4FNMA 4WEOA 2G8NA 1DJNA 3BAZA 4CCYA 5A5DA 1E99A 1L7AA 2SKCA 3DMHA 4WXYB 1FXSA 2ES4A 2W93A 4O4LA 3HFJA 1IONA 1CDOA 1MDFA 2X14A 1GCIA 1XLVA 1O2DA 5AI4A 2AG1A 5JZVA 4FR0A 1RQ2A 2JDID 1L0BA 2ZANA 5F12A 2AG8A 2ZQYA 4I5EA 4R69A 1H22A 1QQAA 4YH1A 1JSLA 1JHDA 1IM8A 4AZ0A 1R0WA 2FP3A 3B52X 1XPRA 4YJKA 5LDGA 5JAOA 4GC9A 3LTNC 3G2MA 4GLOA 1G5TA 4V03A 2GYUA 4NLLA 3BHMA 3JPYA 5L8VA 4R2WA 2E85A 4WZ6A 4EKYA 2VHZA 4HN2A 5TF4A 4M0CA 1F1BA 3CH6A 2BMDA 4REQB 5E0OA 1HX7A 1CFJA 3ZXSA 4Q02A 5DDIP 2L2QA 3VPFA 2VP4A 2GJKA 4ZO8A 2GHQA 2H7VA 2ZUBA 4HS4A 3RPEA 3GGJA 1A2KC 2OB1A 3TLGB 1U8CB 1YUNA 4ZDJA 3B3QA 4DR2B 3IIJA 3ZYZA 4OSEA 5JANA 5JR3A 3WGLA 5A5EA 1IEQA 4PCVA 1AHNA 3GMIA 1ND6A 3BZWA 3L4BA 3LNTA 3OHMA 4LJLA 4U6SA 3T9DA 4DA8A 1K7FB 3A36A 4KB5A 2Y76A 1VLZA 3U1BA 4X1IA 2ZM6B 1M34B 1W581 5HKLA 4DY6A 4NCBA 4H3HB 4HX5A 4IH4A 3QVKA 4JFAA 5CEEA 2X77A 3B6ZA 4ZU1X 2P8SA 1PD0A 4J49A 4L6AA 1XKXA 3WJAA 3PDJA 4RTKA 5GONA 3W04A 3C6YA 3SQNA 2Z8YM 3PUIA 4UUPA 4AROA 3T5MA 2DY0A 3H2HA 5CNKA 5HQTA 5KEIA 3GUZA 4X6XA 4RZHA 4OFZA 2ANCA 5IS2A 4FBMA 5KX5B 1Y5MA 4Q03A 2DFVA 4R81A 4PEVA 1FU7A 4L4UA 4PG4A 1IY9A 2FLWA 4MV7A 4DR7B 1UXHA 3BMOA 2ZRGA 4UCQA 2DCUA 4TTRA 4L02A 5HIMA 4ZAZA 4LQLA 1T5BA 4FYXA 4RQTA 3CM0A 3UTCA 4OQ4A 3X0DA 1BVYF 3QE9Y 2FZ5A 4G5FA 1ISMA 2AC4A 2ODEA 3FTNA 2WUWE 3NVAA 4L9SA 2HRZA 4ZQCB 4ZAVA 4R8KA 2JHFA 1E7SA 1L5MA 1P5ZB 3MRTA 3A2MA 5EWLA 5J23A 1L3CA 1ZJWA 2KW5A 2ZT8A 2Q21A 3LT2A 3SI7A 4UOEA 5DSTA 5CB4F 4E7OA 1VLLA 1I2CA 4IDGA 3MN1A 4DN6A 5D8DA 3S1LA 4QGBA 1XSEA 3DBOB 2Z6UA 3O26A 1NXQA 1Z0SA 2IS2A 1Y6GA 3SDBA 3BH6A 2CZQA 1Z4JA 3NBKA 1IUOA 1B3RA 4IJUA 3MYRA 3VPCA 5IF9A 2FX3A 1ESMA 2XVZA 1KK0A 2B1JA 2A88A 3R3WA 2DM6A 3U3RA 1C4XA 3I2IA 1YOBA 2XB6A 2B21A 1BGWA 3EXHC 2G80A 3ME5A 3SYMA 4TTJA 1JEDA 3O2NA 1G6HA 4PNEA 5IDWA 2BGKA 4L9AA 3TZHA 2ZM5A 1DFHA 5C7LO 1RKBA 3KLBA 5I7RA 2J1LA 2VC2B 5L6MB 5ALTA 2WD7A 1J25A 2X4LA 3KHSA 3VKVA 4HDNA 4LJ4A 5EPUA 1GPLA 4GGOA 4ZQFA 2JIOA 5GM1A 4K9RA 4IEEA 5KTYA 2I22A 4RVHA 4R51A 4FB5A 2YWHA 1XR3A 1JG4A 3S7ZA 2C4VA 1GU1A 1U7XA 1VYTA 3TQCA 1EFHA 2FSGA 2GESA 3JVDA 3EAGA 1V1RA 2YMLA 4QDOA 4TLDA 3RSGA 2W0SA 1RZUA 4NZOA 3RROA 4C01A 3NHKA 1U8FO 4U3JA 5EKSA 4MYSA 2JJMA 3TX2A 4EDFA 4YCDA 2B7CA 5CA0B 2W0MA 2IUFA 3AG5A 3BE8A 2JIBA 1VMIA 2O6LA 1HUQA 4NEQA 4PX5A 4UPDA 3FYDA 4DCNA 2G9ZA 1O95D 1I1OA 4F3TA 4GLJA 4NMHA 3VR3D 1R4ZA 1S3IA 3R3UA 3U1TA 4L4XA 4TRRA 1VCHA 3F6EX 3UAGA 5EEGA 2HJ9A 5G53C 5J2UF 1RWKA 2P9BA 4EAAA 3M6AA 4ER7A 1T0IA 3RWBA 1U2QA 2I2FA 4FZ5A 5LKRA 2C5AA 3R75A 3W1EA 1ZITA 2W8BA 3HDVA 3G8DA 3OG9A 1EA5A 2Y9PB 1YHZA 4POAA 3WLSA 5HUQA 1FNSA 1OBVA 1QHNA 5GINE 5EXPA 3A2LA 3FVQA 4KQXA 5CPFA 3FOZA 1V39A 4G65A 3OUTA 2YFKA 3QX7A 4QM6A 1DKRA 1VE5A 4KVFA 1TCCA 3MW8A 1DV1A 2C31A 1WZIA 3I2GA 3ND7A 3QE2A 4HL6A 2W00A 3N70A 4P2GA 5JSUA 3IRUA 3IIKA 3DJYA 3AHIA 1NYTA 2VHTA 3IAUA 3CH7A 2VYND 2XQKA 2P41A 4IGIA 4CF6A 3KT6A 4WWHA 1R4AA 1B16A 3KTOA 4I50B 4NFYA 2AN5A 1CRQA 1SBIA 4UVGA 2CLFB 3PSAA 2YC2C 1JLSA 3H9CA 2D3WA 1DVRA 3AVWA 4EARA 1NSTA 2ZWAA 3FXAA 3O8QA 3G5LA 1E1DA 3RF6A 1QPBA 2ZUVA 1UXIA 3ZWAA 3A1TA 4HAWA 2MMCA 4CLOB 2CB9A 1W5BA 2BMEA 4ZDIA 2FEOA 5JXIA 4W7SA 5LOVB 2NMVA 1ISJA 3QXGA 3C3CA 1N6LA 2GA9A 4E1BA 4RYLA 2ZUSA 2O5CA 3V9AA 4FFBA 1BE1A 1NXWA 3VZRA 2R1TB 5TF0A 4DIBA 2R7KA 2QZJA 5IT4A 3DO8A 5A5GA 1OJLA 2MYTA 2O2GA 1Y8RA 3TMAA 3MPOA 5FHRA 4BKPA 4KHPB 1I6LA 1UWCA 2Q9BA 5GPBA 3NTXA 3BMXA 2WF5A 4M9SA 5IBQA 2X9LA 2XOXA 3L7BA 3B9RA 5EJ9A 5AKLA 3F78A 4EA9A 1MO6A 3BTSA 3OAAA 3EA4A 1XC7A 1Z17A 3SC4A 2GFHA 4EFNA 5JS7A 3EVTA 2F3PA 4H1VA 2H1LA 5C0OE 4FGWA 4FMDF 5MDHA 2QUIA 2PL1A 2PMWB 3MFYA 4L8WB 3T06B 5IEBA 4CTOA 1U2ZA 3EBPA 3AUKA 4FEAA 2OO5C 3DGEC 3H8JA 3MJCA 1DRJA 3QU5A 5I9SA 2X0DA 4D99A 3ZVMA 3EUAA 3W2HA 3DMTC 3L1VA 5FOTA 3UT5A 2GD1O 4AKHA 4OI1A 3TRHA 2C7RA 1GCOA 5LNK1 3WGIA 3ANSA 3CLSC 3FM9A 2QRZA 3GJ3A 2IE8A 4YONB 3IR7A 5EQJB 3OSZA 3AI3A 3TR0A 3A4YA 4MULA 4E2ZA 2NUAA 3MWDA 2Q7DA 2C5EA 4QGFA 2E37A 3FNHA 3LBYA 3NHFA 4ZANA 1N7IA 1N2CA 3ZEAA 1VJRA 2AN4A 2AXNA 2G5CA 2HQRA 3L2OB 5IJXA 3SC6A 2DLNA 5BMOA 1MAUA 3CF6R 2OCXA 5FNVA 5AW8A 3EODA 2NP6A 1E69A 1JYEA 2IDJA 1EP9A 4PAMA 4EVQA 5CFLA 1BA2A 1C3OA 1QGAA 1V8ZA 2R9VA 4EG1A 1BSVA 4Q16A 5LP6C 3ICEA 1L4UA 4PPQA 1QYWA 1W34A 2ZUTA 2QQGA 1R0ZA 3RRBA 2ODPA 3G0IA 3F3MA 1H93A 3OU2A 2ASEA 4KCGA 5BVGA 4OX9Y 3BWXA 2APJA 4NZYA 4RS4A 2X15A 3FGZA 1LFAA 2OHOA 5DX8A 5JS1A 3DHNA 4IBOA 4J9UE 3UENA 4GRIA 4F56A 1DP4A 1G291 3RYFB 1DWOA 2FEWB 5B58T 2PD4A 3BL6A 3KOMA 1L3IA 2FZKA 1ZMTA 1C14A 1KZGB 3RK0A 3IUJA 2XWBF 3CY6A 3OEED 2UZ3A 5KNCA 4KX3A 5A7GA 2XKJE 4BV3A 1TVEA 5FLYA 4B75A 5M7EA 5JFGA 3SAJA 1TGVA 2IXGA 3WA6A 3OLQA 2J87A 1GLGA 3PF9A 2V98A 2I3BA 4P08A 3VI4B 2PZBA 4KIWA 1D5CA 1UOPA 1X87A 1J8DA 5JMPA 2N46A 1CR4A 3ZGXA 4QPDA 3SSOA 3UMCA 5BSEA 5IC4A 5I8ZA 1B41A 1ZCZA 3ABZA 3K1ZA 5T5QA 1JHZA 4KP7A 1SKBA 3IV7A 4XB2A 4BO0A 1HE3A 3H75A 3OKFA 4EJSC 3ZDRA 5EXDA 5K0JA 2GCOB 4DARA 2YBEA 2BHNA 4OXKA 4ZVPA 3CZMA 3CNNA 3LUBA 1DRWA 1WDKA 5AKZA 1HO3A 3R8FA 3ECAA 4RPGA 5DV9A 2NLOA 5F1YA 5AKJA 4IHQA 3A1WA 4LHYA 3PNKA 1NLZA 2EIXA 5EPEA 2YTZA 2NU8B 5A4AA 3ZGNA 4Q82A 1BTOA 4GIBA 5ALMA 5HZGA 5TLSA 5L3SB 2QLBA 2D13A 3UPDA 5GQSA 1WW3A 3OIGA 4IMJB 5KYYA 3UV3A 1E7MA 5KIAA 1VTKA 1GDDA 1HE1C 3WWPA 3E8XA 1OUMA 3MMSA 5ESXA 4GG1A 2JBWA 3DDSA 1XZHA 2ZPAA 1GV1A 2BBSA 2AGVA 3IMCA 3PG5A 1BWPA 2BC9A 2HQBA 4QUIA 3GVIA 1XFDA 1GCGA 1RRFA 2YJ5A 4H7JA 4BRWA 2UZ1A 3BHJA 4O4JB 4MYHA 4JUAA 3K96A 1DJLA 1XJ0A 4PWZA 4RMJA 3EVGA 3WL3A 4B1FA 4J6FA 3ELUA 3GJZA 1CY7A 2GEVA 4K2AA 4CCYB 1YD7A 4BQEA 3HJBA 1SVKA 1YDHA 2E5FA 2IU6A 3I45A 3RM3A 2IZ5A 3S99A 1ISSA 3GPDG 3KYJB 2OXCA 2QTHA 2ZTLA 3P94A 4K87A 3QMWA 1QSGA 1UJCA 4UMFA 4C76A 4UNRA 2ZQ5A 2AA3A 3KT3A 1HDEA 2YVUA 5CR9A 4L0QA 3RODA 1UBEA 1ZN8A 5HUJA 3TCNA 1FK8A 1R37A 3CB4A 1X15A 2JZCA 1JEYA 1UIRA 1M0WA 2VZLA 3R2JA 3TTWA 1JH9A 4TWRA 1ZY2A 4KQEA 5JD3A 4C05A 4Q7LA 4QJIA 1IWBB 2ZRPA 1PJ8A 3NHMA 5DM70 1I2ZA 1NUSA 2IUUA 3S3TA 3TCXB 2HHLA 1MUUA 3G5UA 2RHGB 3V2IA 2WLTA 3K4QA 1Y0BA 1HQDA 2ZSIA 3TGWA 1C9NA 4YUYA 1DC5A 2Y1LA 2RBKA 1NHGA 3A7DA 3NHAA 4RHXA 4AUKA 4GI5A 5K8UA 5CVJA 3TI7A 3ZNPA 4EY8A 2AJBA 3EVFA 3PDHA 4BP3A 1K66A 4DJ5X 1R18A 1JSRA 1EFTA 4KN9S 4RNCA 3X1WA 2QN2A 3LXMA 2H1RA 4YHBA 4LMPA 2H17A 4JL8A 4C2BA 3IIEA 3QRWA 3RI3A 3FFWA 2H4ZA 2C7QA 3VKHA 3D8SA 2H29A 3EMDA 4IOMA 4CIDA 4MROA 2E87A 4JY7A 5D00A 5FWDA 2WINI 3Q7PA 2BMVA 4HC4A 4M0LA 4QU9A 3RVNA 1ZKMA 3FTFA 3SMQA 4U1RA 4X1IB 2H1SA 3CRMA 4RXMA 3VQTA 2I8CA 3PUJA 2YVQA 4P34A 1J2JA 2GR9A 5HZKA 4KFUA 3KKQA 3EGIA 4EHIA 4MDFA 5G0WA 4J8PA 2BY4A 3FBGA 5GONB 4CE6A 1J56A 2F43A 3QE3A 1F2UA 1RJFA 3DDUA 5A6SB 4DC1A 4RL6A 3EA5A 3NBXX 4UVDA 5HRUA 4P5EA 5AH0A 2X0JA 3G3EA 1P7ZA 2FHPA 2GT1A 5F76A 4DLXA 2FSUA 3JWIA 1UPAA 1EXNA 1PEKE 1Q74A 4FFLA 4CW7A 4EHHA 3ROGA 5LPNA 1XO1A 2A1UA 1RRPA 2J3HA 3FPHA 2KE5A 3EIOA 3MD0A 2PMEA 5JU6A 1KI8A 3FR8A 4N82A 5TSDA 5TR9A 1DC3A 1CDDA 3RS4A 3W7BA 4U2CA 4IKEA 3H8VA 3F7NA 1WXIA 5EZQA 1A3CA 3WLHA 2GPSA 2V7UA 2VHQA 3QFCA 4D8XA 5AXBA 2QBYB 5BW6B 3ET5A 5CFMA 2XKAA 1DAHA 3KJXA 1J0CA 5LMUB 1SCQA 1DIGA 3QY0A 4PGAA 5CD9A 2OCGA 3GFRA 1CJVC 2ZRBA 2CEAA 3BJEA 1Z6ZA 2Q4DA 4C07A 5ADUS 2VQEB 4V0MA 2RH9B 2D1SA 4D96A 4MV3A 3F97A 2QT0A 3L6OO 4IGAA 3RYTC 1VG8A 3IHLA 5CG2A 1PD1A 4RZQA 2H31A 2JFWA 1ND5A 4NAUA 4RHTA 4ZOAA 1L7VC 5IW8A 3RSQA 4CEIB 2H2HA 5ESRA 5C31A 3GLFE 3NU1A 3IBTA 5DMXA 3IE0A 3WIEA 2QN7A 4EYGA 3NRCA 4DT1A 3BJMA 3KE9A 2J09A 1LY1A 2V8BA 4Y1RA 1YS4A 4HVCA 1K3FA 2ACWA 1UBMS 3FTQA 3QOXA 3OM9A 4QNMA 2PRSA 2PWAA 4X1YA 4FS3A 1PFWA 2JH8A 3V7FA 2E48A 2V7PA 2H2GA 2PT5A 3G8BA 4EYQA 4KITB 2YZMA 5FDFA 1WULS 2Q1TA 2BTQB 4DLKA 3GDFA 3MWKA 1LLCA 1NYRA 4KMOA 3TTSA 3UOGA 3WXBA