2ERYA

The crystal structure of the ras related protein rras2 (rras2) in the gdp bound state
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
171
structure length
167
Chain Sequence
b'SMQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein R-Ras2
publication title The crystal structure of the Ras related protein RRas2 (RRAS2) in the GDP bound state
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 60
structure length 167
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2eryA00
2D7CA 2R6GA 4LHZA 2V3CC 1G21E 1WA5A 2ZRIA 3R20A 3SJBA 3FKSA 3VR2A 1W46A 3PUZA 4GP6A 2F55A 3ZQ6A 1OH6A 3E1SA 3SYLA 2ZR0A 1XD2A 4PC6A 4O25A 3NXSA 3HP1A 2PZGA 3VKWA 1KY3A 2QAJA 2DYKA 3E2IA 3AVWA 3W90A 2F3RA 4U7DA 1XXHE 3X2SA 4KFSA 4LOAA 2I3BA 2WSMA 2X77A 4QBFA 4CDGA 5CITA 5H8WA 2QGNA 3GJ4A 3SI7A 4A4DA 3A4LA 4C3ZA 3H1TA 4M8NE 4JKYA 2CE7A 2Q3HA 4LDJA 4WZBE 2WKRA 5AWFC 4A9AA 1W48A 4AG6A 4L9WA 3TW4A 5BN3A 2DFLA 1E2JA 2GXQA 4LHYA 2QZ4A 3A8TA 4YMTA 3EZ9A 3HJNA 1KSHA 2A5YB 1L2TA 2ERXA 1ZNXA 2MSEB 3U7HB 1A5TA 1Z0JA 4Q4AB 5JJKA 1G8PA 4YMWA 5C2JB 1YHNA 3I5XA 2GKSA 1XX6A 4M0LA 3K9HA 2ATXA 2MMCA 1AGPA 1TPZA 4GRAA 3RHFA 5CB6A 4M53A 1OHHD 1OSNA 721PA 3VMFA 1E9CA 2ZU0C 3TQCA 2EFDB 4BGDA 5EP3A 3PG5A 4PQRA 1QHHB 1KI1A 1RW4A 4DDWA 4NH0A 1UKZA 2WMNB 3W8NA 2ANBA 3QPWA 4IFBA 2F43B 1NN0A 621PA 4YDHB 2PCLA 2JDID 3TIFA 2FPLA 2KWIA 5IT5A 1D8TA 3U4QB 2J0QA 4DEXA 3I5YA 2DPXA 1EFTA 1GUAA 2Z6VA 2CLDX 5CK4A 1K8RA 4AI6A 5HKKA 4TMKA 5JSZB 4LPKA 1NBME 2HV8A 3E70C 2VL7A 3FKQA 4NPHA 5J5CA 1HURA 6Q21A 1L4YA 1ZD9A 4RKEA 3GLHA 1UEJA 3KXLA 2PZFA 5H1YA 1NMXA 3VR3A 3SJZA 3KQHA 2FPKA 2FZ4A 2WSSA 4DSNA 4D25A 2GEDA 1MV5A 2L0XA 1SZPA 4IW3B 4JLAA 3UK6A 3ZH9B 2FMXA 4C9BA 4HLCA 4A8JB 1MT0A 2NGRA 1JEDA 4XWAA 1II8B 4JL6A 2Z4RA 4MGKR 1KYIA 1BIFA 1VDZA 1GP2A 4CW7A 5FFMA 3KQUA 3AV0B 4LHXA 3T34A 5L3SA 4GDFA 1U8ZA 4XJXA 1UBEA 3EIEA 4JJKA 4IDQA 1F2TB 2ZQ5A 3MFYA 2WWFA 3CH5A 1D9XA 3U6BA 1X8KA 3SQWA 1CJKC 2R2AA 2VP9A 3T1TA 5KDLA 4Q9LA 2A5JA 1FZQA 5DE3A 1A1VA 3CR7A 1IN8A 1H8HD 3BIFA 3PJRA 1S4QA 2R9VA 2V4ZA 2GEVA 3AH8A 5A5GA 3RLFA 4ESHA 4DZZA 2WJVA 4BZQA 2HDNB 1Q3TA 3DZ8A 2IYZA 2QPOA 2OCBA 5CYPA 4MYUA 1XB2A 2OFOA 2P3SA 2ZI5A 3QIAA 1P3JA 2RKOA 2CK3A 1J99A 3HYTA 3H0KA 3T5GA 2ZJBA 3FMPB 3L0OA 2IXGA 3A1VA 1ZM3A 1RFLA 4MGZR 1M7HA 2AN9A 4PSKA 5FTLA 2PX0A 3CZPA 2J59A 3N5CA 2ONJA 3VR4A 5E4FA 2G1JA 4LV5B 1P9NA 2YWGA 4A6XA 2WWYA 3VR5A 3TR5A 4Q7LA 2CDNA 3CRMA 3FFAA 1P2VA 4WXPA 3K70B 1FUKA 3FFBA 3KUCA 1Z3IX 4NP6A 1NKTA 2EVWX 4A0FA 2RB4A 4IOLA 4AYWA 3D7MA 2RGGA 4LJ4A 1KO8A 4RD3A 3GFTA 1ZIOA 4M4SA 3ZVRA 1VCNA 3RRNA 3NC1C 3T06B 3U4QA 3GJ3A 3T1OA 1PLLA 1OFUX 1GNPA 3M6AA 2OAP1 3WHKA 2DBYA 2PLRA 3FWYA 1NRJB 3NBXX 5CM8B 4PR0A 3BB4A 4NE2A 5FL7D 3TVDA 3ADCA 1W36B 5BWMA 1X3SA 2CBZA 4YMVA 1J8YF 5JWRA 1BMFA 4U5XA 1NI3A 4CVNA 1R5BA 2UKDA 3O8DA 4NHOA 4Q4HB 1XZQA 3U44A 1TUIA 1UJ2A 2J7PA 3GLHE 4RD6A 4PHHA 2D3WA 5EXSA 2QT1A 2A5GA 4I1OA 5DH9A 1GM5A 4DVGA 3E5HA 1S3GA 3KFVA 1ZM4A 2XEXA 3C41J 1NIPA 1ODFA 1TQ6A 3DOEA 1G7CA 4O2LA 5FPSA 4YXWA 4C0KA 2YZ2A 2V54A 1XPOA 4UJ3A 4QNMA 2ZYUX 3PITA 2P5SA 1HA3A 2FSGA 4CEIB 4NTZA 3SS8A 3IBYA 1I4TD 4ACAA 3R9XA 2HJVA 3K53A 2N46A 4KCGA 2QTHA 1FL9A 4B32A 3BB1A 4L8GA 2H8KA 4US1R 4CGZA 2XB4A 1R7RA 3EIQA 1KZGB 2AX4A 2V55B 3DHWC 4N0EA 4TTRA 1VYTA 4LBZA 4NYMR 5BW8A 2FFHA 2CXXA 1SKYB 1G7SA 1T0JB 1OLOA 4L9SA 4P33A 2EFHB 4DUGA 3ONWA 4LPSA 3UXMA 3QNUA 1F2UB 2WBLC 3U60B 2ZJ2A 4MITA 1ZUHA 3VKHA 2H1LA 4RD0A 1IOZA 4IOKA 4A1FA 3IGFA 2G3YA 2WWGA 1P7CA 2JJ8A 3F0TA 1Y63A 2IT1A 1NG1A 521PA 1R8QA 1P2SA 4TLBA 4RD2A 3NEYA 2QAGA 3I92A 3B9QA 4RFSB 3WBKA 1Q44A 2ZYVX 4ZDIA 5KDDA 3BJIC 3G82C 3OFNA 4PSAA 2GZAA 4D4KA 3CLVA 2EWVA 5IF9A 1VCIA 4C7OB 4PXAA 2HCJB 3BH7A 3N2EA 4Q1EA 4N3NA 3WNBA 3K70D 2O8BA 5EE9A 1G6OA 1P2UA 2QP4A 4ERNA 2XX3A 1MO6A 3MG9A 1Z6YA 3EW9A 2P6RA 2CHQA 4Q7MB 4W5HA 4TYQA 1EESA 2VHCA 1W4RA 3GEEA 2Z4SA 4FMCF 4L5BA 3GJXC 4C0SA 5JHHB 4PPFA 3GLFB 1SXJA 3RS4A 2NIPA 1U99A 3O8RA 1AQYA 2ZSEA 5DHAA 5EE3A 4OJQA 3DO6A 2ZSBA 1E0AA 3A58B 2PBRA 5K8IA 1B23P 2BMEA 2OESA 3ZVMA 4BLRA 5HZKA 5KU1A 1OV4A 2CLSA 1E2DA 1ZM2A 2N1BA 1W36D 3QXSA 1U8AA 2ZRDA 2QM7A 2WZQA 3BAFA 3CZQA 3ASYA 5SZKB 3GLIB 1CR0A 4Q7JB 2ZETA 1ZBDA 2CHVA 3KKOA 2J7KA 3RABA 821PA 2DR3A 1ZIPA 3P27A 4FMDF 4KSCA 2R6DA 2K5UA 3KX2A 2AFIE 1OKKD 4D4MA 3GLGA 1BYUA 4LJ5A 4OI4A 3OESA 4PC7A 3LX8A 4BZPA 2RHDA 2D74A 2ZEJA 3VAAA 4G0NA 4CEIA 2WJYA 2NTYC 3BXZA 1AKEA 1KO4A 4P4SA 5JZVA 3R9WA 1NN1A 1Z2CA 1FP7A 4I81A 4DRZA 2QEQA 3THWB 4OL0A 2JLQA 4BWYA 4URZR 4URYR 5JMTA 3VX3A 4F38A 2O8DA 1JQLB 3C5HA 1T4GA 4E5UA 4IEIA 3OEHD 3W8RA 1CRPA 1G20E 2NO6A 4R9UC 4KAXA 1NNEA 2IF2A 1OJLA 2HXYA 2V1XA 4G3XA 4Q48A 2KBEA 2WKQA 2W6JA 4URXR 4QKQA 4F4IA 2OE2A 4B3DA 3LWNA 3KQKA 3SHWA 4ZDWA 1EX6A 4LJ9A 3RS7A 2MMGA 4A0RA 3PUXA 2JCSA 1U0LA 4UXJA 5FI1B 4DCVA 4ASUD 5FBVB 1LS1A 5JEEA 2Q9BA 1G16A 2ZUBA 1NJFA 3ZZTA 1I2DA 3H4MA 4M9ZA 5JBQA 4HZIA 2YYZA 1E2NA 2VP2A 1ZNZA 2UZ3A 2JASA 4UNSA 4B34A 1DG3A 4HYYA 4IVRA 2BKUA 2ZE7A 2RGAA 4LYAA 3B60A 3NVAA 3PENA 3SDZA 2QRNA 4NCJA 3U3RA 4Q9HA 1M34E 1WRBA 2PH1A 3TE6A 4O2RA 4ZI2A 3W9YA 2JLSA 5AUPB 5H70A 2C78A 2YWFA 4BPBA 2J9RA 2QA5A 2ZAMA 3W5JA 1ZMXA 2ATVA 3B1YA 3MWYW 3RS0A 1P75A 2QENA 4HZUA 2XOKA 4PHGA 1QG2A 3QF4A 1CR4A 2BBWA 1IXSB 3IPYA 4MGIR 1DAIA 1EWRA 1GIAA 1SXJE 1H8EA 1R0WA 3GEIA 3QKRA 3QEJA 4X8OA 4D80A 1D9ZA 5KNDA 2ZI6A 5GJVC 5JS7A 4B2LA 2G0TA 1IN6A 2Q9CA 3AF3A 3ZS8A 4UJ5A 1CBUA 2H18A 5LBIA 1JR6A 2ONKA 5DHFA 1HQYE 1J8MF 4JJZA 4TLAA 1P61B 4Q9IA 1HE8B 4IVQA 5AR1A 2PMDA 1E2PA 2EFGA 2IWHA 2CL0X 2AHOA 1IN5A 1KIMA 1T0HB 4A82A 4HLUC 2R8RA 2X19A 5P21A 2XITA 1G3QA 4ZIRA 1VYVA 4W7SA 3AVPA 4ZI3A 5KSZA 1IHUA 3O8CA 3ADBA 1OB5A 1NVUQ 2E1RA 2IYQA 4MRSA 5DYGA 3A4MA 2VP5A 2VSOA 3GLGE 3SU8A 3VTKA 4TQUS 2VYFA 2RGBA 4F7WA 5JWOA 4LBVA 1Z47A 5E3HA 1VHLA 1FX0B 4A92A 3ND8A 2OEPA 4IDOA 3WYAA 2XTZA 3DKPA 3BBPA 4BFUA 1TL7C 5J4KA 1IXRC 3RVBA 1PJRA 5FTKA 2EFEB 1OXSC 3I32A 4BEBA 2B8WA 1Z6TA 4KHZA 4RVCA 5D3MB 2V7QA 5HZHA 2CL6X 1EFRA 3PUVA 4OK6A 3KKQA 4B76A 1N5LA 3EAQA 1US8B 2J0UA 2GA8A 3H86A 3TKLA 3TUIC 4URUR 3X1YA 1SVMA 1EG7A 3K8YA 4XVQA 2QUZA 2KB0A 1XCPA 3OZXA 1A82A 4XVRA 2RH5A 1MR3F 2G0NA 3V9PA 3LXRA 2XSZD 1TADA 4RD1A 1II9A 4KO8A 3TVTA 4B48A 2OILA 4HI0E 2KSQA 2W58A 1E98A 1DAHA 1OFIA 5KNBA 1EK0A 3DL0A 4BFWA 1E0SA 4JLNA 1N6RA 2ERYA 4URVR 5TVKA 2JLWA 1Z28A 2JJ1A 1XNJA 2VRWA 4PZYA 4BFYA 4DLYA 3BE4A 4R2HA 4TQ9A 4KLZA 5BQ5A 1W0KA 1XF9A 4QHYA 3NDBB 1WF3A 4KU4A 4HAYA 1N5JA 1N6KA 2JA1A 4JLMA 5DI3B 2CEAA 4JVMA 1E1RA 2RCNA 1QBKC 2GZHA 2QPTA 4EPXA 2BCJQ 5D3QA 1CJMA 3LY5A 2GBLA 1IJEA 3B1ZA 1MO3A 2C98A 2C9OA 2GHIA 3RRMA 1UADA 3RS3A 4QJ3A 1GWNA 1VECA 1YU9A 1WDTA 1ZW6A 3QKTA 4M21A 1W2GA 5EXPA 2ZRNA 1JQJC 5FBLB 2W00A 4FW9A 3GJ7A 1GL7A 1RC8A 1XMVA 5FBWB 1RYFA 3CNOA 4US2R 3VHXA 3ZD7A 4BFSA 2B92A 1OYYA 2EQBA 2FN4A 3D8BA 1TF2A 3SJAA 4TTPA 2C99A 2A5FA 4ARZB 1D2NA 1WMSA 3MRSA 5AUOB 3ZIAA 1CKEA 3IO3A 3PEYA 1JPNA 1E2GA 1S1CA 3QQ5A 1DE0A 3WMGA 1M8PA 3LDAA 2XNDA 2WWXA 1X86B 1ZM9A 1KK1A 3QEOA 1JNYA 1W1WA 2RGDA 2YWEA 4JL5A 4LBWA 3S1AB 1ONBA 2JLXA 2ZI7A 1LF0A 4JLPA 5J47A 4PAOA 1SHKA 3ZVLA 2FNAA 4IDPA 5TARA 1E99A 3IKJA 4S2EA 1PZNA 4AWXA 4TTQA 4AURA 3K9GA 2ZS8A 2YV5A 3WY9A 2H7VA 3HR8A 2FPMA 3CIOA 4UXHA 3NHBA 5KDOA 1TU3A 3SFZA 3R7WA 1CR2A 4OQMA 4W5JA 5ANRB 4OKSA 2NPIA 1TQDA 3EC2A 1KTVA 2NO9A 4BFZA 1N6NA 2G9NA 1F60A 4LHWA 4LYHA 4OBEA 2ZS9A 4C0BA 5AJVB 4YMSA 1KI6B 3W6NA 2VTKA 1U9IC 1Q1QA 1U0JA 5FPYA 1ZNWA 1R4AA 4MKGA 4Z1MD 3LNCA 2ZRFA 5JCPA 3KTAA 1FPMA 3HPRA 2ZR9A 1Z0IA 2QQ0A 2QG6A 1G4AE 4QRHA 4B71A 1EFHA 3U5ZB 2DCUA 3AUXA 4Q4JB 3NEJA 3LRPA 2FEOA 4X8LA 4B74A 2TMKA 2AKYA 2EWWA 1G1MA 4G5QA 2P65A 4KFRA 4DLZA 4DCUA 5B57C 4HDQB 2P6NA 5AUQA 3W3AA 4M1SA 4A0GA 1W5SA 2JEOA 3OF5A 3W6OA 4G5SA 4RY2A 3U7GA 4PPNA 3EARA 1TAGA 3G0HA 2GCOB 3LVQE 2BV3A 3DKVA 3QE0A 4IDHA 5SZHB 5JHGB 1LV7A 4V0MA 3KDSE 4NDZA 4TMXA 4Q18A 4XIGS 3MLEA 2AFHE 4JLKA 1KSJA 4PQYA 3OIVA 2ZRHA 1XEXB 3Q5DA 4JBXA 3VR1A 3Q9LA 2B8TA 3UMSA 5L3QB 2NPFA 4QM6A 1DVRA 2O0HA 3NH6A 1XPUA 2O8FA 4PX9A 2N42A 1XPRA 2YKGA 1E0KA 3THYA 1EGAA 1W47A 4DBLC 2NZ8A 4NONA 3QUSA 3SN6A 3WP0A 4Q01A 4LJ8A 4QGAA 3L2OB 2GAAA 2IYLD 1NSTA 4TZ6A 2ZI3A 5KNCA 2WWIA 1ZD8A 2ZIAA 4CEJA 1YZGA 2OT3B 2BWJA 1OHHA 1BS1A 4LK2A 4F4CA 1I4DD 2YOGA 5FOSA 4ZV4A 2O52A 1T91A 1M7BA 1V5WA 4D26A 2IHBA 4JLBA 1NY5A 2HF8A 3P26A 1COWD 1N6LA 2A2ZA 2R62A 4BECA 3RRYA 4DT1B 4AKIA 2X1VA 3L43A 1JEEA 1LW7A 2QM8A 3GEHA 3CF6R 1J2JA 4DLWA 2W2VA 3UG6A 1YR9A 4O0MA 4XOIA 4GSYA 2JDIA 1K5GA 4V0LA 3WP1B 4CT4B 5HPYB 3NTUA 2FWRA 3ZGXA 1AZSC 1ZINA 1YRBA 3OHMA 1ZM7A 4HB0A 4DHEA 1KMHA 5CJPA 4LX0A 3IHLA 1SKQA 1S1MA 2VP4A 4R71A 3AVTA 5E7IA 1K5DA 4WOPA 2AWOA 1ZRHA 4LY6A 2VEDA 3HWSA 5FTNA 3ZVNA 4ACBA 3BK7A 4PFSA 2WMOB 1OFHA 1WXQA 4HUQA 3TNFA 4O3MA 3IQXA 2QT0A 3I8XA 4LJYA 1VG1A 4HAWA 1NY6A 4MGYR 5FI0B 5FTMA 4D4JA 4DXAA 2REXB 2VIIA 5KOYA 1W5TA 2QMUA 4OJKA 2OZEA 4XH9B 3U7FB 1HT1E 1N3BA 2WICA 2W6ID 2O8CB 2OFWA 5G41A 3X1XA 3QENA 2CCKA 1YR6A 3CPEA 4ZPXA 3P20A 4BLOA 4NYIQ 4BLTA 1G7TA 5EP2A 2RMKA 1OIVA 2OHFA 4E09A 3CNLA 2OM2A 4LC0A 2GCPA 2FGKA 1X1RA 2WAYA 1KJZA 1GTVA 4CZ2A 3W3ZB 4G5OA 1YZNA 1GVNB 4C0AC 1XTQA 5G40A 1TUEA 4W5WA 1G5PA 1GL9B 4ESVA 3CX8A 2F9LA 1H8HA 1OIXA 2YVUA 4Z8YA 2ECKA 3Q8XB 5JLJA 4A2QA 3CPJB 2F3TA 4AKGA 1PUIA 3LW7A 3SFVA 1DOAA 1Z22A 4CT5A 1DTSA 2FX3A 4DKXA 5G3YA 1E32A 4AKEA 3NKVA 1RVDA 4ZO4A 2H57A 4TYPA 4DDTA 3BGWA 1NVXQ 3IIJA 4FMCB 2C9YA 2VSFA 1E2MA 2CJWB 1YZLA 1ZNYA 2JATA 4BEJA 2YOFA 4Q4AA 2WPDD 4LGMA 4V0ME 4OHYA 4JLVA 2ASEA 2VLIA 3BORA 1DAFA 1N0WA 2ZTSA 2IUSA 3Q7QA 3I8SA 2JLZA 3VQTA 1YE8A 1UKEA 3ASZA 2CE2X 2EYQA 3P4YA 3MGCA 1MKYA 2ZRCA 5IK2D 2HJGA 4ITRC 3K09A 1G291 1UBFA 4L15A 2WIAA 4KFUA 1QHHA 1Z6GA 1YZUA 5EQTA 1A4RA 4KBGA 3M0EA 3RWMB 3CBQA 4BASA 3FHTA 4D0LB 2F43A 2RGNA 4FMDB 5JECA 1DEKA 1XDBA 5G3ZA 3GCGA 3U61B 1JR3D 2J41A 4YDSA 1VMAA 2BBSA 3A1UA 1FQJA 4LYFA 2UZIR 3B1XA 1CEEA 5JSZA 5BYJA 5LPNA 4BQSA 5HCNA 5KPDA 1JPJA 4LJ7A 4A6PA 4JYCA 3BC1A 4QHSA 3BWDD 5FL7A 4B3GA 5EJEA 3O8BA 1CR1A 5F2EA 4B33A 3NBFA 4AYXA 1U2RA 5LB2A 3BD9A 3CF2A 2FFQA 3BB3A 4MUBA 5CJ2A 1OIWA 5DIFA 5SZIA 1ELOA 2ZE6A 1W7AA 1Z0DA 2C9CA 1GOTA 5GVRA 4OHZA 4A8JA 1GRQA 2BCGY 4KVAA 3L82B 4NKRA 1II8A 1C9KA 1FP6A 2BMJA 3KZ1E 1YVDA 3VU9B 5J4HA 2IS4A 1Q12A 1DAKA 4LHVA 5EE1A 4B6FA 2ZJAA 3CR8A 3T35A 3V4FA 3CF0A 1M6NA 3TBKA 2IF0A 3T12A 2QORA 3B1VA 4TL6A 1F2TA 1U0HC 2GRJA 4UQOA 5FUVA 1KHTA 2PT5A 3OE7D 1FNNA 2HLDD 4WIAA 2AKAB 5KPJA 4TLCA 5G53C 3IIKA 1E2HA 1HUQA 3QKUA 2FZLA 4F93B 3IPXA 3SR0A 1DAGA 1TQ4A 2O8EB 1KK2A 3LAWA 2XJ9A 4Q1BA 3AM1A 1G8GA 2D06A 2JJ2D 4ZCMA 2GTPA 2GNOA 5FL3A 2LKDA 5HE8A 2O5VA 3FGNA 3ZYCA 3LVRE 4C0LA 1RRCA 1VIYA 1XBTA 2ZYTX 3AVQA 3LLMA 4NMMA 5FTJA 3RS2A 2CNWD 3GD7A 3SE0A 1NG9A 3AP3A 3TGPA 1T3HA 1LVGA 2OBMA 2BEKA 2ZE8A 2ODWA 1AS3A 1BKDR 1MRSA 1M7GA 1KNQA 1IY1A 1UKYA 1N6IA 2J46A 2J5XA 3GJ5A 4ON9A 2ZRJA 4PAMA 1E9FA 1KO1A 1WBBA 1DELA 1AZTA 4DWJA 4HATA 5GJWC 4Q4LA 2GILA 1NN5A 4TN1A 3OAAD 4A36A 1XJCA 2CMKA 2RAPA 3RDPA 3RAPR 1AK2A 2QMOA 3KJGA 5CLLA 3QKSB 1PVOA 3EWSA 5FR2A 2OAQ1 3QXCA 4RZUA 3UANA 4JIMA 4A15A 5H68A 1P62B 4A2WA 2DWQA 4ZDKA 1XTRA 4II7A 1Z0KA 3IIMA 1KK3A 3D3QA 3KQNA 4HDCA 1ZP6A 3Q72A 3K0CA 4GMDA 3K0AB 3U2QA 4AK9A 1GDDA 3LH5A 4PC2A 1R5OA 4KV9A 1NSFA 3JVVA 5TDHA 4JT2A 4MKFA 4TL9A 2QBYB 3AVVA 2EFCB 1S9DA 1SVLA 1WBDA 5CYOA 1G4UR 1T5IA 2D2EA 4FIDA 3T1QA 4EJSB 4PSVA 3EXAA 1W0JD 1MABB 1K6MA 4A0HA 4IDNA 1Z63A 1DO0A 3CONA 3PIRA 5CLQA 5KO2A 3NDPA 4Q4HA 2ORIA 3B5JA 1XD9A 2Z83A 1FTNA 2ANCA 5BXQC 4TQAA 5B64A 4JKIA 1GKIA 2HT6A 1VHTA 2DY1A 4M1KA 2WOOA 2G6BA 1KK0A 2AXPA 5DGXA 2IYSA 3GQBA 5EE0A 2X2EA 3QVUA 1Q57A 4KYIB 1AM4D 1OKKA 1GNQA 4AD8A 4Q47A 5DLQC 2YC2C 3OEED 3EZ6A 5E95A 1CU1A 1MH1A 3BERA 3K09C 2O0JA 3KKMA 4QFMA 2VSXA 4GNKA 1OH8A 3PEWA 1JAHA 4QBGB 3SZRA 2C8VA 2WJJA 1FMLA 3B1WA 3WMEA 1E96A 2IYWA 2A30A 2WOJA 3OEHA 4LC1A 5C4GB 4EFMA 4C2UA 4NZYA 4NU0A 4QNRA 3EZ2A 3QXJA 3B78A 5CIQA 3EG5A 2GZDA 5DYIA 3T5DA 5J4LA 1H65A 2I1VB 4PHFA 1MRNA 1TEXA 1Z6AA 3MWLA 4JBWA 2ZXUA 5GJBA 2HYDA 1F2UA 2ZYWX 4G5RA 2BJVA 1UFQA 4C4PA 3H2YA 2CCGA 4MA4A 4OI1A 5EE5B 2VBCA 1GKYA 2H16A 1OB2A 4ASUA 4I99A 1G8FA 2OLKA 3HU3A 1QVAA 3PR1A 3TR0A 3A1WA 1IM2A 3OIUA 4JVLA 1E94E 4IFEA 4JVNA 4DSTA 4MYCA 1QRAA 3WNDA 4RFSA 2XZOA 3NBYC 4GT1A 2XB2A 4OI0A 5TY0A 4C7OA 4CEHB 1AA9A 1S8FA 1KDTA 2GJSA 1PUJA 2QROA 3KL4A 4A8JC 4R98A 2XZLA 2ZSDA 1ETUA 4AC9A 4QM7A 2I4IA 1E6CA 1TX4B 5FOUA 4PTLA 1UF9A 1GRRA 1VG8A 1XTIA 3FVQA 1UDXA 2WJHA 4EPTA 3RNLA 1RRPA 1ZC3A 2GXUA 4B43A 5GVSA 4M1YA 2V8OA 2IUTA 1QHXA 3GLFA 2ZI9A 3B9PA 1GSIA 3I73A 3MAAC 4PO8A 1FNMA 1G3IA 1A2KC 1JB1A 1OF1A 3JZMA 1XTJA 2ZU6A 4I1SA 1FFHA 5HR5A 2DHRA 5JI3E 3AP1A 1AS0A 2AD1A 3EIHA 4L4UA 4MRVA 1UEIA 2FV8A 5LD2C 2CVFA 1AS2A 4KXFB 4EJSA 5SZJA 3DMDA 3WXMA 1XXHB 2W0SA 5A4JA 3GLIA 3VFDA 3D6TB 1G3RA 4TT3D 1Q1ZA 4UNRA 3RSOA 4QL3A 4MRPA 1P9RA 1KJWA 1ZYUA 3IEVA 4XTRA 1CLUA 1L4UA 1CJTC 1DBSA 3QOFA 4RZ2A 4JVSB 4FN5A 3KJHA 1V43A 2QQEA 3LBHA 1HEIA 1KI4A 1VIAA 2E9SA 3RYTC 3LQQA 3ZDQA 1CS4C 1T3LA 3KKNA 3B7GA 2QAGC 1QHIA 4MKHA 1M1YE 1XJQA 5JI2E 5DNYB 1DADA 3O47A 5FH9A 1E2LA 4B6EA 1XRJA 3C8UA 4KITB 3CRRA 2PX3A 3AVYA 1E69A 4QBHA 1E1QD 1Z0AA 4PC3A 3THWA 1XTKA 3C4JA 3JVUA 1NLZA 2O0KA 4G1UC 5L3RA 1NL3A 4NYJQ 1S2MA 3NBZC 5AJZA 2WV9A 4G5GA 3TUJC 4NYIR 2VQSA 2ZAOA 5J40A 3TUZC 1HT2E 4GP7A 2GJAA 1SXJC 4EQ6B 4XSHA 4QGHA 3LQRA 5J4VA 1SVKA 2ZVPX 1R10A 1LY1A 2FJUA 2KI5A 2WWHA 4PAQA 4TMTA 5DN6D 2XXAB 2IYRA 1Q3HA 4XVUA 1W44A 4LJAA 2A9KA 1T6NA 2AD5A 4I1VA 4KYUA 5L3VA 1SKYE 4YC7A 1NKSA 2B21A 1JJVA 2HUPA 3DOFA 3FB4A 4PHTA 2ZJZA 1QG4A 3LD9A 3DDCA 1UAAA 5IDVA 1CJUC 3ZS9A 2JIZD 2ZRBA 2R44A 1OYWA 4B35A 2OBNA 3DEFA 2QGZA 4XD7D 3T61A 4K81B 1G5RA 2XSZA 1RJ9B 3V00A 5AJYA 1S96A 1Z07A 1KI2A 2QTFA 4YONB 1FUUA 3DM9B 3K0FB 4BRUA 1X1SA 4QGFA 3THXB 2OG2A 1P60A 3UATA 1G8YA 4B3CA 2NO1A 1IONA 2WM9B 2ZS7A 5EUMA 1NF3A 2ORVA 3TK1A 3W34A 2QTVB 2BOVA 4EPVA 1M74A 4V03A 2FSIA 3NWJA 3OIWA 2DWPA 1O3YA 2NOAA 1E2QA 2VF8A 2PL3A 3U7EB 1IBRA 4WAUA 4M1MA 3BFKA 4JL8A 1NLYA 4WA7A 2MSCB 2PT7A 4XTCS 2FA9A 2GF9A 4URWR 3I62A 3IQWA 2XZPA 3QG5A 1Q0UA 4GZLA 3GLFE 2C77A 4WZ6A 1N6OA 3GFPA 2ZR7A 1AJEA 1E2KA 5B58C 4B47A 2X2FA 2E87A 3QI2A 3TAHA 4F91B 1TQ2A 4IJMA 1N6HA 1NMYA 3LFUA 1XD2B 1JI0A 1TNDA 3F3YA 3PV0A 4D0GA 3QPUA 1X8JA 2ZPTX 2JLUA 1KSFX 4K46A 3G5UA 3CWQA 3B82A 1ZUNB 2NO0A 1XEWY 3QPVA 3GLIE 3L8YA 5FOXA 4RFVA 4IEEA 1KO7A 2GDJA 3BRWD 2B7BA 2OXCA 3I72A 3UPUA 2D4HA 2P67A 3GJ0A 5LDDC 1SULA 3KFXA 3GJ6A 1NN3A 4BLSA 1DS6A 3J81k 4KI0A 4M1TA 1T5LA 4L16A 3BFXA 4H1VA 2D62A 1S9HA 2OSBA 5CM9C 4TYWA 2GAOA 4LRWA 4MDFA 1TU4A 3AF2A 2QRZA 4D82A 5BYKA 4PO9A 3REGA 2IYTA 1JXMA 1FX0A 4GOXA 4EIWA 4RD4A 4IXMA 4ZCLA 1ZUIA 2HCBA 1XCGB 1SVWA 1U98A 2G88A 2AL7A 4HLQB 1XJ0A 3KB1A 2F1IA 1E2IA 3I1FA 4F4JA 5TB5A 1W4CA 2QN6A 1X8LA 3D31A 5D3MA 2OO7A 3UWOA 3PUYA 5AJWA 1ESMA 1Q20A 5EZ6B 3T1VA 3AB3A 2D7DA 5EP4A 3U3OA 1US8A 1UBGA 3VHLB 4D4LA 1R8SA 3HYRA 2VHJA 2ZROA 4P4UA 2QMEA 1RE0A 1D5CA 2BIFA 5GJCA 1E79D 4OHWA 1W4BA 1Y3AA 2CHGA 1PV4A 2NG1A 4TSFD 5FPKA 4C0HA 3UMFA 2IYYA 3K1JA 4RCZA 2ZJ8A 3RANA 4N1AA 2AXNA 3AVUA 1NBMD 5BN4A 4WXRA 4M9XA 2WHXA 5F3WB 4JT4A 3Q85A 1UDWA 1IQPA 2ZSFA 4B75A 4GOKA 4Z1MA 1YZKA 4DCTA 4I1UA 4B3FX 2IEYA 2BBTA 5FOTA 1E9BA 2QSYA 3GJ8A 4OQFA 3ZQJA 4E22A 3GLHB 2IC5A 3EPHA 5F9HA 1R2QA 3HU2A 5DI3A 1E4YA 3TSZA 5AUNB 5DSZA 3P4XA 2QE7D 3M1IA 4UNPA 1XD8A 4ILEA 1ZU4A 1VKJA 2CL7X 2Z5FA 1E4VA 2QSZA 1N6PA 3CUEF 3TW8B 1KAOA 3FKSD 5JFGA 1CJVC 2H17A 1U90A 2EU8A 1QHSA 4CRWB 4OHXA 5L3SB 1HYQA 2VHTA 4ABYA 1S3SA 1ZD1A 4KFTA 4Q03A 4DIEA 2JLRA 1N0VC 3A6PC 1GFIA 1P5ZB 3NC0C 4EFNA 3ETLA 4Q00A 4GL2A 1D2EA 4Q21A 1G41A 1RPZA 5AK0A 3EWAA 3WBJA 1A7JA 2FEMA 4UXIA 4TYNA 4OYHA 3PUWA 2NQ2C 1KDOA 4JLJA 1XMIA 4D2IA 1RIFA 3L0SA 5CK5A 3SEAA 1P4SA 4WVFA 1FOEB 2F6RA 3C5CA 1T3SA 1N2CE 2ZRAA 2OUKA 3U6KA 4ARZA 5J4YA 1G5TA 3HDTA 4TZ0A 4RJLA 2ZE5A 3RWOA 4W9MC 1EWQA 3AKCA 5EXTA 1E9SA 2IK8A 3U3MA 4R2IA 3PCRB 4TMVA 1BOFA 5DISB 5FR1A 4Q9KA 3ZLJA 1P2TA 2GJ8A 4AY2A 2VP0A 3JZAA 1COWA 1HY3A 1G18A 2P5TB 4HAZA 4OQNA 1ZCBA 3SBEA 1F5NA 2CCJA 3S1AA 4Q02A 4EPWA 1J70A 1XZPA 1Q1BA 1KOFA 3CWZA 3PFIA 4UNQA 3TH5A 2J0SA 1DO2A 1T8TA 4QXAA 3R8CA 1Z29A 3K9LA 4PC1A 5FBQB 4OK5A 2NO7A 3MUFA 2GBLC 1ANKA 4IKEA 1GRNA 5TXGA 4G01B 5KUTA 2A7QA 4FWTA 3PQCA 1WCV1 2ZRLA 1OXTA 5FOVA 2Q21A 3KUDA 2Q6TA 4H9GA 2ODEA 1OXXK 1G7RA 2BMDA 2Z43A 3TRFA 2REOA 3CKLA 4Q9JA 4DCSA 1G8HA 3SOPA 4JSTA 4Q66C 1WQ1R 1SVIA 3QXXA 2JLVA 3I4LA 3WRXC 1G6HA 1Z06A 1E9DA 1VG9B 2BHRA 1KI6A 1MO4A 5HKKD 3FYHA 1XMJA 2HXSA 2IA5A 4TL8A 4BLPA 4DDUA 1MOZA 4DLRA 2W6IA 4MQBA 4QHTA 3PXGA 3QSYA 1IXZA 3EA0A 1LS6A 3TMKA 4JLOA 4D81A 2GESA 1EXMA 2GF0A 2QU8A 4Q4JA 1OT3A 5KSPA 1KI7A 3LW8A 4FD2A 4C0JA 3FHOA 2WSSD 1SQ5A 3AQ4A 3CRVA 5LB4A 1HH4A 2BM0A 3I3SR 4LCBA 5FUWA 3MWJA 2Z0MA 2HEIA 3U44B 4S35A 1NVVQ 1AN0A 4FCVA 2JLYA 3AGPA 3AKYA 3B85A 1D2MA 2F1HA 2XTMA 1W4AA 2FSFA 1R5NA 4GZMA 4DJTA 3SHFA 2ZRKA 1F3OA 3IHWA 4NBSA 2GCOA 4IOJA 2R65A 2QI9C 1Z6XA 3KXKA 1I4LD 2RGEA 1Z08A 2VO1A 2PMKA 3CO5A 1LTQA 3EZ7A 3V4RA 4AIIA 3ICQB 3UWKA 4EKDA 2OCPA 1AKYA 4B3XA 1XEXA 4XWKA 4DLTA 3AF0A 5L3QA 2Q9AA 3EASA 2AK3A 1XU4A 4NCNA 1E0JA 2WPDA 2F1RA 3B2EA 5JRJA 5EXXA 1JBKA 2ZUCA 4YQFA 5LD2B 1CRQA 2PEZA 2NZJA 2W2XA 5CDFA 3P32A 2AWNA 3KB2A 2V1UA 1EFUA 2B6HA 2QMHA 3VKGA 5IK2A 2WAXA 1YZTA 2GVDC 1GL6A 4M9QA 2CK3D 2YHSA 2C03A 5E7MA 3NIBA 5K8UA 4HB4A 1ZJ6A 1YRAA 2LWIA 2CLCX 3CRW1 4JSYA 4MKIA 4OI2A 1T8UA 2GJ9A 2R6FA 2WIBA 4DT1A 3DM5A 3A1TA 4C0QC 3OIYA 1G3MA 3KJIA 4F92B 3T15A 3AVXA 3AF4A 2OLJA 2C2HA 2P6UA 3RC3A 2QAGB 4DDVA 1JR3A 2IWRA 4BLQA 4FWIB 1ZCAA 3L8ZA 4P3YA 3MMPA 4NYJR 3L0IB 1QZXA 2WKPA 3LXXA 2O8BB 4UKDA 2WWWA 4RKFA 5AJXA 2P0EA 1EFCA 3W5IA 4TYYA 4DLSA 2YJTD 4DLXA 1VG0B 5JEDA 2Q0HA 1WP9A 5TMPA 3VNVA 1ZU5A 3SQXA 2XAUA 1IJFA 3GPLA 5KSYA 1CF4A 1KGDA 1SXJB 4J0QA 1E2FA 1KSGA 2PCJA 2WJGA 3GFOA 3DMNA 5M04A 2W2TA 3TSWA 5FUXA 2FFBA 2YOHA 4KSBA 1Z8FA 2O8CA 1YJ5A 1A2BA 1RRGA 4NL4H 1OH5A 1RKBA 2XTNA 1KI9A 1BMFD 5K8TA 1U81A 4TMZA 4WW0A 1KMQA 4DSUA 2H5EA 2AR7A 4Z8XA 1KY2A 1N25A 1U94A 2IHYA 2YNMA 4FXPA 2WJIA 2J7PD 4ZDJA 3OE7A 3Q7PA 1J7KA 2W83A 2HLDA 3CX6A 4P4TA 5JCZA 1KO5A 2FDCA 1BH2A 1N5IA 1CTQA 4QGGA 2P2LA 2FF7A 5JRZA 5KSOA 1KAGA 3BOSA 4PO1A 2D2FA 4YXWD 3GLGB 3FOZA 3GMTA 3IEUA 1NMZA 3PEVA 1FQKA 2JJ2A 4XWOA 2HYIC 2Y8EA 5CB8A 2BBOA 1C4OA 3BH0A 1L7VC 4EFLA 4P4SB 4Q1AA 2VA8A 3L0PA 2PEYA 2CJWA 3CW2A 2CNWA 4FCWA 5F98A 3DVLA 4DIDA 2FFAA 4BRWA 3QVVA 1LB1B 1G19A 4ZCIA 5KTYA 2O8DB 1L8QA 3LLUA 3DZDA 3MCAA 1C1YA 4MRNA 4PPGA 4PQFA 4EDHA 3EPJA 1NVWQ 5BN5A 2IXEA 4GPTA 5KHOC 1GAJA 1XP8A 4RSGA 5DI9A 3SYNA 3NH9A 4DUGD 3MSXA 4B73A 1IY0A 3OAAA 1P9WA 2VP6A 5CDFE 2W0MA 2ZJ5A 2FE4A 3AGQA 4IRUB 5FBRB 4CF7A 1QDEA 4EUNA 4P32A 2QY9A 4H1UA 4JMPA 3B6EA 1F6BA 3WMFA 1OXUA 5HCIA 5JJIA 1N0UA 3TLXA 4HLUA 3NHAA 4CIDA 5C46F 2GK6A 4JS0A 5DO9A 3TAUA 2WTUA 2RGXA 2BC9A 3OFND 3LBIA 4KJZA 1R0YA 1CP2A 2V6JA 4DEYA 2J1LA 3MJRA 1OE0A 4MYHA 1JR3E 1BYIA 3M4YA 1IN7A 5IHPA 2JGNA 3UIEA 3AEZA 3CH4B 1VTKA 2IW3A 3FPAA 1W0JA 8OHMA 1SXJD 4DCNA 4V0NA 2WVJA 3MJHA 5E7JA 1R0XA 4HDOB 4HZUB 3EPLA 3QF4B 1E2EA 2ZJYA 2A3RA 2AK2A 1VCMA 3QKRB 1LFDB 4MRRA 4GFDA 3LX5A 3VU9A 4LZZA 3A4NA 4P31A 3THOA 1RZ3A 4BFTA 2QL6A 2IEZA 4EPRA 1E9RA 4IVPA 4Q1DA 2VH5R 2IUUA 1OXVA 2J3EA 2GETA 3OEEA 1AQUA 121PA 2FGJA 3UKDA 3EPKA 3SBDA 3LV8A 4FMBB 4V0OA 1YQTA 3QF7A 3KQLA 4E03A 3X1WA 2ZRPA 5FPTA 2IYUA 4DLVA 1S0UA 3AF1A 1RRFA 2RGNC 3ICEA 1HV8A 2IS2A 2KJQA 2LCFA 2O8EA 1P73A 3ADDA 2BM1A 3SJCA 4ZIRB 1G64A 3EZFA 4PZZA 3ND9A 4MDEA 1KKMA 1EX7A 3PEUA 2J45A 1N5KA 3WHLA 2DWOA 3IDQA 4GBMA 4X8HA 1XFAA 2C96A 2BMFA 4POAA 3I61A 2GEUA 1TTTA 4R7ZA 1KDPA 3CM0A 1U8YA 3KKPA 3IBGA 1GKUB 4PZLA 1YKSA 4KBFA 4M22A 3C16C 1Z0FA 1QHYA 2C5LA 3HU1A 4AG5A 1T9HA 3SNHA 1XTSA 4QBIA 4EPYA 4MYTA 4EAQA 2W6JD 3F5FA 1MO5A 1VPLA 2F1JA 3EC1A 1TF7A 3QKSA 2IS1A 2J0UB 1B0UA 4QC2A 2NMVA 2FSHA 3IILA 1M2OB 421PA 4IHQA 4Z54A 1XCMA 2IYVA 2OXRA 2QPAA 2OFXA 1P6XA 2MSDB 4TL7A 1Z5ZA 2OBLA 4PPQA 4U02A 2GXAA 3K0AA 1QVRA 3UG7A 3UMRA 2A5DA 4DB4A 4LWZA 2EYUA 2REBA 2BDTA 1OPXA 1NLFA 4LV8B 1GITA 4HB2A 4UNNA 2QBYA 1NP6A 2IX3A 3AKEA 4JLDA 1JJ7A 2GVZC 4B44A 3FDIA 2R6CA 2ZRMA 3FMOB 3C15C 1TF5A 4WBSA 2XNSA 4ZKEA 2ZI4A 3R9IA 5L8VA 2I1QA 2H92A 1MABA 2BVNA 2IL1A 1OFTA 2J87A 4OHVA 3CB4A 3A37A 1XEFA 1DARA 2XOKD 1KZ7B 1FMJA 3QG1A 2DFTA 4M2LA 4YMUA 1Q21A 4N0DA 4TT3A 3CRQA 1DG1G 1RYHA 5FPHA 1H8ED 1I2MA 4GMXA 3MWKA 2RGCA 5EUQB 2LKCA 1JECA 3AP2A 4XSGA 4DSOA 3QXHA 1Q1EA 2GWHA 1ZC4A 3CNNA 1FTSA 3FHCB 1ZAKA 2ZRGA 2Q3MA 4AYTA 1ESNA 2DFKB 4KODA 2QP3A 4RCYA 3U3JA 2GXSA 5CIWA 2ZM5A 2UVQA 5A0FA 1KNXA 2VF7A 4BUJA 2OV2A 1KI3A 1E1QA 3SC3A 3K70C 4B3BA 2IBMA 2ORWA 4Z51A 3U3KA 1U9IA 5UKDA 1SVOA 1VCOA 3K0SA 2IS6A 5FOWA 3F8TA 3HR7A 1Z2AA 5FUYA 3C14C 2OCYC 2QNRA 4TLEA 4RZ3A 3REFA 1UBCA 3K0CC 3WYGA 4TWZA 4FCTA 2A78A 4LBYA 5DN6A 2IXFA 3CX7A 4IXNA 3RRZA 2VPPA 1NVVR 221PA 1HTWA 3Q5EA 3R8FA 2HT1A 1G9XA 4HAUA 2J0VA 2ZANA 4HAXA 4CYMA 5HTKA 3IUYA 5C18A 2C95A 3FTQA 1W36C 2G77B 2XJ4A 3FMFA 4NCKA 1UKVY 3A1SA 2CVHA 3X1ZA 4Y0VA 4B2IA 2JIZA 2ZUDA 4M1OA 2VHQA 3DPUA 1VYUA 3FE2A 2ZITA 4XD7A 3ECCA 1NJGA 1CIPA 1R0ZA 1WE2A 2V7QD 4C30A 4LYJA 4HUTA 5KYKA 1EFRD 3RC8A 3TJZA 1QHNA 1F48A 1KKLA 3ZZ0A 5K8LA 4CEHA 1J90A 4D6PA 3QBTA 1CXZA 1E9EA 1KJYA 4HB3A 2GK7A 4HEJA 5F9FA 5ELXA 4U00A 2ODBA 1LNZA 4LV6A 3BS4A 3R7WB 1UPTA 3K9NA 2XGJA 4TMWA 3C7KA 5HE9A 3X1DA 3N70A 3BFVA 3IO5A 3GP8A 5JWHA 3LBNA 4DC9A 1QF9A 1Z83A 2BJWA 4JZKA 4HAVA 4Q7KA 1G17A 1DAMA 4D0NA 4V02A 4BZXA 2PZEA 4IOMA 4US0R 2JJ1D 4MUAA 4QJ4A 3ZD6A 3Q3JB 2PJZA 2KBFA 1E3MA 1ZVQA 4NCIA 1HE1C 3KTAB 4C2TA 1W0KD 1OW3B 2V9PA 4K8OA 1LF5A 4BE7B 3B8HA 1IY2A 3P1JA 2JAQA 4PANA 2DB3A 5C1BA 1XXHA 1GZSA 2HF9A 4NYMQ 1XEWX 1YZQA 4FINA 3LA6A 4OQLA 2BEJA 1E1RD 2Q3FA 1X6VA 3TSOA 3RS5A 3CPHA 2KE5A 5TV2A 4Q19A 1FW6A 2FU5C 4AKHA 1GG2A 1AGRA 4DB2A 2BKEA 3N2IA 1PLKA 5IRCD 2V6IA 2SHKA 1JAIA 1SHZA 1O87A 2F7SA 2ZVQX 4JYBA 1P72A 1IN4A 1KI8A 4HLDA 3WYFA 4DLUA 1XMSA 2G83A 4I4LA 1KDRA 1W49A 2DFNA 1NIJA 1YR7A 3QBVA 5GADl 1R6BX 3B13B 3KJEA 2YINC 4Q1CA 2C04A 1GNRA 4QOSA 3FMIA 3W6PA 2VHUA 1CULC 1JXOA 4LSGA 4QJ5A 3MD0A 5EP1A 5C4MA 3PVSA 2O8FB 2RHMA 1G3UA 1E9AA 3BH6A 1TMKA 2ZJOA 4M1WA 1II0A 4X8MA 3THYB 3WRYC 3ADKA 5JS8A 4OQXA 1Q22A 2FOLA 1BO6A 4BFVA 4EQ6A 1UM8A 3H84A 3K0EA 5B2ZA 3QY0A 4NCHA 3SYKA 5B30A 2XXAA 1GILA 3VNUA 1PLJA 4KLNA 4LJ6A 3A36A 4CEJB 3NG1A 2EW1A 3ZIAD 3QJYA 4GOJA 4BFXA 1SGWA 1W2HA 1D6JA 2XNDD 4LUCA 2R6AA 1QHGA 2IYXA 1E79A 1SVSA 2OCAA 4EJSC 3HPQA 1AIPA 2ODNA 3TQFA 4M9SA 3VX4A 3AVOA 1YR8A 4TSFA 2YWHA 3EA5A 3AKDA 1DAEA 4TLDA 1RJ9A 4WZAE 4Y0AA 3VR6A 4E07A 2YC4C 4KVGA 3K0FA 4A2PA 2FG5A 3THXA 1NBMA 3AUYA 1JALA 1XWIA 3ZZUA 2QP9X 1DPFA 2F9MA 3KXIA 2X8AA 2G1KA 4P0TA 4QG7A 1OH7A 4MH0R 1KMHB 2ZREA 4GI7A 2PLFA 4YLGA 3EX7C 3ZJYA 1IAQA 4RZXA 1WB9A 2GCNA 2B7CA 4Q1FA 4JBYA 4ZKDA 1HQCA 3WNCA 2GJKA 4LI0A 4OK3A 5JJLA 3LO5A 4FI3C 4HUQB 4HSEA 4B2PA 2FH5B 3RSLA 2ZSAA 4V0KA 2QE7A 2PJRA 4Q5IA 1TEVA 5EZ5A
chains in the Genus database with same CATH superfamily
2R6GA 4FE3A 1BXGA 2CNOA 4YR9A 1G21E 1WA5A 4X1IB 2NXEA 2PKRA 3I09A 5F35A 5CG1A 3PUZA 5BY2A 2PJDA 4P3XA 2HEGA 2W8ZA 1H5QA 1TAQA 2C1XA 1JLSA 4RHCA 4TS3A 1G6Q1 2VVTA 4UASA 4AS2A 4D3ZA 3DAGA 3NXSA 4ZRMA 1XZIA 3D2CA 2RHRA 3N8NA 1WPGA 2DYKA 4JX9A 2ALJA 5CLJA 5LZ8A 4MI3A 1Y4AE 3W90A 1VJGA 2OPHA 4E88A 1XXHE 4CIVA 3AOGA 1I3KA 3JQPA 4QBFA 5G2OA 5CITA 3OPMA 3SI7A 5H8WA 1SZDA 1IEWA 1Y7TA 3A4LA 3JRXA 4R2LA 4G1CA 1T6ZA 4IFIA 2CE7A 3MXTA 4IKPA 1A9SA 2ZIZA 5F1YA 4AJOA 1BWSA 2NVOA 3DQQA 1V16B 1W48A 4AG6A 3DWIA 1KJIA 2IRWA 3IAXA 1YHYA 5FA8A 4BPRA 2F1OA 3O21A 4FFSA 5FLKA 4YMTA 3BGOS 5KQLA 3SVLA 1N9GB 4MV6A 3KXPA 4CG0A 2A5YB 4JUBA 1L2TA 3VPBA 2B9VA 4HWTA 4IDDA 2P7HA 4BGUA 5IF3A 4DV6B 3THSA 1V1RA 3ABOB 4NLLA 3VDRA 3V8BA 3UH0A 1QO0D 2FWAA 1RZUA 2O06A 3CS3A 4IG4A 4Q4AB 5ALQA 1LVUA 1Y8RB 3OPQA 5TQ0A 3NS7A 5CAEA 4F3TA 3OPNA 2QXUA 3UMVA 1NW5A 4D9MA 4P35A 5EC8A 1TPZA 3E58A 2NNWB 4GRAA 3PXCX 3RHFA 3A6JA 4OGFA 5B1SA 1OSNA 1XQ1A 3DZFA 4M1QA 4JP1A 3PUKA 1DX4A 1KI1A 2V0GA 3B7PA 3H5WA 1G8JA 2PHZA 2H7CA 1EVYA 2ZKIA 2HK7A 4DG5A 3VJRA 2I03A 2VXYA 4EY7A 3L6EA 3IBCA 3I2YX 5HF5A 4IFBA 3WGHA 4PS1A 4D41A 1NN0A 4GPBA 3K32A 4LI3X 4E7PA 4EYOA 2JDID 3BWEA 1SXGA 2RDMA 4Y6RA 4ERXA 2HIGA 1D8TA 3PYXA 2YQZA 4JUAA 1EFTA 1GUAA 2BF4A 4TMKA 2A88A 5BV2P 4YRIA 3O73A 1VRWA 4WD3A 4YTEA 3AI1A 4L75A 3AZPA 4BNNA 3E70C 4EY4A 1WV0A 1UQTA 2VL7A 3MOGA 1XDDA 3FMGA 4NPHA 3TSAA 4TXHA 4HNTA 2YIMA 4E31A 4P8RA 2P3LA 4WEQA 1NMXA 2AMFA 4PQEA 3SJZA 1HORA 4BUCA 2XUIA 3MBIA 4E08A 5IEJA 3TD2A 4MHOA 4JGGA 2YV4A 1VL8A 1E1DA 1SZPA 3OM0A 1I1QB 3QHQA 1F14A 2FMXA 4PYRA 3JALB 2AC2A 3VPCA 5I7VA 3QU7A 2P79A 4O4HA 2PH7A 1IH8A 5JH7F 4YO7A 4JL6A 1YFZA 4MGKR 3WFIA 1KYIA 3HL0A 2IXDA 3PWSA 5CT5A 3T9EA 4ER0A 3HV0A 3RM3A 4CW7A 1REQB 4YJ3A 5KIAA 1ETHA 1LNQA 3AV0B 3VZCA 3T34A 1SUIA 4W63A 2CZCA 2XA1A 3QLVA 2ISSD 3QRWA 4O4IF 3L0DA 2VAXA 5IJ0A 1UBEA 5AHXA 3EIEA 1JDJA 1M8JA 2H54A 4IIHA 1HX7A 1F2TB 2ZQ5A 4IXTA 3R9XB 4ISCA 3S6JA 2WWFA 4F8JA 1GY8A 1JVNA 4K87A 1X8KA 3U6BA 3EG9A 3SQWA 3PGKA 2R2AA 5GZ6A 3WL5A 1SUPA 1FZQA 1L8AA 3P52A 4HXGA 3VGPA 1WUTA 4BP1A 4ENRA 4IICA 1CJCA 1NNUA 1IN8A 4U9IS 3ENZA 1X77A 3HXPA 5LQJA 1CUXA 2GEVA 3AH8A 3RLFA 5I7SA 3VO1A 1V5EA 5EHQA 4LXUA 1EGVB 1E6EA 3SM9A 3D7KA 1C8BA 2Q4TA 4YPFA 5KWIA 4IM7A 4EYGA 3LTEA 4A1OA 2GN0A 1RQXA 3KUUA 2GT1A 1JJAA 2VZLA 3GY0A 4BNIA 1G66A 3CEMA 3LKDA 2RKOA 1LCIA 1XTBA 2QTNA 4HP8A 1MPTA 1UPBA 2WEKA 3T5GA 4RL4A 2UYYA 1V8ZA 3A1VA 1Z68A 2OO5C 2XPCA 3OQJA 3RGWS 5CA0B 3ZCXA 4YCDA 2ZBDA 4MGZR 3JQCA 1WUJS 4RHTA 5D2CA 3GFRA 1GFSA 2HJHA 4RUKA 3CZPA 4OHKA 3IMGA 1BQ4A 3ENKA 4G8BA 2JAHA 3I37X 4YUZA 4JROA 3MF4A 1J2UA 4JLWA 1WZNA 2HSEA 3A70A 2XRZA 1OX4A 1UMCA 1XVTA 3FPCA 4LXQA 4MA5A 1M10A 3ZCTA 1PT7A 4PRKA 1Y8ZA 1IWPB 1YRWA 5JZMA 3HUUA 4C22A 4ENWA 5DWVA 1H94A 2M6LA 3ZEAA 4KH0A 3TW0A 4H2DA 1RLIA 3ESBA 3FFBA 5BWLA 4BVGA 4A0SA 4YJKA 4Q7EA 4H7JA 1MOPA 4NP6A 3ORYA 2EVWX 4Y67A 2RB4A 2BP7A 1TOAA 3OSUA 1JG4A 4AYWA 1VE6A 4YREA 3O93A 4CF3A 5C5DA 3LYAA 4EKYA 5I45A 3I39X 4ITUA 4ZEMA 4AQYB 4JEHA 3QI7A 1P4RA 2EKPA 3ACCA 3UGQA 3ZVRA 4Y0NA 1VCNA 4JX8A 1HEUA 1GZ5A 4V2IA 1BU8A 5CH5A 4KQ9A 4LOHA 3RRNA 3ZEIA 1V41E 4Q4CA 4QYTA 2WM3A 1PLLA 3IELA 3QVJA 5B3KA 4NFLA 3WHIA 1GNPA 2BH2A 2OAP1 1DIAA 5FEMA 1XK7A 1IUKA 4ZVVA 3EEBA 4PYQA 3UXYA 5CM8B 1T5HX 1NRJB 3PKIA 5ISMA 4N39A 3FCEA 4O6VA 1LK5A 4MW0A 4LF9B 5BVHB 3PQ2A 4WOBA 1W36B 1E0DA 1X3SA 2YY6A 3JU3A 4YMVA 1BMFA 4ZFNA 2WPNA 1M5UA 1LSOA 3GOQA 3P9CA 1R5BA 2UKDA 3QKWA 2WB4A 1FC0A 1EUCB 1Q11A 2ATEA 4NHOA 1R6VA 1QCYA 3U44A 3IMFA 1GR1A 4RD6A 3Q6NA 4PHHA 2QT1A 1GM5A 1QB7A 1QV6A 4XM2A 1ZL0A 3KFVA 3ZJVA 2C5GA 3GMSA 1HDGO 3C41J 2A4KA 4YQEA 4H4EA 1ODFA 2DF8A 1P3DA 2J6BA 1G7CA 3AEQA 3DOEA 3GQBB 1TLTA 4D1YA 4O2LA 4C7VA 5FPSA 1YQQA 3W5BA 3ZE8A 3ELUA 4YAFA 2QN1A 2P5SA 4CTKA 5HHTA 1HA3A 2FSGA 4AROA 1R6DA 2BLLA 6LDHA 4K6KA 2BFDB 2FN7A 1VE9A 2CB9A 1AQIA 1T13A 4J4TA 2AEEA 3IP1A 1FFAA 1EI9A 3RYFB 4GYYA 2H8KA 4MV0A 1CVIA 1NQ5A 1R7RA 4G81A 4MQEA 5BR7A 2PJUA 1UZUA 1X2EA 2ZWOA 3C6MA 3I76A 4Z9YA 3DHWC 5B2FA 1UL1X 2EW2A 2PKQP 4D3YA 1ZONA 2DPHA 1T3GA 3DJFA 1CE8B 2FWJA 3WLJA 3QWFA 1T0JB 3VPHA 4R8VA 4L9SA 5INTA 1NJ5A 3I9V1 4OU5A 4ZOLF 4DUGA 4V24A 3DHNA 5HJ5A 3JPYA 9GPBA 4BNDB 2AQIA 3HO8A 3ONWA 4ZVLA 5DNAA 4ZMRA 1N2IA 2SCUB 4MJXA 1GQQA 1ZUHA 1BVRA 1UKAA 2YJNA 2H1LA 5TR9A 1IOZA 2W98A 2B2XA 4IOKA 4DCMA 3IGFA 2G3YA 2TRSB 5SY4A 1P7CA 2JJ8A 3IE1A 1I80A 2FRDC 2DSTA 3PPXA 3F2VA 3EGDB 5I9SA 4K0KB 1IZYA 4F3CA 1HLFA 2QAGA 3BL6A 4MO9A 5BOVA 4CMHA 1Q44A 1RMYA 2NO4A 3R4CA 1WL8A 3VYUB 1O6GA 1T5DX 3G9TA 1P1CA 3T9CA 2R1TA 1VSVA 3IDOA 2EWVA 2ZBFA 4FD3A 4C7OB 4PXAA 3N2EA 4LZWA 7REQA 4UM8B 2O8BA 2X1HA 4QNNA 2WHPB 4K9DA 2ZXEA 3NTXA 4ERNA 1T0BA 1WSWA 3K5IA 4QO8A 1J42A 3MG9A 2P6RA 1XC7A 4NOKA 4W5HA 2WWVD 4HEQA 4PIPA 2Z4SA 1FFDA 2MT9A 2Y1FA 3O8OA 3VR4H 3WKDA 4LX8A 3O9VA 1SXJA 3AILA 3IRVA 1OR8A 4FE4A 1NP7A 1U99A 4PLTA 2XB8A 4QOJA 4CLRB 2GARA 2B30A 5FWDA 4BKQA 4QATA 1IE3A 2V0NA 4WY2A 2J5QA 1VGQA 3ONVA 3HEMA 2NACA 3BN3A 3DO6A 5K8IA 3GX1A 1KY4A 5HF8A 2IHUA 2V4MA 2GH1A 3TYXA 1AKNA 1L4HA 1ZM2A 2GASA 3ND7A 3EFBA 3QXSA 4XQCA 1IOVA 1NV9A 1RYEA 1SCIA 2HJRA 2WZQA 3AC0A 5A02A 3AEUB 3MHPA 3AFGA 2J9ZB 1Z13A 4FDTA 1IPEA 4Q7JB 4D4HA 2OORA 3CLTC 1YT5A 2CHVA 2Y1EA 4I50F 1ZIPA 3P27A 4OM8A 2QSJA 1EVEA 4H0CA 4KSCA 3R75A 3HWWA 2UVDA 4WY8A 1ODSA 3A27A 4RH0A 2BTQB 2IEGA 3OX4A 2AFIE 1EJBA 1L4FA 1BYUA 1TK2A 3PQDA 5DWQA 2GNPA 1XA0A 1VBKA 5EHZA 5DHPA 4BJHB 2IBSA 3NEPX 5IAGA 3VJLA 1RJGA 1JIUA 4G0NA 4NPCA 4ZQBA 1H66A 3ORHA 3GLKA 1AKEA 4BX0A 1D4OA 4W99A 1KO4A 2WRZA 2UZ0A 3I0NA 1JKXA 2E48A 4YK7A 3R9WA 5FIUA 1T2DA 2PMEA 3HA7A 4BWYA 2ZYIA 3U9LA 4URZR 3EXEA 3G9UA 3I05A 3M6XA 4F38A 2O8DA 3D59A 1JQLB 1TQ8A 3CHYA 2XUHA 2HA3A 2GUWA 2IZ5A 4K9RA 1CRPA 2QTTA 3QNMA 4NULA 3MTBA 1G20E 1I2BA 4R9UC 2O2YA 3Q2KA 5F5XA 4Q48A 2HXYA 2JHFA 2ZB4A 2B7LA 2KBEA 4E0BA 1LLQA 1Z3CA 4CMBA 1ECPA 3PF8A 3NM6B 3IEXA 4LDNA 4NATA 3R5SA 4QKQA 4C4YA 2GUGA 4WOKA 2WDPA 2PWPA 4GC9A 3SZGA 3UGJA 1YAJA 4LJ9A 4DGQA 3M4XA 4A0RA 4AZ0B 4Y2RA 1HE2A 2ACWA 1U0LA 2CUNA 2JCXA 1ZA2A 2O07A 2C5BA 1L5VA 3L0ZA 4ASUD 2WAMA 3KDAA 4F2GA 5FBVB 5JEEA 2EKZA 3UKJA 1TCVA 1P6QA 2ZUBA 3S7ZA 1B8PA 2AJDA 1NJFA 3D2LA 3FZEA 4JJAA 3ZZTA 3H4MA 4HZIA 2YNMC 3VSAA 2VP2A 4RQAA 3LGSA 1U6IA 1U1DA 2UZ3A 3AY6A 1HGXA 3LY8A 4Y9TA 1HNNA 5TEVA 4I7EA 1U2GC 1J1IA 1T35A 3HI6A 3G2KA 4RY0A 4TVBA 1QGAA 4LYAA 4YT8A 1CUJA 2HSJA 3RNOA 1WTAA 2H2AA 3LA8A 4DPLA 3OZBA 3PC7A 1WRBA 4ZI2A 1HDOA 4WK4B 5JCOC 1LDMA 1Q84A 2VA9A 3W9YA 1LPOA 3BMCB 1OBVA 2P11A 4IQ8A 2PH3A 5LYJA 5H70A 3U4GA 4ENSA 3KJQA 3N6RA 1XRSB 1T9GR 2GVNA 3Q2OA 1ZUWA 2QA5A 4LGYA 4D9CA 4HBZA 3MWYW 3HZZA 3CVOA 4K88A 4K9NA 2QENA 4OV6B 4YRSA 2ZB2A 3PUJA 3SR4A 2ESRA 1NTOA 4B85A 5FWXB 5KOJA 1CUFA 2CC2A 3QF4A 4CM4A 4QVGA 1UDRA 1GZHB 4K9SA 4WNCA 3ZUPA 4EOGA 2IZOA 1GIAA 1T2CA 3GXOA 5U1PA 4KJXA 2W2MA 1FTWA 3OLYA 4XLZA 1XZBA 2E4ZA 3P9RA 3DXZA 3PGA1 3UHJA 4I5FA 1IQ0A 3RBZA 5TQ2A 3C7AA 3JQ7A 2Y05A 1VE5A 2AX3A 3E3OA 1P8AA 2Q9CA 3G2HA 5J2TA 3AF3A 3FDJA 2H3EA 3P9QA 2HQOA 1JR6A 1C3LA 1ZL2A 2ONKA 2PGXA 3H87A 4Q3AA 3N86A 3DR3A 2GYWA 3BEOA 3H2KA 4ID9A 1I2CA 2P6PA 2PMDA 3W0LB 4EEXA 5AD1A 6NULA 4NMHA 2IGTA 1C8VB 2CL0X 2FI1A 3PQ3A 3FY4A 5GQSA 2A9PA 2W6QA 1N2CB 4NBVA 3RKSA 2G82A 4A82A 1ULHA 4CQJA 1A9PA 1FYFA 1NC3A 1XZGA 1Z6QA 2X19A 2ORYA 4I1RA 4IMIB 5K3DA 3FCSB 4W7SA 2J48A 4JDPA 4QX6A 5KSZA 3KL2A 4EVQA 5G0TA 1BRTA 1P4HA 3ONEA 1OB5A 4EABA 1JW9B 3I04A 5A5DA 1WB5A 5ITWA 3BSFA 4R1LA 5IABA 1H3EA 3F97A 4F60A 3ADOA 2IYNA 4R2JA 3HKCA 1YZHA 1Q0RA 2X23A 2CJPA 5JWOA 3URKA 3RBAA 5KSWB 4E94A 3UCFA 3EIXA 4C4RA 3ND8A 4IDOA 2GO1A 4MTCA 2C9BA 4BFUA 1CS0B 3BBPA 4M0MA 3A1EA 5J4KA 3A6EA 4XFJA 1E2UA 4ETNA 3F5DA 4U2BA 2EFEB 1OXSC 1P7WA 4RLSA 4BEBA 1FU8A 4M46A 1Z6TA 3ERCA 4RACA 5D3MB 4ZHQA 1A7AA 4L2IA 3TIVA 4LDRA 4ZPJA 1WIWA 1S7GA 3LCJA 3N39C 3Q7RA 4OK6A 4B76A 3WGJA 5KAPA 3L3BA 3T5PA 3ZWKA 1J49A 3BQ9A 1GPKA 3KDPA 1IYZA 4KUGA 4URUR 2CUZA 1XHLA 3D4PA 4UTOA 1SVMA 2QUZA 1XCPA 3OZXA 1CUDA 3L93A 3LUDA 3WKBA 2PVPA 2QW0X 3SLRA 1EDOA 1MR3F 4UHHA 4HH3C 2JZOA 3T4EA 4Y1FA 4DR4B 2F90A 2NT4A 3OJOA 1WU7A 4KE8A 1II9A 3ENVA 3K2QA 2Q4RA 2WUDA 3OJEA 1XR3A 2KSQA 1XCLA 4INZA 4B48A 5IVHA 4EY6A 1G21A 1XAGA 4FDAA 4MVJA 2W37A 1OC4A 4L4XA 4NBTA 5IAOA 3BL5A 4Q3NA 5EKXA 2D6FA 4BFWA 3VPFA 4JLNA 4B7AA 1KVUA 1TZKA 1GV0A 3SC4A 3UJ6A 1EUDA 5L7WA 2JLWA 4ED9A 4PZYA 3D0RA 4F8YA 1T8WA 3FDXA 4J16C 4BQIA 1PQPA 1T5SA 4QGSA 1T15A 3CGWA 3ORSA 1F8XA 3KAKA 1JR4A 3I1IA 2OHGA 2GN6A 3Q2IA 2HA4A 5A4KA 1P7PA 2I6GA 4HKTA 2AA3A 4H1HA 4HWGA 2VUTA 1ZI9A 4D0RA 5I7EA 5HA5A 4BQPA 2QPTA 5CB4B 2WQ7A 2QTMA 5U4QA 2CXOA 3H2SA 2I7VA 1X1QA 2XDQA 1TT5B 3G23A 3LY5A 4P98A 1FFEA 5KKAA 1IJEA 1UBJS 1MXFA 1UXHA 1BE8A 4ZXFA 1VLLA 1KVTA 3V4VB 3BXEA 4NMWA 4F2WA 3RS3A 3M2TA 5LCXA 3O0DA 3ZBQA 5JCJD 1ZW6A 3QKTA 4M21A 3BUSA 5JSYA 1W2GA 2D1SA 1LZKA 4MXDA 5EXPA 5LKAA 2VLBA 3DL2A 1JQJC 5FBLB 1GNTA 2OM6A 2VAWA 3WRXA 2W00A 3EXFA 3DB1A 5HUJA 3NNNA 2QTLA 1P8JA 1XMVA 3F6YA 3ROKA 4Q9NA 3PQFA 2ZJ1A 4E6EA 3EJ6A 4BFSA 2FN4A 5KREA 2EQBA 4N49A 2R5FA 3UJBA 4UZFA 1PJ4A 3SJAA 4TTPA 4V38A 2AYXA 1ULSA 3A6DA 4ARZB 5F2KA 1D2NA 1YRYE 3MAJA 3F9CA 3NTVA 5AUOB 3SR3A 3ML1A 4J0FA 4CDMA 5HG0A 1K9SA 1U0EA 3QQ5A 4AN0A 4E5VA 2I4NA 1FMCA 4L3VA 3ZQKA 3HKEA 4RQUA 5ADUS 2XNDA 3D4IA 4ZVRA 3MUEA 4FFBA 4FX2A 1AY0A 2IELA 3DFIA 4B5LA 5HYVA 4RTNA 3RV4A 2OHXA 5LLSA 3TGWA 2VTDA 2OYRA 3F5SA 3H2IA 4L4RA 1GAXA 2ZRQA 5KZMB 4LBWA 2YWEA 3CZRA 1ONBA 2ZI7A 3DAYA 1LF0A 1T3TA 4QUDA 1XL0A 4I9NA 5AKEA 4PAOA 1TYAE 1SB9A 3H7IA 4DLNA 3T52A 1JWLA 2V3WA 3EVDA 3F74A 8ADHA 4AWXA 4W5TA 4R8KA 2XGGA 4AURA 2ZS8A 5BQFA 1YDGA 3WY9A 2H7VA 3HR8A 2EZ9A 5AT1A 3NHBA 4R41A 5HFAA 4Q9AA 2BHLA 4JIGA 4E2WA 3ILXA 5GY7A 1CZLA 3RODA 2DRIA 1IJKA 4XCXA 2BFMA 5BSHA 4W8HA 1XZCA 2N0SA 1DHRA 4S1TA 2WFZA 4NI5A 2NPIA 3I1JA 5YASA 3Q15C 2NXJA 3PJEA 3BTOA 3GFSA 2RG7A 2QRVB 4LHWA 3A0RB 4GDMA 4EDFA 1JEYA 1RI5A 2ZS9A 4R5HA 4XX1A 5AJVB 4LAFA 1KI6B 2VTKA 1Q1QA 2MDTA 1FYVA 1R4AA 5IC6A 3WK9A 3LNCA 4TKZA 4J3NA 2GR9A 1YMUA 1RYYA 1R3DA 1V7QA 2PSEA 3HPRA 2ZR9A 4XWTA 4D8UA 1LDGA 4XPIB 4B71A 1JQDA 3AUXA 5DTEA 2WTEA 2PUWA 3NEJA 1MRZA 4EYEA 2XWQA 2YW9A 3WLLA 4JFAA 4HGQA 5BSWA 3EEIA 2TMKA 4KK4A 1W4ZA 1SUEA 2AKYA 2EWWA 2X1MA 3H5TA 1NOJA 2CFSA 2INGX 1I9CA 1RXIA 4G5QA 2I8LA 4DLZA 1VFNA 4PHCA 1C1HA 3G1WA 4HDQB 2P6NA 5AUQA 4M1SA 3T54A 4LDZA 1OZHA 2EXXA 1JG3A 3GVIA 3W6OA 4QUGA 1J24A 1E92A 2QN9A 2VPXA 5EWLA 4PPNA 3M89A 3LVQE 3UJHA 2JI8A 3QE0A 1DG9A 1OBFO 5A4IS 5SZHB 5JHGB 2BL4A 1H4SA 2DVMA 4NQRA 1I7LA 3C48A 1KC1A 3KDSE 3OKPA 4V0MA 1QYXA 3IXLA 3MEQA 3QPAA 4RMIA 4XIGS 3VU3A 3ZDRA 5L6MB 1QIKA 4BLTA 4F0JA 5C37A 5DM4A 3TRDA 3VR1A 4QM6A 2QJFA 3UMSA 2QTZA 2JBHA 4X3CA 2E5WA 1IDOA 3AWIA 3HFJA 5CH8A 3QNWA 2YKGA 2WILA 5FTWA 3FVWA 3ICWA 4K6GA 2ZBRA 2V03A 3DLAA 3BIOA 4NJMA 4RJJA 4DCJA 4DBLC 3O9ZA 2NZ8A 4CI9A 4Q01A 4RA6A 4DZRA 4MDHA 1ZUD1 3L2OB 2IYLD 1P5JA 2NYRA 4OA5A 2ZI3A 5KNCA 4TZ6A 1ZD8A 4RPHA 4CEJA 2BWJA 1F8UA 2YIJA 1K6EA 1YS7A 1BS1A 4MKXA 3GAAA 4MS3A 1X7XA 3RBXA 3TOVA 1B41A 2C97A 3DXXA 1T91A 4KN6A 2YXNA 2C4NA 2C3YA 4DFDA 3AUUA 4ES6A 2X9GA 3WLKX 2JZNA 3WIOA 4DT1B 2R62A 1F17A 3RRYA 2X1VA 3L43A 4PG5A 3VOSA 5HS4A 3LPMA 2PGOA 2JPDA 3LXMA 2QM8A 1HM5A 1J2JA 1W94A 1P2DA 1XVIA 3UG6A 2POCA 3TAXA 4DLWA 1M5RA 1EFAA 2G25A 2HWKA 2OQRA 3AHEA 1ODTC 1QH8A 2IDJA 3TFWA 3ENWA 4IMRA 1K5GA 3IT0A 1TFUA 2XT6A 4CKWB 3FZNA 2DPLA 1XKQA 4AZ3A 1YRBA 2PMFA 2BJHA 1X7HA 3DE3X 4R9SA 1T5BA 2VAPA 2VXOA 2G76A 2BMVA 4L0QA 4C3VA 3CNBA 2DG2A 2R5WA 4WOJA 3T5MA 3AVTA 3OTHA 5E7IA 2FMHA 5JDCA 5E2AA 4DL9A 4DNQA 1TMGE 1M6YA 1U1EA 2VEDA 3HWSA 3FVTA 1FS5A 3UAXA 1LDYA 4AM8A 4BMXA 2H1RA 2WMOB 4PFSA 4HUQA 2AF4C 4BVFA 5A1TA 4LJYA 2C07A 5FTMA 1ODLA 2OAGA 2REXB 4UOQA 3QTLA 4EW1A 1W5TA 4OJKA 4OXYA 4B6PA 1DLIA 2BFFA 2OZVA 4XH9B 3LX6A 1WV1A 4XE5A 5IUNC 3E4CA 1ECBA 3GPIA 2O8CB 3EQ6A 3F49S 3HCAA 5AJUA 4ZC8A 1LLDA 2GZ3A 3QXGA 1ZGAA 4ZPXA 4A0QA 3NFYA 4BLOA 3JQFC 4KE9A 4I66A 4NYIQ 1C4KA 4QYSA 3O94A 4R8LA 5CHYA 2VNAA 2DZDA 4BEVA 3VYSB 4KXLA 1UOOA 3BGIA 4NECA 1KA9H 1SCUB 3HO1A 2C61A 4FB4A 4AUEA 1X1RA 3U4QA 1PBTA 3B9BA 4DQ0A 3JQBC 3DEKA 4I55F 3JQQA 4PGMA 3ONNA 1V45E 2QTAA 3PZBA 5ESRA 4EY3A 4F71A 1XV5A 4AMVA 4C0AC 1T6BY 3OE5A 1TUEA 3QYJA 1G5PA 1PR6A 2H31A 2IU6A 4ZT3A 5LZ4A 2HIMA 1LBQA 1WEHA 4QYXA 1ECGA 1N5DA 4B84A 5JLJA 3Q8XB 3ZWDA 4OGKA 1PS9A 2R85A 3LW7A 3SFVA 1TA4A 1Z22A 3FYTA 2FW8A 4CT5A 6ABPA 3OPYI 2EKBA 1RVDA 1AKMA 1FE8A 2X9LA 4CUJA 3PRKE 2VDMB 1UDBA 3BGWA 4FFOA 4FMCB 4PYJA 4DDTA 2VSFA 4JLSA 1KR2A 4YUVA 4DA9A 3TTYA 1E2MA 5AXAA 2JATA 1YZLA 1ZNYA 2PSSA 4MWGA 2XMQA 3UWSA 4EG0A 2YOFA 1FNDA 1K4YA 1NPDA 4N0MA 3AR3A 4IIEA 4DSAA 3QM1A 2XE8A 5M5BA 4GOND 2IUSA 4LF8B 4F3NA 2X40A 1D4ZA 3UFXA 4MV5A 3R6LA 3LT2A 1U2SA 5F3RA 2AVDA 4W8GA 2NXCA 1CDZA 3OU7A 2MYNA 3P4YA 1MKYA 4B9EA 4TTIA 2HJGA 2EC5A 2H5LA 4JBIA 3DAFA 2RHJA 4MHTA 5C3UA 1T9GS 4QECA 5THQA 3CLTD 4D3SA 2I9KA 1VLJA 1MQAA 3THRA 1K5PA 2HWYA 3GCDA 3MQ4A 3IR7A 2G17A 4LKRA 2AHRA 3OOWA 4MS1B 3PHBE 1FX1A 1A77A 3GFVA 4A8PA 4Y2SA 5G1OA 2PUGA 3FHTA 1V9SA 4D0LB 3HGMA 1BCSB 5BO5A 5JECA 2Y27A 3LWZA 1TCUA 4OBXA 2H65A 4PYKA 4W6ZA 1SIOA 4NCAA 5JBNA 5EKSA 4JEMA 1JR3D 2GZMA 3OZVA 4J94A 5LC1A 5L4SA 2WTBA 4YDSA 1Z12A 2BBSA 2H7YA 2WI8A 5IKEA 4WBXC 4EUHA 1D6NA 3NIDB 4PSUA 4DLLA 4LYFA 3QPBA 1NNLA 4OHOA 5JSZA 1VLZA 3PQ4A 5LPNA 1R16A 2O14A 1Z5VA 3ZQ4A 3JD0A 2Q0SA 3QSGA 1S2OA 3IBTA 4QG3A 1NUUA 5JJBA 3OKFA 3E1KA 4IZOA 3GUUA 5T3UA 4GX0A 1QIMA 4XIIA 5BV1A 3OTIA 3WB0A 1QTRA 3BXFA 3NBFA 2ZBQA 1KYQA 3GVHA 1J8FA 1PVVA 1RAIA 1XRNA 3GROA 4L5IA 5SZIA 1OIWA 2GI4A 1ELOA 1Z7GA 1ABFA 1Z8DA 4O33A 3H3JA 3VYRB 2BE7A 3QBJA 5B55A 3DBHA 2BCGY 5TJ9A 4TXLA 4Z4HA 3L82B 4NKRA 1FP6A 3ANTA 1QGZA 1YVDA 2V7BA 1MO2A 3N2NA 3OWOA 1DAKA 5DSTA 3SMQA 1AMNA 4CF6A 3S2YA 2C59A 5CXQA 2HMVA 2CF6A 3T35A 5GTDA 4B40A 4MS4B 3S7TA 3T12A 1TYCA 4XEHA 1IMOA 1CYEA 4IHAA 2YNMD 2C88A 3ZE7A 1U0HC 2OBBA 3M4JA 4Y9DA 2I66A 3OE7D 4QXMA 1FNNA 1MP0A 3MWEB 3V3KA 2AKAB 3NBKA 1O0BA 3IVXA 1SIBE 5G53C 5K51A 4MK4A 2C9MA 2P30A 4QU8A 4XDYA 2LW7A 5DM1A 3RVNA 3L0YA 4LNUB 2FZLA 3WGTA 4F93B 1NURA 3IPXA 4K3VA 1CRLA 1DAGA 3SR0A 2O8EB 1KK2A 4Y6GB 3H1FA 3HB9A 1O8BA 1YR3A 3DWGA 4Q1BA 4E51A 3AM1A 2FN9A 2CFIA 2OD7A 3EDMA 3L41A 1A88A 4LZAA 4FBMA 4ZCMA 1Z62A 3B2NA 4MRAA 3HJTA 3JQRA 1P1HA 1U2ZA 2Q3LA 3M6FA 4I8IA 3LVRE 4C0LA 3AVQA 2J9YB 3FNQA 1KP9A 2I87A 5ALJA 1IJBA 5EJ2A 2ZUWA 4X92A 3CKKA 5DYNA 3AUTA 5G1NA 3SE0A 5IT0A 1LVGA 3V1LA 4S1OA 4D3XA 1WUYA 3BREA 3EIQA 2E4XA 2FSUA 1IY1A 1O97C 1N6IA 2MR6A 1DO8A 2C7VA 2I8CA 2QQ5A 3K9CA 4Q6BA 3JRNA 4FZ5A 1KO1A 4PNHA 4PVCA 5DWDA 3O5AA 5ELMA 3AG6A 1EK5A 1U3UA 4I9HA 1AO0A 3BFPA 3C3YA 1YNSA 3W4KA 4W1QA 3A7EA 3L7AA 2GILA 1NN5A 2Y0CA 4TN1A 2BAGA 3G2QA 1U31A 1RP1A 3B20A 5ALPA 4H6PA 3RAPR 5ALMA 3WWCA 1V1MA 3WIUA 1NHWA 3EWSA 4RTPA 2OAQ1 5JANA 2M32A 3I2FA 3IQZA 4LRYA 5A6SB 3HBJA 1NJSA 1OWMA 2FW9A 3FMVA 3LK6A 3PL1A 4LOLA 4UVDA 2ZPUA 5H68A 4A2WA 4ZDKA 5KYXB 3LKVA 5EIWA 1DC6A 1PFWA 1VLHA 5HIMA 1PJAA 1V11B 1R6XA 2WUEA 3UMMA 4TM8A 4RV5A 2VJQA 1O6BA 1VZ3A 4I2VA 4KXQA 3U2QA 2R2GA 3UQYS 3PXBA 1VLMA 4PC2A 4ZQHA 1R5OA 1NSFA 1H2EA 4NE7A 1O58A 4TQGA 2DKFA 4MKFA 2GZRA 3L8GA 4TL9A 1P74A 3NBAA 3TXXA 4NOLA 4CLDA 1WBDA 2HNAA 3A1DA 5CYOA 4GR9A 1V4NA 3O4JA 3EXAA 1W0JD 4JSRA 3SS9X 5K09A 4IDNA 1NYRA 3PIRA 5CLQA 4JP8A 1R3UA 1U3CA 4K6CA 3NDPA 4N03A 4QLAA 1CUBA 4Q4HA 3B5JA 3ONDA 2AS0A 1Y1KE 2ANCA 4L0MA 2V6FA 3TL2A 3RYCA 3AUFA 2P2YA 1CDOA 3BZUA 2DLDA 2XQFA 2HT6A 3RFUA 1M1YA 2AXPA 2EKLA 1I3MA 4CKBB 3G2LA 3H0CA 4FLMA 3K8QA 4K9KA 4BVAA 5JTUA 1AM4D 1OKKA 5T67A 3H65A 5E2IA 3ZN2A 1ISSA 3RRXA 3T0FA 3OEED 3EZ6A 3UZUA 1PNRA 4DJJA 1MH1A 3R6TA 2O0JA 1OH8A 3CG4A 4LXXA 5LLDA 2QUBA 2VI5A 3FAZA 4KQWA 4FE7A 4MRMA 1Z4QA 4QBGB 5AESA 2WJJA 3G2MA 1FMLA 4M0CA 3HCNA 5HZGA 2OB1A 3PB3A 3LK7A 1RRMA 2NZ2A 3GVXA 4R0VA 4QD3A 1TEHA 5TEWA 5KI6A 3OEHA 1GGJA 2HWUA 4DXDA 1K08A 4EKEA 1P5HA 4C2UA 2PQ0A 3VZQA 5JT1A 1BJKA 3IAM6 2B4AA 2VC2B 3GLSA 1WW2A 5CIQA 1H65A 3LQ2A 3IQHX 4MJLA 3ZWCA 1MRNA 1TEXA 1ZSYA 2IKQA 3G6WA 3MWLA 4JBWA 4JT9A 4N82A 3L1IA 2HYDA 2JFXA 3CLSC 4PRZA 2BJVA 4DRXA 1NVTA 5K01A 1DBIA 1NQOA 2HMSA 3KNZA 4K6MA 4N3GA 3RSQA 1SKMA 4MA4A 4WZAB 4RW0A 2C4UA 3NQ41 3Q0EA 1OB2A 4PFKA 1QVAA 4OXQA 3A1WA 2WT4A 5AM2A 2BISA 1BHO1 2RBEA 2X9NA 3DMYA 3KZCA 4GXQA 1HOTA 1O4VA 3DHVA 4IFEA 2CF5A 3G88A 1U8TA 3NHYA 3NYIA 3WSTA 1Y1QA 1FK8A 3QVLA 1MJNA 2VUHB 3NPMA 2REQA 2DERA 3BPSA 3LRTA 4LHEA 4GEGA 1OLXA 3QJ5A 1IUOA 2ENWA 1AA9A 1DXOA 1S8FA 2GJSA 3FXAA 4FOPA 4KGZA 4LWPA 1AV6A 3MJ4A 3U26A 5C8YA 4QM7A 1E6CA 1L9XA 2PBZA 1LWNA 1UKCA 3TXAA 2IQ5A 3EE6A 1UF9A 4BGEA 1HF3A 2E18A 1VM6A 1XTIA 1UDXA 3UMYA 4E2XA 4TMYA 3G68A 1RRPA 1X0VA 1ZC3A 2GXUA 3ID6C 1OFGA 4MP3A 1RMQA 2ZDHA 2IUTA 1QHXA 4YY3B 3WV5A 2CXTA 2ZI9A 4PO8A 4KDEA 3MAAC 1AK9A 2BF7A 4IV0A 5A3QA 4BXOB 3VVBA 1JB1A 2BZ0A 3HLKA 4YRCA 2QD3A 4IIJA 5BRAA 2FMTA 1Y34E 2XCQA 4M3NA 3W7VA 4YRFA 4JI7B 3AP1A 1DAPA 2GYUA 1AS0A 4D43A 3FZQA 1UEIA 2H07A 2FV8A 5F1PA 2EP8A 4DG9A 2VZ0A 3JPWA 1AS2A 5EN4A 3WDSA 1ADFA 3ZGYA 3FGOA 5IBRA 1LK7A 2JCBA 3BD8A 2XEDA 3L6OO 4K9OA 5AKGA 4BYMA 2FK8A 4YJ2F 4TTAA 1EAYA 4GM1A 4OLHA 4ETMA 1GCIA 5F5NA 3D0QA 3RSOA 1FP1D 1KJWA 1PFKA 4FXOA 5BSKA 4XTRA 3IKTA 1L4UA 1EB9A 1DBSA 3D8RA 3CURA 1CQZA 3I8OA 3OX2A 1T43A 4JVSB 3AMVA 2IXBA 3E5MA 1BROA 4D02A 1CIVA 1KI4A 2V7VA 3V4ZA 1DKLA 1W6RA 3LQQA 3RYTC 1T3LA 3ZDQA 4EWLA 3VBEA 2FW1A 3B7GA 4Z9BA 3AUJB 1JQKA 3O8QA 4UM7A 1XK6A 1GU7A 2DR0A 3IXQA 4L7VA 3RKRA 1XNRB 1PKXA 2OAEA 1U3WA 1DADA 4KXXA 1V8FA 3HGQA 4H08A 4U7JA 3SQLA 1VGVA 5B7PA 5FH9A 4JBGA 4KITB 5JQGB 1E69A 2VJDA 1E1QD 1XO1A 4PC3A 4DWVA 1XTKA 3FYUA 3C4JA 5IUKC 3DTVA 4UE6A 1NL3A 3VSBA 1S2MA 3NBZC 2WV9A 3LGXA 3BWCA 4EBBA 1EZZA 1Z5PA 3NHMA 3W8DA 5IDWA 3D43A 3T1YB 2D0IA 4GP7A 5ALNA 1ZWKA 3AEKB 1UJMA 2O2IA 2FEPA 3BCUA 4X1YB 3LQRA 5CDTA 3SY8A 1SVKA 2WAAA 2GPWA 4PAQA 5IMBA 2XXAB 1Z4IA 4OKNA 3GEMA 4XVUA 2H9IA 1VDMA 4JWTA 5F5LA 1GO2A 2H4WA 1T6NA 1GPH1 5DB4A 4HDMB 2WWRA 4KYUA 4WUTA 4Y2VA 4R1SA 4YC7A