2ERYA

The crystal structure of the ras related protein rras2 (rras2) in the gdp bound state
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
171
structure length
167
Chain Sequence
SMQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein R-Ras2
publication title The crystal structure of the Ras related protein RRas2 (RRAS2) in the GDP bound state
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 60
structure length 167
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2eryA00
2XAUA 5CK4A 2AXNA 4G0NA 2JDID 2QMHA 4GPTA 4P31A 5DISB 1LF5A 3Q5EA 3H84A 1NLZA 2J41A 3NHAA 5HKKD 2GXAA 1U98A 3QENA 4TQAA 2VA8A 3OHMA 2WHXA 1VG9B 2A30A 2QNRA 2PCJA 3F5FA 2XB4A 4XTCS 2ERYA 5KSPA 3UMRA 4UJ5A 1M6NA 1XEWY 1GZSA 4HAWA 3OIWA 1U8ZA 3E2IA 1F5NA 3JZAA 5KYKA 2V4ZA 5KTYA 1TPZA 1ZUIA 2GHIA 2IW3A 1HQCA 4LJ6A 4OHWA 3I61A 4ZV4A 2Z4SA 1U2RA 2ZS9A 3ZZTA 4FMCB 4DLWA 2ORVA 4V02A 5B2ZA 3FKSD 1YZGA 2P5TB 2R2AA 1H8HA 1V5WA 2G83A 1XTKA 1XCGB 2Q9BA 2D62A 4M1MA 2JJ2A 4LPSA 5AJXA 5JWHA 4NYJR 3PITA 4MKGA 1GRQA 3HWSA 4FIDA 1XNJA 2IEYA 4JKIA 2C9OA 5CK5A 4PSAA 3SR0A 2ZJ8A 4F7WA 8OHMA 2Z83A 2BV3A 2VTKA 4IVPA 3SC3A 4AK9A 3TUIC 2XTNA 4KLZA 3S1AB 1M34E 5C1BA 2OBMA 4D80A 5FOWA 1NLYA 1N6OA 2HF8A 4BPBA 1AN0A 1Z6YA 3TAUA 4QGAA 1II0A 1T6NA 2BJVA 2N42A 2P5SA 1X8LA 1U99A 1DBSA 4XVQA 4E5UA 3LY5A 3SFZA 2QI9C 1KI4A 1ZINA 1P9WA 2IYUA 4HUQB 2CHVA 3ZH9B 2HDNB 3W3AA 2EW1A 4XTRA 2J0UA 3BERA 3RC8A 1OKKA 1N5LA 4G5OA 2NPIA 2BWJA 1VHLA 2OLKA 1VHTA 2KI5A 3N70A 4PO9A 1S96A 4D0LB 3ZQ6A 5JCPA 3JVVA 2NTYC 3I5YA 1G3UA 4M1TA 5J4LA 3B78A 3Q3JB 3A4MA 1KAGA 5EXSA 2IS1A 2TMKA 3AGPA 5EXPA 1HUQA 3W6NA 2ODEA 1G8GA 3QXCA 1JQJC 2AD1A 3PEUA 4EJSA 1OJLA 3NBYC 1II8B 5JHGB 1OH5A 4LYFA 3FGNA 3VNVA 1EGAA 3BFVA 4KVGA 3UWKA 2CNWA 2XB2A 4D25A 4B73A 4HLCA 1HV8A 4C3ZA 1Q22A 4P32A 3V9PA 2WJVA 4MRVA 4NP6A 4OHXA 4LJAA 3AVOA 1E9AA 1L4YA 1W48A 1XTQA 2B7CA 1F2UA 4C0JA 1P75A 2CLDX 2ZJAA 1G8YA 4ABYA 4RCZA 4TL7A 3KQHA 2RGDA 2I1VB 1BOFA 5J4HA 2P2LA 2W6IA 4Y0VA 4DLTA 2YC2C 3P20A 1CJVC 1J8MF 1C4OA 2WWFA 4DKXA 4LK2A 1M8PA 4KFUA 2CE7A 2QE7D 3LX5A 3NC0C 4UXJA 4PC7A 3ZVMA 1A82A 3FE2A 2GK7A 2QU8A 3B1WA 4TYQA 3DL0A 3FMFA 4Q7KA 4TZ6A 3SQWA 1WMSA 1CP2A 3UG7A 1N6NA 4UNPA 3NXSA 2WMOB 1JECA 3A1UA 2ZITA 5IK2A 3SJZA 3ZIAA 1IBRA 4PO1A 5J47A 4QKQA 3TGPA 2ZEJA 1KDTA 1QZXA 2IUSA 4KU4A 1T3LA 2AL7A 4HB0A 2XSZD 1JAIA 1RJ9B 3OFNA 1NMXA 4EFNA 1XBTA 3DVLA 4JL5A 4PZYA 1VDZA 5K8UA 1DO2A 4EAQA 2A7QA 2YOGA 1SVMA 3RWOA 1Z63A 4TLCA 2XNDA 3GLHA 1P2VA 3L8ZA 2I3BA 1E2QA 1CBUA 1FP6A 3IUYA 4JLAA 4Q7JB 4TT3D 5BW8A 3B1YA 1IONA 5FR2A 4NYIQ 1P72A 1WE2A 2CVHA 3K0FB 1R5OA 1ESNA 1TEVA 1YZTA 4M1OA 4US2R 1MABA 4UNQA 5SZKB 3QXXA 4BUJA 4RD6A 2ZXUA 3TMKA 1XEXB 2N46A 4LJ4A 2QROA 2R6AA 4YDSA 1W4AA 4A92A 1Y3AA 3PUWA 3D8BA 4NONA 3UXMA 2O8DB 5KSYA 4EUNA 2O8BB 1JBKA 3WNCA 2GF0A 4IOJA 2QMOA 4EKDA 2BMEA 2Q6TA 1Z6XA 1ZP6A 4W5JA 1JXMA 1L8QA 3O8DA 3MLEA 3R9WA 1XB2A 1GOTA 4QL3A 4EQ6A 1M7BA 1JR3A 4HLUC 1KZ7B 2KB0A 4JS0A 4KFRA 3K9GA 2R6FA 3E1SA 3ZDQA 2LKCA 3SYNA 4JL8A 3DM9B 1FP7A 1Z0DA 1KMHB 2QZ4A 3T1QA 1IN5A 2JA1A 4OJKA 4U5XA 4YDHB 3K09C 2GESA 2ZSAA 1PJRA 2BJWA 2CBZA 2NO7A 5JECA 3HR8A 4TLEA 1E6CA 2WKQA 3SDZA 1VYVA 2JDIA 4LDJA 1GFIA 2FN4A 3MWKA 2EFCB 1DAHA 1EK0A 4LBYA 3IEUA 5FPYA 3RC3A 1VG1A 3RS3A 5HKKA 2XEXA 5FBWB 4B3CA 4J0QA 1TU4A 1G291 1NRJB 4YLGA 4ZKEA 1GVNB 1N5IA 1G8HA 5CJ2A 1HT1E 2VPPA 3TUJC 4D2IA 4QGHA 4DLUA 1X1RA 1OIVA 5D3MA 3SYKA 1G3QA 1S4QA 1KAOA 2VF8A 1JQLB 2W00A 1QHXA 1K5GA 2PLFA 3K0AA 5KO2A 3TE6A 2OG2A 5AUQA 3KDSE 1M2OB 3OIVA 3EC2A 1EFHA 4IFEA 1E2GA 4Q9IA 4CEIB 2ODWA 1XTIA 1TNDA 3GLIB 1DTSA 2O0JA 4RD2A 5E7IA 4DWJA 1Q3HA 1KI9A 3FKSA 4PANA 1T8TA 1KNQA 4RD1A 2BM1A 1W36B 1EFUA 1TQDA 3RDPA 4B74A 1JB1A 2X2EA 2QRNA 2PZGA 4C2UA 1Z0FA 4CT4B 3VHLB 2F7SA 3ADCA 4IRUB 3WRYC 2VLIA 3GD7A 4MA4A 1TUIA 4YC7A 2XZLA 2ZANA 1ZNXA 4Q4JA 1AQYA 1E2IA 3BXZA 3NBFA 2QENA 1A2BA 4FD2A 1CLUA 4C7OA 4FN5A 3DPUA 2EU8A 1OIWA 1PUJA 4FXPA 5JI3E 1IXSB 4IOLA 4KXFB 1OYWA 3EW9A 2Y8EA 4IXMA 2IXEA 3N5CA 1IOZA 1KOFA 2V55B 1EX6A 1W5SA 2BKEA 3OEED 4HZUB 4LRWA 4EIWA 5KDOA 4HAVA 2H7VA 1FTNA 4IW3B 4QJ3A 1LS1A 3N2EA 1W47A 4Q9JA 4PTLA 5JJIA 2ZE8A 4YONB 3R9IA 3T61A 5DHAA 1XMIA 3K70B 3HDTA 1W4RA 2JATA 3AF1A 2ZRMA 2JCSA 4AD8A 1NIJA 1NSTA 5DI3B 2D2FA 1SKQA 4BZXA 5F9HA 2JJ1D 5FI1B 2ZE7A 1GNRA 1HURA 1W36C 5EUMA 3GFOA 2QP3A 3KUDA 1I4DD 2FSHA 1XXHE 2ZRIA 2XJ9A 4PPFA 4Q1DA 421PA 3ZS9A 1BKDR 1KHTA 3GLGE 2NMVA 1VIAA 1G3MA 2VHTA 1UDXA 3LX8A 1M1YE 3U61B 1UBGA 4OK6A 1W36D 4Q1AA 3AUXA 3L2OB 2O52A 4CIDA 2QG6A 4GP6A 4M9XA 4IOKA 1G16A 4QJ4A 5FPTA 5G40A 5BWMA 4A2QA 2QORA 3RHFA 3LXRA 1S1CA 1CJTC 3X1YA 3GQBA 1OSNA 2OO7A 5SZJA 1TQ6A 4CVNA 1QHHB 4HLDA 2J45A 1E99A 3T1VA 3U3RA 3S1AA 5JLJA 5EZ5A 5EP4A 1RPZA 2IWHA 4GSYA 1EESA 2GXUA 4HB3A 1Z0KA 1Z47A 3K70C 2QE7A 3NHBA 2XITA 4DLSA 5AJYA 4D4KA 3FHTA 3ZQJA 2AXPA 2QM8A 2FGJA 4M53A 2VHJA 1D8TA 1TF7A 3FDIA 1UJ2A 2RHDA 2P6UA 2FSIA 2ZSFA 4LUCA 4HUQA 2CCKA 1N5JA 4NHOA 4LHVA 3K70D 1FPMA 3M0EA 1VMAA 4B32A 4EFMA 1UKZA 2G6BA 2ZYVX 3F8TA 5AR1A 4WZ6A 1H65A 2XSZA 3L0IB 3I92A 4TTPA 4DCNA 5ELXA 2P3SA 5E7MA 4HB2A 3TH5A 4DEYA 1W0KD 1TEXA 2WPDD 3AQ4A 2VP9A 3CONA 4TT3A 1DADA 5HR5A 3BH6A 4HDQB 3QPVA 2MSEB 4MYTA 3TKLA 4F38A 1II8A 1ELOA 1M7GA 2ZR0A 3QF7A 4I81A 1B0UA 1E2EA 3AGQA 5FTJA 5G41A 5KU1A 4XVRA 3VR4A 2ZJBA 3A36A 4TMVA 2I4IA 5FUYA 5CJPA 3RS7A 4P0TA 3RSLA 1SVLA 5KDDA 3BAFA 3IPYA 1Q20A 2XOKD 3TVDA 3ICQB 3IIJA 1DS6A 5FOSA 2JLSA 2OCAA 3SI7A 5KDLA 1ANKA 1R8SA 1FW6A 3CIOA 3IQXA 4OHZA 2C98A 2ONJA 1XRJA 4RFVA 3PR1A 3ZD6A 1SXJE 1ODFA 3VR6A 1N0UA 2WZQA 4RCYA 5C4GB 4M21A 2J7PD 4FMBB 1OHHD 1OFTA 2FPLA 2DWOA 4Q9KA 4F4JA 4Q7LA 3AP1A 3GJ7A 3ZZUA 4C0HA 4LCBA 4DT1B 1GKUB 4E07A 2ECKA 3AEZA 2FDCA 4HLUA 1GRRA 3LLUA 4DLVA 5IT5A 2BOVA 2HJGA 4QG7A 1OFUX 4Q19A 1BYUA 3K9HA 5FTLA 2W2XA 1XEWX 2QPTA 1SGWA 3G5UA 1R0YA 1UF9A 2GEUA 2OCYC 2LCFA 1XZPA 1RJ9A 2IF0A 4A0HA 2UKDA 4OJQA 3NDPA 4DDWA 4D26A 1KGDA 3DDCA 3K09A 2CK3D 3AH8A 3W8RA 2C9YA 2WOOA 1XP8A 3AVPA 1E94E 3VKGA 2HXYA 3K0FA 4B3XA 1G5TA 1G9XA 1N5KA 1FMJA 2UZ3A 2C9CA 4A36A 2FEMA 4AKGA 4XH9B 1Q57A 1UKYA 1IY0A 1ZRHA 2ZJ2A 4OQMA 1JJVA 4B6EA 3RS5A 4ERNA 1G4UR 3U6KA 1XEXA 1AKYA 2EFDB 2QPOA 1D2EA 3BFKA 2CL7X 2Z0MA 2O8DA 2QQEA 3RS2A 2O8BA 1LFDB 2VHQA 1J99A 2A5GA 4XSHA 4G1UC 4P4SB 4DLZA 1US8B 1QHSA 3I32A 3IKJA 3QI2A 4LZZA 4CYMA 4G5GA 1OPXA 5G3ZA 1E96A 4ESHA 4FWIB 1CR0A 2PLRA 4FW9A 1RVDA 1PZNA 4JZKA 2W2VA 2WWWA 2ZE5A 3GLHB 2O5VA 4A2PA 3U7HB 1IJEA 4ILEA 2ODBA 3VR3A 1Z8FA 2JASA 3FVQA 3NG1A 1NSFA 1OB5A 3SBDA 1KMQA 1KMHA 4IFBA 1WBBA 4GP7A 3NVAA 3KJHA 2ZJOA 1CRQA 4RD0A 4NCJA 5AK0A 4TL6A 2B7BA 1LTQA 3WHLA 2VIIA 1TX4B 3GFTA 3UMFA 4FMDB 1P6XA 4PC3A 5FTMA 3RLFA 2E1RA 1KO7A 3OEEA 1NY5A 3LW8A 4LHXA 1VECA 4L5BA 2D3WA 2GA8A 3KXIA 3P26A 4BEJA 3D3QA 3UPUA 5FOUA 2FWRA 2ZU0C 1COWD 2WBLC 3CF6R 4DSNA 3BE4A 5C4MA 3MWJA 1N6KA 4JIMA 2GAOA 2ONKA 1OXVA 3GJXC 1YRBA 2GZHA 2XGJA 2WTUA 2P65A 2FF7A 3KTAB 2JLRA 4QGFA 1ZNWA 2GKSA 4L4UA 4E22A 2CL6X 4CEIA 5JZVA 3GLIA 2VP2A 4JLPA 3CUEF 1DO0A 3ASYA 1WCV1 5BN3A 1R6BX 3SNHA 1GSIA 3A8TA 4A6XA 1G8FA 4BFWA 1W7AA 1NY6A 2FNAA 3NBZC 4JLDA 4E03A 5LB4A 3F3YA 3B6EA 3KJIA 4H1VA 1OT3A 5EE5B 1NMZA 3GJ0A 2F1HA 3MJHA 4I1UA 2FFQA 2IYXA 3K9LA 3CBQA 3VFDA 4AKHA 3CX8A 3JZMA 4BRUA 1L4UA 1T91A 3H86A 4UXHA 2V9PA 2QBYB 1PLLA 1P5ZB 2QGNA 4WBSA 4A9AA 2F55A 4I1OA 2BBWA 1G4AE 4EPWA 4B2LA 1NN3A 3IGFA 3HU1A 4BLTA 1ZCAA 4YQFA 3QF4B 2GILA 3SYLA 1XTJA 2W0SA 4AKIA 1W0JD 3KKQA 5LB2A 1AS0A 1XJCA 1IQPA 4MGKR 1Q1BA 2OESA 5IHPA 4NH0A 1P73A 3PG5A 4HZUA 3DHWC 2OAP1 4RZ3A 4Q02A 2ZS8A 1QVRA 3QXSA 4Q21A 4DRZA 3I72A 3AVXA 1SKYB 2VP5A 4WVFA 4JLOA 2QMEA 3TBKA 1KIMA 1OYYA 2ZRCA 1WXQA 4ZDKA 3MAAC 4O25A 4QM7A 1Y63A 4TMTA 5FPHA 4PXAA 5DI3A 1TL7C 3KKPA 1ZIPA 2C03A 1E0SA 3QJYA 4ARZB 3A1TA 2WPDA 4IDHA 4RKEA 2IYYA 3WY9A 1ONBA 2D7CA 1T3SA 3UATA 1P7CA 1DG3A 3MJRA 4JYCA 2C96A 1ESMA 1I2DA 3U4QB 2F1RA 2PCLA 4Q00A 2CEAA 2WMNB 1WF3A 1ZM9A 1ZU5A 5BYJA 4TL8A 4BWYA 1P2TA 3LA6A 4C9BA 1Z3IX 4UNNA 3DMDA 5CDFA 3E5HA 1FNMA 2XOKA 4KHZA 4DIDA 3CRMA 5L3RA 2JLXA 4LBZA 821PA 3D7MA 4LYJA 2QSZA 1QHHA 2G0NA 2GCOB 2NQ2C 4LC1A 4NYMR 3ASZA 4ZCIA 4TMZA 4DSOA 2CVFA 5LPNA 4TMKA 1F2TB 4TLDA 1DEKA 4ZCMA 4HYYA 1S9HA 2PMDA 2J7PA 2Q21A 4JKYA 2ATVA 4A4DA 1OHHA 1LY1A 3PVSA 1F60A 5FBVB 4IEEA 2PL3A 2ERXA 1N3BA 2ZVPX 2GRJA 1M74A 2REBA 3K0EA 4D4MA 2WIAA 5KNCA 2FFHA 1OW3B 2F6RA 2FFAA 5FOXA 2G3YA 3K9NA 1XX6A 3SHWA 4Q1BA 1R8QA 2CHGA 4B71A 2OAQ1 4V0LA 1GL7A 5M04A 2AKAB 1SZPA 4GNKA 5EQTA 1E3MA 4LBVA 1MO3A 4WA7A 4AG5A 2G1KA 4BLQA 4JJZA 1E2MA 3LXXA 4LHYA 2OXRA 5CIQA 2EFHB 3PUYA 1E2PA 3B1XA 3P4XA 3ZD7A 2CK3A 2REXB 1D2NA 1X6VA 2IT1A 2MSCB 3KQUA 3CWQA 4M4SA 4MYUA 2G0TA 2AN9A 4DLXA 4MKFA 4KSBA 2ZRHA 2PJRA 3MWLA 5JHHB 3O47A 2RGCA 4BE7B 2NOAA 1T4GA 4XOIA 4B33A 4GT1A 2CLCX 3LBHA 3SN6A 3ND9A 4QHYA 2V1UA 2DHRA 1CJMA 1KNXA 1R5BA 2KJQA 2WOJA 1XMJA 2QPAA 4CGZA 1XFAA 3UIEA 2AKYA 4KAXA 5GJVC 2V54A 3WMFA 3TIFA 3IHWA 4GRAA 1CXZA 3AKEA 4X8LA 4N0EA 5FPKA 3A1VA 2GWHA 4Z54A 4M1KA 1CKEA 2IUTA 3W90A 2H18A 2YWGA 1FX0B 1W44A 3QEJA 2FG5A 1W5TA 1CR4A 3BFXA 1K8RA 4WIAA 3MGCA 1KI6A 1IHUA 3EZ7A 2CCGA 4DT1A 1U90A 2RKOA 2B8WA 4DDUA 4MRPA 5TARA 1J7KA 4D82A 5HPYB 1YR8A 2ZRDA 3IEVA 2WJYA 3TLXA 2J59A 1HE8B 1Z6GA 2A78A 1G64A 3FHOA 3I8SA 1E79D 5TB5A 1KDPA 2MMGA 2RGXA 1SVWA 3OE7D 1LW7A 2VHCA 4LX0A 4QM6A 1YZKA 4IDOA 5CM9C 4AWXA 4LJ8A 3B9PA 5L8VA 4QXAA 4QJ5A 1IM2A 3QKSB 1HH4A 5JBQA 5EE9A 1E2LA 5G3YA 3TVTA 4KODA 3O8CA 2IWRA 3CZQA 4PPGA 3B1ZA 4GMXA 1P2UA 1COWA 2X2FA 4L15A 1Z0JA 4LYAA 4O2LA 2R8RA 4QNMA 5AJVB 5FTKA 1XD2B 3VX3A 2QAJA 1RIFA 3NWJA 4KFTA 4NE2A 2NG1A 4URYR 1F3OA 4RZ2A 4UNRA 3HJNA 1E2JA 4GZLA 3LQRA 2VF7A 2K5UA 4IEIA 2OT3B 2O8CB 4A15A 3CX6A 4B34A 5JEEA 2A3RA 2GXSA 1NBMA 5KSOA 2OXCA 1W2GA 1T3HA 2MMCA 4RJLA 1P4SA 4GMDA 1Z83A 4BFUA 4P4SA 4PO8A 1US8A 4B44A 3R8CA 2R62A 2MSDB 2ZRBA 2CJWA 1E9RA 1Q1EA 3LWNA 5IRCD 2AWNA 4CF7A 1E9BA 4MDEA 2FE4A 3LNCA 3KJGA 2IEZA 3RYTC 1SVIA 2WAYA 3LFUA 1E4VA 3I1FA 1ZM3A 4CRWB 3L0SA 1OXUA 4JLKA 1U8YA 3ZJYA 3EZ6A 4EPRA 3NDBB 1W1WA 2C78A 4F91B 3QG1A 3LBIA 2D7DA 3SJAA 2VEDA 4DCVA 5DNYB 1WB9A 3R7WB 4ZDWA 3B1VA 4KLNA 3BH7A 2DPXA 1YZQA 4HDOB 1DPFA 1W49A 1E0AA 2HUPA 2B92A 4M9SA 4XIGS 3DM5A 2QT0A 3EG5A 1A5TA 3A4LA 221PA 3C15C 1G20E 2IYLD 1ZD9A 2ZRGA 1WP9A 4TLBA 3CR7A 3PIRA 3RAPR 3AVVA 3EARA 1E98A 3FMIA 1E0KA 2WVJA 4JVNA 1YE8A 1EWRA 4M8NE 2ZRJA 2ZREA 5TY0A 2JLVA 3C41J 1YR6A 2NO9A 3RABA 4W9MC 4BQSA 3LW7A 3PFIA 2PEZA 1KDOA 5GJCA 3CZPA 3GPLA 2H92A 2FX3A 1ZJ6A 4QBFA 5AJZA 2ZROA 3KTAA 3RRYA 2JLYA 4R2HA 1XDBA 3ADBA 4DSUA 4R98A 3GLFE 2FZLA 3U6BA 4N0DA 1RZ3A 4YMSA 1IN7A 3BJIC 2Q9CA 3RRMA 1OH7A 1YU9A 4NYIR 3ZVLA 4YXWD 2KBEA 2DR3A 3EA5A 3ZZ0A 3RWMB 3PQCA 3GJ4A 2WWYA 2QAGB 4BLPA 4KI0A 3CRVA 3T35A 4GBMA 1CR2A 2CMKA 1FUKA 4MGIR 5J4VA 4PSKA 4JYBA 1KI3A 3AUYA 3EIQA 3EIEA 4FWTA 1G17A 2J46A 1G8PA 4OK3A 1Z07A 3GMTA 1G6HA 3C5CA 4XVUA 2QBYA 3DKVA 1UBFA 3GFPA 4EFLA 3QIAA 2H57A 5IDVA 2ZRPA 1OXSC 4DSTA 2Q0HA 1KSFX 3FTQA 4BLRA 3EPKA 3QF4A 3N2IA 4FMCF 4GDFA 3CH4B 1XMVA 3EA0A 5EE3A 5JCZA 5D3QA 1OV4A 2RGEA 5J40A 3A37A 4ZDIA 2ZE6A 4ZO4A 3KFVA 1DAMA 3LRPA 3EZFA 1TQ2A 5CIWA 2EYUA 4B2PA 3DZ8A 2QA5A 1MOZA 2WV9A 4IDQA 1MO4A 3AKCA 2QT1A 1AK2A 3C4JA 1OB2A 5H1YA 2QTHA 4EPVA 3UG6A 1ZNYA 1X3SA 4TSFD 1UDWA 4ARZA 1G3IA 3VKHA 5HCIA 3ND8A 1X86B 2BEKA 2OBNA 1YRAA 2QAGC 2EFGA 5FPSA 4M1YA 3C8UA 3KXKA 2V6IA 4H1UA 4JLVA 4PC1A 4RKFA 4XWAA 1P62B 3U4QA 1SHKA 4ZI3A 1Z0IA 3PENA 2OUKA 5FL7D 2YJTD 1SVOA 5AJWA 1ZC3A 1FL9A 3T1OA 4C0SA 4P3YA 1PUIA 5L3QB 4X8OA 3QEOA 3WHKA 1BS1A 5KNDA 2I1QA 4P4TA 2PX0A 1RRFA 4AURA 1EG7A 3HP1A 3IBGA 5TVKA 4KO8A 4AG6A 5J5CA 4B35A 1FFHA 2F9LA 2JJ8A 1QHGA 1VYTA 3TJZA 1IY1A 3L0OA 2GCOA 3CLVA 1EFRD 4A0RA 4RY2A 4LY6A 1MH1A 1Z08A 1D6JA 1ZUHA 3EZ9A 2GTPA 1F2TA 2VSXA 2YV5A 3THYB 1N6IA 2GJAA 3EWSA 4US0R 3KXLA 4B3DA 1RRGA 1YHNA 2ZR9A 3BIFA 4PSVA 2ANCA 1XXHB 3EIHA 2OCPA 1CTQA 3D6TB 4TYPA 5L3SA 3VNUA 1ZCBA 3GLGB 3EPLA 2IC5A 3K0CC 1DG1G 4WXPA 1DELA 3QSYA 5P21A 4TL9A 3OIYA 3QPUA 5HE8A 1VCMA 2YWEA 1E79A 4B3FX 4LV8B 3OE7A 4HAYA 3QKTA 621PA 1ZAKA 2D4HA 2YC4C 4O0MA 2UZIR 4Q1FA 1Z0AA 1KO1A 4CEJB 1MO5A 4R2IA 4UXIA 1JNYA 1GP2A 4ASUD 2ZR7A 5DYGA 4NCNA 4C4PA 1IN4A 2B8TA 2IYVA 5KPJA 3U5ZB 1LF0A 4RFSB 2XZOA 3A6PC 4PX9A 4BLOA 4UQOA 3MG9A 2OBLA 4DLYA 1Q1QA 2WWIA 3HYTA 1I2MA 1ZIOA 4KJZA 4PQRA 1AZTA 3MWYW 3X2SA 3B7GA 2VP0A 3TK1A 1XMSA 1PVOA 5C46F 3VR5A 2ZS7A 5BN5A 1SULA 3BB1A 3LVQE 3WMEA 1HA3A 2EQBA 3SOPA 4DB4A 4PHHA 1OFHA 5UKDA 2HF9A 2XZPA 3W5IA 5FL3A 1CIPA 1G21E 3NKVA 1NG9A 4I1VA 3QXJA 1CF4A 2UVQA 3U44B 5HE9A 2GXQA 1AGRA 1GNQA 3PEYA 2RH5A 4MITA 1AS3A 2ZYUX 2H17A 3DMNA 2BM0A 2WSSD 4K81B 1FX0A 5HZKA 1YZNA 4AIIA 1Z06A 1RRCA 4BFYA 3GEIA 5GJBA 1CEEA 1Z2AA 2LKDA 3WMGA 1ZBDA 2KBFA 1DAIA 4LJ7A 5DLQC 4A6PA 1Z22A 4LJYA 4MH0R 1TAGA 1YKSA 3B82A 4JLNA 4N1AA 2HJVA 3WYGA 2DFNA 2RGGA 3WBJA 1YZLA 2FOLA 2DCUA 4TYYA 4Q1EA 1E2KA 2J1LA 3QVVA 4V0KA 1DVRA 1KJZA 4D81A 3CRRA 3FHCB 3QKSA 3VMFA 1S1MA 1FUUA 1PLJA 1T0HB 3B13B 4Q4LA 3KQKA 1JJ7A 4L9WA 4PAMA 2G9NA 3IBYA 1TQ4A 1XD2A 2BC9A 1OH8A 2ZRKA 1E9CA 1SXJB 2AHOA 2VSFA 2OFWA 1NI3A 4WXRA 4KYIB 4Z1MD 2BBOA 3QNUA 3W6OA 1KI6B 1P2SA 4D4JA 3UK6A 2O8EB 4LC0A 2O8CA 1KY2A 2ZTSA 5DIFA 2IHBA 2PT5A 3NEYA 3ETLA 2ZI3A 1KKMA 3Q8XB 1AM4D 3WRXC 2WWHA 4YXWA 4G5RA 1DAKA 4L9SA 3IILA 2QGZA 4NCIA 1KSHA 3TR0A 3HYRA 3KQNA 1GKYA 2NGRA 3X1DA 2YHSA 2EVWX 4TZ0A 1ZYUA 1Q12A 2WICA 1Z6TA 2WM9B 3FWYA 2NPFA 2OFXA 3VR1A 2JLZA 3PCRB 2FV8A 2J0VA 3SEAA 3CH5A 3CF2A 3TR5A 1NG1A 1W2HA 4IOMA 2W6JD 4LGMA 4PZLA 1PV4A 2ZAOA 4TYWA 4TQUS 5KOYA 5G53C 2J0QA 1EFCA 2WAXA 5FTNA 2B21A 5JWOA 4QHTA 3R7WA 4PAQA 5DO9A 3T5GA 4DLRA 1CJKC 1S8FA 3KZ1E 2Q3FA 3NC1C 5CITA 2ZRLA 3K1JA 3CX7A 4OQXA 1SXJC 4OHYA 2ZIAA 2R9VA 1H8ED 2ZAMA 1P3JA 5BYKA 2J9RA 2A5YB 2XTMA 2ZU6A 2CJWB 4KV9A 4MYCA 5EJEA 2YNMA 2C77A 2XXAB 2FMXA 2DFLA 4HAUA 3CPJB 3U7GA 1S0UA 3IO3A 5CB8A 5FH9A 5F98A 1OLOA 5JFGA 4Z8YA 1KKLA 1LV7A 1NBME 1S3SA 1SXJD 5E95A 3RRZA 721PA 1U94A 2YKGA 1E4YA 4O2RA 1MRSA 4TSFA 1E2FA 3B5JA 1CR1A 3QKUA 4V0NA 5JEDA 1EX7A 1P60A 2O0HA 4ITRC 4JVLA 1A1VA 2VQSA 2V6JA 4Q4HB 1KYIA 1HE1C 3TW4A 4DDVA 2R65A 1KI7A 1HYQA 3L43A 2WJIA 4RZXA 4BRWA 2PEYA 3AVQA 2X1VA 5DN6D 3T12A 2RGBA 3GLHE 3HPQA 3U3MA 1T0JB 4XWKA 2PZEA 3MFYA 4DCTA 5FL7A 2DFKB 3LO5A 2QAGA 1D5CA 3A1SA 3DOEA 4PR0A 5EE0A 4BFVA 2ZSEA 2RMKA 2ORWA 4JT2A 3H2YA 1HQYE 3IDQA 3KL4A 5JI2E 5H8WA 2IYRA 3THXB 4TQ9A 4B6FA 1DE0A 4B2IA 3LV8A 4NMMA 4PHGA 4QRHA 4M9QA 1EFRA 2JJ1A 1UM8A 1N6LA 1OH6A 4UJ3A 5B58C 5EP1A 1N0WA 2Q9AA 1RC8A 1XU4A 5FR1A 3TQCA 3REGA 2F9MA 4C0BA 1G5RA 1Q1ZA 4JBXA 3WNDA 1G19A 3OEHD 3OESA 1JR3E 4HZIA 3ONWA 4B48A 2AK2A 1G6OA 4A0FA 4MGZR 4U02A 4V0MA 2HV8A 2DYKA 3EXAA 1U0LA 1JAHA 2CLSA 2D06A 2ZJ5A 1IAQA 2OV2A 2NO1A 3FMPB 3RRNA 1AKEA 4A8JB 1QHNA 4IVRA 4LOAA 5TV2A 3CRQA 2HCBA 2ASEA 1AGPA 2BIFA 3M6AA 1NVWQ 2HYIC 1I4TD 3TQFA 5IK2D 1RW4A 1NVVQ 2PX3A 1GRNA 4D0NA 1TUEA 1E1RD 3K0CA 4PHFA 4ASUA 3TAHA 1ZM4A 1TU3A 4URZR 5CYPA 1NMYA 1GILA 1E2NA 2ZVQX 3I3SR 4L16A 2EWWA 1TF5A 1W4CA 5FOTA 1Q0UA 1MO6A 1YZUA 1LNZA 2JEOA 4MKHA 1I4LD 5LD2B 1XWIA 5GVRA 5L3QA 4JSTA 1KI2A 2WKRA 5AWFC 4LWZA 1QDEA 4Z8XA 2CE2X 2GAAA 1WQ1R 3AKYA 2JLUA 4CDGA 5K8IA 1ZW6A 1G3RA 1QVAA 4ZPXA 121PA 2IL1A 3AP2A 2HLDD 2DY1A 2GCPA 4ACBA 2W83A 3VHXA 1UKVY 4LYHA 4P4UA 4C30A 2H5EA 4JSYA 5A4JA 1SVSA 2Q3MA 2XX3A 4KYUA 4JVSB 3GJ5A 3KB2A 2J87A 3TNFA 1W0KA 3THYA 4KITB 1J8YF 2ZYWX 5E3HA 4A8JC 4GOKA 2ZYTX 4NYMQ 2WSSA 2GJ8A 5B64A 2IHYA 2CXXA 1XXHA 3PUZA 4G5QA 1CS4C 3W9YA 2GZAA 4LBWA 3X1WA 3GLGA 3HU2A 2GK6A 4MQBA 2WJJA 3ZS8A 3T1TA 5F3WB 2GNOA 4II7A 3VTKA 3H0KA 2OZEA 4M9ZA 1M7HA 2ZI5A 4AC9A 2D74A 4OQFA 4LJ5A 1R0ZA 1K6MA 1BIFA 4E09A 2OSBA 2O0KA 2WJGA 2OCBA 5TXGA 4M1SA 4CW7A 3VU9B 5FUXA 3LDAA 3UWOA 3PJRA 3UMSA 5C2JB 3IQWA 1E69A 1XD8A 4Q5IA 1E0JA 3VX4A 2KE5A 1F48A 1NKSA 2LWIA 3I4LA 1FOEB 5GVSA 4NYJQ 3B9QA 4LI0A 5SZIA 1KI8A 1XJ0A 5LD2C 3ECCA 1JR6A 4ESVA 2YVUA 1DAGA 4RFSA 1DAFA 5TDHA 4XSGA 2O8FB 1BH2A 1OF1A 2X77A 3HU3A 5H68A 1KZGB 3R9XA 2F3RA 2ZQ5A 1N0VC 4Z1MA 2BMFA 2YWHA 5L3SB 4AI6A 2IF2A 5IF9A 4PC6A 2AFHE 2HEIA 4QOSA 3QQ5A 4LV5B 1OXXK 1FZQA 3DKPA 5EZ6B 4YMVA 1IXZA 2BMDA 4URVR 4W5WA 3E70C 2R6CA 1KDRA 1XF9A 1CJUC 4C0KA 3U44A 2X19A 3Q7PA 1NVUQ 3MMPA 2R6GA 4EPXA 2JIZD 4PPNA 5DGXA 4JLJA 3M4YA 3GJ3A 4A0GA 4BFSA 2BMJA 1R10A 2GEVA 1NJFA 2FSGA 1UPTA 2AWOA 2W6JA 4NDZA 1XPUA 1T9HA 2OE2A 1G5PA 1A2KC 2PBRA 2P6RA 1CRPA 5DHFA 4MUBA 4BZPA 4DUGD 4I4LA 4BFZA 3LQQA 1O87A 3C7KA 3C5HA 4K8OA 3K0SA 2PMKA 5H70A 3HPRA 4OYHA 2F1JA 1H8EA 2BBSA 1AQUA 1ZD8A 3ADDA 3CNNA 3B8HA 4POAA 1O3YA 3U7EB 1KY3A 4LJ9A 3QY0A 4JL6A 6Q21A 4F93B 5CLLA 2JAQA 2ZUBA 1XD9A 3KUCA 1RYFA 1E2HA 1SXJA 4LSGA 4U7DA 2E9SA 4IDPA 3THWB 4CEHB 3EPJA 2FJUA 2Q3HA 1QG2A 3O8BA 5TMPA 2O8EA 1XTRA 5SZHB 4WAUA 3UKDA 1SHZA 2FGKA 1Z2CA 2C8VA 4OL0A 4MRNA 3AVYA 1NVXQ 2QN6A 3NEJA 2HT6A 2JGNA 4ON9A 4XD7D 5DE3A 4FMDF 3L8YA 5DH9A 1SVKA 1RYHA 5DN6A 4UKDA 1B23P 1L7VC 3AF2A 1KO5A 2NZ8A 4TMXA 1UBEA 2E87A 4D0GA 5EXXA 1D9ZA 4HB4A 4IDNA 1T5IA 3T5DA 5JMTA 4WZAE 2GVZC 4IVQA 2GEDA 4C2TA 3LBNA 1S2MA 3QBTA 4TMWA 4OI1A 4B75A 5B30A 2IXFA 2C95A 1ZUNB 2FFBA 1N2CE 1XZQA 3TSZA 1PLKA 2J7KA 2CL0X 4NTZA 3EASA 5EUQB 4NL4H 4FINA 4KBFA 1EWQA 4Q03A 2YWFA 3OEHA 4YMTA 3KFXA 3R8FA 1L2TA 1ZC4A 3Q72A 4MKIA 2DFTA 1T5LA 1OFIA 1VCNA 4AYXA 1GL6A 1QBKC 3FFBA 2XXAA 1KK0A 4N3NA 1JEEA 1FQKA 3GJ6A 3TUZC 3BBPA 4G5SA 3Q9LA 4JLMA 1G7TA 4OKSA 3VQTA 4EDHA 3NH9A 5F2EA 2ZI6A 5AUNB 2ZETA 2BKUA 2C04A 5JJKA 3FMOB 4Q9HA 3LLMA 1KI1A 1J70A 1E1RA 4MGYR 1LVGA 2N1BA 2BCJQ 2H8KA 1WRBA 3SJBA 1FNNA 2YZ2A 4Q4HA 2FA9A 2REOA 1P9RA 3PV0A 4EPTA 2V7QD 1UAAA 3BB4A 4BASA 4OHVA 1LB1B 2PH1A 1W0JA 2ZI7A 2BVNA 4YMWA 4OI0A 1ZD1A 2ZJYA 1DOAA 1HTWA 1S3GA 4BECA 2IA5A 4B43A 3ICEA 3LH5A 3CKLA 4P33A 4BFXA 1D9XA 3BH0A 2CCJA 3CW2A 1AZSC 2GCNA 2P0EA 4HUTA 3U60B 5FBRB 4B76A 5CYOA 3KKMA 1KK3A 4PQYA 1FTSA 5EXTA 3THXA 1JALA 4LHWA 3P1JA 4WZBE 4BEBA 1NN0A 2HLDA 4F4IA 5FUVA 2VP4A 3GP8A 1E9SA 5JJLA 2C2HA 2F1IA 3B60A 1YJ5A 5JSZB 4KSCA 1CULC 2P6NA 2W2TA 3W5JA 2HYDA 2VYFA 1U9IC 3BS4A 2A5FA 3ZLJA 1VPLA 4B3GA 3FPAA 3MUFA 1N6PA 2V8OA 3PEVA 4Q4AB 3RS4A 3M1IA 3GLFB 1XPOA 2GJ9A 3MRSA 3U2QA 5C18A 4HATA 3SS8A 2GBLC 5AUOB 3SBEA 4D4LA 3X1ZA 1YQTA 3P4YA 2OFOA 3U7FB 3EPHA 4A8JA 4HSEA 1N6RA 3ZGXA 3CB4A 1X1SA 4FCWA 5JS8A 1E2DA 3U3OA 4DB2A 1FMLA 5BN4A 1KK2A 1GIAA 4YMUA 1BO6A 3CWZA 2BEJA 1VCOA 1RFLA 4TN1A 2OM2A 3DOFA 3LVRE 1G18A 5DI9A 4XJXA 4DXAA 5KUTA 4I1SA 4X8MA 5JRZA 3G0HA 1NNEA 4F92B 2B6HA 2Z43A 4B47A 1QF9A 5DSZA 1KK1A 2HCJB 1QHYA 1LS6A 1Z28A 4RD3A 5CM8B 4AKEA 2AK3A 3NH6A 4QBHA 2ATXA 3AV0B 1MKYA 1WA5A 4DEXA 1J90A 4PQFA 4HDCA 3KKOA 1NN1A 2GVDC 4KVAA 1KSGA 4F4CA 3FB4A 1HT2E 2AD5A 4URWR 4ZIRB 4JT4A 4PPQA 3U3JA 3PUVA 2IYZA 4CZ2A 1E9EA 2BCGY 3H1TA 3QKRB 4ZI2A 4MRRA 1TADA 3GLIE 2QM7A 4PZZA 2A5DA 4Y0AA 5BXQC 4I99A 2V1XA 2FSFA 1ZNZA 1U0HC 2JIZA 3BORA 4V0ME 1II9A 2H16A 2DWQA 3SZRA 1GDDA 4QBGB 5HCNA 4PC2A 1UKEA 4NZYA 2ZRNA 4W7SA 4OK5A 2F3TA 4L8GA 3W3ZB 2QEQA 1XCPA 2PZFA 2PJZA 4BFTA 1RKBA 3GEHA 2NO0A 3CO5A 3F0TA 2F43B 3JVUA 4FCVA 2H1LA 4DUGA 2EFEB 2OEPA 3AF4A 3FOZA 4Q9LA 4S2EA 1TMKA 1AJEA 3LD9A 4WOPA 2ZI4A 2NO6A 4WW0A 5EE1A 3RS0A 3BGWA 4TYNA 3K53A 1U0JA 4BGDA 2IX3A 3FFAA 2J0SA 1GWNA 3VU9A 5DYIA 1S9DA 3OAAD 3O8RA 2ZM5A 1KTVA 1VCIA 4Q18A 3VKWA 1NJGA 1UFQA 2R44A 1UBCA 3PXGA 1WBDA 1Q21A 3RVBA 2YOHA 5JRJA 5HTKA 2ZRAA 2O8FA 3CRW1 3OIUA 4NKRA 3RANA 3EC1A 2QY9A 3BD9A 2D2EA 1GKIA 2YINC 2HT1A 2JLWA 2OLJA 3MD0A 1XCMA 3RNLA 1HY3A 1P61B 3SFVA 1ZM2A 4CT5A 4CEJA 5FBLB 3VAAA 2RGNC 4XD7A 1R4AA 2BDTA 5BQ5A 4A82A 3EZ2A 1E1QD 2KSQA 2XNSA 3FKQA 3KB1A 1MRNA 4ZKDA 4GFDA 2RGAA 5F9FA 2A9KA 4MUAA 2XJ4A 4R9UC 2WWXA 4DC9A 2CDNA 1P9NA 1EXMA 3BB3A 4LHZA 2EWVA 1NP6A 1J2JA 1UEJA 4DDTA 1EFTA 1N6HA 5CLQA 4ACAA 1X8JA 5A5GA 2ZUDA 3CPHA 5CDFE 2QP9X 1HEIA 1UADA 4DCSA 3NTUA 4ZDJA 1BMFD 1BYIA 3HR7A 4DZZA 1VG8A 5FFMA 3CPEA 3WBKA 3ZVNA 1A4RA 1YR9A 4TWZA 3DEFA 2NIPA 3AVUA 3BOSA 3B85A 3SHFA 3AP3A 3G82C 4AYTA 4BLSA 4C0LA 4OI4A 5AUPB 3DO6A 2YOFA 3Q5DA 4GOJA 3WP1B 4A1FA 1MT0A 1GITA 4NCHA 4OQNA 3EX7C 2QTFA 2VBCA 4IJMA 3KJEA 1XTSA 4M22A 4KFSA 3THWA 3AM1A 2IS6A 4CEHA 3PEWA 4XWOA 1G7CA 2C99A 3QVUA 1JPNA 1KJWA 1RE0A 3W8NA 3WYFA 5GADl 1ETUA 4RZUA 4G3XA 1T8UA 4GOXA 4NBSA 5K8LA 2FU5C 5K8TA 1AIPA 4X8HA 4B3BA 4UNSA 1IXRC 2V7QA 2VHUA 1MR3F 4MRSA 5CB6A 3REFA 2IYTA 3K8YA 2EYQA 3A1WA 4TTQA 4PFSA 3D31A 3X1XA 4OI2A 1NN5A 1MV5A 2G77B 2J5XA 3SJCA 1TTTA 1OXTA 3IO5A 3SU8A 4Q7MB 4C0AC 1GL9B 3A58B 1ZU4A 3GEEA 4GZMA 2AX4A 5KPDA 2W58A 4OQLA 2DWPA 5FI0B 4IKEA 5KNBA 4URUR 2VL7A 3MSXA 4Z51A 3T15A 2R6DA 3SQXA 1GAJA 2J0UB 2Z6VA 3FYHA 1DARA 2WSMA 1NLFA 1KO4A 3OZXA 2V3CC 2VH5R 3AVTA 3QBVA 4HEJA 5E4FA 4Q47A 2GETA 3EWAA 3C16C 4AY2A 2QQ0A 1U81A 2ZRFA 3I73A 4V03A 3AKDA 5FUWA 2PT7A 2IYSA 4RVCA 1D2MA 2WJHA 1E32A 1CU1A 1AA9A 1IN8A 1AS2A 4M0LA 4US1R 1IY2A 2IYWA 1U9IA 1JXOA 4HAZA 5FOVA 4EJSB 4W5HA 1VG0B 2NZJA 3ZYCA 2GZDA 4AYWA 2G88A 4QHSA 3CR8A 1H8HD 4D6PA 4KCGA 4IXNA 4H9GA 1XJQA 2GJSA 3B2EA 4GI7A 4JLBA 2GBLA 5J4YA 3KKNA 2FPMA 2SHKA 2JJ2D 4JMPA 3I5XA 1VYUA 1XPRA 1F2UB 2FEOA 4DJTA 3NIBA 1JI0A 3BK7A 1K5DA 4PAOA 4DHEA 3AF3A 1QG4A 1KJYA 1R0WA 4RSGA 3GJ8A 3L0PA 4JJKA 4KBGA 2A5JA 5JS7A 1RRPA 1XEFA 4TLAA 1TF2A 2ZSDA 3MCAA 3QPWA 1C1YA 3WYAA 2FZ4A 1R7RA 2A2ZA 2IS2A 2IUUA 1QRAA 2VP6A 3C14C 1Q3TA 2XTZA 2ZJZA 1G7SA 5L3VA 4QBIA 3BRWD 4V0OA 3V4FA 5A0FA 4Q48A 3WXMA 5JSZA 2DB3A 5HZHA 2QTVB 3P32A 4NCKA 5KHOC 1ZVQA 1VKJA 1OKKD 1YVDA 3DZDA 4EJSC 2IXGA 4OBEA 3SE0A 3GLFA 4Q4AA 3IHLA 4NU0A 5ANRB 3VR2A 2AR7A 1KO8A 4DCUA 3ZVRA 4K46A 4DIEA 3ADKA 1IJFA 1V43A 1G7RA 2G1JA 3NBXX 4DBLC 1F6BA 1WDTA 2QRZA 3P27A 3KQLA 2ZSBA 3J81k 2ORIA 3T06B 2JLQA 1G41A 4FI3C 2IS4A 3KX2A 4IHQA 3PUXA 3QOFA 5LBIA 1MABB 1NF3A 3CF0A 1Z29A 3OAAA 1SQ5A 3TSOA 2CNWD 1ZM7A 1R5NA 1U8AA 2X8AA 4EPYA 4R7ZA 2ZUCA 4TTRA 1QHIA 1A7JA 4G01B 4PHTA 3T34A 4BZQA 3Q7QA 2BBTA 2QMUA 3CM0A 3IIKA 3I8XA 4ZCLA 1Z5ZA 2YYZA 2FPKA 2OHFA 2W6ID 5EP2A 4MDFA 1FQJA 2RAPA 4EQ6B 5LDDC 4Q01A 4M2LA 4R71A 4MYHA 4JVMA 1JEDA 4QFMA 1N25A 2GF9A 1OE0A 3AVWA 2FH5B 3UANA 4ZIRA 4S35A 2QL6A 2WIBA 3QKRA 1E1QA 3TRFA 2J3EA 1W4BA 3A4NA 2HXSA 3IIMA 2ODNA 3WNBA 2L0XA 3ZIAD 1NBMD 4Q66C 4A2WA 1GUAA 4DVGA 2W0MA 4RD4A 2RGNA 4LPKA 1ZMXA 3AB3A 3W6PA 1W46A 3U3KA 3QXHA 3QG5A 1X8KA 4JBYA 1R2QA 1VTKA 3TW8B 1IN6A 4HLQB 1NIPA 1NL3A 2QUZA 3OFND 1C9KA 1NKTA 1GG2A 5KSZA 2BHRA 3QUSA 3LAWA 5FBQB 3BWDD 2WWGA 3CNOA 5JWRA 1VIYA 2XNDD 1BMFA 2F43A 3TSWA 3V00A 3I62A 5D3MB 5E7JA 5J4KA 2WKPA 3K0AB 2IK8A 1E9FA 3THOA 4JBWA 1R0XA 2VSOA 2OILA 3IPXA 4QNRA 4URXR 3V4RA 2VRWA 4M1WA 2RB4A 2ZPTX 2QSYA 2IYQA 2IBMA 3EAQA 521PA 1OIXA 2RHMA 2Z5FA 5EP3A 5B57C 1UEIA 3CNLA 2GDJA 3BC1A 4HI0E 3W34A 1GTVA 1YR7A 4O3MA 2KWIA 2DBYA 1SKYE 1GNPA 2ANBA 1KSJA 3WP0A 2RCNA 4FCTA 4C0QC 2C5LA 1GM5A 4QC2A 1NVVR 5GJWC 2Z4RA 1Z6AA 1JR3D 3RSOA 2CHQA 3GCGA 3L82B 1G1MA 4HAXA 2ZI9A 2AFIE 1E9DA 3Q85A 3OF5A 4Q1CA 4U00A 1Q44A 2VO1A 2GJKA 3R20A 1JPJA 4Q4JB 4LV6A 4GL2A 4NPHA 1DAEA 2QP4A 3AF0A 4C7OB 2P67A 4QGGA 3QE0A 3H4MA
chains in the Genus database with same CATH superfamily
3SHTA 3CURA 2EFJA 5FLKA 2VBIA 4B80A 3NVKI 2XAUA 4ODIA 3M4NA 1COZA 2OZLA 2WFLA 4DANA 2NP6A 1GGKA 1SUBA 4G26A 2QMHA 4XRGA 1GPH1 1RPNA 2H9IA 3F6CA 3R9XB 1ODJA 4P3XA 1L4FA 4I4TA 3NHAA 1FTWA 2J3HA 3OFVA 1YUMA 4BC0A 1W59A 2CYAA 2IY7A 2P1DA 3SC2B 3DZKA 1K8QA 1N3LA 1VG9B 2OUIA 2PCJA 4IL5A 5DNEA 3CV3A 1UWVA 3QBJA 4YN3A 5FQOA 2VUHB 3BGSA 4BNXA 4R1LA 3K2QA 3OHPA 4KH1A 1WZUA 2W2LD 3PD0A 1PJTA 2AFHB 5IJ9B 4MVJH 3BL6A 3K4PA 4MV6A 4Y2QA 1UMDA 5IAAA 3OTWA 1ZUIA 2EFYA 5ICSA 1C7IA 2IW3A 4F3KA 4KXNA 4LJ6A 1BH6A 3WL3A 4ZV4A 2Z4SA 2DECA 3E3OA 4U5QA 3WFIA 3ASVA 1CPYA 2ZS9A 3OF2A 1UZMA 2XNCA 4OBXA 1JE1A 4DLWA 3PIDA 4EOGA 4NG4A 1X7HA 4FLFA 1YZGA 1AUPA 4BV3A 2G83A 1FRNA 1Q74A 1A7UA 2BJHA 3ONFA 4PO3X 1KJJA 4V3BA 5K0NA 1UP6A 1RJWA 2Q9BA 2WFZA 2PH5A 3PRJA 4GX1A 3VKVA 4BB5A 3C5WP 1QXSA 2PX5A 1JZQA 3D7RA 3L7AA 5AJXA 1K0FA 1W73A 3IB6A 2VQ6A 4MKGA 3O38A 4AXXA 4RHFA 4F12A 2OM6A 3LWDA 8ADHA 2C9OA 2Q07A 4BMNA 3TBHA 3B6KA 3R2JA 4DA6A 4EA7A 4WOBA 5KCZA 4YP7A 2V98A 3TUIC 1CEXA 3LGAA 2PUEA 1MB4A 2PKXA 1U5AA 2OBMA 3TQOA 4D7AA 4D80A 3LZ6A 1NLYA 2Q9UA 2QYHA 5LP6B 1H4QA 3BICA 4BPBA 3IE0A 3WLTA 4ZMSA 4K9NA 2R4TA 1II0A 3J80A 3RCBA 1EFAA 1TE2A 1ACLA 2V96A 1ORDA 1XZ8A 1DT5A 1LVHA 1FU8A 3LY5A 4YUWA 3T5BA 1ZINA 3BRWA 4TV8A 4ZVTA 3PLAE 3ZQ4A 4HUQB 4KO1S 4R9RA 5IAKA 2EW1A 2OHJA 5JXIA 2ZWMA 1UBHS 4XPIB 2I6SA 3RVLA 2XKJE 1Z4JA 4QUBA 4YP5A 4A8HA 1OKKA 3GAZA 3H8JA 3OOWA 5FJJA 1YMQA 2OBYA 1DCTA 3ESBA 4PRZA 4R3UC 3RI3A 3E3LA 2FRVA 2FYTA 3IBTA 2C2ZA 3N70A 1S96A 4DIUA 2HNBA 3JVVA 1ILWA 1VP9A 2NTYC 2R5WA 3RD5A 3ROPA 2XYVA 3H9JA 2Y0DA 1QF6A 5B1DA 1TC1A 1TC2A 2OHVA 3H1FA 2GKGA 5DNAA 2FVXA 1K97A 1M2WA 3A4MA 4CM8B 3AGPA 1EI9A 1G6Q1 1N8TA 1G8GA 3KUXA 4EJSA 1II8B 1Q92A 2JPDA 4LYGA 4WZAB 1DBWA 5AI0A 3ETGA 4QYMA 3BFVA 2BEWB 2ISQA 1I24A 3IKVA 3KZNA 2VDWB 1I1HA 4D25A 2QM0A 1KJIA 3CG4A 3IP6A 1B93A 4KPUB 4KDRA 4OHXA 4W8GA 5LP6C 2VZ9A 2SICE 3AVOA 2FZCA 1QPGA 1XTQA 2XEDA 3FG9A 3KSRA 2HIAA 2QTRA 3CXUA 4B17A 3ONNA 4G1MB 1IM8A 3Q7IA 5DP1A 1D6SA 4ABYA 4QPJC 4TL7A 3BVPA 1RAIA 2O3TA 2I0FA 3TTTA 1TM7E 3OLQA 4Y0VA 2QX8A 2P27A 4BP9A 1RM5A 4WESB 3HJBA 4O63O 4RXTA 2YC2C 1SCJA 3P20A 4DJDC 1Q17A 1RBQA 3G68A 1C4OA 3OTQA 2FY8A 1M8PA 1NDHA 2HTFA 4JX9A 4UXJA 4HR7A 2C42A 4PC7A 4ZXPA 2IP4A 5TQ0A 2E1PA 2WRZA 3KZMA 3W79A 5LQAA 3EDQA 3WX0A 3L4BA 4Q7KA 2WTXA 3GW8A 2AXEA 3SQWA 2R7NA 1A4IA 3HBMA 1CP2A 5FV4A 1O0SA 1FXUA 3A1UA 1ZICA 3HCOA 1E1DA 3L7LA 1QCCA 1QH0A 2V6FA 3P52A 5IK2A 4PO1A 5A4KA 3S2IA 3S28A 5J47A 1VB5A 2FUG1 3CLRC 3Q3GE 5HDBB 1UDBA 2O2GA 3DVSX 4G5YA 4R9VA 2XUQA 3COSA 3MF4A 2H1WA 4CM6A 2IUSA 3WGIA 4FVTA 1GQYA 2VRCD 4HB0A 4E5MA 3OFNA 1YB2A 2TRSB 3DG9A 3P71T 2J6HA 3OP4A 1VDZA 1HYGA 4LNUB 1Z63A 1SVMA 3RWOA 1YIDA 1PR3A 3CLRD 2POQX 2YBDA 1FP6A 1R18A 2NSJA 3C3JA 3IUYA 1J24A 4JLAA 4Q7JB 4EH1A 5BW8A 1YAJA 1IONA 1XTBA 3B1YA 2BHSA 1TTPB 2H5LA 2HCFA 2WW8A 3ELYA 3HE3A 4LRQA 4NYIQ 4RHTA 3R3YA 1ESNA 4K28A 3SZUA 1H0KA 1TEVA 3Q6NA 1T8WA 4J0KA 3E3AA 4M1OA 5HOEA 5HTOA 10MHA 1JG7A 4UNQA 3VV3A 3DBRA 1NW3A 1CUJA 3VR4D 4RD6A 2GS9A 3KXPA 4A23A 3VDNB 1FNSA 1HFEL 3BXGA 1QE5A 1Y3AA 4INAA 3UXMA 4A92A 2V0GA 4OLJA 1FDWA 3WGLA 1JBKA 3OCCA 1RRMA 2GF0A 4OAPA 4X63A 2QMOA 4KQEA 1U8CB 3CS3A 3EXFB 4JZYA 3VU0A 4EKDA 3FH0A 1JXMA 2WU0A 1L8QA 5BSEA 1KXJA 3IQGX 1KQ3A 4WLEA 4BX0A 4QL3A 4EQ6A 4BCBA 1M7BA 3H17A 4X44A 1E5DA 3UJBA 5KWIA 3W04A 3W3AH 5IVIA 4U7JA 2P8SA 3DEAA 4KYTA 5F52A 3E1SA 1X1CA 2IEGA 3OP1A 4OLFA 1DIAA 3FBWA 4Z7OB 4D56A 3BXFA 1NUHA 4W1QA 5EHGA 1OGIA 5HGXA 2VK2A 3OU7A 3O2NA 2XMGA 4XFJA 1KMHB 2N9UA 1LDYA 3DYBA 4LW8A 4CM4B 2IYFA 4OJKA 1UC9A 2GESA 1HO3A 5EXEA 2O20A 5I6DA 1BRTA 2RHTA 4R4JA 4URHA 1PJRA 2QXTA 3JQQA 1REQA 2HO4A 2YRWA 3HR8A 1YU6A 2WKQA 3IEPA 1QGDA 3UWSA 3DAOA 3O1JC 2FN4A 4B81A 2XVMA 3F5SA 2FKNA 1P7YA 1DAHA 2WMYA 3MJFA 2GFIA 4PG6A 2QYSA 4MVJP 3RC3A 2W7TA 2YWJA 5A62A 1YZYA 4B3CA 2PRZA 3CWCA 4K6CA 1JHZA 4RPGA 4ZKEA 3ONEA 3HJHA 3QJGA 3CISA 3TUJC 1O8BA 4D2IA 2NU8A 3GEMA 5CNIA 4PXYA 3LRXA 1S4QA 1KAOA 3T7KA 3RG2A 1QHXA 2PLFA 1I7NA 1LU9A 2W2LA 3IB3A 3AESB 4FGJA 2EJVA 1LQ2A 3TE6A 4J3JA 3VPGA 1IEVA 3KDSE 4P81A 1R0KA 4WNAA 5E6SB 2X0IA 1E2GA 4PR3A 2ODWA 3D3JA 2PSJA 3HB7A 1Z0SA 3ZDAA 4D8YA 1GG8A 3FA2A 3VSAA 4RD2A 3ZHXA 1TT7A 4DWJA 1TRKA 4PZEA 1EK1A 3GDOA 5AM3A 3T3NA 1T8TA 3EHDA 5KBYA 2NUAB 3W8DA 1KNQA 4MVJG 2BM1A 3HUEA 1DJPA 1N0HA 1TQDA 2JGLA 3L7BA 4KE9A 2X2EA 3VX3A 4MLDA 5LMZA 3DHEA 4G1FA 3T3OA 1PP4A 2QUHA 2Q6VA 2I78A 3N3AC 3SPXA 5HUJA 5TPZD 4CHTA 1XQ6A 2YWCA 2RHGB 1PFVA 1ZPDA 3PGVA 4G0WA 1BMQA 5FNVF 4IRUB 3ADCA 1R6XA 4UMVA 2VLIA 3VR3D 2B83A 2BSXA 4YC7A 2XZLA 1RAHA 3A9TA 4FNOA 3JASA 2PWYA 1XLWA 5HVNA 2J0EA 4BLWA 2QENA 1LTKA 3LT5A 3GO4A 4IV0A 3L4EA 3IJPA 4R8SA 5H02A 2CDAA 1OIWA 1Z74A 3LLCA 4FXPA 5E0OA 5H59A 3AFMA 3AWIA 4IOLA 5LYYA 2X7JA 2X0EA 2IE8A 4AKTA 1JPVA 3N8HA 2IXEA 3DEYX 3N5CA 3OKFA 3OQ1A 4HGZA 1LH0A 1N2IA 2O1EA 2ONYA 2V55B 2VZEA 1W5SA 3OEED 3R9XA 2GZ3A 4HZUB 1OROA 3TPZA 4DLBA 1I4WA 5KMGB 1H2YA 5HEKA 4RSHA 4IW3B 1MMFB 3E22B 3KWLA 3N2EA 1WULS 5IKOA 4PTLA 1Y3CE 1HBJA 1JXQA 2ZE8A 4QVKA 3SC2A 3T61A 4Z6KA 3K70B 3HDTA 3NRJA 4OJMX 4XI9A 1P17A 2ZP1A 2QD3A 2VYND 1PR2A 3DNPA 3AF1A 3E2MA 3L7OA 1JIUA 2ZRMA 2JCSA 1PUXA 1NIJA 1NSTA 5KWVA 1SM4A 2AFHA 3V2GA 5IJ9A 1SKQA 4HTAA 1PS9A 3NXKA 1GZVA 5CGZA 1GNRA 4XQCA 4KPFC 1RLOA 5JDIC 3DQQA 3GFOA 4P5EA 4L72A 2FSHA 3MWDB 1THGA 4K2HA 4PPFA 2CNLA 421PA 2ORED 3ZS9A 1XTZA 1T9AA 3U3XA 1H1LB 3WBFA 3AQIA 2BH2A 2VK8A 3S70A 2JBWA 3LX8A 4P34A 4B7AA 1WD5A 1UBGA 4OK6A 1B8OA 4O1HA 4Q1AA 3AUXA 1DKMA 3I37X 3NEPX 1P1KA 1DINA 1C8KA 4GBED 2QG6A 4MHSA 4M9XA 5AI4A 3O7WA 4AN4A 4WY5A 3B3QA 3L9WA 1R9MA 1I0LA 3OT4A 5BWMA 2H63A 2WR8A 4FC6A 2LW7A 4WWHA 4YECA 1VOTA 4CQMB 3N0XA 2BEVB 2V7VA 3HJFA 1Y6FA 5A3RA 5JY1A 5ITSA 3AHDA 4B6GA 1K63A 4RZHA 1QPBA 1E99A 1K06A 2YHAA 3KEGA 1ZMOA 3ELWA 3BDAA 5EP4A 5F64A 1EESA 1R64A 4HF7A 5EY5B 3TE7A 5LP6A 1MAHA 1PFUA 1Z0KA 1MU0A 1JKIA 1ZN9A 3K70C 3PTZA 3L02A 5EJ5A 1RQRA 1JWAB 3T7JA 3ZQJA 5J2TB 3QW2A 3DNFA 3Q5GA 4M53A 4UVGA 1FRQA 4HS4A 5DK4A 1XT6A 5BNFA 2PRSA 4JJEA 3IPLA 2P6UA 1JAZA 2FSIA 3ILXA 4FOOA 4OU5A 4HUQA 2CCKA 4KEAA 3LT4A 1Z7EA 4OQQA 1TKBA 1XMQB 3BWBA 3K70D 4PV7A 4XPIA 1MHPA 2FUCA 1GLGA 1MGOA 4J9VA 1XA4A 3UOGA 4B32A 5K8JB 1AV6A 3IAM1 3CN9A 2ZYVX 3EMKA 1DC4A 2VRCA 4WZ6A 3UUEA 1ZK3A 3DE0X 1KMCA 1SXHA 3MJVA 4H4CA 3NI2A 4KH0A 4L4ZA 1I13A 4DNPA 5ELXA 1S2OA 3GRVA 4ZQGA 4HB2A 3L8EA 2WHRA 3TH5A 4DEYA 1P0IA 1W0KD 2PA0A 3LQ4A 5AVZA 4UBJA 3M1LA 4YX9A 1F3LA 3BH6A 2A9FA 1OTHA 3QPVA 4JOSA 3S55A 2QN1A 3O2JA 4MWZA 4CM8A 4F38A 1BZYA 1II8A 1OLSB 2WMDA 4WZAA 1B0UA 2XQIA 4GQBA 1E2EA 1TJPB 1UPUA 2PL9A 4MB0A 4Q34A 4IX9A 3HEBA 3TZKA 1QYIA 2BEWA 4M7WA 1QYRA 2VDWA 3VR4A 8GPBA 3BK2A 4B9AA 1YL5A 4TMVA 1E18A 3HL0A 4KPUA 2XA2A 3A25A 4WY8A 3C1OA 3T9FA 5LP1A 3BAFA 3W5DA 3GAAA 4CQMD 3ZJTA 3ICQB 5AQEA 1DS6A 3OPYB 3Q2IA 3SLKA 2I71A 3TPCA 4BP1A 3F4LA 2W2KB 1NFQA 2VPZA 3GCWA 2FMFA 4MR8B 3IQXA 3DKIA 3NIWA 4WCFB 3FGZA 4I1RA 3GMSA 4WESA 5CLFA 4MUJA 2GLUA 5COAA 4MEBA 2Q62A 1LLCA 1KH2A 1XRJA 4RFVA 3PR1A 1SXJE 4LOKA 3A6HA 3HZHA 1N0UA 1SCUB 4RCYA 4M21A 4FMBB 1KP2A 5T64A 2E48A 3Q87B 4Z4GA 4WOKA 1MA3A 1P1JA 2FWJA 3HDVA 4B7UA 4O1IA 4CF3A 5FJIA 4F4JA 4Q7LA 1XTTA 1Z17A 3GJ7A 3KPYA 3ZZUA 5KNCD 2FWAA 4WQMA 1GKUB 2JHAA 2ECKA 3CFYA 3AEZA 4PM4A 5CLIA 4EMBA 2FDCA 2XQVA 5IT5A 3BQ9A 2BOVA 3SE7A 5CJJA 4Q19A 4ND5A 1BYUA 3FOEC 1PJ3A 1JV2B 5JATA 2I62A 2LCFA 4MKXA 1OZAA 1NP3A 2LDXA 3FN4A 1LJLA 2VHXA 4D9EA 4RSRA 1QLHA 3IEKA 1YK1A 2UKDA 3QLVC 4K8RB 4WDRA 1CERA 2CD7A 3TB4A 2W8ZA 1YS9A 1HT3A 2X58A 3N0WA 3EDYA 2CK3D 4LNUA 3AH8A 2HUNA 1PGNA 4KP7A 3MINB 1XP8A 1Q83A 3AVPA 3CT4A 1UBRS 3VKGA 4DBLE 1O9GA 2HXYA 2RK6A 4J1NA 1GKLA 1DDGA 2G9UA 1FMJA 3OQ6A 2Y6UA 4NDAA 3FPBA 3MRVA 1DHRA 3W2TA 2PTGA 1BU8A 3K6KA 4U0KA 4XH9B 4A36A 1GUDA 2FZEA 1UKYA 2HHAA 5HF5A 4B6EA 4OQMA 4WCFC 5AI6A 5KYNA 3OZWA 3UMBA 3U6KA 1AKYA 1HDCA 1TLTA 4LMRA 1D2EA 3H1PA 1GG5A 3VPCA 3WGHA 3C3WA 1U2DC 2J5QA 1W5EA 4G8CA 5HZMA 1QOQB 4MQ6A 1Q91A 4QZVA 1US8B 1QHSA 1IHOA 4MYDA 4LZZA 5A2GA 3EXFA 2AOWA 2AJTA 1E96A 1PT6A 1RCTE 3A6JA 3ONVA 4FWIB 4B0PA 4CLRB 1CR0A 2ZBUA 3EF1A 4R69A 3ZWAA 5K0BA 4YAKA 1RQXA 2P4QA 2ZWPA 4RKYA 2ZE5A 3GLHB 4UZFA 4BNKA 4ZZ3A 3R9KA 4TQGA 2QW0X 3VR3A 4IMJB 4PGMA 2C8KA 2HSWA 2YV1A 4D6YA 1GV1A 1E3LA 3KE9A 3PQFA 3SBDA 1KMQA 2HWXA 1KMHA 1GSHA 1WBBA 5ICEA 3AIOA 2FWNA 1KS2A 3NVAA 1Z4LA 1GQOA 3ZV4A 4TL6A 2B7BA 4EABA 3KELA 4ZAWA 2PZMA 4EG5A 3GG9A 2SECE 1Y7LA 3WTCA 1FFBA 1WXGA 4PYRA 1TCBA 3HFSA 3OEEA 1JMVA 1NY5A 2YXBA 1B26A 4IYRA 3LW8A 4JC8A 4P7FA 4JQSA 2F64A 2GA8A 4LFBB 3KXIA 3P26A 3UQYS 1IH8A 4UEQA 4UTRA 3TNLA 3ZNOA 1BE0A 3M2TA 5FOUA 4GHWA 3VV2A 4E70A 1COWD 1VLQA 2WBLC 2IYOA 4LRXA 2VYNA 1Q0QA 4KGXA 3WK6A 2BZGA 4EHJA 3UPTA 1KFBB 3VTAA 1OXVA 2GZHA 3AESA 1R3DA 2XGJA 2RD2A 1E60A 1ZESA 1AURA 3MN1A 5IUNC 3AX6A 2R47A 2JLRA 4Y1RB 2WD7B 5E6SA 2J48A 2W4QA 5FF9A 2O5EA 1I30A 1LX6A 4FFMA 5JZVA 1IHDA 3GV0A 3IRUA 5JH7F 5CYGA 3AR6A 1CIJA 1PL6A 2HMAA 3GPCA 5TQVA 4E03A 1J42A 2H9AA 3G5AA 2NUAA 3S0JA 4QBKA 1FFSA 1ULBA 3B6EA 3I30X 3SYRA 3NT2A 3W2IA 5JDIA 3SZ3A 1M1NB 3M8KA 2PRKA 3OJ0A 4FPXA 1ZWKA 1OT3A 5EE5B 5M3BA 4GVPA 1T36B 1L6RA 3WL4A 2WUDA 1IY9A 3OOYA 1TO1E 1L5VA 5JNRA 3MVEA 1UPXA 3CBQA 3VFDA 2OLEA 4AKHA 2R4QA 2B0JA 3CX8A 1Y9AA 4XARA 3JZMA 4RVUA 1ZMTA 4Y9RA 5A7HA 4B79A 1BE1A 2B99A 2XXJA 4CMKA 1L4UA 5U9CA 2RB5A 1HOXA 1UANA 3OX4A 4MIEA 2ZIXB 3T3IA 4E94A 3R40A 1PLLA 1P5ZB 2AV6A 2QGNA 5JQGF 3ZU3A 1PJ8A 3UNXA 1G4AE 3ABSB 1FNCA 2HB6A 4WKOA 1PSWA 2XYHA 3IGFA 4QATA 4ZOQI 4YQFA 1T15A 3SYLA 1XTJA 1LCIA 2ZUTA 1LBTA 4KR7A 4AKIA 3HI4A 1W0JD 3PNOA 1KRHA 5LB2A 4RORA 4UEOA 5IHPA 3R7AA 2OESA 4NH0A 1QIHA 4UC0A 3ZCPA 4HZUA 2A3NA 5KMGA 4DRZA 2XNJA 4PZ9A 4H18A 3VNRA 1CUSA 1DWQA 1N1MA 3E22A 1DIOB 1XKXA 5E9QA 3MPUA 2DPHA 3F9CA 4F8JA 5C37A 1Z4KA 3MTGA 1FDSA 4ZCQA 1P80A 1OYYA 2MCFA 1PSDA 2ZRCA 4EEZA 4X5OA 1WXQA 1C2TA 3AU8A 4O25A 4FUQA 5CA1B 2VDQB 5FPHA 5K0CA 1C0IA 3Q15C 1HNXB 1OBVA 1NUQA 1TL7C 3BJRA 4FGLA 1JIKA 3DE3X 2AFIB 3B3FA 5IAGA 2C03A 3QQPA 1LX7A 4BY9E 1LC0A 1M33A 3FW1A 1Y5IA 2PBZA 2IYYA 1R9JA 4QJBA 5CNKA 2D7CA 4LNAA 4A8TA 1EE1A 5AW9A 1T3SA 3MWDA 4DR1B 4OO3A 1T4MA 4B2YA 5D5HA 2EC5A 1XYGA 1I9CA 2AFVA 3ESQA 4JYCA 4N5LA 2QTTA 1H1LA 4W1SA 5SYAA 1BGVA 2GLTA 2I2WA 5H80A 4BO4A 3CVVA 4R2XA 4UHHA 5DM2A 3CUYA 2VUSA 4LJKA 1DT3A 2ONZA 3RC9A 3E53A 1ZM9A 2PD4A 2A0UA 4NCBA 4GOND 5FEUA 1U9CA 2VDMB 1TECE 1Y6RA 1P2TA 1XRPA 1GVHA 2WLSA 3KPVA 5AESA 1AH2A 4RELA 3LI2A 4CQMA 2OAEA 4KHZA 4CUKA 2BEVA 2IJGX 3CKYA 1RYZA 5U4XA 4LBZA 1C7QA 1OFUA 1T9DA 1TZ2A 1ZIDA 3D7MA 3GEPA 4LVNA 2NQ2C 4NYMR 3AUSA 5JAUA 3HA2A 5DRYA 1GTRA 4TMZA 1YFJA 1E6UA 1Q0PA 4M1QA 4TMKA 1F2TB 5B2EA 3JZDA 5B4UA 4TLDA 3O82A 4ZCMA 4YAIA 1EZZA 4NVRA 4LF9B 1TJ5A 4KO3S 1OX4B 1L8LA 1U02A 3L1UA 1U1EA 1RXYA 3GOQA 4GM0A 1OI2A 4MCHA 5J2TA 4IEEA 2O0MA 2WYOA 2H8GA 2X40A 2GRJA 2A0WA 1LPNA 2HPAA 1HSZA 4RESA 4YO8A 4C5AA 5KNCA 1BXKA 3K9NA 4ADSG 2Q4OA 2ZT7A 4ONEA 3SHWA 3ZHSA 1CRZA 2VTDA 4BWGA 2OAQ1 3NCHA 2G1UA 3ZKWB 4FI3F 5LYJF 2HRQA 1GL7A 1TIKA 3NP9A 1QFSA 4XCXA 4UUMA 3ZBTA 1TAHA 2NU7B 1KOJA 4ZOLB 4DKJA 1UDAA 1TCCA 1XFDA 4JI0B 4DM3A 1QFZA 2B5WA 4N0QA 4ZI5A 4AG5A 1BTOA 1E2MA 1QHEA 4LHYA 4QPZA 1RHKA 2WUVA 5ELLA 2ICAA 4BB9A 2HL6A 3EZNA 1E2PA 3GFSA 3PCXA 3PUYA 3B1XA 4V2UA 2CK3A 2XB6A 4AYXA 1WUTA 3JU3A 4IG4A 1X6VA 1M34B 2B1IA 4JP5A 1T3TA 2CB9A 3CWQA 4X62B 4M4SA 2AN9A 2IP1A 4RVSA 4MKFA 2ATEA 1OLSA 3WAKA 1EU1A 2ZRHA 5CFQA 4FYWA 4PCLA 1SHLA 2O3SA 5JHHB 1YZVA 3OEWA 3QLVA 4QQ8A 3FWKA 4W82A 4D9NA 5B5SA 3F47A 3OLCX 2OBFA 4YT5A 1PT7A 1A72A 3LBHA 1QUEA 2QL5A 4MQUA 3KJXA 2V1UA 2DHRA 5CBPB 5KNDD 4JN6B 1E1CB 3FNFA 2GCGA 3ETJA 2KJQA 1Y5LA 3HDJA 1MHTA 1GAQA 4AO7A 4QT4A 3OPYA 4F0JA 1U3CA 4KAXA 2W2KA 3DR3A 3A06A 3IHWA 1EE2A 4MR8A 2PYZA 1CXZA 3AKEA 3R5XA 4WCFA 4YMHA 1FSSA 2FR1A 4N0EA 2KW5A 2WF8A 4UCQA 5LCXA 3SEZA 4Z54A 1MX5A 4M1KA 5TNXA 2WZBA 4IDAA 1CKEA 1T6ZA 2VA9A 1JWBB 3JQFC 2WNIA 5CXSA 2X4LA 1SCUA 1VKHA 4QDUA 3FNGA 1U2DA 4Y2XA 2OYRA 3NWOA 5HBRA 2HBQA 2WD8A 1ND6A 3P9RA 4OAQA 2UAGA 2Y0PA 1L4HA 2PV7A 1EZ4A 1DWOA 5BRNA 5CAEB 3NW9A 2CCGA 1U90A 2B8WA 4XWYA 3U49A 2AC7A 5AJUA 5TARA 3DHNA 3MT7A 2YIVX 1YR8A 2YJ5A 1G38A 2A78A 3R3VA 1I4EB 1G64A 4LXXA 3ZGLA 4CKCB 2F1OA 3UFXB 4QM6A 5I01A 1ULAA 1YZKA 3DBHB 1TM2A 4FKMA 4UBMA 5J2UB 4D41A 5HFAA 3AG6A 2VZ0A 1R9NA 4QJ5A 4ZYWA 1Y34E 5CIYA 5JBQA 5I9MA 3O8CA 4KODA 2B69A 2IWRA 4ROTA 3OO1A 4BMPB 4O2LA 1COWA 4QFBA 5TB5A 2Q8NA 3MINA 5AJVB 2R8RA 3NUQA 4UM5A 3F67A 3I2IA 5FTKA 4KFTA 2CFRA 4UHEA 4J3FA 4URYR 1VGRA 2R8XA 4Y98A 4N49A 2ECOA 3G8CA 1E2JA 4JGIA 4INOA 3G0CA 4EZEA 1CETA 1RBZA 2HZ7A 4WJZA 2CHUA 2K5UA 4IEIA 2O8CB 1KHHA 2JVJA 2J9YB 1BX1A 3VR5D 1SKBA 2GXSA 3WGJA 1KZ6A 1W2GA 1T3HA 2EW2A 3M33A 5B1SA 2UV8A 3TIVA 4AJIA 1P4SA 1X1AA 2J08A 3SVZA 4EDFA 3M6XA 2Q49A 2XBUA 4PO8A 1US8A 4TM7A 5LVAA 1C30A 2R62A 1H9AA 2BSAA 3A4TA 2ZRBA 3DEIA 2YFHA 4ETIA 5T3UA 4NOKA 2D6FA 4BMZA 3UC5A 3PDHA 4CLRA 2QDXA 4KHPB 2FE4A 1ZK1A 1U3FA 1Q0RA 3GPDG 1IBSA 2JIMA 5CX1B 1E4VA 4B4UA 1ZM3A 3SSNA 4HWPA 4IR7A 4YV7A 3L6UA 1VIVA 5KCMA 3ZJYA 4UU8A 3STWA 4EY6A 2C78A 4F91B 3G2LA 2BHNA 1NF8A 4E2YA 5KU7A 3SJAA 2YW2A 4YQYA 2HJSA 2NVWA 4BQOA 5DNYB 2B3TA 1X87A 4B6PA 1JQEA 2VVTA 3Q40A 3QVOA 2NUPB 1YB4A 4MQFB 2B5VA 4YP6A 2DPXA 1YZQA 1KJ8A 1DPFA 3C45A 3KQYA 2O2HA 4XB6B 5FUMA 4LF5B 2W2QA 2HUPA 4PYLA 4EG7A 2H4FA 1YJBA 3WJAA 1XHFA 2E6KA 4DWWA 3EG5A 2D0DA 5M34A 5AQ1A 3P9KA 3TEMA 1F4VA 5TC4A 2IXAA 1WW8A 2R66A 4XLLA 2IYLD 4J1SA 4JA2A 4TLBA 2QQ5A 3OUTA 3O4IA 3KETA 5A6VA 3EARA 1SQGA 1E0KA 1GLNA 4JVNA 3LOPA 2ZRJA 2JLVA 3L7NA 2C5HA 3C41J 5KVAA 3QKIA 1YR6A 2NO9A 3BD7A 1TM4E 3Q4GA 2Q3BA 4BQSA 3GPIA 4UEJA 2H2DA 4YLYA 5IF3A 5DTJA 5J1SB 4H0CA 3N0VA 5ETJA 2Z6UA 5EQJB 3I12A 3GVPA 3CBGA 4Y1RA 2UXDB 2VDOB 2WD7A 4TKLA 1YR2A 1XDBA 1BGXT 2R6R1 2FZLA 3MJCA 1RZ3A 2R97A 1C3JA 3H05A 1N34B 2KX7A 3UW3A 2GTIA 1OH7A 1NT2A 3OM0A 3PFBA 3ICCA 4P3OA 3LK7A 4JCCA 4D0SA 1DB3A 1ENYA 1PVDA 1EK6A 4TVSA 1KYYA 2GN4A 2P2NA 3H4TA 4BIMA 1M1NA 1PJSA 4BLPA 1NZDA 3EGVA 1CQWA 1TVKB 3I5MA 1V25A 3BEDA 1T36A 3H5RA 1V8BA 3PYXA 4GBMA 4B85A 1FUKA 1Z5GA 2PU5A 5ALMA 1XMOB 3W7BA 1KI3A 5KOJB 1X1TA 3EIEA 5DZSA 5LZ4A 4KFCA 2I33A 4JI5B 1DZIA 2AUMA 1Z07A 3UAVA 2DBZA 3CEPB 3DPIA 4XVUA 1UOPA 3DKVA 2ZIXA 4E30A 1J7JA 3N2ZB 1AKNA 1IVYA 4EFLA 1XAJA 3QIAA 4O1MA 1GPKA 3ZXIA 1Y3IA 4F56A 5D00A 1U4SA 3EPKA 3FJ1A 2C54A 4MW9A 1JH8A 5EE3A 4AY3A 2JH8A 4B6SA 3LWZA 3FRIA 3KHSA 4KRFA 4AL4A 5JAOA 3A37A 2HHCA 1BQ3A 1I8TA 1PU2A 2OBBA 2P62A 4S0XA 2ZE6A 3OSUA 5EVJA 3KFVA 1JW9B 1DAMA 3GU3A 3JD2A 3Q7EA 3FRJA 3GN2A 4FOTA 1C7FA 1RQLA 3LPAA 1KWKA 4JV5B 1C4KA 4CT0A 3WSWA 1CUIA 1XRSB 1FMCA 5B3AA 2ZIVB 4XASA 1MO4A 1AK2A 2P69A 3H1GA 5H1YA 2QTHA 5CA1A 1YVPA 4N3GA 1V1RB 2A9VA 3BFPA 3U62A 2FDRA 4E32A 2AFIA 4K88A 1MPXA 2UYOA 3RFVA 4EUFA 3ND8A 2CNOA 4GGOA 2OBNA 1UP7A 4GNRA 4KLCA 4P0QB 2PH3A 1UQUA 4UTNA 1J09A 4ZODA 1BDBA 3MB8A 2ZT5A 3MWGA 3KXKA 1TMYA 4IFIA 1B6SA 1EVLA 2V6IA 1CUAA 3EZYA 4AT1A 2XAAA 2IHUA 2OECA 3LQFA 3PENA 5BR4A 2OUKA 2M2IA 3BAZA 4NG5A 3D54D 3T1OA 4C0SA 1DJLA 2FQ1A 4MGHA 3WHKA 4BNWA 1BS1A 5KNDA 4G9EA 4O4IA 2RHOA 3L05A 4NBWA 1UMBB 3HP1A 3IBGA 4XWGA 4OSPA 4YCAA 4AG6A 1R6DA 3WK4A 1FFHA 1T0UA 2BAGA 3WK7A 2JD0A 4PSDA 1JFTA 5F23A 1VYTA 4ETWA 4UUPA 4ZTZB 3IVCA 4D92A 1F7UA 1EFRD 4A0RA 4OYYA 4LY6A 1MH1A 1Z08A 1D6JA 1ZUHA 3AY6A 1JJAA 1R66A 4JBNA 1F2TA 1AQNA 3H97A 3THYB 3C6YA 1VLLA 1L7MA 3EWSA 1PGJA 2GJAA 4US0R 2F62A 3KXLA 3OIDA 3GUVA 3W1WA 1SIBE 1OX4A 2J3QA 2OP0A 2JEYA 1XF1A 5DV9A 1L5WA 2UUPA 1W85B 4F3RA 1DSSG 3S7TA 3ZK8A 2X6TA 1GA6A 4TYPA 2IGTA 4MUMA 4B4KA 3GPBA 3B7WA 5T41A 4CM1A 5L95A 4WXPA 3L07A 4O4JB 1Q50A 2CMHA 5DSTA 2WTMA 3D4OA 3JQFA 2AE2A 1VCMA 3QIVA 2YWEA 1JUDA 1J4AA 1N2JA 2B9EA 2W48A 3ZKWA 4CL8A 621PA 4HAYA 5CDSA 4YALA 2FW0A 2D4HA 2NU7A 3Q3CA 4O0MA 4XFKA 4ZOLA 1P6UA 3MD9A 3ZKAA 4Q1FA 4O4HB 3EPPA 1IZ9A 5LZ5A 3UWPA 3VOBA 3ZY2A 1DKOA 2E55A 2GBGA 4ASUD 1S2DA 2GA9A 3AI3A 3HGQA 4NCNA 4YGYA 4C4PA 3DBOB 5FWAA 5JNSA 2IYVA 1M34A 4LF7B 1T34A 4P7GA 1LF0A 2J6IA 2PTHA 3M6WA 4JJIA 2ECFA 4L7VA 4O2BB 4BLOA 5TEWA 2IU3A 4K9QA 1XHLA 4DLYA 4FSHA 4KACA 1T6XA 2WWIA 3ICOA 1QQ7A 3BWYA 3R0QA 5CU7A 1I2MA 1MT3A 4LZJA 1FU7A 1RS0A 1B1CA 4PQRA 3R23A 5DGCA 3WB0A 3TK1A 1XMSA 1PZFA 3Q9SA 4WCVA 3VR5A 4II3A 1P9LA 3D1VA 3IA2A 1ESZA 3PL5A 4G1EB 3ZBQA 5CBPA 1O5TA 1E1CA 1PYDA 3LVQE 1GAXA 4KTTE 4A3SA 1YTLA 3PGKA 1ETHA 4O02B 2WWTA 1A9XB 3W5IA 3Q11A 1CIPA 1QNFA 4LF4B 2YV4A 1NG9A 1PW5A 1DUVG 1VZ3A 3EGXB 4OH7A 1THMA 4RVFA 3DGEC 1AGRA 4PRLA 5FWNA 4WMLA 3DT8A 2WV7A 2RH5A 2B1RA 2DBVO 3JQBC 5MF6A 5H0IA 1NUTA 1PFYA 4K81B 1QRTA 3K1AB 4X92A 5HZKA 4AIIA 4NJMB 1A1SA 3RM3A 1PZHA 3WMGA 4RWZA 2YICA 5AHKA 2AE1A 3BJEA 3TFQA 2KBFA 4UDOA 2N75A 3QVLA 5I45A 1TAGA 4JLNA 1N78A 1ZOPA 3U56A 1GDTA 2ADOA 2MT9A 1WTCA 2ROQA 2YV3A 4PTZA 5H3CA 4C87A 4CKCA 4IPTA 3BHIA 4QPCA 3IQIX 2RGGA 2Q8QA 3PJEA 3QHQA 4G2TA 4X85A 5TT1A 3UFXA 2FOLA 1EAMA 3DBHA 2F4NA 3QVVA 1NXSA 2PKQP 3ESRA 2EW8A 1KMMA 3ISTA 3K30A 3TNJA 4YV2A 5J2UA 1CJBA 4N3BA 2VAPA 1SY7A 1AX9A 4A1OA 3H11B 3GAMA 3M49A 4RACA 4WEQA 5AK4A 1FUUA 5K05A 4RTRA 1T0HB 3JQGB 3OSZA 1I6WA 1JJ7A 1ZJYA 4L9WA 1WB5A 3ZW7A 3IBYA 3I8OA 1PDOA 5WRFA 5IFLA 3DXFA 4FNAA 1TQ4A 1ZR2A 2ZRKA 3Q3VA 1E9CA 3AYZB 2OFWA 2RI0A 4M0EA 4WXRA 3QPDA 5IJZA 4Z1MD 3S81A 4QDJA 1PK9A 1UZAA 3VGPA 2O8CA 5E1DA 2HKIA 3H2SA 2GPJA 3ZLBA 3LECA 3DTNA 3ER8A 4PTYA 3HH8A 3TOXA 1R6UA 4BP8A 3STVA 5A4IS 1YRHA 1PI3A 4BNVA 2OSVA 3HYSA 1FPQA 1HLDA 1T2UA 2WWHA 4G5RA 1I5EA 3VXKA 5ADUS 4IS2A 3SLRA 4X93A 5EIXA 3HLKA 3A4YA 4NV0A 1KSHA 1WY5A 4LZAA 3P96A 4NZOA 5JYCA 4E11A 4JC4A 2XQGA 3W05A 1LK5A 1Q12A 2NPFA 1Z6TA 1A3CA 1DC5A 1N0IA 5CX1A 3U4HA 3UAXA 2OFXA 3DYVA 2GZRA 2I4RA 4D3ZA 2ZIGA 2FV8A 3H4IA 4NFHA 1XJ5A 3WSTA 3CF2A 5T67A 3ZX5A 4JXKA 1YQ9A 1I3MA 1FP4B 1PV4A 3TLJA 5BORA 1U0NA 2WAXA 4KQMA 5EJ2A 5DK6A 5FTNA 3K2BA 3EQ8A 4BE4A 5CCDA 2FG7C 5JWOA 4YUXA 2A58A 2NUPA 2WYUA 4MQFA 4DLRA 3KZ1E 1AUOA 2Q3FA 4UREA 2VKQA 4B6RA 4RIHA 4OQXA 5AJTA 1J8QA 2YIJA 4RDIA 4MV3A 1V1MB 4XR4A