2ERYA

The crystal structure of the ras related protein rras2 (rras2) in the gdp bound state
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
171
structure length
167
Chain Sequence
SMQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the Ras related protein RRas2 (RRAS2) in the GDP bound state
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-related protein R-Ras2
total genus 60
structure length 167
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2eryA00
2CNWD 2CXXA 1KKLA 4XIGS 1YZTA 3W8RA 1KTVA 5H1YA 1G6OA 1N3BA 5F9FA 1CEEA 3LNCA 4GZLA 4FWIB 2QAGA 1T5IA 1ESNA 3HU1A 4GDFA 5LBIA 3CNOA 1JQJC 2WHXA 1E2JA 3JZMA 4DCSA 4DBLC 1GTVA 3W8NA 2GZDA 2ZE5A 5FI0B 4XWAA 5HCNA 4WIAA 3KDSE 4ESHA 3ZH9B 2BIFA 4GMXA 5EE5B 1KI3A 4AKGA 1OH8A 1ZNZA 3MWKA 4QRHA 1TTTA 5FUYA 2BMEA 3B1YA 4GI7A 1U9IC 3EPKA 2YINC 4EFLA 1E9AA 1RRFA 2BVNA 2IF0A 1CU1A 4RCYA 4QXAA 3UG6A 1FNMA 4AC9A 5JHGB 1WA5A 5LD2B 4Y0VA 2G6BA 3PJRA 4LC0A 4Q4JA 5DE3A 3SFZA 2FU5C 4QKQA 3VR5A 3IO5A 3NBXX 4WXPA 3X2SA 5F3WB 3MCAA 4AYWA 2XB2A 1KK3A 1P60A 3EARA 4WOPA 3FKQA 4Q4LA 4JVSB 2JJ8A 2YWGA 4URYR 1WXQA 1KYIA 1DAGA 5FL3A 5LPNA 3VKHA 2VSOA 2AR7A 1Q1QA 4NCHA 2EW1A 1P61B 2CNWA 121PA 3R8CA 4RD0A 4W9MC 2DWOA 3FPAA 4DLXA 3HR8A 2GNOA 4MKFA 4O2RA 5J47A 4HEJA 1E9RA 1II9A 2Q3FA 1TEVA 2ZETA 2V4ZA 5DSZA 4UNSA 1TADA 3R7WB 2WPDD 4A8JB 3DEFA 2O5VA 2XTMA 3TQFA 4Q4HB 6Q21A 1CBUA 1T8TA 3QENA 1Z0KA 2OAP1 3AVWA 1T3SA 3X1WA 4BECA 2QROA 3ASZA 3FMFA 3D6TB 5DLQC 1DARA 4TL9A 4TYPA 2NTYC 4NHOA 3I1FA 2C04A 1W2GA 5KSOA 2FF7A 2MSEB 4PTLA 1W0KD 2CE7A 1Z0FA 1HY3A 4R98A 1SQ5A 1CIPA 4OQMA 2P3SA 3B13B 1G41A 1G4UR 3LQQA 3AB3A 3DKPA 1JNYA 3GPLA 4LHVA 4B74A 1X1SA 2QGZA 2WV9A 4R7ZA 3W9YA 1JAHA 1SVIA 1Z0IA 3W5IA 4ZKEA 4LV6A 3RRZA 1YE8A 2F43B 3CPJB 3Q3JB 4TTPA 4D25A 3KXKA 2ZRLA 3VHXA 3TE6A 2GXAA 3RRMA 4Q9JA 1VG1A 2RGBA 3LA6A 1OIVA 3DZ8A 1CKEA 1KNXA 2ZJAA 3CF6R 1KO5A 1FQKA 1EFTA 1H8HD 2FG5A 2YVUA 2O8CB 2WJVA 1A82A 1FTSA 2OFWA 1XMSA 4URXR 1DAEA 2REOA 3WHKA 5CLLA 5DHAA 3SS8A 2WJJA 4EPWA 1Z63A 1OXVA 2IYXA 2XOKD 5E95A 3IQWA 4I1UA 4W5WA 4A0GA 1R0XA 1LFDB 2PJZA 2W6JA 1ZM7A 4JKIA 1EFCA 3PEYA 3DM5A 3L8ZA 4ZIRA 5CK4A 4YMTA 4F93B 1IN6A 4CEJA 1U0JA 1W0KA 1G9XA 1G8FA 4URWR 4DIDA 5JWOA 4E03A 2WVJA 1OV4A 4G5RA 4MUBA 2FWRA 2B8TA 1QG2A 4RD6A 1HH4A 3ZVRA 2BJWA 1R2QA 4GSYA 5DI9A 3F5FA 2RKOA 5AJZA 2VL7A 3BH7A 1BYUA 3PUWA 2NMVA 2C98A 2HXSA 3KX2A 1G7TA 3RHFA 1KK1A 3GLIA 4EFNA 1YZQA 3FTQA 4KBFA 1II8B 1KGDA 2IS1A 2BMJA 1Z6TA 3NTUA 1KO7A 2OFXA 4Y0AA 5TARA 2AD1A 2ZI5A 2DPXA 4KSBA 5FL7A 4S35A 5DIFA 4QL3A 2DYKA 1SGWA 2ZJ5A 1RIFA 5KSZA 3SYNA 2QBYB 2J7PA 1UKEA 2EWVA 5LB2A 1FPMA 3AVXA 4PPNA 2OILA 1AK2A 2OEPA 3KFVA 1XWIA 1YR8A 5GVRA 3M6AA 3AUYA 2GJ9A 4LJ9A 2WOJA 2VH5R 4RJLA 3EA5A 1GKYA 521PA 4BFWA 2KE5A 1SHKA 2I4IA 2P6NA 2Y8EA 2Z83A 2ZJYA 3GEHA 4OQFA 5EUMA 1IXSB 3NEYA 1G8PA 1NMXA 1XXHB 2CLDX 3AVQA 4DXAA 2A3RA 2RGAA 3NEJA 3L43A 3ZS9A 2BBOA 2ZSBA 2QAJA 3AUXA 3FMOB 1TF5A 3NWJA 4HB4A 1TAGA 3TIFA 3TJZA 4WZAE 1XPRA 4D26A 2N42A 4N3NA 3I32A 2GF0A 1E4VA 1BMFD 1MKYA 1DAHA 2QAGC 3P32A 2O8DA 5EXTA 2IL1A 1VCMA 3GMTA 5EP2A 4ARZB 4M1WA 3O8BA 1Q3HA 1Z5ZA 4JZKA 2DWPA 2IYRA 5FOUA 1KDRA 1RZ3A 3I73A 1OIXA 3A37A 2IYZA 2ZR9A 4G1UC 3OIWA 1ZM4A 1F48A 4P4SB 1SVMA 1SXJE 3MRSA 3IO3A 1FMLA 1XTRA 1SKYE 2FEOA 3B78A 1P73A 3IUYA 4GP7A 3IPYA 1G7CA 1RJ9B 4I1VA 3NDBB 1N5KA 2QMOA 3T34A 1YKSA 4HATA 2QNRA 5IK2A 4B48A 1GRRA 2G9NA 4TLCA 1G20E 1E2MA 5EP3A 4JLBA 4TT3A 5BQ5A 1OHHA 2XNDA 1OFHA 2XZOA 3K9GA 5H68A 3SE0A 4JLDA 1PVOA 3LXRA 2AD5A 1G3IA 2QMEA 2OCPA 1J8MF 3L0SA 1GZSA 4PQRA 1JJVA 1WF3A 2VP9A 1TU3A 1S9DA 4KHZA 2HCJB 3SQXA 3GLHB 1M7GA 1VHTA 4P4TA 4G5OA 1ZCBA 3HU3A 1XDBA 2N1BA 2V7QA 3BC1A 2Q9CA 3T35A 4LV8B 5BWMA 4TL8A 4XWKA 4JL8A 1DG1G 4KODA 2XSZA 2F1IA 4DB4A 3N70A 5FPHA 4AKHA 4NE2A 4XWOA 1XB2A 1NVVR 1V43A 4UQOA 4ZCLA 3BRWD 4NL4H 4DC9A 3KQKA 1E2LA 4FMCF 3B8HA 3CWZA 4BE7B 1Q0UA 3LX5A 4MKGA 1U8AA 2CDNA 4PAQA 1E2QA 4DLVA 4Z51A 4QBFA 4WA7A 4URUR 3TGPA 1J8YF 1ZJ6A 2ZVPX 1IY1A 3HR7A 3RS3A 5CB6A 4OK5A 1K5DA 3TQCA 4P3YA 4ZI3A 3PUZA 3Q7QA 3CRW1 4Q21A 3GLFA 1V5WA 1YZUA 2DY1A 5KNDA 1Z0DA 2X2FA 1MRSA 3DKVA 3QKTA 3WMFA 5BN5A 5J4HA 3EX7C 1E9SA 3B9QA 3NIBA 4HB3A 1QHHB 5BN3A 3MJHA 3ZIAD 4OHXA 3GJ0A 1GL6A 2I3BA 4FMBB 1KI6A 3FVQA 1E4YA 2P6RA 2K5UA 1FUUA 4OHZA 2C9OA 4TMWA 3ADBA 3O8CA 2XB4A 1AGPA 5AJXA 3QF4B 4V02A 5CB8A 1L7VC 3NC1C 3THXB 4C0JA 4H1UA 4HB2A 1QHNA 4AG5A 2ATVA 1QRAA 5HTKA 4TQUS 3B1WA 3MWLA 2X1VA 4MRRA 1IN7A 3DVLA 5FOVA 2P65A 4TZ0A 1AJEA 2QP4A 1T4GA 4WZBE 2QAGB 3C5HA 3KKOA 1JR3D 1NN5A 1OF1A 1PJRA 3PENA 4LPSA 421PA 2AL7A 1G1MA 3AM1A 4HLUA 1NRJB 2ZE6A 2O0HA 5CM9C 2I1QA 2ZYUX 3DM9B 3EAQA 3RABA 4PO8A 3SEAA 3PEWA 4JJKA 4JBWA 3F0TA 1SVWA 4RD1A 4CT5A 3BXZA 2CK3D 2ZRKA 5LDDC 2ZUDA 1KIMA 2QTHA 1ZINA 2XJ4A 4UXHA 4IVQA 5EQTA 1E1QD 5DI3B 1X86B 1QG4A 2HF8A 3VX4A 3PFIA 2C9YA 4BFYA 4TYWA 2UZ3A 2GEVA 3QKRB 2JLUA 3D3QA 3QF4A 2BM0A 3T1TA 4ZIRB 2JEOA 1ELOA 2QE7A 2YOGA 2VHTA 4V0KA 1C9KA 4YLGA 2J0SA 1M7HA 2P6UA 3SHWA 1XFAA 1AZSC 1W5TA 4ZI2A 3K9LA 2YJTD 1BOFA 5TY0A 1WP9A 5FPYA 3IIMA 5KHOC 4ON9A 1W4AA 2GA8A 2B8WA 4LWZA 2CJWA 3KUCA 4TMVA 4BFTA 3V00A 3VR1A 2QTFA 2OESA 1EFHA 2AX4A 4KLZA 4TN1A 2ZU6A 1YRBA 1K8RA 1MRNA 1W0JD 1Z6GA 5GJVC 2JLSA 4ASUD 4CVNA 2HYIC 1ZUIA 3VMFA 4JMPA 3W34A 2ZANA 1G6HA 4JVLA 4HI0E 4GMDA 1CTQA 1R5NA 2GXSA 5DYIA 4EPYA 5BYKA 1KSFX 4FMDF 2NZJA 4Q1DA 3U3RA 3ZIAA 1GL9B 5JI2E 3SYKA 4B34A 1OIWA 3BFVA 5A4JA 1ZNYA 1EFUA 5FOTA 4DLWA 3RS0A 2ZI3A 5DNYB 3OFNA 3BK7A 5J4KA 2C5LA 2R62A 5L3RA 2G3YA 1DPFA 2DFKB 1DAFA 3E70C 2F1HA 4I1OA 1W5SA 3A1SA 3LBNA 5G40A 4EAQA 4BFUA 2KJQA 4MQBA 5GJWC 2BBSA 2VHJA 2GBLC 1VG8A 2BM1A 4QHTA 2IWRA 3ZGXA 1FX0A 2WKQA 4KVAA 5C46F 2WWWA 4HLCA 2FDCA 3U7GA 4JBXA 4GZMA 1FFHA 2BKUA 4LBYA 1OH5A 4PHFA 2CCJA 4JLMA 3UIEA 4JL6A 4Q1CA 3CR8A 2F3TA 1NI3A 1P2UA 4FW9A 4M0LA 2C78A 2A78A 4A4DA 2OCYC 1PLKA 2YWHA 5DN6A 4DDUA 1BO6A 2GDJA 4WZ6A 5CIWA 4Q4AA 5C4MA 3ADDA 1HE1C 2QQEA 1JB1A 8OHMA 2ZRMA 1E1RD 2XITA 2IEYA 4Q4JB 2YZ2A 2BHRA 2LKCA 2NPIA 5A0FA 1WBDA 4TYYA 2KSQA 1IOZA 1R7RA 2VIIA 1Q1EA 3OAAA 2IS4A 2GZHA 1QVAA 4MUAA 1NBME 3CF2A 3AF4A 1IM2A 2A2ZA 4B2LA 5JWHA 1XEWY 3FMPB 4PPGA 4RZUA 1TF2A 2J0UB 4DSNA 4LJ6A 5C4GB 3GLGA 1OHHD 4JSYA 2JLYA 4OKSA 5G3ZA 4LJ8A 4MYTA 3CX6A 2CEAA 2Q9BA 2MSDB 3KKQA 3P4YA 3U61B 2ZJOA 3IQXA 3WMEA 4AKEA 3EIHA 2GCOA 2JLQA 4M22A 1UKYA 1FUKA 2ZPTX 4LY6A 1SKYB 1NLZA 1KK2A 2ZAOA 4LBZA 3LAWA 3PG5A 2J7KA 4PHHA 3V9PA 1FMJA 4I1SA 1E9CA 2ZR7A 4IOKA 1P2TA 3FOZA 4QM6A 4AI6A 1Q1ZA 1ZC3A 2JIZA 1E99A 2ZRHA 1W4RA 2FFBA 3ZZTA 5SZKB 1MO5A 4LV5B 3SN6A 721PA 4OI2A 4LSGA 3K1JA 3VQTA 3QXXA 4A2PA 5TV2A 1UBEA 1AQUA 2C99A 2ORIA 4AYTA 2IHBA 4E09A 4IEIA 2IYQA 3RLFA 4QJ5A 4BZQA 1Q3TA 1UKVY 5HCIA 1JEDA 1VTKA 3J81k 3UATA 1GILA 1KI6B 5FFMA 2J87A 4AURA 4NP6A 3C41J 4I99A 4OQXA 1E9BA 1PLLA 2D06A 4PAMA 2OBLA 2AFHE 4ESVA 1SVLA 2D2EA 4QBGB 2YOHA 4LHZA 2ORVA 4AYXA 4LYHA 2PBRA 2ZSAA 3AKCA 3A4MA 5IHPA 1XNJA 2VTKA 2V54A 2AXNA 4A6XA 1P9RA 5GJBA 1KDPA 4MGZR 1AA9A 4D0NA 4LJ4A 3FFAA 3K09C 3NH6A 2V3CC 1XMJA 5EUQB 4F4JA 2E9SA 3BB3A 1AN0A 1Y63A 4P31A 1DBSA 4S2EA 3SZRA 4TLEA 5IT5A 5GVSA 4GPTA 3C15C 1NY5A 2IUTA 3PUVA 1OFUX 2JASA 3EZ7A 4FN5A 1KO1A 4N0DA 2JLZA 3HU2A 3IDQA 1VYTA 4RFVA 4MYUA 1E1QA 2QSYA 4GP6A 3NXSA 4LJ7A 3PXGA 2IYLD 3I92A 1KI2A 2QORA 2VRWA 3UK6A 4UNRA 2IYVA 3AVOA 5F98A 1X8KA 2C96A 5L3SB 3GJXC 2HDNB 4RZXA 4QJ4A 1F2TA 1E94E 5AUOB 4EPRA 3ZZUA 3GLHA 1RFLA 3C16C 4P0TA 2FEMA 2D7CA 2IHYA 1XTSA 4F91B 1G8YA 2PH1A 2ZITA 3EG5A 3QPUA 1LS6A 1JR3A 1G4AE 3QKRA 3UPUA 4JT2A 2V6JA 1VCNA 4Q18A 1OPXA 2VSFA 1KSHA 1IXZA 2Z6VA 4IOMA 4TQ9A 3OFND 3LLMA 1W36B 2JJ2A 3REFA 1TUIA 4YMWA 1XEXB 2IC5A 3QG1A 4JLVA 4A92A 4UKDA 1E1RA 1ZW6A 1ZCAA 3QNUA 3Q72A 4RZ2A 2JGNA 4B3CA 4C0BA 2QA5A 2VPPA 3AGPA 3CNNA 5FPTA 5LD2C 2OM2A 4NYJQ 1AQYA 3VR2A 5FTNA 3DOFA 3KTAA 1GM5A 3QKSA 2B6HA 1JXOA 2PT7A 3CB4A 3R20A 3T06B 1XEWX 2B7CA 2H7VA 2H5EA 1IBRA 4DLTA 2FPMA 3KXIA 4PAOA 5JEDA 3RAPR 1R0YA 4L16A 4KCGA 4A2QA 5M04A 3FKSD 1FP7A 3HPQA 4IKEA 4C0QC 4DCUA 2FPKA 3NBFA 2DFTA 2GCPA 2NZ8A 1TUEA 2PX3A 1NN1A 2WWFA 2ZQ5A 4CW7A 1GITA 1ZIOA 4CEHA 2G83A 3AKEA 3RC3A 4M9SA 2ODBA 3RYTC 4Q7JB 4BEJA 2BBWA 4L9SA 3U44A 3T1OA 1OB5A 1NMYA 5FPKA 3FHCB 5JRJA 4Q1EA 1Z6AA 4KJZA 4FINA 1EWRA 3AV0B 2XZLA 5FBRB 5JEEA 3S1AB 2EFDB 3TR5A 3AF3A 4M1KA 1S96A 1RC8A 1H8HA 1NY6A 2A5JA 2ERXA 3W5JA 2CHVA 2UZIR 4DSUA 2GJ8A 1BKDR 3MFYA 2NG1A 3NVAA 4RSGA 2VBCA 1YHNA 3THYB 1N6HA 4P4UA 3UXMA 3OIVA 1QHIA 3SJZA 3P26A 1L2TA 3CIOA 4MGYR 4V0ME 1S9HA 2DCUA 5DI3A 3RRNA 3KXLA 4M1YA 3ZYCA 4O3MA 4M1MA 4U02A 2ZREA 1G21E 2BKEA 1ZVQA 5DISB 1JXMA 3UMSA 2IW3A 4PO1A 3OIUA 3FE2A 1GDDA 1W0JA 5FPSA 4ASUA 1KO4A 2CHGA 3BH6A 1Z6XA 4M53A 3WBJA 4EPVA 4ZDIA 1G3MA 2O8FB 2BEJA 2EWWA 4KFTA 2WWHA 3K0SA 3UANA 5B58C 3VNUA 2IXEA 1JALA 4KLNA 1JBKA 2J46A 2Q6TA 5E4FA 2ZJZA 3GCGA 4IOJA 4LUCA 4Q01A 4CT4B 4DIEA 1T8UA 3EZ6A 4MYHA 3MLEA 3D31A 1KJWA 1OKKA 4ZCMA 1AIPA 1UEIA 2P5SA 3ADKA 2P0EA 2GCOB 1W49A 4PHGA 4MITA 4EJSC 4HAWA 1ONBA 4KSCA 3QXSA 3B6EA 3K8YA 4X8MA 1AZTA 2BC9A 5C1BA 1NIJA 5KSPA 3WNDA 3OZXA 3FB4A 1NKSA 1TQ6A 1BS1A 4R2HA 5FTMA 1SVOA 3N2IA 3Q9LA 1GWNA 3TAUA 2QRZA 1G7SA 4ZDKA 4V0MA 2ECKA 1U98A 2GESA 3CZQA 4AKIA 1P6XA 5AUNB 3W6NA 1LVGA 2D4HA 2YWFA 3T61A 3B7GA 2ZXUA 1FOEB 4X8LA 3W90A 2NO0A 4JKYA 4IRUB 1NVWQ 3VU9A 1KY3A 4O0MA 3M1IA 1W36D 3BORA 4ERNA 1NN0A 4D80A 2GEUA 4PZYA 1Z22A 4DLUA 3TUIC 4TZ6A 1W1WA 4LK2A 4Q4HA 5BN4A 1Z29A 1A4RA 4HZUA 5JHHB 2H18A 2ERYA 3BAFA 1IAQA 3DMDA 1NMZA 2VHCA 4UJ5A 3EWSA 3BOSA 4WVFA 4L15A 2A9KA 3MJRA 2MMCA 1EK0A 2LCFA 3GLIB 2FPLA 5TB5A 2C95A 4G0NA 2AWOA 4QJ3A 2R9VA 2W2VA 4C3ZA 2JLWA 1E0KA 5LB4A 1DOAA 3FYHA 2P5TB 5IK2D 1Z47A 1W2HA 2ZRAA 1AS0A 3OEHA 1E2HA 1KI1A 2XXAB 2YHSA 3ZDQA 3VTKA 3SJCA 3ZQJA 1KY2A 1S8FA 2W6JD 2KI5A 5JCZA 4LJYA 1KMQA 4OYHA 1XD2B 2CCKA 1VCIA 3FKSA 4C0KA 4A0FA 1G18A 4LRWA 2REBA 4IVPA 3CZPA 2H17A 2W2XA 3AH8A 3LW8A 4US0R 4QGGA 5AWFC 2IS6A 5DYGA 2FE4A 5G53C 3EPJA 2PX0A 2NO9A 1M1YE 2V1UA 2WOOA 5FUXA 1UKZA 3GFPA 4ARZA 1BH2A 4UNQA 2O8CA 3A4LA 5TMPA 3LWNA 4GFDA 1EG7A 1W4BA 4GBMA 3N5CA 4G3XA 2QZ4A 4DEYA 4YMUA 3B1VA 1F3OA 2JDID 3P1JA 1W47A 2VP4A 2V7QD 4OK6A 3TAHA 3N2EA 2ONJA 3DOEA 5L3SA 4MDEA 3AF0A 4OBEA 3QEOA 3RS7A 2R65A 4FXPA 3GFOA 2RH5A 4TT3D 3I8XA 4M9ZA 2WAXA 2ZSDA 3ND9A 5HKKD 3KKMA 1I4DD 2DBYA 3QBTA 4TL6A 3I61A 3AVVA 3SNHA 4DT1B 2Q9AA 3I3SR 2PT5A 3LVQE 4CGZA 2ZYWX 1ETUA 3LH5A 5KNCA 4Z1MD 2ZAMA 3KB2A 2VHUA 5JRZA 1E2EA 4AG6A 3K0AB 2FMXA 4DKXA 1YZLA 3G82C 4LJAA 4RD3A 2ZS8A 2FFQA 1XTKA 4JYBA 2ZJBA 1OXSC 1B23P 1F6BA 2OXCA 3Q8XB 3R7WA 3EPHA 1T6NA 1T0HB 4M4SA 3VHLB 2GEDA 1U81A 1K6MA 2F7SA 3C7KA 5B2ZA 3TSWA 2W0SA 3AP3A 3QKSB 1R8QA 4D82A 1N6PA 3IIKA 2QT1A 1YVDA 4B32A 3I4LA 3UMFA 2QSZA 4I4LA 1KSJA 1OH7A 1P3JA 4GOXA 4JS0A 3KUDA 1RE0A 2OO7A 1U0HC 5FH9A 1X1RA 2JJ1D 4K46A 4Q9KA 1G3RA 4DSOA 1DO0A 1D9XA 2J59A 1T3HA 2W0MA 4Q9LA 5KDOA 1W48A 4C7OB 2MSCB 1YR9A 3D8BA 1JPNA 4B2IA 5HKKA 4Q5IA 1IN5A 3E5HA 1XTQA 4ILEA 3S1AA 4D6PA 3MAAC 3QEJA 1I2DA 2ODEA 1C1YA 1QHXA 2HF9A 1RRGA 4R2IA 3UKDA 2GF9A 3QF7A 1COWD 1UDXA 2XX3A 2XZPA 3EIQA 2CL7X 2OSBA 5G3YA 4HAXA 3CX8A 2R6CA 1HE8B 2FSIA 1NIPA 1QF9A 2ZU0C 1M2OB 1QHHA 2A5YB 1XCMA 1ZM3A 2QGNA 2IWHA 4GRAA 4V03A 2OZEA 5SZHB 3I5XA 2G88A 1RYFA 3T12A 4PHTA 3X1XA 3ZZ0A 2RCNA 5BW8A 2A7QA 2WKRA 3PCRB 3RANA 5TXGA 4C0HA 5EE9A 2NO1A 3SQWA 2QPOA 3ECCA 4B33A 5EJEA 1ZUHA 2G0TA 1E2DA 1QZXA 4PQFA 5JJLA 3H1TA 2D2FA 4DEXA 1D2NA 4BPBA 4JYCA 2JIZD 4IDNA 4LYAA 2QG6A 3EZ2A 4JLPA 3NG1A 3ADCA 1DAIA 4U7DA 2WJHA 1R5BA 2IS2A 4C0AC 5FOWA 4CRWB 2VEDA 3LXXA 4IXNA 4UNPA 3VKGA 3A1WA 1II8A 2FN4A 3KQLA 1MT0A 4A8JC 4KO8A 2EFCB 1AS2A 1W46A 3KB1A 4YDSA 1GOTA 2OLKA 4CDGA 4KFSA 1JAIA 5FTJA 3VX3A 5BYJA 3UWKA 1KSGA 1XD2A 2NQ2C 2XTZA 4B3BA 1NBMD 2EYUA 2YYZA 4JLKA 2ANCA 3SBEA 3IILA 5DO9A 2J5XA 2RB4A 1W44A 4NCNA 3DO6A 4EFMA 3MD0A 4RZ3A 2OT3B 3BFXA 1TQDA 2CLSA 2OHFA 4TYQA 1RW4A 1PLJA 2WSSD 5EE3A 1Z0AA 3SDZA 1CULC 3K0EA 3CONA 3LBIA 4HAVA 2YC4C 4W5JA 5KYKA 4PX9A 1J2JA 1AS3A 4A0HA 3BB1A 3I5YA 3IBYA 4X8OA 4BRWA 3LO5A 3K09A 1PV4A 1T91A 1G3UA 1Q21A 1DAKA 4JVNA 3W6PA 2J3EA 4LJ5A 5JLJA 4DT1A 2FSGA 3VR4A 3BWDD 4QC2A 4ZKDA 3KL4A 4D4MA 2J0VA 3QXHA 3CKLA 1R0WA 1XRJA 2D74A 3WXMA 1XF9A 4LHYA 1XX6A 4I81A 3SBDA 2AKYA 2C8VA 3CR7A 1NSTA 4B43A 5AUPB 3TH5A 1HURA 1FP6A 4KYUA 4Q7MB 3RS5A 1ZU5A 1KAGA 3JVVA 4A1FA 3B1XA 3PUYA 4C9BA 1PUIA 1VPLA 1Q57A 1G291 1Y3AA 1H65A 1FQJA 2ZI7A 2E87A 4WXRA 2ANBA 5JWRA 4GOKA 2WWXA 2O8FA 2J0QA 4P32A 1NLFA 4XD7D 2WJGA 4QNMA 621PA 3IGFA 3OEEA 2XXAA 5E7IA 1HYQA 1VKJA 2OFOA 3TKLA 3LBHA 1OH6A 1G5TA 1NN3A 4C2UA 1AGRA 4TMKA 1JQLB 3SI7A 4URVR 1P62B 2QN6A 1D6JA 3V4RA 5KO2A 2VP6A 2ZRGA 4UJ3A 2Q3MA 3CX7A 4HUTA 5FBVB 2W83A 2KB0A 1BYIA 3NHAA 3F3YA 1KJZA 4O25A 3E2IA 1P9WA 4M8NE 2JDIA 3L0IB 4QHSA 3A6PC 4Q03A 1R0ZA 1YZNA 3WMGA 1N6NA 1LB1B 1VG9B 2X19A 2Q21A 1LNZA 2PMDA 4L8GA 3WY9A 2ZM5A 1XPOA 1DAMA 2Q3HA 2QE7D 2OV2A 4D4LA 2FZ4A 4LBVA 2ZUBA 4E5UA 1KHTA 2XGJA 1US8A 4DJTA 5L8VA 1XCGB 3GD7A 5H70A 3PEVA 3VU9B 4Q1FA 3OE7A 4EJSA 4BLPA 4LDJA 1N6LA 5F9HA 3CRQA 3M0EA 4XJXA 1KK0A 4XD7A 4LHXA 3KQNA 1J70A 1R4AA 2W2TA 2IYWA 3B2EA 3CF0A 4PANA 4YDHB 2B21A 4HSEA 3QOFA 1G3QA 2QT0A 1OYYA 2WJYA 1OSNA 1Q44A 1XMIA 2QUZA 4NYMR 4QGFA 5TDHA 3U7HB 1VYUA 1TQ4A 3OESA 3PITA 3GLGB 2H57A 4HZUB 1HUQA 1R6BX 2JA1A 4BZPA 1XXHE 2V1XA 3A4NA 3BH0A 3GFTA 2CBZA 4Q47A 1CRPA 2RHMA 5FOSA 3ND8A 2J41A 1Z2CA 4M9QA 5KOYA 3ZVMA 4F7WA 1SVSA 5JZVA 4PXAA 3GLFB 1TNDA 4YXWA 2BCJQ 4QOSA 3VFDA 3PIRA 1I2MA 1KMHB 1ZNWA 2HJGA 3QUSA 5KTYA 4R9UC 1JR3E 1XU4A 4URZR 4G01B 1IQPA 3SU8A 4AD8A 4DB2A 4BQSA 3U3JA 4BRUA 4GL2A 4ACAA 1E9DA 1CRQA 3HPRA 4PFSA 2WSMA 4RCZA 4AY2A 4MKIA 3QBVA 4TMXA 5JFGA 2FV8A 3U60B 4C7OA 1HT2E 2CK3A 4FD2A 3FHTA 5L3VA 4JJZA 1LY1A 1MOZA 2QI9C 3DDCA 4QGAA 1W4CA 1CP2A 2OCBA 1E2FA 4MDFA 4TWZA 1A5TA 4ZO4A 2ZJ8A 2WSSA 3ZQ6A 3IBGA 2R6DA 3ZD6A 1VYVA 2HLDA 2BMFA 4NBSA 1UAAA 4M1OA 1DS6A 4HAUA 3JVUA 1RVDA 2HEIA 1DE0A 2GWHA 3MWYW 2W00A 1P7CA 2PMKA 4V0NA 4A8JA 4BGDA 1YR7A 3GJ6A 3CPEA 2RMKA 3CH4B 2ODNA 3CRVA 1GNPA 4JVMA 2GJAA 3REGA 5HZKA 2DB3A 5DGXA 2Q0HA 4BWYA 2V9PA 2C03A 3X1ZA 3GLGE 3U7FB 2OLJA 4KYIB 4YONB 2RGEA 1ZIPA 1ZNXA 4YC7A 4EIWA 1I4TD 1OJLA 4UXJA 5CDFE 3QVUA 3AVYA 1SVKA 2VP5A 1GNQA 4DDWA 2VYFA 3QSYA 3RC8A 3EXAA 3ICEA 2BCGY 1P4SA 2HJVA 4PC2A 2OUKA 4MGIR 1A7JA 3ICQB 3WRXC 3BJIC 3GEIA 1YR6A 4IFBA 2RAPA 4IW3B 4FIDA 4M1SA 2BWJA 1N5IA 3RNLA 1P2VA 3T1VA 2B92A 2DFLA 1IJFA 3RVBA 1HQYE 2BV3A 5DHFA 2EFEB 1U8ZA 4W5HA 2HLDD 1DG3A 2BDTA 2FGKA 3U6KA 1OXTA 4B44A 3P20A 1GFIA 4RY2A 5D3MA 3PQCA 3RS4A 1N6IA 2LWIA 3HWSA 2VLIA 5KPJA 1MABA 3AQ4A 1ZU4A 1XP8A 1K5GA 3QKUA 4TMTA 1L4YA 5EXXA 2F55A 3AKDA 2KBFA 4TSFD 2WBLC 4HAYA 2JJ2D 5F2EA 221PA 3MWJA 3I72A 2RGGA 1KJYA 3QJYA 1LV7A 1N5LA 4BFSA 3K70C 1GIAA 2ZRFA 4W7SA 1SXJD 2A5FA 1G5PA 1F2UA 4Q7KA 3H0KA 3DHWC 5JJIA 4XOIA 5FUWA 5BXQC 3U3MA 4DLZA 2V8OA 1XEXA 3A1VA 4K8OA 4TLBA 1UBCA 1OFIA 3LRPA 4NYIQ 4N0EA 1S2MA 1U0LA 3TUJC 4NYIR 5J40A 1G7RA 1CR2A 1RYHA 2GZAA 5CK5A 4KFUA 1ESMA 3EPLA 4JIMA 3H4MA 4DUGA 4PQYA 5J4LA 5A5GA 5K8LA 2WWGA 3I62A 4F4CA 5AUQA 1C4OA 1OYWA 4KI0A 5D3QA 3ASYA 2VA8A 2WJIA 5GADl 1KZGB 4RFSA 1F60A 2ODWA 4NPHA 3C5CA 3NDPA 1MO4A 1EESA 2PL3A 2F1RA 2R6AA 1GL7A 1HQCA 2ZRBA 4LBWA 2F9MA 1AKEA 2FSHA 4B71A 2OBNA 2RHDA 2GTPA 1HTWA 4M9XA 1E69A 4OQLA 1DTSA 2KWIA 2ZRDA 3GLHE 2EU8A 2ZTSA 3NBZC 4HDQB 4OI4A 1E2KA 4V0OA 3WRYC 1CJVC 3RRYA 3SJAA 4A9AA 2J7PD 2IX3A 5KDDA 3PV0A 5J4YA 2JATA 3K0AA 4NZYA 5FTKA 2ZRJA 2GK7A 1EXMA 4LZZA 5AJYA 3W6OA 4QHYA 3GJ3A 4LHWA 3G5UA 1VIAA 4MYCA 1NJGA 2ZYVX 3R9IA 4DHEA 1YZKA 2R2AA 2O8BB 1S3SA 1CF4A 2ZS9A 1YJ5A 3UMRA 4TYNA 4OHYA 3ZVLA 4B2PA 1JEEA 1J7KA 3K9NA 1ZRHA 2AK3A 4IDPA 5EXSA 3WNCA 4HLUC 4B47A 1X8LA 3OF5A 3WP1B 3IEUA 1D9ZA 5CM8B 5FBWB 4F92B 1N6RA 4G5SA 3Q85A 5DN6D 4Z8YA 3LQRA 1KDOA 5GJCA 2GCNA 2QPTA 3C14C 3MUFA 2JLVA 2G77B 2GKSA 1ZMXA 2QP9X 1SXJA 3X1DA 3NH9A 2A30A 2RGNA 3NKVA 1GKIA 2VP0A 1XD8A 2C2HA 4Q00A 3IHLA 4XSGA 3SYLA 1DELA 2CVHA 1XMVA 3OEHD 4B73A 1X8JA 4EJSB 3AF2A 2G1JA 2WWIA 3CO5A 1NG1A 3LFUA 2FZLA 3U4QB 3SC3A 1UM8A 1UJ2A 1B0UA 2BMDA 3KTAB 3A58B 3R8FA 1MH1A 1EX7A 3B9PA 3TLXA 4EPXA 1IY0A 3RWMB 1X3SA 1ZUNB 2YWEA 3QI2A 1XTJA 3K70B 4BUJA 4NYJR 1IJEA 3B82A 2WMOB 3PR1A 1NVXQ 1R8SA 2FFHA 2ZS7A 4NDZA 3GQBA 4NCJA 1ANKA 4HDCA 4PPFA 4CZ2A 1L8QA 3KQHA 2XOKA 2ZVQX 1IONA 5EZ5A 4IOLA 4PC1A 4DSTA 3FWYA 3K0FA 3KJEA 1KI7A 1OFTA 2OAQ1 4D4KA 4Z54A 1TF7A 3GJ5A 3VR6A 2O8EA 1SZPA 4A2WA 5L3QA 5IDVA 4MH0R 4UNNA 2QM8A 2H1LA 1N25A 4TMZA 2CL0X 4LCBA 5C18A 2QQ0A 3B1ZA 1KI8A 5KPDA 2FA9A 1SXJB 1ZM2A 1FZQA 1G16A 1VHLA 1E2IA 3AKYA 1OXXK 5JMTA 4A15A 2WPDA 4IFEA 4OJQA 4MA4A 4OI0A 2A5GA 1U99A 4LPKA 1Q20A 2FOLA 1JI0A 2V55B 4PR0A 1RRPA 4U00A 3C8UA 2IXGA 3U44B 5J5CA 4WW0A 3QG5A 1NP6A 3QIAA 2CLCX 1BIFA 1E9FA 1NLYA 2IK8A 3Q7PA 4FMDB 2DWQA 2VF8A 3LV8A 3U7EB 4LI0A 4R71A 1GG2A 2O0KA 2IYSA 4QFMA 5FI1B 4YMVA 1UBGA 4GOJA 1Z06A 5SZJA 1Z0JA 4A0RA 2GXQA 2PJRA 3EW9A 2GBLA 4DUGD 1U2RA 1GRNA 1ZAKA 3RS2A 1A2BA 3U3OA 2IF2A 3CNLA 1D5CA 2ONKA 4QG7A 1U94A 4RD2A 1Q22A 2D7DA 4DCTA 2KBEA 2PCJA 1WB9A 5DH9A 5K8TA 4H1VA 2AFIE 4EKDA 1O87A 3CRMA 4B3XA 4PO9A 3CH5A 5AK0A 2QM7A 2GILA 4BLTA 1T3LA 4OI1A 3M4YA 2XNSA 2P2LA 2CL6X 2IYYA 4EUNA 1YU9A 2IT1A 4B75A 2IEZA 3H86A 4US2R 2YNMA 4F4IA 2AHOA 3GJ4A 3V4FA 3WYGA 1S3GA 4ABYA 3QE0A 1NL3A 4C0LA 2ZSEA 1N2CE 1S4QA 3O8DA 3WYFA 3DMNA 1FW6A 1XCPA 5K8IA 4B35A 4JSTA 3DZDA 1NF3A 3WNBA 1E32A 4OJKA 4B3GA 3SJBA 2F6RA 3KJIA 2GHIA 4D0LB 5D3MB 4DCNA 4AK9A 1AKYA 3BB4A 1JECA 4JT4A 4NCKA 3AGQA 2GVZC 3H84A 3RWOA 2XJ9A 3AEZA 4OQNA 5HE9A 1E9EA 1MO6A 1ZD1A 4ACBA 1MABB 5B64A 2ZUCA 3PVSA 1KDTA 4YMSA 2O8BA 2O0JA 5EP4A 2FSFA 2EFGA 1WRBA 4Q1BA 2N46A 3VR3A 1J90A 1HT1E 2JLRA 3AVUA 1XZPA 2CHQA 4TTQA 4GT1A 5AR1A 3EA0A 4JL5A 1NG9A 4M2LA 3OE7D 4IEEA 4KU4A 1XXHA 3CUEF 3NBYC 1NVUQ 4ITRC 4V0LA 5J4VA 4HB0A 1P2SA 5E7MA 4KITB 4ZV4A 3CRRA 2WKPA 2HXYA 1CR1A 1OXUA 2GXUA 2CVFA 3HYTA 1CJTC 4HLDA 4H9GA 3IHWA 1Z07A 2UVQA 4MKHA 3LVRE 3RSLA 2NO7A 4FCVA 3TNFA 1OE0A 821PA 1P75A 1A1VA 4KBGA 4KV9A 3U4QA 1XJCA 3BERA 2EQBA 3C4JA 4WAUA 4Q19A 5SZIA 1N0UA 3IIJA 1S0UA 3DL0A 4GNKA 3BGWA 1S1MA 4D0GA 1EX6A 1U9IA 4O2LA 2HCBA 4MRVA 4XVUA 1GUAA 1PZNA 1E2NA 3IEVA 3VNVA 2VHQA 2ZYTX 1T5LA 2FX3A 3MG9A 5JJKA 1QVRA 1D8TA 3BIFA 1LF0A 1QHYA 3ZVNA 2YOFA 1US8B 2LKDA 4HZIA 2NIPA 3K0FB 2X8AA 4PC7A 1QHGA 4DDVA 4HLQB 1GKUB 1KNQA 1U90A 2J9RA 2WM9B 3WYAA 3K9HA 4EQ6B 1LW7A 4LYFA 4KFRA 4PSKA 2WZQA 2AWNA 4Q9IA 1ZM9A 5EZ6B 3QXJA 1WMSA 1KI9A 2D62A 4G5GA 1T0JB 1ZBDA 1ZP6A 2GVDC 1OT3A 1PUJA 1HA3A 1TQ2A 2ZI4A 4J0QA 3B60A 1DVRA 2CCGA 4YXWD 3GJ7A 1RPZA 1FTNA 4QBHA 1M7BA 3LDAA 4NU0A 2CMKA 1KKMA 3TW8B 1CR0A 3TBKA 2B7BA 1KMHA 4JLAA 3TVDA 3GLFE 1G8HA 4XH9B 4HAZA 3T15A 3Q5EA 1DO2A 4KAXA 4WBSA 1F2UB 2QL6A 1R10A 1EGAA 3TRFA 3EC2A 1G5RA 2L0XA 4NONA 3B85A 4XVRA 1H8EA 4NKRA 2J1LA 4IDOA 2YKGA 1ZD8A 3A8TA 2ZRPA 3QXCA 1D2EA 1IHUA 3TVTA 4DRZA 3FMIA 1GNRA 2GETA 2TMKA 2WIBA 3W3AA 1O3YA 2HYDA 2FJUA 2GJKA 2QMUA 1XTIA 1NKTA 2XSZD 3MSXA 4Q4AB 2Z43A 2NPFA 2W6IA 2RGXA 3KKNA 3OEED 1N5JA 2CE2X 2WMNB 4FI3C 4C0SA 3R9XA 4N1AA 3HYRA 4AIIA 2WWYA 1VMAA 1Z83A 1U8YA 3E1SA 4MGKR 2ZEJA 3U3KA 3ZLJA 1Z2AA 2ZJ2A 3LD9A 4KVGA 3CW2A 3MMPA 2HT1A 2F9LA 5E7JA 3TUZC 1OKKD 4L4UA 4L5BA 3QQ5A 1E96A 3O47A 1RKBA 5EE1A 2IA5A 3ZD7A 2R44A 1GVNB 2AKAB 2YC2C 3BE4A 2E1RA 4XTRA 4LX0A 1Q1BA 5P21A 5H8WA 4RKEA 1AM4D 2ZSFA 2VO1A 4CYMA 5JCPA 1LS1A 2EVWX 5FL7D 2XTNA 5UKDA 1N0VC 2FGJA 1G17A 4P33A 1WBBA 4M1TA 2O8EB 3FHOA 2X77A 3QVVA 3K0CA 3K70D 1G19A 2ZIAA 3HP1A 3Q5DA 3LLUA 3THWB 4Q7LA 3TSOA 2WICA 3TMKA 2PZFA 5EE0A 3FDIA 4RVCA 5IRCD 3ETLA 1E2GA 1DADA 3EIEA 3BBPA 4II7A 1CJKC 3T5DA 4HYYA 4OL0A 1UPTA 5KSYA 3P4XA 2ZRNA 1OB2A 2FNAA 3OAAD 5JECA 3KFXA 5EP1A 4CEIA 2V6IA 1Q12A 3TK1A 5FBLB 4BZXA 1VECA 1VG0B 3F8TA 3KZ1E 1SHZA 5FR2A 2H16A 3EWAA 1MR3F 3KQUA 1II0A 1OLOA 1KZ7B 4PSAA 2OCAA 1SULA 1ZD9A 4OHVA 4D4JA 3EC1A 1NJFA 1WQ1R 2VF7A 2ZR0A 2ZRIA 3W3ZB 2HT6A 3THOA 2PEYA 1TU4A 5CIQA 2ZE8A 4E22A 3P27A 2PZEA 2A5DA 2ASEA 2ZI6A 3T5GA 1P72A 4BFXA 4MRNA 1CR4A 1WCV1 4US1R 4OHWA 2R6FA 1RRCA 4BLRA 3K53A 2GK6A 3A1UA 2GJSA 4PZZA 5FR1A 1DEKA 1QDEA 1SXJC 1Z8FA 2XEXA 3GLIE 4DDTA 1YZGA 1GRQA 1UFQA 4XSHA 3EZFA 2ATXA 4QNRA 4RD4A 1HEIA 1XEFA 2W58A 4ZPXA 3K0CC 4IHQA 1IN8A 3GEEA 4XVQA 4YQFA 5JI3E 5JSZA 3ZS8A 4CEIB 4M21A 4JLOA 1E3MA 1GP2A 2EFHB 4UXIA 4NYMQ 4A6PA 5KU1A 5L3QB 3SR0A 1W36C 2O52A 1Z6YA 5E3HA 1GSIA 4BLOA 1BMFA 1X6VA 1KOFA 4QGHA 3OHMA 1EFRA 1N6OA 5FOXA 2O8DB 3U5ZB 1TEXA 1CXZA 2C77A 4JBYA 2IYTA 4TTRA 4B3DA 1XJ0A 1NVVQ 5CJ2A 4Z8XA 2NGRA 3CLVA 3THXA 1M8PA 5JS7A 3BS4A 3NC0C 4QM7A 3HJNA 4IDQA 3AP1A 3LW7A 2QMHA 3SFVA 1FX0B 1YQTA 5HPYB 1LTQA 2AXPA 3KJHA 4PSVA 4BFVA 3JZAA 2QU8A 4HDOB 2JCSA 3IKJA 2BOVA 4HUQA 2I1VB 3L0PA 2WIAA 5ANRB 1G8GA 4BFZA 2UKDA 4EPTA 2PCLA 4LC1A 5JS8A 3MGCA 3CM0A 1MV5A 1UF9A 1UADA 2AK2A 2XNDD 2WTUA 2OE2A 5CITA 2J45A 1UEJA 2DHRA 1ZYUA 2OXRA 4DZZA 1E98A 2HUPA 3L0OA 5KDLA 2W6ID 4U5XA 4PC6A 4K81B 4NH0A 1E79A 2XAUA 3SHFA 5B57C 5KNBA 3WBKA 2Z4RA 5IF9A 3FGNA 4BLSA 2PEZA 2P67A 4LYJA 1TX4B 1EWQA 1N0WA 1KI4A 1XZQA 4OK3A 1M34E 1F5NA 3LY5A 2AN9A 4IVRA 1M6NA 3L8YA 2F1JA 1UDWA 5TVKA 1XD9A 4IXMA 4CEHB 1ODFA 3KKPA 4C4PA 2JJ1A 4C2TA 2IYUA 3CBQA 1KAOA 4RKFA 1JJ7A 4TLAA 4DCVA 4BLQA 5KUTA 2GAAA 1NSFA 4XTCS 2EYQA 1JPJA 2GRJA 2DR3A 1YRAA 4IDHA 2QY9A 1QHSA 4FCTA 4DLYA 4Z1MA 1Z08A 2PLRA 2J0UA 3H2YA 4NMMA 3D7MA 1VIYA 2FFAA 3WP0A 2IXFA 4MRPA 1W7AA 1MO3A 3ONWA 4BASA 3QY0A 5CYOA 1R5OA 1COWA 1KO8A 3THWA 3CPHA 1WDTA 1P9NA 3AVTA 2PZGA 3RSOA 2JLXA 1E6CA 1LF5A 3IPXA 2OG2A 2Z4SA 3HDTA 1J99A 2F3RA 3VKWA 4D81A 3THYA 1Z3IX 4FWTA 2OBMA 1E79D 2ZROA 3X1YA 1Z28A 5CLQA 4DLSA 4MRSA 1TL7C 4A36A 2ZE7A 4L9WA 4TSFA 4E07A 1XPUA 1E2PA 4ZDWA 1A2KC 4B3FX 1F2TB 4B76A 3TW4A 4PZLA 4CEJB 4TL7A 3G0HA 2HV8A 4CIDA 2NOAA 5G41A 4CF7A 1QBKC 3DPUA 3KJGA 1E0JA 3AVPA 2RGCA 2QPAA 1G64A 3PUXA 2R8RA 2X2EA 4TLDA 3BD9A 4P4SA 1XJQA 4JLJA 4Q9HA 5AJVB 2YV5A 1UBFA 2Z0MA 2C9CA 1TMKA 3QPWA 2SHKA 3AF1A 4Q02A 2FH5B 4DLRA 4KXFB 2ZI9A 1EFRD 4X8HA 4Q48A 5C2JB 1D2MA 4D2IA 2DFNA 5CJPA 2BBTA 4PPQA 3EASA 3TR0A 4ZDJA 3GP8A 4FCWA 1FNNA 3UG7A 2Z5FA 3B5JA 2QRNA 1NNEA 1H8ED 1I4LD 3I8SA 4EDHA 4B6FA 4NTZA 1P5ZB 1TPZA 1T9HA 2H8KA 3L82B 4TQAA 5AJWA 3U2QA 4AWXA 1XBTA 2G0NA 4NCIA 5JSZB 4B6EA 5EXPA 2IUSA 2RGNC 3BFKA 5HE8A 3RDPA 2IBMA 2R6GA 3LX8A 2QBYA 4PC3A 1M74A 4Q1AA 1OW3B 1E0SA 3QPVA 4POAA 1CJUC 4HUQB 5CDFA 5B30A 3U6BA 3O8RA 2JAQA 2RGDA 5CYPA 2VP2A 5K8UA 2ZRCA 3VAAA 1IY2A 3NHBA 1IXRC 2BJVA 1VDZA 2CJWB 3PEUA 4LGMA 1N6KA 5FBQB 2BEKA 3TSZA 4EQ6A 5JBQA 3ZJYA 2GAOA 4JLNA 2MMGA 2F43A 3L2OB 2IUUA 2QEQA 4DWJA 3T1QA 4ZCIA 1HV8A 1FL9A 1NBMA 4RFSB 4F38A 1E0AA 3OIYA 1ZC4A 2NO6A 3GJ8A 4G5QA 1GAJA 2G1KA 2REXB 3AP2A 3EZ9A 1CS4C 5HZHA 1IN4A 4IJMA 2D3WA 1SKQA 4QBIA 3UWOA 5ELXA 1JR6A 2VSXA 5FTLA 3A1TA 2QTVB 4FMCB 3SOPA 1S1CA 2PLFA 2VQSA 3FFBA 2QENA 4A82A 1L4UA 5FUVA 1VCOA 4C30A 4BEBA 2QP3A 2WAYA 1RJ9A 4LOAA 4DVGA 1WE2A 3A36A 1CLUA 3CWQA 2ORWA 3R9WA 5HR5A 3WHLA 1CJMA 4Q66C 2H92A
chains in the Genus database with same CATH superfamily
2CXXA 1IK6A 7MDHA 4XFDA 4ODIA 2XUOA 5H1YA 4C4RA 1QQ5A 5IBRA 3LNCA 4K6FA 4DWWA 3HLTA 3PYMA 4N01A 1T1EA 4EVIA 5TPZA 4PS0A 5LBIA 3CNOA 2WHXA 4DBLC 1QPBA 1GTVA 1OI7A 2BHNA 3AEKA 4X61A 5CA0B 1JU9A 1ZOIA 5FOQA 3EQ6A 4R1PA 3RO7A 3I8OA 5I7SA 5GINE 2ZG6A 5JYBA 3PT5A 3VTFA 2P75A 2WVAA 4B83A 4Q4CA 1QWOA 2WDZA 3MWKA 5B7GA 4AP6A 1PFGA 2ETVA 2CNKA 3MB5A 3RBZA 5LMZA 1DKPA 3N9IA 2GFHA 2BMEA 3GUCA 4MNTA 5LIPA 3R3YA 3SHOA 4JQYA 1D2CA 1E9AA 2BVNA 2IF0A 1MEEA 2VI5A 4RCYA 3AHDA 4QXAA 3UG6A 5ILOA 1TIBA 3DZJA 2J5KA 4RBNA 4BTVA 5IULC 2G6BA 2XWQA 3ICWA 5B5SA 4HTFA 2BTOA 5LXTA 2BGWA 2JFXA 3SFZA 3FBGA 3HGQA 3JASA 1PGOA 3VR5A 4C89A 2D5LA 4WXPA 1F8GA 3X2SA 5F3WB 3N8NA 5B1EA 5DCYA 3V6LA 1RTTA 4CLHA 3EARA 1R6AA 1QGDA 1Y5NA 4WOPA 5CDTA 3U56A 4XJSA 5C31A 3RAEC 3F6EX 1KYIA 3V1YA 1DAGA 3E3NA 5K2OA 1PBTA 3OZIA 1SBYA 3IXMA 3FI0A 4NCHA 2EW1A 1P61B 3DJYA 3MJSA 3WG9A 2DWOA 1J2EA 3I2HA 4PSCA 1SKBA 1C9MA 2HKIA 1C1XB 2HHAA 2Y93A 3ZWYA 3CVYA 5BSTA 3QEAZ 1TEVA 1IB0A 3EVFA 4B45A 5DSZA 1AXEA 1VSTA 4EZBA 1GN8A 3SEZA 4A8JB 2PPLA 1A04A 4L72A 4OSEA 2NSDA 5BUQA 6Q21A 1T8TA 2CEKA 2R4QA 1Z0KA 3C98A 3ZI4A 5JAQA 1OFGA 3EZGA 1A5BB 3HRIA 1IEQA 5DLQC 1BDJA 1HT3A 3ZI0A 3WK4A 1Q74A 4TYPA 2B4RO 2QX8A 4AWBA 4ZYVA 2C04A 1W2GA 3PKZA 4O4HB 5GY7A 5E4JA 2PRKA 5KSOA 1DO8A 2YMPA 4C4XA 1O5TA 2JHPA 2R5NA 3KRTA 2IEDA 3N86A 4KIFA 2P9QA 4R98A 1Q7RA 3D02A 3FOFC 3GPLA 3H04A 1X1SA 5EJMA 3QX7A 1LDEA 3W9YA 3CJQA 1Z0IA 1H2WA 2VNIA 3ICCA 5REQA 3G23A 1J2YA 5A0VA 1IG0A 2W2MA 4E4RA 3RRZA 3CPJB 2F43B 4MULA 3VR2D 2ETXA 3EZLA 1QXSA 4KE6A 4KXYA 4N40A 5LXTF 3RARA 3VHXA 3QH4A 3TE6A 1QQTA 2GI4A 3AHFA 4EMSA 2SKEA 2ZBDA 1X2EA 2AJTA 4NFHA 1NM5A 4NV3A 3WLJA 2RD2A 1JFSA 3S68A 1ACLA 3KZMA 3LA6A 1OIVA 3AY3A 4EH1A 1AN9A 3GUHA 3T4UA 4FX5A 1LJ8A 2B8NA 3FTPA 4ZGGA 3JV7A 1P2DA 1EFTA 3CXRA 4M8SA 5E6RB 4A03A 4BYMA 2Q8PA 3F6PA 5HFJA 2AT1A 1Z8HA 2EBUA 3QWIA 3JQRA 1WETA 2ZPUA 4MR9A 2OFWA 4E4YA 1P5HA 1TGVA 3HXLA 1FRQA 3WHKA 5CLLA 1RWKA 3HVKA 4XCXA 1WXIA 1K8QA 2HA3A 3I28A 5IM4A 3IQWA 4UW9A 1H5UA 4W5WA 2PJZA 1H69A 4JLUA 4UVHA 2W6JA 3SIXA 4JKIA 1K7SN 3D54D 1HG1A 2C5SA 4N54A 4O2AB 3LE8A 3UAZA 3PEYA 5AOCA 3L8ZA 4F93B 2JD0A 2QTGA 1IN6A 1M8JA 1U0JA 3C3PA 1W0KA 5KYTA 5KYYB 4GGOA 5JFTA 2H9AA 4JHLA 5IVPA 2OXFA 4KVFA 4EHKA 4MUBA 4RIHA 3EHEA 4TV9B 5IYZF 2B8TA 1QG2A 3OE4A 3PK0A 2Q2OA 5EQDA 1W76A 1N1DA 3L4BC 1RRVA 4XVHA 5DI9A 4NI5A 1R37A 1VE3A 1KVSA 3GT0A 4AF6A 1U2QA 4AROA 2NMVA 3ZV4A 2VZ0A 4QDUA 2O5EA 3I6IA 1Z17A 2ZBFA 2JGDB 3K1AA 3T7JA 4OBXA 3FTQA 4PPYA 1JKMA 3AM3A 1QKJA 4EOGA 2Z08A 2XA9A 5JS6A 2BMJA 1Z6TA 1TA9A 2IS1A 1KO7A 2BELA 2OFXA 4I8XA 2UVDA 4UU7A 4YP6A 2ZI5A 1L5OA 2VHWA 1SCJA 5FL7A 1K86A 1WXEA 2ZJFA 2ACVA 2IYOA 3OE5A 3PXEA 3S2UA 1SB9A 2DYKA 1BDBA 4ZU1X 2FKNA 1GUYA 4FGZA 3SYNA 2RHHA 2QBYB 4KZKA 2ZQZA 4GUAA 4JXJA 1IM5A 5LB2A 5J2TB 4PPNA 5ENDA 1AK2A 2OEPA 1N4DA 4X71A 1FFEA 1NNI1 3WBBA 1LNSA 4ZPJA 1WW2A 3WSTA 1YR8A 3OTHA 4QVKA 2XB9A 1UC8A 2XA2A 4NICA 3VU3A 1VSVA 2O1XA 3KUKA 1K27A 2I4IA 2VQ3A 2Y8EA 4OQFA 4H15A 3SC2B 2A84A 1DIAA 2AJCA 1NMXA 3NEYA 3NHRA 4N8EA 3DFIA 5FFNA 3DTVD 3NEPX 1FXUA 2A3RA 1P31A 1GQOA 3H2GA 3ZS9A 1OWMA 2BFCA 1XMPA 4S24A 3WB1A 3FMOB 3T7KA 2HMYB 1B0PA 3TJZA 4D26A 1E92A 3LDGA 4BBZA 3UUWA 4J90A 4E5YA 3MJ4A 4OHFA 1QX3A 4HFRA 1ZISA 2ZVJA 1VI2A 4MV5A 4DOMA 2QAGC 3R4VA 2BE7A 3RHTA 1IOVA 1TW2A 1Q95A 3G2QA 2G9UA 3JYQA 1UH5A 3P32A 3F5DA 4Z9FA 4D57A 1BA3A 3EXEA 4FYYA 4MQEB 1HYGA 2VSYA 1JKJA 1QIDA 2HSJA 2DWPA 3I39X 3MFQA 3DV9A 4MS1B 4NZZA 4R6XA 1KDRA 1RZ3A 2X7JA 1C2TA 1NVTA 4G41A 5JZSA 1IMOA 5ALKA 3A27A 2EJVA 1SUPA 2IYZA 3SEQA 4G1UC 3V8BA 2ZJ6A 3N76A 2O8VA 4EAAA 1ORVA 3LHKA 4EG3A 3IO3A 1HL3A 4MUNA 1XTRA 3B78A 4GP7A 2EX4A 3IPYA 2QDXA 3HRHA 3KBBA 1TCCA 4XWYA 1NU6A 3B5IA 4F8JA 4XUEA 1BX3A 1OVGA 4BVLA 1WHTB 1RLUA 4UASA 2QMOA 4JDPA 4DQDA 3HI6A 3JSXA 2QNRA 4HATA 4WASA 5IK2A 1Y1KE 4NBNA 5AVOA 4TT3A 4F2WA 5BQ5A 4MQMA 2IRWA 5EHIA 3DBHA 1I32A 5G02A 4IJ6A 3BGDA 1DRVA 2MTBA 3UT0A 4UZFA 1H0HA 1U0GA 2OBBA 2QMEA 3T3IA 3JQ9A 3RB8A 3GUZA 3BWCA 1GZSA 2C7OA 1Y42X 5CT9A 1WF3A 2C0PA 2QDKA 3TQQA 4DJJA 4C6TA 2AEJA 1WU8A 1LRJA 2P0AA 2ZSJA 3KFLA 4Z1OA 1V47A 4C03A 2V97A 4P4TA 4YPOA 3G2NA 4XRGA 2P6PA 3E9RA 2WAOA 2ZIZA 1TM1E 3F98A 2ODPA 3L46A 3QX9A 4LV8B 4TL8A 1JIXA 2J6CA 4JL8A 4D9EA 3B6IA 4OGLA 3ZWMA 5AJHA 1WZ2A 2F3PA 1XCLA 3IIIA 1DRWA 4MIEA 2BP7B 1X7HA 4FJ2A 3ZWXA 1H93A 4OYYA 2CZQA 2QZJA 4PZDA 5ALQA 5DHPA 3WLSA 3ROXA 1NM5C 4E1VA 1V43A 3ZCXA 3BRWD 3C24A 5J9FA 4AJ2A 1EINA 4FFSA 1E2LA 3B8HA 4PRZA 1I4EB 1MJNA 4MKGA 5LXTB 2XRFA 3PUKA 3QU9A 1ZJ4A 2OFFA 3KIPA 3OZ7A 4GPD1 3MS4A 5K45A 1SB8A 3I4CA 1J1ZA 1UP7A 2YZNA 1A5ZA 1IY1A 2PIDA 3HR7A 1N75A 1UPXA 4IDGA 4LVOA 4OK5A 4P2BA 5LKRA 3C4QA 4EPTA 4WY2A 5KQRA 4X92A 3TQCA 2W4IA 3Q7QA 3EVEA 5CGZA 4Q21A 5KTTA 2BEWA 4KLCA 5EZQA 4GEKA 2X2FA 1MRSA 5J2UB 3QKTA 3N2LA 1NW4A 3K5HA 1TVMA 3B9QA 3NIBA 1PU2A 5DU2A 2YH2A 5K6TA 1M1YB 2JAUA 3FYUA 1W5FA 1L7EA 2JBHA 1FUYB 3PA8A 1V8BA 1WS6A 4GKVA 1QIKA 4J1TA 2V4UA 3TI9A 6GPBA 5I4KA 2EDCA 1TUGA 3QI7A 3NHUA 4R69A 1KXZA 3WGJA 2P6RA 4BNNA 1H0KA 2K5UA 5BNTA 3GCXA 1YBFA 2QK4A 4TMWA 3ADBA 3O8CA 1SBQA 1ORWA 2JCXA 3A9RA 3PX3A 4HDKA 3I6BA 1MJ5A 1DIHA 2OWDA 2R1UA 3JARB 4HB2A 3V8EA 1OZ0A 3TLCA 3Q7IA 3X3HA 5JMWA 3GZNB 3BSSA 3CFYA 2UV8A 4JAVC 4XQEA 4DA4A 4W5RA 3DVLA 4IDCA 1J56A 1KEZA 1O2DA 2B4QA 2Z56A 2AN1A 1T4GA 3OF2A 2X42A 3R77A 5DK4A 1H6BA 2OCDA 2VYVD 1OF1A 3G5AA 2IOYA 1SU8A 3PENA 4ER5A 2AL7A 2AQ8A 1THGA 3IOYA 4KMRA 1BFKA 1RCUA 1RI3A 5ERXA 1JQBA 3OURA 5REQB 3ZLTA 2I1QA 3RABA 1XYVA 2GN0A 2OQRA 2MYTA 4H3SA 3SEAA 2V0GA 3PEWA 1K97A 4EGAA 2Y1WA 4HQRA 1HG0A 1XR3A 3AV3A 4RD1A 4P83A 4PZPA 4OHOA 4EJ6A 4X62B 2XRMA 1KIMA 1WCYA 4OMUA 3U9LA 3ZKWB 3GVHA 2GOYA 5EQTA 1Z38A 3DTYA 3LS2A 3Q3IA 1SO8A 2BM9A 3HBJA 4PZAA 4PN3A 3FSRA 1DZ3A 1B8VA 3P71T 1QX4A 1X86B 1Z5NA 1WUYA 3IAS1 3K72B 3OWOA 5HHTA 1X7ZB 4OQQA 3TCXB 5E2BA 1ND5A 2Q5OA 2EJUA 1YB2A 3IT0A 1U1DA 4DV7B 3D3QA 5KHLB 4WL0A 4NHEA 1EA7A 4M55A 4FYJA 3FMVA 4NZOA 4S1OA 1T13A 2QE7A 3CKMA 4V0KA 4UC0A 1ZJZA 4G67A 4BBPA 3V4PB 2QD5A 1M7HA 2FQ1A 4CDMA 1BHO1 5DWVA 4ZYWA 1ADBA 1XFAA 4M98A 3V4OA 1I7QB 2FR0A 4NENB 1KFCB 4DNPA 2WU8A 5A7FA 1Z13A 1YR3A 2FWNA 4O2AA 5TY0A 4N3AA 5HMLA 4JR0A 3D3EA 4G5YA 2GM9A 4CTOA 2X4LA 4BL5A 1ZKMA 5G0SA 5CFRA 1TYZA 3X44A 1JSZA 3V00A 3VR1A 3OH8A 2OOKA 4KQWA 5HKBA 1L3IA 2GZMA 2C2KA 3OJWA 4F12A 5HM6A 2I4TA 4ASUD 1X7GA 4G0UA 5AJUA 3PGVA 4JMPA 3W34A 1WXWA 4BNUA 3DAOA 4H4CA 2WKWA 1KOLA 3ZXIA 4XUCA 2PKEA 2FPGA 4M0FA 5TJHA 1WVIA 3BKXA 2PM8A 2W6MA 3VYWA 2VAMA 3WJ2A 4B3RB 5EPOA 3IODA 3SYKA 1VJCA 2I7XA 3D3WB 5ECWA 1TVEA 1OIWA 3H42B 4II2A 3G7SA 1UC5B 3S1SA 3BBLA 1A95A 2AW3A 1A8SA 2QRMA 5ALEA 2OK7A 2IGTA 2VC2B 2WFLA 1B0ZA 1L5LA 2PS3A 2Q3DA 2E5LB 4XOUA 1EU1A 3MJEA 2BI8A 2VVTA 4X3CA 3RS0A 3OFNA 5EKTA 3V3TA 5J4KA 5DNYB 1O5OA 2R62A 3L7JA 3TM5A 3FUUA 2ILVA 5AHWA 2PLAA 3EMBA 3IP7A 5M5BA 1ZOPA 2ZAYA 1E1YA 1YI8A 4J3FA 1W5SA 4I2NA 5G40A 2V6GA 4J0DA 3UJAA 4NZMA 4MQBA 1CETA 1H2EA 2C07A 2GBCA 4JLSA 3TXXA 2O3TA 2DPYA 2X14A 4ILKA 3VVLA 1XA4A 4QFDA 1B3BA 3ZGXA 1U8EA 4XGIA 4CMKA 1YACA 2WKQA 3WYEA 1GQSA 2CFOA 2HRCA 4KVAA 3QE2A 2E18A 1EZ1A 1OTXA 2CJPA 2FDCA 3U7GA 3ZWAA 4JBXA 4G5HA 1I30A 3EVCA 2VAPA 1LSSA 4M76B 1SCBA 2YTZA 2XCRB 1VLZA 3I0ZA 1JQ5A 4LBYA 4HKTA 1UBSB 2QTRA 5JADA 5A3RA 5DTMA 3ZCUA 4MW4A 3KHSA 4BKQA 1Q0ZA 1TRHA 4ZO7A 1RYYA 1QH8A 4G26A 4BO2A 1CJSA 4HGPA 4G1VA 3RT1A 3T94A 5LA6F 2A78A 1N2IA 5JCOA 4A4DA 5DHRA 5DOZA 1PJQA 5EGNA 5DN6A 4GX0A 1PFYA 3W2EA 2GDJA 2XI4A 4V3CA 1M1YA 3FYUB 1I8TA 3ADDA 1TMYA 3FRJA 5AXAA 4UU8A 2IP2A 3KAJA 1JB1A 1FYWA 5CLFA 1XE3A 2XITA 2ZYSA 2OG1A 3LKZA 4M38A 4RA6A 3UAXA 1MD9A 4F0JA 1DLJA 2Z1DA 5C8XA 9GPBA 2DG2A 2J9YB 3IPCA 5JQGB 4CR6A 4EW2A 1GEGA 4EO7A 3OZTA 1IOZA 1NFFA 3FFXA 1QR6A 1F38A 4JBLA 4QNNA 1JVBA 3BGVA 4YMHA 2EGGA 3MOIA 1QVAA 4LS3A 1KOJA 1IM2A 2A2ZA 3FMPB 4IZHA 3KOOA 4RZUA 5EIHA 3T7AA 3T3NA 1BX0A 1W88A 3NUZA 4GDMA 4TYMA 5C4GB 4HEQA 1OHHD 4H7KA 5AW5A 2XA1A 5K8VA 2VDWA 4ZV9A 4OKSA 1LGYA 3NGLA 4Y6SA 1NAHA 1DV1A 1G55A 1GFZA 4NK4A 3REQA 1GJRA 1QHFA 1YULA 2CXRA 2MSDB 5BSMA 2WAAA 2QX9A 3NYIA 5YASA 3IQXA 4KXLA 3WMEA 2JLQA 2RH8A 3B36A 2ZPTX 3F4KA 3LPLA 3ZDFA 1SKYB 2BGKA 2ZT6A 4NAUA 4D3SA 3LAWA 5T3YA 3DLPX 1ZN2A 3HSSA 3V9PA 2NTEA 1FMJA 2WABA 3M5PA 3TIGA 2ZR7A 4TXJA 4WK2B 3ZGYA 1NBIA 1SFRA 1N1EA 1P2TA 4WNAB 3FOZA 3IEMA 3HO1A 1ZA1A 3E0XA 3SP1A 3IAM6 5K20A 4HDAA 3AIMA 3O74A 4BO6A 5IJ0B 4C2AA 1L5RA 1CY4A 1HDOA 721PA 3BDVA 3HN7A 4MCAA 2WP0A 1LSOA 2Q4TA 2WJWA 2N9UA 3QXXA 4CLEA 1F4VA 4MLCA 4GKAA 4R9RA 5B1DA 3LUFA 4UTOA 5TV2A 4A2PA 1WU7A 3NJ4A 5CHYA 4ZMRA 3SXUB 2ZOSA 3DE3X 5I7VA 2IYQA 4QJ5A 2O05A 4YACA 3TLMA 3MTEA 5JH7F 5FADA 3J81k 3KR2A 1GXSA 1KI6B 2ZDHA 2XLCA 3JQGA 4KIUA 4OB6A 4B80A 1X38A 4HHEA 4ZGWA 4I99A 4PAMA 5I7UA 4M87A 3F6BX 1FY2A 3ZHTA 4MWEA 4ESVA 2HD4A 2D2EA 1GU0A 4QBGB 4JYZA 3ZBPA 2ORVA 3MT9A 3PWKA 1T6ZA 2AR9A 2XQFA 1N32B 4RANA 1Z4QA 3LYLA 1XNJA 3H9EO 2JGMA 3SIWA 5IC6A 2VTKA 2V54A 2AXNA 4XDHA 4A6XA 1NJ2A 2VF2A 5EHGA 4MGZR 3BTVA 3OX1A 2A9OA 2DPLA 3K09C 4EDFA 2WF6A 4WLOA 1SD2A 2VK1A 2RBEA 6NULA 3I5MA 2B99A 3SX2A 1XMJA 4A7PA 5JS1A 4ETMA 3GAAA 2FX5A 1JHXA 4E11A 1AN0A 1QIGA 1ZK2A 2H7CA 4TLEA 3GN1A 3SZRA 3T8YA 5GVSA 3GI1A 1X92A 3G8AA 1X1QA 5DHQA 1IK4A 1O96A 1PBNA 3PUVA 4BMNA 3KPWA 2FQQA 3ZLBA 1XROA 2I2WA 3ZJVA 3IDQA 4RFVA 1GZ3A 2XQGA 3CEJA 2PX8A 2X9GA 5LJLA 1E1QA 3VPCA 2JFVA 3DL4A 1CUIA 1DU4A 3I92A 3Q10A 3RUCA 5BT9A 5AFSA 1P1RA 1TZKA 2B2CA 3PUHA 3BMCA 3FI9A 7REQA 1QK4A 3NALA 1X8KA 3AEXA 3R5SA 3JSAA 4I4CA 4LWQA 2OMKA 4QJ4A 2R85A 4RZXA 4YPFA 4NS4A 4LG1A 4E88A 5AUOB 1SXQA 3W78A 3ZZUA 2HREA 3GLHA 1K7YA 3DE7X 3NPMA 3TWOA 2D7CA 3LBAA 5BSHA 1PR5A 4F91B 5DLEA 3UPTA 1G8YA 1E18A 1IOWA 2VYVA 2QVLA 3UPUA 5A1TA 3LY7A 1H4VB 1YKFA 3N1UA 2J3JA 3WXBA 1Y48E 2Z3ZA 5IMBA 5A6VA 1KIFA 1C80A 1OPXA 1BQ4A 1JDZA 1A4IA 1W1UA 2VPTA 4J0EA 4MCIA 1RI2A 1NR5A 1V95A 3W1VA 4PGHA 1E3LA 4BWGA 4H31A 1IXZA 3A6JA 4IOMA 1KYZA 4TQ9A 2CXTA 1MEOA 1SBIA 4K9LA 1X9IA 1W36B 2A9QA 2I54A 3REFA 3KPUA 4HV4A 4LXUA 5IU6A 2HEGA 1E1RA 1ZW6A 1SEPA 3F2IA 4R0MA 1JQKA 5KTOA 2W2LD 4C0BA 2QA5A 1FP4A 1Z12A 2VPYA 3UQYS 3WS7A 2NZYA 3H05A 4J91A 3SQOA 5LD2C 3AIIA 3DOFA 5D8DA 3ROQA 1RJWA 2NU6B 1M5UA 4OIFA 5ALSA 2P7HA 3PQ7A 3V1NA 2H5EA 3J7AC 4DLTA 2FPMA 5HUJA 2PE5A 5E6RA 4EA8A 4C3OB 1BFUA 3UUEA 3W8DA 1DQYA 4EP1A 2IU4A 2JCBA 4MR9B 3L7YA 4RWZA 1FP7A 4HXGA 5JJBA 4R5HA 3HPQA 4RSMA 3Q6MA 2DFTA 2GCPA 3JQ6A 4W1PA 1M2EA 1YZFA 4DUPA 1FF9A 1ZIOA 2UYCA 4CEHA 1KS9A 4AY3A 2JC3A 3HJGA 3RC3A 3BWMA 4EARA 4FNMA 3TOCA 5I9NA 3BG5A 3CSUA 4DV4B 1C4XA 6ADHA 4IWYA 4BN5A 1UBHS 2WE8A 3HEAA 2WWTA 3RD5A 1Z6AA 2QL7A 4FINA 1EP1B 3F5QA 3FTDA 4F85A 1EWRA 2XZLA 2BGRA 4DABA 1WCXA 3TKAA 4DQ0A 1IVYA 1FDWA 1N9GA 1OWOA 2EKPA 1H2HA 1ZIYA 2F8MA 2J07A 1RCTE 3CUVA 3PUJA 4QU5A 4FK8A 3BXXA 2B69A 2ZSUA 4EHHA 2A5JA 5BY2A 5JVDF 4KGVA 5DRYA 5A02A 1F8FA 1THZA 1PDVA 4MCHA 2DUUA 2QD1A 1E3WA 4UHFA 4UREA 1BWQA 2WF7A 1UMBA 2OCKA 2VK2A 4P4UA 4WOJA 4HK4A 4TVSA 3OIVA 4XW2A 4GYYA 4KEAA 2HHJA 4M8KA 5AKGA 3CIOA 4PBTA 4ISBA 4M1YA 3M8KA 2I29A 3DAGA 4U02A 3INYA 1RHUA 4K28A 1L5GB 1ADJA 2WINI 2BKEA 1N2JA 1ZVQA 3U4MA 4FFLA 4NU6A 1JXMA 1E1CA 1L1QA 4IXTA 1HYHA 2K7ZA 2IW3A 3FNFA 1REQA 3CTPA 1W0CA 4H0CA 4BGIA 2PYZA 1QBGA 2H1CA 3EJ6A 3BWYA 4DM3A 4K0RA 2D1RA 4ZFNA 1VJRA 3A9UA 3P9KA 3D0OA 3R7NA 2V74B 4EG6A 2O50A 3DTTA 2C57A 3EULA 4WWHA 3EYWA 2O8FB 2EWWA 2YHBA 3D43A 3KR9A 3T52A 1I3KA 4FZVA 2V7WA 2BFBB 1JALA 5L4NA 1QH9A 3FR7A 5JZMA 1DKNA 1JBKA 3E2PA 1AQ6A 4TRNA 1KMCA 4N7MA 4IOJA 1CV2A 3A06A 4LUCA 1MEJA 3ENKA 4GYKA 4PGFA 2I2AA 5CDGA 4YBRA 4ZCMA 1DRKA 2ROQA 4L02A 5U4QA 2D4AA 3ADKA 3DZIA 4R8LA 3UW3A 2FKAA 3JYLA 4PHGA 1MB4A 1ONBA 3PQEA 2YFHA 2R97A 2C2WA 1ECPA 3B6EA 2X9VA 4RSHA 2BC9A 4X8MA 5A6SB 1NIJA 4PO3X 3IBTA 3WNDA 5C1BA 3ZBQA 1BU8A 2GJ4A 1NKSA 4LXTA 5BO5A 4R2HA 5FTMA 1SVOA 2CKDA 2ZTHA 5HDBB 1ACJA 4FYPA 3TAUA 3MCTA 4A23A 3GRFA 2ZIEA 1O4VA 1U98A 5EERA 2MDTA 2EATA 3C43A 5KOJB 1CB0A 5CT8A 2A0WA 1PWHA 4L5JA 3M1AA 2LW7A 3T61A 3MT8A 5HRUA 1M67A 1MX5A 3EE6A 3X2FA 3WFJA 1BKSB 1KY3A 4O0MA 4Q1VA 3BORA 3RTBA 4KXQA 4RQBA 3NONA 5HIMA 2GEUA 2Z5GA 3HNPA 3RBXA 1Z22A 1DQNA 3NHZA 1UT6A 1FYFA 3I53A 2FZ5A 4H7PA 4OLFA 5BRAA 3KELA 5C7OO 2HC9A 2VZEA 3TUIC 2ODTX 4C7VA 4ZVNA 3F73A 1XLWA 1TZ2A 2ZB8A 3TD6A 1R4NA 1Z29A 4HZUA 2H4JA 3B3JA 3SE7A 2ERYA 2WE7A 1IAQA 3BAFA 1NMZA 3RBVA 5KNDH 3W9BA 1XRPA 4UBJA 3MJRA 1ZJWA 1C5KA 2MMCA 1EK0A 3UJ7A 3PC7A 4ZANA 2FPLA 3QFRA 4FYIA 4HZGA 3FYDA 1R0RE 1M66A 2AWOA 2MSWA 3CCCA 2PMWB 2R9VA 1M3SA 3MM4A 4GMGA 5CUQA 4C3ZA 4QJ3A 4YCLA 2XCUA 2BP7A 4U4AA 4GBGA 1DQZA 4MTCA 5LOVF 2ZXEA 3EUAA 1NW3A 1ZH8A 2GEKA 4X64B 1AS0A 2I4MA 1D1SA 3DD5A 1QZZA 1FS5A 4TTSA 4RMNA 3ZDQA 4F06A 1O94D 2AFVA 4LCEA 3L4SO 2CNDA 3MIIA 3SJCA 1KY2A 3H6KA 1S8FA 4M0DA 2PJUA 2KI5A 4WFQA 1CYDA 2X0IA 4U3JA 4H2DA 3OOEA 4OYHA 4G0VA 3FKSA 2CCKA 1VCIA 2QN9A 3SZLA 4C0KA 2PA3A 3GGCA 3D81A 1U1EA 2DBRA 4IVPA 3FLMA 4UVIA 5KYWB 3C2QA 3QV2A 4QGGA 1HGXA 4IICA 3GAZA 1OUMA 3U5TA 2EGUA 2A57A 5G53C 2L17A 3PUIA 1GARA 3EPJA 1M1YE 4BQNA 4HDMB 4I1YA 2RCYA 1XAJA 1GPMA 3VRHA 4ARZA 2XE4A 1BAPA 3CGWA 5J2UA 1AHPA 1BH2A 4UNQA 2O8CA 2I6SA 3A4LA 3L0ZA 4GFDA 1EG7A 1UXGA 4GBMA 3V4SA 5FUMA 3A11A 4YMUA 2QZ4A 1EKXA 4R1NA 5B2FA 1GYRA 1X7WA 4E6PA 2MIIA 4G8BA 1NWHA 2JL1A 3CH6A 3GDOA 1Y3FE 2GPJA 3G0IA 4FYWA 4MDEA 1H2RS 2EQ5A 3O82A 3VNRA 4ATNA 4K0KB 3R3JA 1ARZA 3EDCA 3RS7A 1BJTA 4G56A 5CNKA 2YVQA 4FXPA 2R3SA 4TT3D 5CBKA 4RACA 2ZSDA 2JH9A 3SBEA 4CJXA 5HKKD 3KKMA 3QBTA 3AIKA 4JZYA 3AVVA 1RRMA 1INLA 2Q9AA 5BVHA 5L7TA 4KR7A 2ZYWX 4YI5A 3LH5A 5KNCA 3AY0A 1ML4A 3A3NA 3TPFA 3VSDA 4Z1MD 3ZXXA 3NUGA 4ETIA 4F3NA 4BJ3A 5BP7A 1EB9A 1YZLA 5ALFA 5E7QA 4LJAA 1XMOB 4OXIA 4JYBA 2JFFA 1XTKA 1UJ6A 4YRQA 1DSSG 4W6QA 1EUCA 1OXSC 1KE2A 3EGOA 3Q8XB 4EB6A 3HMQA 1HFEL 4AZTA 3QKIA 5HQJA 3DEYX 4N12A 4S2UA 3BCRA 3I1YA 3NEAA 5B2ZA 1HNWB 4P3PA 4YCMA 2BFOA 5JO0A 1XTUA 2QYSA 3OU7A 1KSJA 1U7DA 1FYDA 2AZXA 2X1HA 1G6KA 3KUDA 3P0EA 1RE0A 3CEAA 4FP9A 2KLBA 4HMQA 4MS3A 2LVBA 4LA4A 5EN4A 1U0HC 3VO9A 5FH9A 5F64A 4NBRA 1EDBA 4F3RA 2JJ1D 5MFZA 1YNSA 1YUMA 2F1KA 1D7OA 4Q9KA 3BKWA 1A71A 1G3RA 4ZEWA 2IH4A 3WGMA 3S6JA 1WZNA 2GNAA 2ERCA 3KYDA 3KZCA 3QVKA 3VR6H 4ZI7A 3R6LA 4AZVA 3SYTA 4MYRA 1OMOA 1QQBA 1QHXA 3L5KA 1RRGA 3UKDA 3D7KA 2XX3A 3F5MA 4NEGA 2H1OA 2XUQA 3EIQA 1KH1A 2OSBA 3PQ8A 2GSDA 2WD9A 3CX8A 4J9VA 4ND7A 5G3YA 3T54A 4LJKA 2IW1A 1QF9A 1N9GB 1NIPA 2YW2A 4LCJA 4PCAA 2A5YB 3HZZA 3CYFA 2QGNA 3PHCA 2IWHA 3I5XA 2PXAA 1NXOA 1RYFA 1RWVA 1LV8A 2QX7A 2YY5A 4MICA 1H05A 4PHTA 5BW8A 2WKRA 3PCRB 2TMGA 4C0HA 5TXGA 3CVUA 5EE9A 1DWOA 1W4ZA 2H0AA 1HC7A 3SQWA 5ALHA 2HWXA 4U2BA 3OM8A 3CURA 1NW6A 2SKCA 1ZUHA 4R8SA 3TRDA 3WOHA 3A6GA 5HBGA 4PQFA 4R83A 4H6XA 5JJLA 3HL4A 5EY5B 2GPAA 2Z1NA 1P2FA 1ZD3A 4DEXA 3WL7A 1ENPA 2JAOA 1DIGA 1V3UA 2RGRA 1EVLA 3GNSA 2PU5A 4R2XA 1J7JA 4EUKA 5CH8A 2R8OA 3ADCA 1DAIA 3RNOA 2FRVA 3HM9A 1I9CA 1Z16A 1PR4A 2F67A 1MC1A 2RB5A 2NU9A 5K3AA 3F67A 1WDLA 4K2HA 1SQ0A 1IHXA 4ZXFA 2IPAB 3AB8A 4YMLA 3LXXA 1IN1A 5FDFA 2K7FA 3KSRA 3M9LA 2VWPA 5CTJA 3W5AA 1XQVA 2TMYA 3F74A 5E2IA 3RAJA 1PEYA 5ADUS 4MPDA 2HK7A 4JQSA 1V11B 4L5YA 4TWJA 5BNZA 4KFSA 3HXPA 2NO4A 3WMRA 4GMFA 3PGKA 5DV9A 3QUCA 1KSGA 3PHLA 4YRIA 3UJBA 3V2HA 5JDIC 2XTZA 4WTOA 2ZWIA 3KP1A 1NBMD 5THXA 2FX2A 2LRHA 2EYUA 4JLKA 3BHNA 1RWQA 1UJNA 5HF8A 1L7QA 1P8AA 5DO9A 2C7VA 1P5FA 1EQ2A 2RAFA 4L5IA 1A8UA 4DR3B 4NCNA 4MV3A 5JBIA 1YDMA 4C22A 1DJQA 4BRSA 4B4WA 4RZ3A 3PNSA 3L01A 4EW6A 2OT3B 2OP0A 3BRCA 2OHFA 4D4GA 1GUBA 3ED1A 4B7AA 3ZHYA 2H4HA 2LCQA 1EBFA 4EW1A 3RM3A 3T5PA 3R5HA 3RSFA 2IZ1A 1V7ZA 4GLFA 4MHSA 1RLJA 1AS3A 2EEPA 1I80A 2UYYA 5D7NA 4QTTB 4A0HA 1E4OA 2XOEA 4QTZA 4BRWA 2VDLB 2BKXA 2YHAA 1A9OA 4I7EA 2BI4A 5LP6B 1SBCA 1YS4A 2R4TA 1T91A 4TMYA 1DINA 2LZ0A 1GUFA 4LJ5A 4RVNA 1NW5A 3RIHA 1UT5A 3QYPA 3UYKA 4ZKDA 1VL5A 2Q4EA 3KKLA 3ZW8A 4R0NA 4Z99A 4D4MA 3QXHA 3TZLA 3HCNA 4YHBA 1RACA 1R0WA 3WXMA 5ADVA 2HA7A 3HH8A 4EX7A 5CAEA 2R1ZA 1I5RA 4TKLA 4FFMA 4LHYA 4ISCA 1T34A 3BDAA 3SKXA 1O6GA 3CR7A 1X42A 4AN0A 2C4NA 4MHTA 4P0QB 3LT4A 3QOWA 3TH5A 4Q7MB 3RS5A 3FUVA 5GGXA 2B1IA 1KAGA 3UOAB 1G42A 1BA2A 1GNVA 4P38A 2GEBA 3MWEA 4X45A 2B5VA 4RHYA 4UZSA 5E0KB 2OAEA 2R11A 1W8DA 4GPZA 5KVSA 1RI5A 3GJTA 3VPAA 1J5EB 1G291 4Q9AA 1Y3AA 1H65A 1T4CA 4FQ7A 3K9QO 5E4YA 6ABPA 5AQEA 1W85A 4DPLA 3PT9A 2PLNA 4GOKA 2WWXA 3IB3A 3L8FA 3DDHA 3ESXA 4HEHA 4HF7A 5ENZA 3D5TA 4H7EA 3FVWA 3L1KA 3L7MA 4TS1A 4XD7D 621PA 3DCYA 4I9GA 4MR7A 2Q3EA 3DL7A 1RWOA 3U7QB 2DKNA 4JC4A 4GL4A 1NUUA 3N2NA 3CISA 1XLTA 2ZR8A 2DETA 1AGRA 3HB0A 4TMKA 1OC4A 3M6IA 3HLYA 3UUFA 1OXBB 1GZVA 2QN6A 2ORYA 1UPFA 1I3MA 2Q3MA 3UJ3X 4RTSA 1Q7BA 1Y5IA 2KB0A 4YO8A 1ADFA 1ISFA 4O25A 3E2IA 1UBNA 3EGEA 3MGKA 3FTEA 4M86A 4M8NE 1VL2A 3L0IB 3L7BA 5D1NA 3L7LA 4QHSA 2IV2X 2YJZA 3SIRA 4JEHA 2PMDA 3WY9A 1JG2A 2UU9B 1WMFA 1X70A 5EC8A 2C8KA 4G0PA 1XPOA 1U1GA 1EHYA 4BMVA 4EG8A 4ENRA 5A7GA 2OV2A 1Y9DA 3EK2A 3F7NA 4MVJE 1WSDA 1W34A 2C7PA 1EVIA 4M89A 2PGOA 4B17A 5BNIA 1ESZA 3KB6A 1M6VA 4EHDA 5KJFA 3T1HB 1ZICA 2O57A 3VM6A 2UZ1B 4EL5A 1QAMA 3ZR4B 2JHFA 3H83A 3PEVA 3VU9B 3OE7A 1E8MA 4RVGA 3H7IA 3SBOA 3WAKA 1XTBA 2ZWAA 4EJSA 4JI0B 3CRQA 5F9HA 1KU6A 3KQNA 2QU7A 2W2TA 1CDEA 5DXJA 4PSUA 2GKGA 3MC1A 2FSPA 4UUNA 3QOFA 2FFRA 1BH6A 1GNTA 1V9LA 2YVAA 1O08A 3M5DA 4RH3A 3NV9A 2EG9A 3JD1A 1DC7A 2IDKA 2Y1XA 3H5IA 3OFKA 3PSHA 4U2KA 1TQ4A 4BOYA 1U8XX 4EL0A 4YRMA 2F48A 4Z3OA 4QDOA 4CQMB 3UC9A 5ER6A 3GFRA 1XXHE 3W3AH 3A4NA 3BH0A 1CRPA 3HBAA 3DZCA 5FOSA 1SXHA 1DRJA 4DMRA 5HFAA 3OLYA 4F5YA 2Z4TA 2FP4B 1PRYA 3UK2A 5JZVA 3CMCO 4RV9A 3ZDBA 1TNDA 4BO3A 4OX9Y 1ONOA 4H27A 2HNAA 2XD9A 4QOSA 1XPJA 2GASA 2NZ2A 4WY8A 3HUFA 4YWJA 1S5PA 1ZNWA 3VFDA 1O94C 5KTYA 2IZZA 3JTMA 4TWAA 5COAA 5E6SB 5KREA 1EE9A 1XU4A 3IB6A 2OZLB 1IQPA 4HQ0A 8GPBA 4R41A 2FJPA 2PFGA 3IAHA 4IM7A 4RKQA 3U3JA 4E3ZA 1W93A 2EBHX 4DA7A 2Z04A 1EIWA 3DUFA 1ZHFA 1FNSA 3O3OB 2WSMA 2OVBA 4MV7A 1H4QA 2J8ZA 2WP8J 3WK5A 4TMXA 5JFGA 4LWPA 4C7OA 1B42A 4N5HX 4K40A 2V96A 3M3HA 3ZXSA 1DEAA