2ES2A

Crystal structure analysis of the bacillus subtilis cold shock protein bs-cspb in complex with hexathymidine
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-rich DNA single strands bind to a preformed site on the bacterial cold shock protein Bs-CspB.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation
molecule keywords 5'-D(*TP*TP*TP*TP*TP*T)-3'
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2es2A00
1SFOH 2A19A 1UE5A 4DPGA 4POFA 3PUWA 4C3HH 2NVQH 4A93H 3M9BA 1S40A 1VQPA 4AIMA 2WAQG 5JEAJ 4IFDI 2YYZA 3I4OA 3H3VH 1NE3A 3K81C 2E2IH 1VQIA 1TWGH 3CMEA 5IYCH 4LF4Q 2VQEQ 3G48A 1IZ6A 3PIPA 1EQQA 1PH8A 4XIGS 4JI0L 1TWAH 3EN2A 3G6EA 4YHHQ 4A3JG 3I4NH 5M5XH 1CKOA 3VDYA 3L2PA 1EUJA 4LNQA 1WJJA 1I50H 1QVCA 1SRUA 3GD7A 4GOPA 3HOUG 1A63A 4BY1G 3ICEA 1XPRA 3TS0A 3PO2G 1UE6A 1VCIA 4QGUA 2DGYA 2F4VQ 2JA6G 1QVGA 4A3BG 2DUDA 1JE5A 4LUVA 4A76A 1MJEA 4DUYL 1VQLA 3KF6B 4A3EG 1VQ4A 2B63H 4NB3A 3CW2C 5IP7G 1E3PA 2K14A 3E9IA 5IYBG 3MXNB 1C7YA 4OO1I 2HT1A 3S2DH 2PQAB 4JI1Q 4C3JH 3AFPA 1EQRA 2BA0A 2LSSA 4LFBQ 4WJ4A 1CKMA 5C4XH 2Q2HA 3CP0A 4UP9A 1IBKL 2JA7H 1J6QA 4K0KL 1PVOA 1WYDA 3M3YH 3HOYH 1YITA 2HHHL 5C3EG 4DV3L 1S3OA 2D0OA 3I2ZA 4A3MH 1J5EL 1Q1EA 2WB1E 3PCOB 3PIOA 3CXCA 5LMUL 1PH6A 3GTKH 4DAYB 3TS2A 1EOVA 4R4OA 3A5ZB 3GDEA 3S1MH 2ZTDA 4X66Q 1E7ZA 4DAMA 1Y1WH 3PV0A 2AHOB 3KF6A 4ME3A 4DR4L 5M5WH 5AJ3Q 2UUBL 4NXNL 1VQNA 2MNAA 2QGQA 4BBSG 1V43A 4A3LH 4HJ7A 4L5TA 1WFQA 4C2MH 3HKZG 4DV0Q 3KOJA 3S1NH 4HIKA 4DV6L 4IPDA 1XTDA 2KBNA 5EAYA 4DKAC 2NVTH 2CWAA 1PHJA 2N78A 5JJIA 1PH2A 2E8GA 4X64L 5LMNQ 5E7NA 2E5LQ 1G51A 4LF9Q 1Q12A 1OTCA 2B3GA 1X3FA 4YWMA 3FKIG 2R7DA 2Q2UA 4DR6L 1YEZA 1C0AA 1AE2A 2UUCL 2N8NA 4GN5A 3G4SA 1L1OA 2WB1G 5IP9G 4C3IH 3OTOQ 3T1HQ 1N32L 4BXXG 1HZ9A 5JEAG 4IPCA 4X65Q 1HNZL 4RMFA 4LF8L 5GROA 4GLXA 3S1RH 1HR0Q 3S24A 4AQYQ 1NMFA 1D7QA 4A4IA 1Q1BA 2NN6G 1C9OA 2ID0A 1UEBA 2KCTA 1T9HA 4JI3Q 2VUMH 2JA5G 4A3FG 3HKZE 4DR5Q 3PO2H 3EBEA 1X3GA 4LF7Q 1SROA 4OWTB 1IBLQ 1OXSC 4UP7A 4HJ5A 4HJ9A 1NMGA 3L0OA 3J81c 4BBRG 1CUKA 1PH9A 2KENA 1A8VA 2EIFA 3GTGH 4GKKL 4DK6C 5JJKA 3T1YL 1X6OA 2PMZE 4A3IG 3GTOH 3RLOA 1N33L 5C0XI 3PO3H 1HH2P 4DR3Q 2OCEA 3RN5A 3S17H 4BA2I 2R7ZG 4APVA 1BBUA 4L5SA 3B6YA 3HOZG 1QUQB 1SN8A 2VL6A 4DUZL 4O2DA 1N34L 1VQ5A 1Y1VH 4OX9Q 3AYHB 3BZKA 3CC4A 4BBSH 3BZCA 4YCVA 2RF4A 3I4NG 1AH9A 2IY5B 3DLLA 3CQZH 5M3FG 2CKZB 4DV2L 5HGQA 3PF4A 1I5FA 4B3RL 2F3IA 2R7FA 1IXRA 3CF5A 3NELA 4GKJQ 3S1QH 3KDFA 1VQ8A 4JOIC 2KHJA 2CWPA 1I6HH 2UXBL 5JJLA 4R1JA 1ASYA 4LF5Q 1N8RC 3MEFA 5GAGC 4DR2Q 1VQAA 2JA9A 3F8TA 1GM5A 3NENA 2KCMA 1XNQQ 1GO3E 4DR7Q 3HOWG 4GNXC 1RIPA 2CQOA 1E1OA 1CSQA 1VQJA 1YJ9A 3CCLA 1V9PA 4KHPL 1B7YB 3J7ZC 1IYJB 2JEBI 1XMOQ 3RR5A 2UXCL 2WP8J 4X62Q 3RN2A 3GO5A 4DK3C 1PYBA 3WWVA 1XNQL 2JJQA 3CCRA 1E22A 2GVBA 3STBC 4DR2L 4H02A 1P16A 3JAMc 4JBJA 4J15A 1KRSA 4PG3A 2I5LX 4Y7NH 1VQKA 4Y52H 3K7AH 1HR0W 4A3LG 1TWFH 3KYHC 2ZJRA 5BR8Q 3ER0A 1VQHA 4YWLA 4DV2Q 4A3KH 3RLFA 1G291 5ELNA 5BR8L 3FP9A 3I55A 3OYYA 1EIYB 4MTNA 4P73A 1QZGA 2ES2A 3HKSA 4OX9L 3U4VA 3W1BA 1TWCH 1SMXA 2F52A 4DUZQ 3H0GH 1N34Q 2HIXA 4TQUS 5HY6A 4HIDA 1YNXA 1JJGA 1WOCA 3M4OH 1FL0A 2VY3A 1N9WA 4GS3A 4BXXH 4IFDG 1JMCA 1VQFA 1VQOA 2YTVA 4A93G 5C0XJ 1VQ7A 2VS1A 4FDBA 4X62L 3CMAA 3NBHB 1XMOL 2UXCQ 1VQ9A 3H3VI 4YCWA 3UDXA 3J81j 3T1YQ 4KHPQ 2VUMG 2NZHA 4YCUA 1OXVA 2XGTA 5GADC 3PUVA 3BU2A 4IPGA 1NJIC 4DR7L 3TQYA 3A74A 2PI2A 2JA8G 4IFDJ 3H15A 4JBWA 3RLNA 3I4MG 4LF5L 1P8LA 4HJAA 4R4TA 1KIXA 4LF7L 3M85A 2UXBQ 4GN3B 4DR5L 4GKJL 3UDIA 4JI3L 4ALPA 5IYDG 3AFQA 4B3RQ 3D0FA 4BY7G 1YJWA 1PV4A 3HOVG 4OO1G 2H5XA 3GTMH 1FVIA 4LUOA 5IYBH 3CAMA 2B29A 4X65L 4LF8Q 1X3EA 4HIOA 1L1OC 4R4QA 5GQOA 4POGA 5M5YH 2BA1A 3T1HL 2K4KA 4JOIA 2UUCQ 3DM3A 4DR6Q 3UDGA 4UY8C 1KXLA 2WAQE 2PQAA 4QL5A 4X64Q 4LF9L 3RZDH 2JE6I 1YIJA 3TRZA 4DR3L 2K50A 4UP8A 1N33Q 2OWOA 4GLAC 3J7A5 3A0JA 1OXUA 5M3FH 1UE7A 4AYBG 5C4JH 1FGUA 2FXQA 4R4IA 4A3GH 3D31A 1YVCA 4OXPA 1VQCA 5IYCG 3CCEA 5AJ3L 1Y1WG 2UUBQ 2K52A 3TREA 4MNOA 1ASZA 4GKKQ 1RL2A 1Q7YC 2YU9H 1LM0A 1OXTA 3F2CA 1H95A 2D62A 4GOPB 1LYLA 2XTIA 3JAMi 5LMUQ 5FJ8H 4QQBX 3GTLH 1WCMH 2KHIA 1IBLL 2Y0SG 5M3MH 3CPWA 4P75A 3KF8B 1PH7A 1IBKQ 2JA6H 4K0KQ 1X54A 4KLKA 4LFBL 2VW9A 1XPOA 3CCMA 5C0XG 3KLWA 3KJPA 3PF5A 4OWWB 1YHQA 1NTGA 2GN5A 4AH6A 4XTCS 4GOPC 4AQYL 1B70B 1HR0L 2MO0A 3CCVA 1D8LA 3E0EA 4A3JH 1HNZQ 2JA8H 2QEXA 2NVYH 3J80i 3OTOL 4IOAA 1N32Q 2OQ0A 1X9NA 4A3CG 2MO1A 2JA5H 2F4VL 3AQQA 1K83H 1SR3A 5IE8A 3J81i 3SGIA 4A3FH 4BY1H 1I3QH 4KI0A 4PZ6A 4YWKA 1MIUA 1VS0A 5LMNL 2E5LL 3HOYG 2BH8A 5IYDH 5FLMH 4DV6Q 2R92G 1O7IA 4DV0L 4A3KG 5IY0A 4BBRH 4A3DG 5C44H 1PH5A 1VQEA 2LXJA 3Q8DA 3ZJYC 5GAEC 4NXNQ 1GVPA 4DR4Q 2VQEL 1Q81C 1QVFA 3PUXA 4LF4L 2HQLA 5ELOA 4X66L 5J3BA 4IJHA 3JC66 4RG1A 2NN6I 1KD1C 5H1SE 4GNXA 1W2BA 4JBKA 3K7UC 1J5EQ 5C3EH 4OWXB 4DV3Q 4A3MG 2HHHQ 2R7ZH 1KL9A 3L7ZC 1Y14B 4PZ8A 3F2BA 4JG2A 4LF6L 2AMCB 5IP9H 4JI1L 1YI2A 1JB7A 1KHIA 4AYBE 1HZCA 2BH2A 2IX1A 2E2JH 2N3SA 1BBWA 1EFWA 3J80c 1EYGA 4JI5L 1WI5A 3M7NA 3KJOA 2K75A 4DUYQ 2C35B 4EX5A 5FJ8G 1K73C 1HZAA 3HOXH 1M1KC 1XPUA 4JYAQ 3RZOH 1E24A 1E1TA 2AKWB 3I4MH 4WJ3M 1MKHA 3HOUH 4DNIA 3G71A 4NXML 2OTLA 2ATWA 2ASBA 4B3SL 2I5MX 2IHFA 4LWCA 1LUZA 1YJNA 1A0IA 3CCSA 1VQDA 4DR1L 4L5QA 4A75A 4EQ5A 4BY7H 1KQSA 3U4ZA 1PH1A 1M90C 4YHHL 4B3MQ 2I5HA 3HOVH 4JI0Q 5IP7H 1KAWA 3K80C 1Z9FA 5DLQE 2YTYA 2RCNA 3K0XA 1AE3A 1L0WA 1KC8C 3FHWA 3GTJH 4JI6Q 1YZ6A 4IO9A 2E2HH 1SE8A 1TWHH 1V1QA 3PO3G 1CKNB 4GN4B 1K9MC 3S2HH 1YBYA 1K8AC 1QUQA 4LUZA 1DGSA 2K5VA 3UE0A 2AWOA 4MZ9A 3IRBA 1K3RA 4A3GG 4PMWA 4JCVE 4IOCA 3W1GA 4JI7L 4IPHA 1PH3A 1B8AA 1Y1VG 2ZJPA 3CC2A 1I94Q 5IWAL 4JV5Q 3F2DA 4JI4Q 4JC0A 2PI2E 2R93H 3STBD 4HJ8A 2EXDA 3RNUA 1Q82C 4LW1A 4DV7L 4L5RC 1TXYA 5FLXc 2ZJQA 1UWVA 2RHQB 1FJGL 1HJPA 1HNXL 1WCMG 2MQHA 5M3MG 2VQFL 4DV1L 1S72A 3GTQH 2GVAA 2ALYB 4R4CA 1CSPA 2HIVA 1XMQQ 1PFSA 1U0LA 2JQOA 2VZAA 3S15H 3HOZH 4LFAL 2Z0SA 4P74A 1VQ6A 1EIFA 1SLJA 3I56A 2AWNA 2A1AA 2V1CC 3PUZA 4YY3Q 3BJUA 1Q46A 3PUYA 2ZM6L 1X56A 2OQKA 3I7FA 4DV5Q 1OXXK 2UU9Q 2PNHA 4LFCQ 2YTXA 2OTJA 3PGZA 3KFUA 3M4QA 3CCJA 3HOXG 1HNWL 4A3CH 2IX0A 3K8AA 2ZTEA 3CCQA 2R6GA 1JJCB 3HFZB 3OW2A 4JI8L 2IHEA 5IT9c 3LGJA 4JI2Q 2I0QA 2D0PA 2Y0SE 3S14H 2Z6KC 1NBWA 4PZ7A 2Z6KA 4QIWE 2R92H 2UXDL 2MFIA 1EWIA 1NY4A 4A3DH 4X6AH 3ULPA 4JI8Q 2Q2IA 1VQGA 4GNXB 1K0RA 2UUAL 2L15A 3CD6A 1LTLA 3NEMA 5LMNW 1HNWQ 1N36L 2UU9L 1PA6A 3W5OA 4A3EH 2B63G 2ZTCA 1XNRQ 1X65A 4DV4Q 4B3TL 4GLVB 4YY3L 1L1OB 2YV5A 4QY7A 1JJ2A 1MJCA 5GAHC 2QA4A 3UE1A 4KHZA 4LFAQ 1IBMQ 3EIVA 1Q8KA 2K5HA 2LXKA 2WFWA 4TVAB 1Q86C 3ERSX 4JBMA 1IBML 2VQFQ 4DV1Q 2CFMA 1HNXQ 1GKHA 4P71A 1UE1A 4DV4L 3M4PA 4B3TQ 3KDFB 2Q2TA 1XNRL 2CCZA 1G6PA 1KRTA 1HZBA 3E9HA 2A8VA 3CCUA 1N36Q 1BVSA 4P72A 4JV5L 4UPAA 2UUAQ 2JEAI 3H0GG 1YHAA 2JK8A 1VQMA 5K36G 2UXDQ 2RHSB 3F1ZA 1VQBA 2K5NA 1BKBA 4JI2L 2VNUD 1GD7A 3HOWH 2NVXH 3FKIH 2IT1A 4A3BH 1U5KA 3U50C 3CC7A 4JI6L 3AEVA 4NPSA 4LFCL 4DV5L 1XJVA 2ZM6Q 1QZHA 4QJFA 4B3ML 4HIMA 2N49A 1CKNA 1X55A 3UDFA 4DR1Q 1PH4A 2JA7G 1XMQL 5C4XG 4B3SQ 3ULLA 4NXMQ 4IJLA 1IL2A 5FLMG 4JYAL 2R93G 1A62A 1FJGQ 1R9TH 1Z47A 2NZOA 1W3SA 3CPFA 5C44G 4DV7Q 3U58A 4JI5Q 4O0AA 4OONA 4JI4L 5IWAQ 1PYSB 1I94L 3PSIA 3S16H 3TEHB 4A3IH 1YHBA 4BA1I 4LF6Q 4JI7Q 1K8GA 3GTPH 1L2FA 2EQSA 3ULJA 1JT8A 3A5UA
chains in the Genus database with same CATH superfamily
2A19A 3R93A 4XT1B 3I4OA 3H3VH 3KBXA 4Q5VA 3IFDA 1F2LA 3CMEA 2E2JB 1IZ6A 1PH8A 5ELFA 4LJZC 3EN2A 3I4NH 5G3LF 3VDYA 1JOQA 4LNQA 1I50H 1SRUA 2KJXA 3HOUG 1I4GA 4FF3A 3ICEA 1O7ZA 5EBDA 1QVGA 4A3BG 2DUDA 1JE5A 3PMFA 5KEEA 3KF6B 2B63H 1G2TA 1C7YA 5C44B 2HT1A 3Q22A 3S2DH 1PFNA 4JI1Q 2B2UA 4LFBQ 4WJ4A 1RD9D 2XWBB 5C4XH 1IBKL 1PVOA 4RWSC 2FHTA 3M3YH 4KJNA 3V96A 3HOYH 2HHHL 5C3EG 1L0XB 1PH6A 3TS2A 5C3EB 5IGBA 5C4ZA 1DZ1A 3S1MH 3M7GA 1EEFD 4DAMA 1Y1WH 1A15A 3PV0A 4ME3A 4BBSG 4A3LH 1V43A 4HJ7A 4BWGB 1WFQA 3HKZG 3S1NH 4K2LA 2MUYA 1PH2A 2XNAC 2Z4HA 1MSHA 3FKIG 2R7DA 4DR6L 1YEZA 2B2VA 4CDCC 1N32L 2WB1G 5IP9G 3I4MB 4RMFA 1I4QA 4GLXA 3S1RH 3S24A 3BDCA 1NMFA 1D7QA 4A4IA 1IL8A 4Q0FA 1EQVA 3SR1A 4KD4A 4JI3Q 1BXTA 2JA5G 4DR5Q 3I91A 5E1FA 5J1ZA 4A3IB 1X3GA 2EYLA 1D5MC 3KUPA 3QO2A 4DGZA 4RA8A 4N8X1 4ZUJA 4EQNA 4LF7Q 1YNJD 5C5LA 1NMGA 4BBRG 1A8VA 2EIFA 3NQIA 5NUCA 3GTGH 5JJKA 3CHBD 3EVQA 1EIGA 1QE6A 1V8QA 1DYQA 3RLOA 4ZAIA 1N33L 1LT4D 3PO3H 4KY6A 1VMCA 3S17H 4BA2I 3CRKC 3B6YA 1JQYD 1SN8A 3E0JA 1Y1VH 4OX9Q 3OMGA 3AYHB 3CC4A 2PCFB 1VDZA 4R8IA 4H44C 3UI2A 2YU9B 2CKZB 4FXGC 1D1IA 3K6OA 4KMUC 3NELA 2R3ZA 3S1QH 2EY6A 4JOIC 2KHJA 2CWPA 1DM0B 1B50A 3SEBA 3VR4A 3BYTB 4O1NA 3RZDB 3HOWG 4FVMA 1LT3D 4NMZA 3NE5B 1YJ9A 1VQJA 4KHPL 2JXMB 5C0XH 2UXCL 1IYJB 1DOLA 4X62Q 3EJIA 2JJQA 3U9SA 2PNRC 1O80A 4H02A 4HN7A 2L4NA 1KRSA 1GXDC 2N88A 1HR0W 1Z6HA 2B2YC 1SBBB 1TWFH 1WTHA 3KYHC 1F77A 1WTVA 1DOMA 4OX9L 1TWCH 3VR6A 1N34Q 5C6AA 5HY6A 1F9PA 4PV1C 3P75A 2XRSD 4RFBA 4RKLA 1ML0D 3VA7A 2VY3A 1N9WA 4IFDG 1A2UA 1VQOA 2YTVA 4C3HG 4A93G 4X62L 3K58A 3NBHB 2ICEC 2G9DA 3H3VI 3RD4A 5JJZA 3C1EA 1EU3A 3I70A 2DY7A 2EJFC 4QB4A 2F0JA 3S9WA 4KKTA 4H13C 4MHEA 4K5WA 4RGOS 2CW0D 3DWAA 1H9KA 4GN3B 4DR5L 4KK7A 5IYDG 1F2ZA 2F0PA 4BY7G 4OO1G 3HOVG 1SYCA 4XYOA 1FVIA 2X69A 4PMBA 4R8NA 3HZXA 3I4LA 4HIOA 1KNAA 5M5YH 2BA1A 3T1HL 4JOIA 1K0SA 2UUCQ 2F0GA 2EYFA 3UDGA 3MVVA 1PLFA 3G7LA 1YNND 4QL5A 4IUVA 1YIJA 1IHZA 4ZLTF 3J7A5 2K5WA 1UE7A 2EYOA 4AYBG 4A3GH 1MD2D 1ONLA 1F2MA 1VQCA 3GTLB 3HEJA 2K52A 1LTAD 1Y8PB 5EKLA 3TREA 1ASZA 2ENBA 3GV6A 4H0LC 1LYLA 3JAMi 5FJ8H 4QQBX 3GTLH 1H9SA 1IBLL 2Y0SG 2FMMA 3K0YA 3KF8B 1PH7A 2JA6H 4K0KQ 1ET6A 5FO7B 4KLKA 4CJ2C 4OEMB 4RCNA 2VW9A 3CCMA 2AQ2B 4OWWB 2NTTA 4NDXA 2J7ZA 2L11A 4XTCS 5I9PA 1B70B 2PPBC 3IAYA 3OWEB 1D8LA 1BF4A 4A3JH 2NVYH 3J80i 4A3CG 1XWEA 1K83H 3J81i 3SGIA 4XYQA 2E2HB 3NQTA 4PZ6A 2E2DC 2E5LL 4DK0A 2A6EC 4RGTA 4A3KG 4A3DG 5C4XB 5C44H 1PH5A 4UAIA 3MFGA 1B44D 2LXJA 3Q8DA 1WTOA 4NXNQ 5EPKA 4TSSA 1FYCA 4LF4L 4X66L 3WOEA 4RG1A 2B2TC 3JC66 1KD1C 4JBKA 2OEOA 3K7UC 4A3MG 3DWQA 2R7ZH 4HTHA 1KL9A 4PZ8A 4EVOA 2G5DA 1BDOA 2AMCB 1V1OA 1YI2A 3JAML 1BBWA 2LMCB 1EFWA 3J80c 1SMYC 1EYGA 1WI5A 3FKIB 3M7NA 2K75A 3A7AB 1K73C 1M1KC 1QJOA 5DNFA 1E1TA 2ATWA 2OTLA 2F0OA 2ASBA 4B3SL 3GTKB 5D14A 1A0IA 3CCSA 1PRTC 4L5QA 2Z1CA 2NVTB 1EU4A 5A2QL 1M90C 5IP7H 2QDBA 5DLQE 2YTYA 2RCNA 1L0WA 3FHWA 1QNUA 2C5CA 1LTSD 4DNTB 3J7AF 3SK5A 1K8AC 1ESFA 3ND9A 3W2DA 2K5VA 1IW7D 5EGTA 4MZ9A 4DU9A 1K3RA 3W1GA 1ZKOA 4A3GB 2VB3X 3ERQA 1I94Q 2R93H 1TIID 2F0LA 4DV7L 2ZJQA 1UWVA 1FJGL 3J7YW 1PMRA 1WCMG 4M1UB 1DOKA 1HTPA 2D2CC 4G7HC 2XN9C 4LFAL 3I56A 4B9XA 1CT1D 4YY3Q 2QILA 1X56A 1K8MA 1GUGA 4DV5Q 4OIKA 2KECA 2PNHA 3M4QA 3HOXG 3PO3B 3K8AA 4DAYA 3HFZB 1CFMA 2Y0SE 1EYAA 2L9HA 2WIIB 4FO2A 2MFIA 3F2UA 3NUCA 5E4WC 4GNXB 4C1NI 3CD6A 1LTTD 4C1NK 1EY9A 2ZTCA 5IGCA 4K2KA 4GLVB 2KVMA 1L1OB 2YV5A 1PDQA 1MJCA 5KYIA 3ZYYX 2QA4A 4K8IA 4KHZA 4DV1Q 5I4DA 3GQBA 5CGKA 1TU2B 1XNRL 2HCIA 1KRTA 1HZBA 1TS3A 3CCUA 2FINB 1BVSA 4A3EB 3H09A 1SYBA 2B2WC 1AZQA 2D5DA 1U4MA 5K36G 3VYTA 1PTOC 2F0QA 3F1ZA 2K5NA 4V190 4JI2L 2B2TA 1EWHA 1BR9A 4HSVA 4A3BH 1U5KA 4J8QA 4DV5L 2CVRA 3S1NB 1BO0A 4B3ML 4HIMA 2N49A 1CKNA 2R7ZB 2E76C 3H91A 4A3DB 1XMQL 5C4XG 1EOTA 3S15B 5I6WA 1F9QA 1WD1A 2L5TA 3J7AV 1PYSB 5CYUA 1FNWA 2K05A 3S17B 3TEHB 4A3IH 3PO2B 4JI7Q 3GTPH 4IURA 4UHVA 1SYGA 4QUCA 3CF5A 4FF1A 5EPLA 4CDDC 3PUWA 2WAQG 4N9PA 5JEAJ 3RMHA 3QJYA 4C56C 1STGA 1XX8A 2B2WA 1TWGH 2KA7A 2VQEQ 2IWHA 2EJGC 3PIPA 2XVSA 5JPNC 4XIGS 3SXHA 4YHHQ 5M5XH 3DXJC 1EUJA 3L2PA 4GOPA 1XPRA 3TS0A 3PO2G 1UE6A 1VCIA 1E2ZA 2F4VQ 1AEXA 1XYIA 4A76A 4LUVA 4A3EG 1BOSA 3SK6A 3CW2C 1E3PA 1RTOA 5IYBG 2A69D 1II3A 4IUTA 4RH6A 2K1BA 5CR3A 2WV6D 1LTGD 2PO4A 5JOBA 4GZYC 3CP0A 1J6QA 1S3OA 1J5EL 3MZ5A 3NK9A 2WB1E 2NVYB 3PCOB 3PIOA 4DAYB 1A3UA 3D3RA 1G6ZA 3GDEA 2ZXOA 4X66Q 1E7ZA 1VQNA 2QGQA 1PZJD 1PFBA 4C2MH 1GUOA 4DV0Q 2EXZA 5ELBA 4DKAC 2CWAA 5JJIA 2N78A 3DWPA 2E8GA 2E5LQ 1B3AA 2B3GA 5M5YB 2N8NA 4GN5A 3G4SA 1L1OA 3T1HQ 1PTOB 4C3IH 3S1RB 4BXXG 3HOXB 3H3VC 4X65Q 3C1FA 3MXPA 4ULLA 5GROA 4B9WA 3T13A 1PTOD 2OT2A 5CV6A 3T53B 1HR0Q 3T51B 1H9JA 1D6EC 2ID0A 3D4DA 2NWGA 1S5CD 1LT5D 4A3FG 1VMPA 2BE5D 1SROA 2FFKB 3BVMA 5C3WA 4HJ9A 2MPMA 3L0OA 3M4YA 1NNXA 2O5JC 1PH9A 3FPPA 1SNDA 4K8JA 4C3JG 5KGUA 2PMZE 3AU7A 3GTOH 1AP0A 3M3YB 2FJ2A 4KKUA 3GTPB 1HH2P 3H94A 2OCEA 4JPBW 4EQOA 5I2YA 1I3QB 2VL6A 4DUZL 1VQ5A 4CJ0B 3VA5A 1YNJC 4XT3B 1CTMA 1C8CA 4GKJQ 3KDFA 4EQPA 5JJLA 4R1JA 4DXGA 1N8RC 3NTKA 5GAGC 3X3MA 4DR2Q 1VQAA 2JN4A 3F8TA 3L9AX 3NENA 2KCMA 5FO9B 3MXGA 4GNXC 2A6ED 1ILQA 4X3UA 2C9OA 1CSQA 3TP6A 5ELCA 1XMOQ 3J7ZC 2JEBI 4OELB 1LLRD 2CH4W 5C5MA 3TSSA 2HQEA 4ZK9B 1AFPA 4DK3C 5M3FB 3RUZA 1XNQL 3WWVA 1E22A 3STBC 4DR2L 1I4RA 1P16A 3JAMc 4CDEC 1B1ZA 4JBJA 1K8OA 1S5DD 4Y7NH 4K6LA 4Y52H 4OL7A 3K7AH 1H9MA 1U4PA 4KD3A 2R61A 5BR8L 5IT9L 1EIYB 4P73A 3OMCA 5FLXE 1ICWA 1NCVA 3ONAB 3U4VA 3H0GH 2HIXA 4GS3A 2HDLA 5CMDA 5IGFA 3EROA 5C0XJ 4FDBA 3H0GB 1I6HB 3N52A 1V1PB 4YCWA 2F0WA 3J81j 2VUMG 5GADC 1PTOH 4IPGA 1NJIC 3A74A 2PI2A 2L55A 3RLNA 4LF7L 3PO2H 3M85A 1EWCA 4ZQ3A 5EPJA 1KDBA 3A7LA 3AFQA 3QIAA 3SK8A 4B3RQ 3D0FA 2AUJD 2CW0C 3S2HB 1TR5A 1PV4A 2A68D 1SYFA 2H5XA 3GTMH 4LUOA 2JA5B 3CAMA 4X65L 1X3EA 2Z6BA 1Q8IA 2Q8RE 4MTKA 4KV6A 1BCPB 4YIJA 2PQAA 2DN8A 4X64Q 4BY7B 3DM1A 1N33Q 5M3FH 4R4IA 3D31A 3ND8A 1TY0A 3CCEA 5AJ3L 2UUBQ 3C2PA 1LABA 2A5HA 4GKKQ 1Q7YC 2D62A 3MXNA 1TVXA 4CDFC 4I7AA 5LMUQ 1EL0A 3EQLC 2KHIA 1JC7A 5M3MH 3GTJB 5M5XB 3I4NB 4LFBL 1ZXTA 1GUNA 3NP8A 1IKMA 4B08A 2GN5A 4AH6A 4AQYL 1HR0L 3CCVA 5M5WB 3R3OA 2QEXA 3OTOL 1N32Q 1X9NA 3IL8A 3C46A 1CQVA 1HCZA 2MO1A 1SR3A 4BY1H 2RDGA 1I3QH 4YWKA 1MIUA 3HOYG 1U9RA 5FLMH 4ZUIA 2JA7B 1NSNS 2PYKA 4I7ZC 3ZJYC 5GAEC 3GTOB 4IUQA 3VR5A 4IJHA 1EZ6A 5CV7A 1SAPA 4OWXB 1HUNA 4XQJA 3MEHA 1Y14B 1NR4A 5IP9H 2WACA 1CM9A 4JI1L 1JB7A 5CC4A 1KHIA 3QOJA 3M4OB 2BH2A 4DXFA 2E2JH 3LNNA 1BCPC 3URYA 4ZCKA 4DUYQ 4EX5A 3HP3A 1HZAA 3HOXH 1C48A 4JYAQ 3RZOH 3I4MH 1MKHA 3HOUH 3EA6A 4A3JB 1STYA 3TMEA 2I5MX 1YJNA 2EYMA 1VQDA 2CQAA 4IQZA 3D6WA 1KQSA 2NZ1D 3U4ZA 2HUGA 4JI0Q 2F0HA 5JVH3 1KAWA 3C3LA 3K80C 1BCPF 1KC8C 2IL8A 5KNDA 1YZ6A 1SE8A 1TWHH 1V1QA 3PO3G 3S2HH 1SMYD 1QUQA 1DGSA 2AWOA 3IRBA 2DNCA 5TSSA 4JI7L 1EYDA 1Y1VG 4E6IA 4K14A 3EFXD 4JV5Q 4JI4Q 4JC0A 2PI2E 4HJ8A 4L5RC 1TY2A 1MI2A 4DNRB 2WB1B 1FD7D 3Q6SA 3SVMA 3OW7A 1S72A 2GVAA 2ALYB 4R4CA 1XMQQ 1RF2D 2HIVA 3G6JB 1EIHA 1U0LA 2JQOA 3HOZH 2Z0SA 2O2LD 2AWNA 2KUMA 3A8KE 5I6YA 2E75C 2M2LA 3I72A 1Q46A 3E6ZX 2VB2X 3PUYA 3S16B 2L12A 1CI3M 2OQKA 2UU9Q 4LFCQ 4K5XA 2K7VA 2QW7A 1JJCB 4RGMA 3PIO3 2IHEA 5K5PA 2I0QA 2D0PA 3CQZB 2A74C 1MGSA 3FDTA 4PZ7A 1GUTA 1TQOA 2R92H 3MA2B 2UXDL 2F0FA 1QB5D 2D9UA 3T4AC 3P20A 2Z9HA 1HNWQ 4WJWA 3W5OA 2ZT9C 4FNFA 2B63G 1XNRQ 1STAA 1X65A 2F1MA 3NWTA 2KEDA 4QY7A 4HMIA 3EIVA 1Q8KA 2K5HA 4TVAB 2PMZB 2I46A 4FF4A 2O4XA 4P71A 1UE1A 4KY5A 3M4PA 3KDFB 2CCZA 1G6PA 2A8VA 4P72A 3DHQA 4UPAA 2UUAQ 1J9OA 1G2SA 3S1QB 2SNSA 1VQMA 2N55A 2UXDQ 1HQRD 4M8AA 2RHSB 2MGSA 3HOWH 2XSCA 4FF2A 3FKIH 1QNKA 4H7BA 4J6HA 5FLXL 2HD3A 1Y1VB 1MBYA 2NB0A 4JI6L 2RBMA 2K03A 4G7ZC 1QZHA 3CRLC 2V4DA 4QJFA 2F0UA 3AMUA 4L8JA 2HCCA 4B3SQ 3HOZB 4G57A 4NXMQ 1JICA 1KNEA 4IJLA 1IL2A 3J81L 1FJGQ 2AQ1B 3BDLA 5IGGA 1CHQD 4IN3A 5LL6S 3U58A 4JI5Q 1GHKA 4O0AA 5CV5A 4QUFA 1JOOA 1HRJA 3S16H 1YHBA 4BA1I 1K8GA 2EQSA 1SFOH 1T5XD 1BNZA 4KTAA 1UE5A 4DPGA 1JORA 1SEBD 4C3HH 2NVQH 4A93H 4AIMA 1ENFA 3HS0C 1NE3A 1VQIA 4KN4C 4LF4Q 5IYCH 3FPUB 4QMGA 1O78A 3GV3A 1O7YA 1W6JA 1EQQA 1TWAH 4A3JG 1CKOA 2NBFA 5M9OA 3FMCA 1QVCA 1QWYA 2LKVA 3GD7A 1A63A 1X3PA 5C4HA 3NTHA 2DGYA 4UDUC 1ENAA 1Y8OB 1MJEA 1VQLA 4X3TA 1GHJA 4DN4M 4OO1H 2K14A 2DY8A 1S4ZA 1HA6A 4G4KA 1EY7A 2PQAB 4C3JH 1RODA 3AFPA 1EQRA 2BA0A 1CKMA 1TKWB 1UUPA 4K0KL 2Q2HA 2M9VA 4J1MA 4UP9A 3E3XA 1WYDA 1UAPA 4DV3L 4A3MH 2D0OA 3GTKH 3CXCA 4PMCA 5LMUL 3HOUB 2CHBD 4R4OA 2ZTDA 1O7LA 1ENCA 3TDQA 2AHOB 4DR4L 5M5WH 4NXNL 1STEA 4L5TA 4P2CB 1R4QB 2ZXPA 3KOJA 1RDPD 2F0IA 1XTDA 3KLRA 4KN7C 2NVTH 2F0KA 2F3VA 1PHJA 4X64L 5E7NA 1G51A 3K5OA 1TWGB 2X6GA 1C0AA 1QOHA 2JP1A 5DM63 3OTOQ 3A8JE 2Y0SB 1HZ9A 5JEAG 4IPCA 4LF8L 2A73B 2B2YA 3LWEA 3T16A 1HQMC 2BCOA 1S5BD 1T9HA 3I3CA 3BDOA 1B9NA 3EBEA 1IBLQ 2IX3A 1OXSC 3OOCA 4ZYSA 2E74C 3OPOA 3J81c 1R4PB 2KENA 4U68A 4GKKL 1HXYD 4DK6C 3T1YL 1S5ED 3TBIB 1WTXA 3V2TA 1JB3A 1GOZA 5C0XI 4DR3Q 3RN5A 1RJTA 2R7ZG 5IGEA 4HR7B 3D4WA 4A3BB 4L5SA 4ME5A 1L0YB 2B8FA 3MFYA 3BZKA 1DXMA 3BZCA 1EQTA 2RF4A 2PZTA 3I4NG 1AH9A 2IY5B 4C3HB 4A93B 2NVQB 3NXWA 4DV2L 5HGQA 3PF4A 4B3RL 1SYEA 2F3IA 2R7FA 2KCCA 2B2UC 1VQ8A 1CA5A 1ASYA 4LF5Q 3PQIA 1RTNA 4LAAA 4F87A 1HA5A 1GO3E 4AYBB 3IFTA 1CHPD 2NN6H 1YNNC 4BBSB 1B7YB 2WP8J 2QF7A 1ZYRC 3GO5A 1PYBA 5ELDA 3CCRA 2B39A 1A2TA 5CBAE 3J80L 3L3OC 2B2VC 3A8IE 4J15A 5KNCA 4PG3A 2BOSA 4ID6A 1X32A 5E4XA 4A3LG 3KK7A 4KJOA 2FMCA 1VQHA 3ER0A 5EBCA 4DV2Q 4A3KH 1G291 3FP9A 3I55A 3OYYA 3N6RA 3VR2A 2ES2A 1QZGA 1QCBD 1SMXA 2F52A 4DUZQ 2PW5A 1YNXA 1SNOA 1D5ZC 3BYYB 1VQFA 3J81E 3MTSA 3QG1A 1VQ7A 2VS1A 2RA4A 2O5IC 2F3WA 2SEBD 3CMAA 2UXCQ 1VQ9A 4KHPQ 1BQQT 3T1YQ 5FKAC 4L63B 4YCUA 1OXVA 3QOLA 2XGTA 3PUVA 4N9TA 3BU2A 1HPCA 3NHHA 3TQYA 1PXUA 1RHPA 3H15A 1I4XA 3TP7A 1IYUA 4LF5L 2BDOA 1P8LA 1KIXA 3K57A 2UXBQ 1JWSD 4GKJL 4JI3L 1W6KA 5D3DA 4ALPA 1TWCB 1EZ8A 3X3NA 1RKNA 2B29A 1PRTD 4LF8Q 2K28A 4POGA 4R4QA 5FK9C 2K4KA 3P1HA 3HOYB 1SNQA 4LF9L 2RSNA 2JE6I 3TRZA 2K50A 4UP8A 2OWOA 4GLAC 1JR0D 5C4JH 1SYDA 2FXQA 3NWSA 1Y1WG 3TZUA 4MNOA 4JK1C 1RL2A 2JA8B 3F2CA 1I4PA 1B9MA 1B53A 4DK1A 1WCMH 3E5SA 1XXGA 1IBKQ 2Q8IB 5IT9E 1XPOA 5C0XG 3KLWA 3KJPA 4QF4A 1NTGA 4GOPC 2MO0A 2B8GA 2G9HD 1AN8A 4QCLA 1HNZQ 4I65A 4IUNA 2JA8H 4IOAA 3BG3A 2OQ0A 2JA5H 2F4VL 3I73A 4KI0A 2L0CA 1VS0A 5LMNL 3A56A 1WTRA 2F4IA 1O7IA 2KEEA 2ZXRA 4DV0L 5IY0A 4BBRH 1KLUD 2QEJC 1SE3A 5JAVA 4DFAA 1TT2A 4DR4Q 1R9TB 2HQLA 5ELOA 4RHSA 2RVLA 1FGBD 5H1SE 4C3IB 5C3EH 4DV3Q 5D3IB 1LV9A 1F9SA 1JCKB 2OXPA 3OSOA 5DAUA 1ESRA 3F2BA 1G8ZD 3HOVB 1ICFB 4AYBE 2IX1A 1PTOF 2N3SA 4ODGA 1NUCA 1A6XA 2C35B 2WINB 4O42A 2AKWB 2SNMA 3AB9A 3G71A 4NXML 4F88A 2MP1A 2IHFA 4HSPA 2Q8TA 4DR1L 4EQ5A 3KF8A 4BY7H 4YHHL 2LY7A 2I5HA 4DAPA 5C4JB 3HOVH 2TSSA 1Z9FA 1AE3A 2LS01 4IO9A 3DMUA 4GN4B 1SXTA 4A3KB 1YBYA 1BCPD 4WRDA 5IGDA 2J4XA 4HMJA 3K7AB 4A3GG 4PMWA 2K01A 4ABNA 4IOCA 1JWMD 1PH3A 2F0SA 3F2DA 1IW7C 2EJMA 3MC0B 3K5LA 3STBD 2EXDA 3RNUA 1RCVD 1U4RA 4RGNA 2B63B 2RCFA 5A2QE 1EY6A 2MQHA 5LHY1 3MAQA 2VQFL 1WVLA 3GTQH 1E0BA 1AZPA 3S15H 2OF1A 5EJWA 1VQ6A 1EIFA 2A1AA 1D5XC 1AW7A 1STHA 2V1CC 3PUZA 3SDZA 3BJUA 4OIJA 2ZM6L 3I7FA 2R93B 4BS9A 3PGZA 3KFUA 1HNWL 4A3CH 2JYOA 2IX0A 3CCQA 2EOTA 3OW2A 4JI8L 5IT9c 3TP8A 2Z6KC 1CK1A 2Z6KA 1U4LA 4KY7A 2EYPA 3R8BA 4A3DH 2F0DA 3ULPA 2K32A 4NKLA 4JI8Q 1VQGA 4IZ8A 2UUAL 2L15A 1ET9A 2WAQB 3NEMA 1N36L 4OHJA 1DCZA 4A3EH 4DV4Q 3V05A 4B3TL 2WKDA 5GAHC 4LFAQ 1IBMQ 2WFWA 2LXKA 1BBXC 4JBMA 1Q86C 2F03A 1A3VA 1F2YA 4RCOA 4HAEA 1JE4A 1QG7A 5KIXA 4JV5L 2JEAI 1WTWA 3IKJA 2EYJA 2A68C 1VQBA 4IFDH 1BKBA 3HKZB 1EY8A 4CBVA 1GD7A 3S14B 1KAAA 1LTID 2NVXH 3DEPA 3U50C 2K5DA 2XRQD 4C3IG 4NPSA 4LFCL 1XJVA 3Q23A 4C2MB 1D1KA 3OIQA 3VYRA 3I8ZA 4DAVA 1PH4A 2PQEA 1DONA 2AQ3B 3ULLA 4HCEA 2CH4A 2R93G 4Y7NB 1IYVA 5KYLA 2F0EA 5C44G 1FR3A 1PYWD 4CGYB 5I9OA 3HGBA 3BS1A 3DEOA 4JI4L 4BBRB 5IWAQ 3PSIA 1E2WA 1KABA 3Q0AA 5A35A 3BVZA 1UNSA 3ULJA 3LWUA 1JT8A 1D2BA 3A5UA 4A3FB 4POFA 4RAUC 2WKCA 4LK1C 3M9BA 1S40A 1VQPA 4IFDI 2YYZA 1A3TA 3K81C 2BE5C 2E2IH 4Z9CB 4CKBA 3R2IA 1IKLA 3FVQA 3P7JA 3G48A 1MHWC 4JW0A 4JI0L 3G6EA 4WORA 2NTSA 2VUMB 1WJJA 2EZVA 4BY1G 4QGUA 2JA6G 2NUCA 2MHVA 4DUYL 1VQ4A 1GUSA 4NB3A 4PNYA 5IP7G 3E9IA 3MXNB 4OO1I 5T1GA 1LT6D 3ITPA 2EY2A 3O13A 2LFNA 3LX0A 2LSSA 3OIPA 2JA7H 1SJED 2Z4IA 1WD0A 2EDGA 1YITA 3I2ZA 4OGQC 4TRDA 3JAME 1Q1EA 4MIUA 1ILPA 1EOVA 2DNEA 3A5ZB 3QWNA 3DUZA 3KF6A 5AJ3Q 2UUBL 1Z7TA 2A6HD 2MNAA 1TS5A 1S5FD 3NSWA 4HIKA 4DV6L 4IPDA 2KBNA 5EAYA 4LF9Q 5LMNQ 1STBA 1TWAB 4DA2A 1Q12A 1OTCA 1X3FA 4YWMA 2Q2UA 1AE2A 3QR8A 1STNA 2UUCL 2X6LA 3BVGA 1HNZL 4AQYQ 1VF7A 3CKIB 1ZEQX 1Q1BA 2NN6G 1C9OA 4K5VA 3K59A 1UEBA 2KCTA 3VYSA 3FEWX 2VUMH 3W3AA 3HKZE 5CBEE 3Q24A 1SE2A 3NBHA 4PQXA 4F7XA 3SK4A 5BN4A 4OWTB 4HJ5A 4UP7A 1BUVT 1Q90A 1K83B 1SSOA 1CUKA 2E2IB 5DEHA 1B3QA 1B4OA 1X6OA 1MSGA 4A3IG 3GTMB 5JPMC 1VF5C 1V1PA 2IPKD 2JA6B 5D65A 4APVA 1BBUA 4XXEA 1CQFA 5LL6X 3HOZG 3H6MA 1QUQB 1N34L 4O2DA 1DJRD 3BZDB 3NBIA 4BBSH 3J80E 4YCVA 2EE1A 2PZWA 3DLLA 3CQZH 5M3FG 2KHSA 2M00A 1I5FA 1IXRA 1C4QA 2PW7A 2UXBL 1I6HH 4X3KA 3MEFA 1NR2A 4ZKBB 2JA9A 1GM5A 2KOLA 1GUWA 1XNQQ 1CZWA 4L6TB 4DR7Q 3R2TA 1RIPA 2CQOA 1FNVA 1E1OA 2EY1A 1H9SB 1V9PA 3CCLA 1SFOB 5F2DA 3RR5A 3TN2A 3RN2A 2JSOA 2GVBA 1KLGD 3FRPB 5DM73 2K33A 3KBGA 2I5LX 1B2TA 1VQKA 5HURA 1LACA 2ZJRA 1SE4A 5BR8Q 4YWLA 3RLFA 5ELNA 2K04A 4MTNA 3HKSA 1CA6A 1T5EA 4FXDA 3W1BA 1WTQA 1M8AA 4TQUS 4HIDA 1JJGA 1WOCA 3M4OH 1FL0A 3A54A 3VYUA 4BXXH 1X3QA 1JMCA 2IW3A 3SHLA 4TKOB 1KTKA 3HOWB 1XMOL 1JWUD 3UDXA 3S1MB 2NZHA 3NPPA 4DR7L 3PIP3 1PZID 2JA8G 2RDHA 4IFDJ 2HDMA 5K36H 1TS4A 4JBWA 1KDAA 4ILWA 3I4MG 4HJAA 1UEAB 4R4TA 4FP5D 1EEID 2XIWA 3I90A 3UDIA 3S2DB 2H1EA 3A55A 4R9WA 5BN3A 4CKEA 1YJWA 4BY1B 1SDFA 5KNBA 5IYBH 3NTIA 2R92B 3GTQB 2IJ0A 1L1OC 5GQOA 5COYA 4QIWB 1LTRD 3DM3A 4DR6Q 4UY8C 1KXLA 2WAQE 4XQQA 1I50B 1KDCA 2EY5A 1I6VC 1DD2A 3RZDH 1E2VA 4DR3L 2F0NA 3KLSX 4RHRA 3A0JA 1OXUA 1QILA 1FGUA 1YVCA 4OXPA 5IYCG 2F0VA 2YU9H 1LM0A 1OXTA 3D6CA 2RSOA 1H95A 4GOPB 5G3LD 2XTIA 3K5NA 4HCSA 4LMQD 3GP7A 5ELEA 1CZGA 3CPWA 4P75A 1X54A 1K3BC 2RQXA 1SNMA 3PF5A 4NW2A 1YHQA 3D4RA 1XTCD 3E0EA 2F0TA 3OWFA 4U673 4KKSA 1EY5A 3AQQA 4HEDA 4X3SA 5IE8A 4A3FH 3MHBA 2BH8A 5IYDH 4DV6Q 4C3JB 2R92G 5EQ0A 1EY0A 2J0TD 1VQEA 5IODA 5ISRA 1G91A 1GVPA 1I4HA 5HGTA 2VQEL 1Q81C 1QVFA 3PUXA 4MN3A 1HHVA 1LO5D 2NVXB 1PRTB 5J3BA 2NN6I 2Z8LA 4GNXA 3RZOB 4FXKC 1W2BA 1J5EQ 2DJFC 3WOFA 2HHHQ 4XDXA 3L7ZC 4JG2A 2EVBA 4LF6L 2SOBA 1HZCA 2VXWA 2GA4B 4IUPA 4JI5L 1SNPA 3KJOA 4F8MA 1WCMB 1XPUA 5FJ8G 1E24A 5C3XA 4WJ3M 5FO8B 4DNIA 4S3SA 3KLSA 1TWFB 4LWCA 1LUZA 2NYZD 2AUKA 4A75A 4B3MQ 1PH1A 4WFN3 4KHVA 1F9RA 2P5ZX 3K5MA 4JVZA 3K0XA 3MWYW 4ZRZA 4CKCA 5M3MB 3GTJH 4JI6Q 1TS2A 2E2HH 2QCPX 4IUUA 1K28A 4RKBA 1CKNB 1Y8NB 5KRUA 1K9MC 2SDFA 2EYHA 5L37A 2F0MA 4LUZA 3UE0A 5IOCA 1M4VA 4A3MB 4JCVE 4CJ1B 2K5QA 4IPHA 2L1BA 1B8AA 2XWJB 3CU7A 2ZJPA 3D8GA 3CC2A 5IWAL 2DJGC 1OO9B 3HG9A 2K6AA 4NP5A 2ICIA 5CV8A 1Q82C 4LW1A 1TXYA 5FLXc 4DF7A 4K6DA 2RHQB 1HJPA 1HNXL 5BN5A 5M3MG 2KQ3A 2EPBA 4DV1L 1CSPA 1PFSA 5EKKA 2VZAA 1JOKA 4P74A 1NAPA 1HFGA 1LTBD 1SLJA 5JVG3 1Y69U 3T56B 2OTJA 1OXXK 2YTXA 2BDNA 3CCJA 2ZTEA 4IALA 2R6GA 3TZDA 3VR3A 3LGJA 4JI2Q 1H9RA 3S14H 1EY4A 1NBWA 4QIWE 1EWIA 1NY4A 4X6AH 4V0BA 2KCNA 1SJHD 2Q2IA 5J22A 3OHXC 1K0RA 3TP5A 1SNCA 1LTLA 5LMNW 3U9OA 2UU9L 1PA6A 5AFWA 1GJXA 4YY3L 1HFNA 1JJ2A 5IIFA 2QDLA 3UE1A 3HRZC 3ERSX 1FNUA 1HUMA 1IBML 1HTLD 2RDFA 2VQFQ 2CFMA 5EKIA 1GKHA 1HNXQ 1EFID 4DV4L 4B3TQ 2Q2TA 4G7OC 1ZYRD 3E9HA 4FYDA 1N36Q 1EYCA 2QKIC 1J8IA 2I07B 3H0GG 1YHAA 4N8FA 2JK8A 2A69C 5J39A 5CORA 5I2XA 3WDNA 2TMPA 1TWHB 2VNUD 2MJ8A 2IT1A 2PZUA 1WTPA 3CC7A 3AEVA 5T1IA 5JEAH 2ZM6Q 1PRTF 2RKSA 2H4OA 3UDFA 1X55A 1Q3LA 4DR1Q 4XQNA 3GTGB 2JA7G 4ZKCB 5CV4A 5FOBB 3QB3A 4CHTB 5FLMG 4JYAL 1A62A 1R9TH 1Z47A 2NZOA 1PZKD 5CV9A 1W3SA 3CPFA 4DV7Q 3SE0A 4OONA 4EGVA 1I94L 1PFMA 5E3FA 2A6HC 4LF6Q 3MXUA 1L2FA 1Y1WB
chains in the Genus database with same CATH topology
1SFOH 2A19A 1UE5A 4DPGA 4POFA 3PUWA 4C3HH 2NVQH 4A93H 3M9BA 1S40A 1VQPA 4AIMA 2WAQG 5JEAJ 4IFDI 2YYZA 3I4OA 3H3VH 1NE3A 3K81C 2E2IH 1VQIA 1TWGH 3CMEA 5IYCH 4LF4Q 2VQEQ 3G48A 1IZ6A 3PIPA 1EQQA 1PH8A 4XIGS 4JI0L 1TWAH 3EN2A 3G6EA 4YHHQ 4A3JG 3I4NH 5M5XH 1CKOA 3VDYA 3L2PA 1EUJA 4LNQA 1WJJA 1I50H 1QVCA 1SRUA 3GD7A 4GOPA 3HOUG 1A63A 4BY1G 3ICEA 1XPRA 3TS0A 3PO2G 1UE6A 1VCIA 4QGUA 2DGYA 2F4VQ 2JA6G 1QVGA 4A3BG 2DUDA 1JE5A 4LUVA 4A76A 1MJEA 4DUYL 1VQLA 3KF6B 4A3EG 1VQ4A 2B63H 4NB3A 3CW2C 5IP7G 1E3PA 2K14A 3E9IA 5IYBG 3MXNB 1C7YA 4OO1I 2HT1A 3S2DH 2PQAB 4JI1Q 4C3JH 3AFPA 1EQRA 2BA0A 2LSSA 4LFBQ 4WJ4A 1CKMA 5C4XH 2Q2HA 3CP0A 4UP9A 1IBKL 2JA7H 1J6QA 4K0KL 1PVOA 1WYDA 3M3YH 3HOYH 1YITA 2HHHL 5C3EG 4DV3L 1S3OA 2D0OA 3I2ZA 4A3MH 1J5EL 1Q1EA 2WB1E 3PCOB 3PIOA 3CXCA 5LMUL 1PH6A 3GTKH 4DAYB 3TS2A 1EOVA 4R4OA 3A5ZB 3GDEA 3S1MH 2ZTDA 4X66Q 1E7ZA 4DAMA 1Y1WH 3PV0A 2AHOB 3KF6A 4ME3A 4DR4L 5M5WH 5AJ3Q 2UUBL 4NXNL 1VQNA 2MNAA 2QGQA 4BBSG 1V43A 4A3LH 4HJ7A 4L5TA 1WFQA 4C2MH 3HKZG 4DV0Q 3KOJA 3S1NH 4HIKA 4DV6L 4IPDA 1XTDA 2KBNA 5EAYA 4DKAC 2NVTH 2CWAA 1PHJA 2N78A 5JJIA 1PH2A 2E8GA 4X64L 5LMNQ 5E7NA 2E5LQ 1G51A 4LF9Q 1Q12A 1OTCA 2B3GA 1X3FA 4YWMA 3FKIG 2R7DA 2Q2UA 4DR6L 1YEZA 1C0AA 1AE2A 2UUCL 2N8NA 4GN5A 3G4SA 1L1OA 2WB1G 5IP9G 4C3IH 3OTOQ 3T1HQ 1N32L 4BXXG 1HZ9A 5JEAG 4IPCA 4X65Q 1HNZL 4RMFA 4LF8L 5GROA 4GLXA 3S1RH 1HR0Q 3S24A 4AQYQ 1NMFA 1D7QA 4A4IA 1Q1BA 2NN6G 1C9OA 2ID0A 1UEBA 2KCTA 1T9HA 4JI3Q 2VUMH 2JA5G 4A3FG 3HKZE 4DR5Q 3PO2H 3EBEA 1X3GA 4LF7Q 1SROA 4OWTB 1IBLQ 1OXSC 4UP7A 4HJ5A 4HJ9A 1NMGA 3L0OA 3J81c 4BBRG 1CUKA 1PH9A 2KENA 1A8VA 2EIFA 3GTGH 4GKKL 4DK6C 5JJKA 3T1YL 1X6OA 2PMZE 4A3IG 3GTOH 3RLOA 1N33L 5C0XI 3PO3H 1HH2P 4DR3Q 2OCEA 3RN5A 3S17H 4BA2I 2R7ZG 4APVA 1BBUA 4L5SA 3B6YA 3HOZG 1QUQB 1SN8A 2VL6A 4DUZL 4O2DA 1N34L 1VQ5A 1Y1VH 4OX9Q 3AYHB 3BZKA 3CC4A 4BBSH 3BZCA 4YCVA 2RF4A 3I4NG 1AH9A 2IY5B 3DLLA 3CQZH 5M3FG 2CKZB 4DV2L 5HGQA 3PF4A 1I5FA 4B3RL 2F3IA 2R7FA 1IXRA 3CF5A 3NELA 4GKJQ 3S1QH 3KDFA 1VQ8A 4JOIC 2KHJA 2CWPA 1I6HH 2UXBL 5JJLA 4R1JA 1ASYA 4LF5Q 1N8RC 3MEFA 5GAGC 4DR2Q 1VQAA 2JA9A 3F8TA 1GM5A 3NENA 2KCMA 1XNQQ 1GO3E 4DR7Q 3HOWG 4GNXC 1RIPA 2CQOA 1E1OA 1CSQA 1VQJA 1YJ9A 3CCLA 1V9PA 4KHPL 1B7YB 3J7ZC 1IYJB 2JEBI 1XMOQ 3RR5A 2UXCL 2WP8J 4X62Q 3RN2A 3GO5A 4DK3C 1PYBA 3WWVA 1XNQL 2JJQA 3CCRA 1E22A 2GVBA 3STBC 4DR2L 4H02A 1P16A 3JAMc 4JBJA 4J15A 1KRSA 4PG3A 2I5LX 4Y7NH 1VQKA 4Y52H 3K7AH 1HR0W 4A3LG 1TWFH 3KYHC 2ZJRA 5BR8Q 3ER0A 1VQHA 4YWLA 4DV2Q 4A3KH 3RLFA 1G291 5ELNA 5BR8L 3FP9A 3I55A 3OYYA 1EIYB 4MTNA 4P73A 1QZGA 2ES2A 3HKSA 4OX9L 3U4VA 3W1BA 1TWCH 1SMXA 2F52A 4DUZQ 3H0GH 1N34Q 2HIXA 4TQUS 5HY6A 4HIDA 1YNXA 1JJGA 1WOCA 3M4OH 1FL0A 2VY3A 1N9WA 4GS3A 4BXXH 4IFDG 1JMCA 1VQFA 1VQOA 2YTVA 4A93G 5C0XJ 1VQ7A 2VS1A 4FDBA 4X62L 3CMAA 3NBHB 1XMOL 2UXCQ 1VQ9A 3H3VI 4YCWA 3UDXA 3J81j 3T1YQ 4KHPQ 2VUMG 2NZHA 4YCUA 1OXVA 2XGTA 5GADC 3PUVA 3BU2A 4IPGA 1NJIC 4DR7L 3TQYA 3A74A 2PI2A 2JA8G 4IFDJ 3H15A 4JBWA 3RLNA 3I4MG 4LF5L 1P8LA 4HJAA 4R4TA 1KIXA 4LF7L 3M85A 2UXBQ 4GN3B 4DR5L 4GKJL 3UDIA 4JI3L 4ALPA 5IYDG 3AFQA 4B3RQ 3D0FA 4BY7G 1YJWA 1PV4A 3HOVG 4OO1G 2H5XA 3GTMH 1FVIA 4LUOA 5IYBH 3CAMA 2B29A 4X65L 4LF8Q 1X3EA 4HIOA 1L1OC 4R4QA 5GQOA 4POGA 5M5YH 2BA1A 3T1HL 2K4KA 4JOIA 2UUCQ 3DM3A 4DR6Q 3UDGA 4UY8C 1KXLA 2WAQE 2PQAA 4QL5A 4X64Q 4LF9L 3RZDH 2JE6I 1YIJA 3TRZA 4DR3L 2K50A 4UP8A 1N33Q 2OWOA 4GLAC 3J7A5 3A0JA 1OXUA 5M3FH 1UE7A 4AYBG 5C4JH 1FGUA 2FXQA 4R4IA 4A3GH 3D31A 1YVCA 4OXPA 1VQCA 5IYCG 3CCEA 5AJ3L 1Y1WG 2UUBQ 2K52A 3TREA 4MNOA 1ASZA 4GKKQ 1RL2A 1Q7YC 2YU9H 1LM0A 1OXTA 3F2CA 1H95A 2D62A 4GOPB 1LYLA 2XTIA 3JAMi 5LMUQ 5FJ8H 4QQBX 3GTLH 1WCMH 2KHIA 1IBLL 2Y0SG 5M3MH 3CPWA 4P75A 3KF8B 1PH7A 1IBKQ 2JA6H 4K0KQ 1X54A 4KLKA 4LFBL 2VW9A 1XPOA 3CCMA 5C0XG 3KLWA 3KJPA 3PF5A 4OWWB 1YHQA 1NTGA 2GN5A 4AH6A 4XTCS 4GOPC 4AQYL 1B70B 1HR0L 2MO0A 3CCVA 1D8LA 3E0EA 4A3JH 1HNZQ 2JA8H 2QEXA 2NVYH 3J80i 3OTOL 4IOAA 1N32Q 2OQ0A 1X9NA 4A3CG 2MO1A 2JA5H 2F4VL 3AQQA 1K83H 1SR3A 5IE8A 3J81i 3SGIA 4A3FH 4BY1H 1I3QH 4KI0A 4PZ6A 4YWKA 1MIUA 1VS0A 5LMNL 2E5LL 3HOYG 2BH8A 5IYDH 5FLMH 4DV6Q 2R92G 1O7IA 4DV0L 4A3KG 5IY0A 4BBRH 4A3DG 5C44H 1PH5A 1VQEA 2LXJA 3Q8DA 3ZJYC 5GAEC 4NXNQ 1GVPA 4DR4Q 2VQEL 1Q81C 1QVFA 3PUXA 4LF4L 2HQLA 5ELOA 4X66L 5J3BA 4IJHA 3JC66 4RG1A 2NN6I 1KD1C 5H1SE 4GNXA 1W2BA 4JBKA 3K7UC 1J5EQ 5C3EH 4OWXB 4DV3Q 4A3MG 2HHHQ 2R7ZH 1KL9A 3L7ZC 1Y14B 4PZ8A 3F2BA 4JG2A 4LF6L 2AMCB 5IP9H 4JI1L 1YI2A 1JB7A 1KHIA 4AYBE 1HZCA 2BH2A 2IX1A 2E2JH 2N3SA 1BBWA 1EFWA 3J80c 1EYGA 4JI5L 1WI5A 3M7NA 3KJOA 2K75A 4DUYQ 2C35B 4EX5A 5FJ8G 1K73C 1HZAA 3HOXH 1M1KC 1XPUA 4JYAQ 3RZOH 1E24A 1E1TA 2AKWB 3I4MH 4WJ3M 1MKHA 3HOUH 4DNIA 3G71A 4NXML 2OTLA 2ATWA 2ASBA 4B3SL 2I5MX 2IHFA 4LWCA 1LUZA 1YJNA 1A0IA 3CCSA 1VQDA 4DR1L 4L5QA 4A75A 4EQ5A 4BY7H 1KQSA 3U4ZA 1PH1A 1M90C 4YHHL 4B3MQ 2I5HA 3HOVH 4JI0Q 5IP7H 1KAWA 3K80C 1Z9FA 5DLQE 2YTYA 2RCNA 3K0XA 1AE3A 1L0WA 1KC8C 3FHWA 3GTJH 4JI6Q 1YZ6A 4IO9A 2E2HH 1SE8A 1TWHH 1V1QA 3PO3G 1CKNB 4GN4B 1K9MC 3S2HH 1YBYA 1K8AC 1QUQA 4LUZA 1DGSA 2K5VA 3UE0A 2AWOA 4MZ9A 3IRBA 1K3RA 4A3GG 4PMWA 4JCVE 4IOCA 3W1GA 4JI7L 4IPHA 1PH3A 1B8AA 1Y1VG 2ZJPA 3CC2A 1I94Q 5IWAL 4JV5Q 3F2DA 4JI4Q 4JC0A 2PI2E 2R93H 3STBD 4HJ8A 2EXDA 3RNUA 1Q82C 4LW1A 4DV7L 4L5RC 1TXYA 5FLXc 2ZJQA 1UWVA 2RHQB 1FJGL 1HJPA 1HNXL 1WCMG 2MQHA 5M3MG 2VQFL 4DV1L 1S72A 3GTQH 2GVAA 2ALYB 4R4CA 1CSPA 2HIVA 1XMQQ 1PFSA 1U0LA 2JQOA 2VZAA 3S15H 3HOZH 4LFAL 2Z0SA 4P74A 1VQ6A 1EIFA 1SLJA 3I56A 2AWNA 2A1AA 2V1CC 3PUZA 4YY3Q 3BJUA 1Q46A 3PUYA 2ZM6L 1X56A 2OQKA 3I7FA 4DV5Q 1OXXK 2UU9Q 2PNHA 4LFCQ 2YTXA 2OTJA 3PGZA 3KFUA 3M4QA 3CCJA 3HOXG 1HNWL 4A3CH 2IX0A 3K8AA 2ZTEA 3CCQA 2R6GA 1JJCB 3HFZB 3OW2A 4JI8L 2IHEA 5IT9c 3LGJA 4JI2Q 2I0QA 2D0PA 2Y0SE 3S14H 2Z6KC 1NBWA 4PZ7A 2Z6KA 4QIWE 2R92H 2UXDL 2MFIA 1EWIA 1NY4A 4A3DH 4X6AH 3ULPA 4JI8Q 2Q2IA 1VQGA 4GNXB 1K0RA 2UUAL 2L15A 3CD6A 1LTLA 3NEMA 5LMNW 1HNWQ 1N36L 2UU9L 1PA6A 3W5OA 4A3EH 2B63G 2ZTCA 1XNRQ 1X65A 4DV4Q 4B3TL 4GLVB 4YY3L 1L1OB 2YV5A 4QY7A 1JJ2A 1MJCA 5GAHC 2QA4A 3UE1A 4KHZA 4LFAQ 1IBMQ 3EIVA 1Q8KA 2K5HA 2LXKA 2WFWA 4TVAB 1Q86C 3ERSX 4JBMA 1IBML 2VQFQ 4DV1Q 2CFMA 1HNXQ 1GKHA 4P71A 1UE1A 4DV4L 3M4PA 4B3TQ 3KDFB 2Q2TA 1XNRL 2CCZA 1G6PA 1KRTA 1HZBA 3E9HA 2A8VA 3CCUA 1N36Q 1BVSA 4P72A 4JV5L 4UPAA 2UUAQ 2JEAI 3H0GG 1YHAA 2JK8A 1VQMA 5K36G 2UXDQ 2RHSB 3F1ZA 1VQBA 2K5NA 1BKBA 4JI2L 2VNUD 1GD7A 3HOWH 2NVXH 3FKIH 2IT1A 4A3BH 1U5KA 3U50C 3CC7A 4JI6L 3AEVA 4NPSA 4LFCL 4DV5L 1XJVA 2ZM6Q 1QZHA 4QJFA 4B3ML 4HIMA 2N49A 1CKNA 1X55A 3UDFA 4DR1Q 1PH4A 2JA7G 1XMQL 5C4XG 4B3SQ 3ULLA 4NXMQ 4IJLA 1IL2A 5FLMG 4JYAL 2R93G 1A62A 1FJGQ 1R9TH 1Z47A 2NZOA 1W3SA 3CPFA 5C44G 4DV7Q 3U58A 4JI5Q 4O0AA 4OONA 4JI4L 5IWAQ 1PYSB 1I94L 3PSIA 3S16H 3TEHB 4A3IH 1YHBA 4BA1I 4LF6Q 4JI7Q 1K8GA 3GTPH 1L2FA 2EQSA 3ULJA 1JT8A 3A5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFO H;  2A19 A;  1UE5 A;  4DPG A;  4POF A;  3PUW A;  4C3H H;  2NVQ H;  4A93 H;  3M9B A;  1S40 A;  1VQP A;  4AIM A;  2WAQ G;  5JEA J;  4IFD I;  2YYZ A;  3I4O A;  3H3V H;  1NE3 A;  3K81 C;  2E2I H;  1VQI A;  1TWG H;  3CME A;  5IYC H;  4LF4 Q;  2VQE Q;  3G48 A;  1IZ6 A;  3PIP A;  1EQQ A;  1PH8 A;  4XIG S;  4JI0 L;  1TWA H;  3EN2 A;  3G6E A;  4YHH Q;  4A3J G;  3I4N H;  5M5X H;  1CKO A;  3VDY A;  3L2P A;  1EUJ A;  4LNQ A;  1WJJ A;  1I50 H;  1QVC A;  1SRU A;  3GD7 A;  4GOP A;  3HOU G;  1A63 A;  4BY1 G;  3ICE A;  1XPR A;  3TS0 A;  3PO2 G;  1UE6 A;  1VCI A;  4QGU A;  2DGY A;  2F4V Q;  2JA6 G;  1QVG A;  4A3B G;  2DUD A;  1JE5 A;  4LUV A;  4A76 A;  1MJE A;  4DUY L;  1VQL A;  3KF6 B;  4A3E G;  1VQ4 A;  2B63 H;  4NB3 A;  3CW2 C;  5IP7 G;  1E3P A;  2K14 A;  3E9I A;  5IYB G;  3MXN B;  1C7Y A;  4OO1 I;  2HT1 A;  3S2D H;  2PQA B;  4JI1 Q;  4C3J H;  3AFP A;  1EQR A;  2BA0 A;  2LSS A;  4LFB Q;  4WJ4 A;  1CKM A;  5C4X H;  2Q2H A;  3CP0 A;  4UP9 A;  1IBK L;  2JA7 H;  1J6Q A;  4K0K L;  1PVO A;  1WYD A;  3M3Y H;  3HOY H;  1YIT A;  2HHH L;  5C3E G;  4DV3 L;  1S3O A;  2D0O A;  3I2Z A;  4A3M H;  1J5E L;  1Q1E A;  2WB1 E;  3PCO B;  3PIO A;  3CXC A;  5LMU L;  1PH6 A;  3GTK H;  4DAY B;  3TS2 A;  1EOV A;  4R4O A;  3A5Z B;  3GDE A;  3S1M H;  2ZTD A;  4X66 Q;  1E7Z A;  4DAM A;  1Y1W H;  3PV0 A;  2AHO B;  3KF6 A;  4ME3 A;  4DR4 L;  5M5W H;  5AJ3 Q;  2UUB L;  4NXN L;  1VQN A;  2MNA A;  2QGQ A;  4BBS G;  1V43 A;  4A3L H;  4HJ7 A;  4L5T A;  1WFQ A;  4C2M H;  3HKZ G;  4DV0 Q;  3KOJ A;  3S1N H;  4HIK A;  4DV6 L;  4IPD A;  1XTD A;  2KBN A;  5EAY A;  4DKA C;  2NVT H;  2CWA A;  1PHJ A;  2N78 A;  5JJI A;  1PH2 A;  2E8G A;  4X64 L;  5LMN Q;  5E7N A;  2E5L Q;  1G51 A;  4LF9 Q;  1Q12 A;  1OTC A;  2B3G A;  1X3F A;  4YWM A;  3FKI G;  2R7D A;  2Q2U A;  4DR6 L;  1YEZ A;  1C0A A;  1AE2 A;  2UUC L;  2N8N A;  4GN5 A;  3G4S A;  1L1O A;  2WB1 G;  5IP9 G;  4C3I H;  3OTO Q;  3T1H Q;  1N32 L;  4BXX G;  1HZ9 A;  5JEA G;  4IPC A;  4X65 Q;  1HNZ L;  4RMF A;  4LF8 L;  5GRO A;  4GLX A;  3S1R H;  1HR0 Q;  3S24 A;  4AQY Q;  1NMF A;  1D7Q A;  4A4I A;  1Q1B A;  2NN6 G;  1C9O A;  2ID0 A;  1UEB A;  2KCT A;  1T9H A;  4JI3 Q;  2VUM H;  2JA5 G;  4A3F G;  3HKZ E;  4DR5 Q;  3PO2 H;  3EBE A;  1X3G A;  4LF7 Q;  1SRO A;  4OWT B;  1IBL Q;  1OXS C;  4UP7 A;  4HJ5 A;  4HJ9 A;  1NMG A;  3L0O A;  3J81 c;  4BBR G;  1CUK A;  1PH9 A;  2KEN A;  1A8V A;  2EIF A;  3GTG H;  4GKK L;  4DK6 C;  5JJK A;  3T1Y L;  1X6O A;  2PMZ E;  4A3I G;  3GTO H;  3RLO A;  1N33 L;  5C0X I;  3PO3 H;  1HH2 P;  4DR3 Q;  2OCE A;  3RN5 A;  3S17 H;  4BA2 I;  2R7Z G;  4APV A;  1BBU A;  4L5S A;  3B6Y A;  3HOZ G;  1QUQ B;  1SN8 A;  2VL6 A;  4DUZ L;  4O2D A;  1N34 L;  1VQ5 A;  1Y1V H;  4OX9 Q;  3AYH B;  3BZK A;  3CC4 A;  4BBS H;  3BZC A;  4YCV A;  2RF4 A;  3I4N G;  1AH9 A;  2IY5 B;  3DLL A;  3CQZ H;  5M3F G;  2CKZ B;  4DV2 L;  5HGQ A;  3PF4 A;  1I5F A;  4B3R L;  2F3I A;  2R7F A;  1IXR A;  3CF5 A;  3NEL A;  4GKJ Q;  3S1Q H;  3KDF A;  1VQ8 A;  4JOI C;  2KHJ A;  2CWP A;  1I6H H;  2UXB L;  5JJL A;  4R1J A;  1ASY A;  4LF5 Q;  1N8R C;  3MEF A;  5GAG C;  4DR2 Q;  1VQA A;  2JA9 A;  3F8T A;  1GM5 A;  3NEN A;  2KCM A;  1XNQ Q;  1GO3 E;  4DR7 Q;  3HOW G;  4GNX C;  1RIP A;  2CQO A;  1E1O A;  1CSQ A;  1VQJ A;  1YJ9 A;  3CCL A;  1V9P A;  4KHP L;  1B7Y B;  3J7Z C;  1IYJ B;  2JEB I;  1XMO Q;  3RR5 A;  2UXC L;  2WP8 J;  4X62 Q;  3RN2 A;  3GO5 A;  4DK3 C;  1PYB A;  3WWV A;  1XNQ L;  2JJQ A;  3CCR A;  1E22 A;  2GVB A;  3STB C;  4DR2 L;  4H02 A;  1P16 A;  3JAM c;  4JBJ A;  4J15 A;  1KRS A;  4PG3 A;  2I5L X;  4Y7N H;  1VQK A;  4Y52 H;  3K7A H;  1HR0 W;  4A3L G;  1TWF H;  3KYH C;  2ZJR A;  5BR8 Q;  3ER0 A;  1VQH A;  4YWL A;  4DV2 Q;  4A3K H;  3RLF A;  1G29 1;  5ELN A;  5BR8 L;  3FP9 A;  3I55 A;  3OYY A;  1EIY B;  4MTN A;  4P73 A;  1QZG A;  2ES2 A;  3HKS A;  4OX9 L;  3U4V A;  3W1B A;  1TWC H;  1SMX A;  2F52 A;  4DUZ Q;  3H0G H;  1N34 Q;  2HIX A;  4TQU S;  5HY6 A;  4HID A;  1YNX A;  1JJG A;  1WOC A;  3M4O H;  1FL0 A;  2VY3 A;  1N9W A;  4GS3 A;  4BXX H;  4IFD G;  1JMC A;  1VQF A;  1VQO A;  2YTV A;  4A93 G;  5C0X J;  1VQ7 A;  2VS1 A;  4FDB A;  4X62 L;  3CMA A;  3NBH B;  1XMO L;  2UXC Q;  1VQ9 A;  3H3V I;  4YCW A;  3UDX A;  3J81 j;  3T1Y Q;  4KHP Q;  2VUM G;  2NZH A;  4YCU A;  1OXV A;  2XGT A;  5GAD C;  3PUV A;  3BU2 A;  4IPG A;  1NJI C;  4DR7 L;  3TQY A;  3A74 A;  2PI2 A;  2JA8 G;  4IFD J;  3H15 A;  4JBW A;  3RLN A;  3I4M G;  4LF5 L;  1P8L A;  4HJA A;  4R4T A;  1KIX A;  4LF7 L;  3M85 A;  2UXB Q;  4GN3 B;  4DR5 L;  4GKJ L;  3UDI A;  4JI3 L;  4ALP A;  5IYD G;  3AFQ A;  4B3R Q;  3D0F A;  4BY7 G;  1YJW A;  1PV4 A;  3HOV G;  4OO1 G;  2H5X A;  3GTM H;  1FVI A;  4LUO A;  5IYB H;  3CAM A;  2B29 A;  4X65 L;  4LF8 Q;  1X3E A;  4HIO A;  1L1O C;  4R4Q A;  5GQO A;  4POG A;  5M5Y H;  2BA1 A;  3T1H L;  2K4K A;  4JOI A;  2UUC Q;  3DM3 A;  4DR6 Q;  3UDG A;  4UY8 C;  1KXL A;  2WAQ E;  2PQA A;  4QL5 A;  4X64 Q;  4LF9 L;  3RZD H;  2JE6 I;  1YIJ A;  3TRZ A;  4DR3 L;  2K50 A;  4UP8 A;  1N33 Q;  2OWO A;  4GLA C;  3J7A 5;  3A0J A;  1OXU A;  5M3F H;  1UE7 A;  4AYB G;  5C4J H;  1FGU A;  2FXQ A;  4R4I A;  4A3G H;  3D31 A;  1YVC A;  4OXP A;  1VQC A;  5IYC G;  3CCE A;  5AJ3 L;  1Y1W G;  2UUB Q;  2K52 A;  3TRE A;  4MNO A;  1ASZ A;  4GKK Q;  1RL2 A;  1Q7Y C;  2YU9 H;  1LM0 A;  1OXT A;  3F2C A;  1H95 A;  2D62 A;  4GOP B;  1LYL A;  2XTI A;  3JAM i;  5LMU Q;  5FJ8 H;  4QQB X;  3GTL H;  1WCM H;  2KHI A;  1IBL L;  2Y0S G;  5M3M H;  3CPW A;  4P75 A;  3KF8 B;  1PH7 A;  1IBK Q;  2JA6 H;  4K0K Q;  1X54 A;  4KLK A;  4LFB L;  2VW9 A;  1XPO A;  3CCM A;  5C0X G;  3KLW A;  3KJP A;  3PF5 A;  4OWW B;  1YHQ A;  1NTG A;  2GN5 A;  4AH6 A;  4XTC S;  4GOP C;  4AQY L;  1B70 B;  1HR0 L;  2MO0 A;  3CCV A;  1D8L A;  3E0E A;  4A3J H;  1HNZ Q;  2JA8 H;  2QEX A;  2NVY H;  3J80 i;  3OTO L;  4IOA A;  1N32 Q;  2OQ0 A;  1X9N A;  4A3C G;  2MO1 A;  2JA5 H;  2F4V L;  3AQQ A;  1K83 H;  1SR3 A;  5IE8 A;  3J81 i;  3SGI A;  4A3F H;  4BY1 H;  1I3Q H;  4KI0 A;  4PZ6 A;  4YWK A;  1MIU A;  1VS0 A;  5LMN L;  2E5L L;  3HOY G;  2BH8 A;  5IYD H;  5FLM H;  4DV6 Q;  2R92 G;  1O7I A;  4DV0 L;  4A3K G;  5IY0 A;  4BBR H;  4A3D G;  5C44 H;  1PH5 A;  1VQE A;  2LXJ A;  3Q8D A;  3ZJY C;  5GAE C;  4NXN Q;  1GVP A;  4DR4 Q;  2VQE L;  1Q81 C;  1QVF A;  3PUX A;  4LF4 L;  2HQL A;  5ELO A;  4X66 L;  5J3B A;  4IJH A;  3JC6 6;  4RG1 A;  2NN6 I;  1KD1 C;  5H1S E;  4GNX A;  1W2B A;  4JBK A;  3K7U C;  1J5E Q;  5C3E H;  4OWX B;  4DV3 Q;  4A3M G;  2HHH Q;  2R7Z H;  1KL9 A;  3L7Z C;  1Y14 B;  4PZ8 A;  3F2B A;  4JG2 A;  4LF6 L;  2AMC B;  5IP9 H;  4JI1 L;  1YI2 A;  1JB7 A;  1KHI A;  4AYB E;  1HZC A;  2BH2 A;  2IX1 A;  2E2J H;  2N3S A;  1BBW A;  1EFW A;  3J80 c;  1EYG A;  4JI5 L;  1WI5 A;  3M7N A;  3KJO A;  2K75 A;  4DUY Q;  2C35 B;  4EX5 A;  5FJ8 G;  1K73 C;  1HZA A;  3HOX H;  1M1K C;  1XPU A;  4JYA Q;  3RZO H;  1E24 A;  1E1T A;  2AKW B;  3I4M H;  4WJ3 M;  1MKH A;  3HOU H;  4DNI A;  3G71 A;  4NXM L;  2OTL A;  2ATW A;  2ASB A;  4B3S L;  2I5M X;  2IHF A;  4LWC A;  1LUZ A;  1YJN A;  1A0I A;  3CCS A;  1VQD A;  4DR1 L;  4L5Q A;  4A75 A;  4EQ5 A;  4BY7 H;  1KQS A;  3U4Z A;  1PH1 A;  1M90 C;  4YHH L;  4B3M Q;  2I5H A;  3HOV H;  4JI0 Q;  5IP7 H;  1KAW A;  3K80 C;  1Z9F A;  5DLQ E;  2YTY A;  2RCN A;  3K0X A;  1AE3 A;  1L0W A;  1KC8 C;  3FHW A;  3GTJ H;  4JI6 Q;  1YZ6 A;  4IO9 A;  2E2H H;  1SE8 A;  1TWH H;  1V1Q A;  3PO3 G;  1CKN B;  4GN4 B;  1K9M C;  3S2H H;  1YBY A;  1K8A C;  1QUQ A;  4LUZ A;  1DGS A;  2K5V A;  3UE0 A;  2AWO A;  4MZ9 A;  3IRB A;  1K3R A;  4A3G G;  4PMW A;  4JCV E;  4IOC A;  3W1G A;  4JI7 L;  4IPH A;  1PH3 A;  1B8A A;  1Y1V G;  2ZJP A;  3CC2 A;  1I94 Q;  5IWA L;  4JV5 Q;  3F2D A;  4JI4 Q;  4JC0 A;  2PI2 E;  2R93 H;  3STB D;  4HJ8 A;  2EXD A;  3RNU A;  1Q82 C;  4LW1 A;  4DV7 L;  4L5R C;  1TXY A;  5FLX c;  2ZJQ A;  1UWV A;  2RHQ B;  1FJG L;  1HJP A;  1HNX L;  1WCM G;  2MQH A;  5M3M G;  2VQF L;  4DV1 L;  1S72 A;  3GTQ H;  2GVA A;  2ALY B;  4R4C A;  1CSP A;  2HIV A;  1XMQ Q;  1PFS A;  1U0L A;  2JQO A;  2VZA A;  3S15 H;  3HOZ H;  4LFA L;  2Z0S A;  4P74 A;  1VQ6 A;  1EIF A;  1SLJ A;  3I56 A;  2AWN A;  2A1A A;  2V1C C;  3PUZ A;  4YY3 Q;  3BJU A;  1Q46 A;  3PUY A;  2ZM6 L;  1X56 A;  2OQK A;  3I7F A;  4DV5 Q;  1OXX K;  2UU9 Q;  2PNH A;  4LFC Q;  2YTX A;  2OTJ A;  3PGZ A;  3KFU A;  3M4Q A;  3CCJ A;  3HOX G;  1HNW L;  4A3C H;  2IX0 A;  3K8A A;  2ZTE A;  3CCQ A;  2R6G A;  1JJC B;  3HFZ B;  3OW2 A;  4JI8 L;  2IHE A;  5IT9 c;  3LGJ A;  4JI2 Q;  2I0Q A;  2D0P A;  2Y0S E;  3S14 H;  2Z6K C;  1NBW A;  4PZ7 A;  2Z6K A;  4QIW E;  2R92 H;  2UXD L;  2MFI A;  1EWI A;  1NY4 A;  4A3D H;  4X6A H;  3ULP A;  4JI8 Q;  2Q2I A;  1VQG A;  4GNX B;  1K0R A;  2UUA L;  2L15 A;  3CD6 A;  1LTL A;  3NEM A;  5LMN W;  1HNW Q;  1N36 L;  2UU9 L;  1PA6 A;  3W5O A;  4A3E H;  2B63 G;  2ZTC A;  1XNR Q;  1X65 A;  4DV4 Q;  4B3T L;  4GLV B;  4YY3 L;  1L1O B;  2YV5 A;  4QY7 A;  1JJ2 A;  1MJC A;  5GAH C;  2QA4 A;  3UE1 A;  4KHZ A;  4LFA Q;  1IBM Q;  3EIV A;  1Q8K A;  2K5H A;  2LXK A;  2WFW A;  4TVA B;  1Q86 C;  3ERS X;  4JBM A;  1IBM L;  2VQF Q;  4DV1 Q;  2CFM A;  1HNX Q;  1GKH A;  4P71 A;  1UE1 A;  4DV4 L;  3M4P A;  4B3T Q;  3KDF B;  2Q2T A;  1XNR L;  2CCZ A;  1G6P A;  1KRT A;  1HZB A;  3E9H A;  2A8V A;  3CCU A;  1N36 Q;  1BVS A;  4P72 A;  4JV5 L;  4UPA A;  2UUA Q;  2JEA I;  3H0G G;  1YHA A;  2JK8 A;  1VQM A;  5K36 G;  2UXD Q;  2RHS B;  3F1Z A;  1VQB A;  2K5N A;  1BKB A;  4JI2 L;  2VNU D;  1GD7 A;  3HOW H;  2NVX H;  3FKI H;  2IT1 A;  4A3B H;  1U5K A;  3U50 C;  3CC7 A;  4JI6 L;  3AEV A;  4NPS A;  4LFC L;  4DV5 L;  1XJV A;  2ZM6 Q;  1QZH A;  4QJF A;  4B3M L;  4HIM A;  2N49 A;  1CKN A;  1X55 A;  3UDF A;  4DR1 Q;  1PH4 A;  2JA7 G;  1XMQ L;  5C4X G;  4B3S Q;  3ULL A;  4NXM Q;  4IJL A;  1IL2 A;  5FLM G;  4JYA L;  2R93 G;  1A62 A;  1FJG Q;  1R9T H;  1Z47 A;  2NZO A;  1W3S A;  3CPF A;  5C44 G;  4DV7 Q;  3U58 A;  4JI5 Q;  4O0A A;  4OON A;  4JI4 L;  5IWA Q;  1PYS B;  1I94 L;  3PSI A;  3S16 H;  3TEH B;  4A3I H;  1YHB A;  4BA1 I;  4LF6 Q;  4JI7 Q;  1K8G A;  3GTP H;  1L2F A;  2EQS A;  3ULJ A;  1JT8 A;  3A5U A; 
#chains in the Genus database with same CATH topology
 2A19 A;  3R93 A;  4XT1 B;  3I4O A;  3H3V H;  3KBX A;  4Q5V A;  3IFD A;  1F2L A;  3CME A;  2E2J B;  1IZ6 A;  1PH8 A;  5ELF A;  4LJZ C;  3EN2 A;  3I4N H;  5G3L F;  3VDY A;  1JOQ A;  4LNQ A;  1I50 H;  1SRU A;  2KJX A;  3HOU G;  1I4G A;  4FF3 A;  3ICE A;  1O7Z A;  5EBD A;  1QVG A;  4A3B G;  2DUD A;  1JE5 A;  3PMF A;  5KEE A;  3KF6 B;  2B63 H;  1G2T A;  1C7Y A;  5C44 B;  2HT1 A;  3Q22 A;  3S2D H;  1PFN A;  4JI1 Q;  2B2U A;  4LFB Q;  4WJ4 A;  1RD9 D;  2XWB B;  5C4X H;  1IBK L;  1PVO A;  4RWS C;  2FHT A;  3M3Y H;  4KJN A;  3V96 A;  3HOY H;  2HHH L;  5C3E G;  1L0X B;  1PH6 A;  3TS2 A;  5C3E B;  5IGB A;  5C4Z A;  1DZ1 A;  3S1M H;  3M7G A;  1EEF D;  4DAM A;  1Y1W H;  1A15 A;  3PV0 A;  4ME3 A;  4BBS G;  4A3L H;  1V43 A;  4HJ7 A;  4BWG B;  1WFQ A;  3HKZ G;  3S1N H;  4K2L A;  2MUY A;  1PH2 A;  2XNA C;  2Z4H A;  1MSH A;  3FKI G;  2R7D A;  4DR6 L;  1YEZ A;  2B2V A;  4CDC C;  1N32 L;  2WB1 G;  5IP9 G;  3I4M B;  4RMF A;  1I4Q A;  4GLX A;  3S1R H;  3S24 A;  3BDC A;  1NMF A;  1D7Q A;  4A4I A;  1IL8 A;  4Q0F A;  1EQV A;  3SR1 A;  4KD4 A;  4JI3 Q;  1BXT A;  2JA5 G;  4DR5 Q;  3I91 A;  5E1F A;  5J1Z A;  4A3I B;  1X3G A;  2EYL A;  1D5M C;  3KUP A;  3QO2 A;  4DGZ A;  4RA8 A;  4N8X 1;  4ZUJ A;  4EQN A;  4LF7 Q;  1YNJ D;  5C5L A;  1NMG A;  4BBR G;  1A8V A;  2EIF A;  3NQI A;  5NUC A;  3GTG H;  5JJK A;  3CHB D;  3EVQ A;  1EIG A;  1QE6 A;  1V8Q A;  1DYQ A;  3RLO A;  4ZAI A;  1N33 L;  1LT4 D;  3PO3 H;  4KY6 A;  1VMC A;  3S17 H;  4BA2 I;  3CRK C;  3B6Y A;  1JQY D;  1SN8 A;  3E0J A;  1Y1V H;  4OX9 Q;  3OMG A;  3AYH B;  3CC4 A;  2PCF B;  1VDZ A;  4R8I A;  4H44 C;  3UI2 A;  2YU9 B;  2CKZ B;  4FXG C;  1D1I A;  3K6O A;  4KMU C;  3NEL A;  2R3Z A;  3S1Q H;  2EY6 A;  4JOI C;  2KHJ A;  2CWP A;  1DM0 B;  1B50 A;  3SEB A;  3VR4 A;  3BYT B;  4O1N A;  3RZD B;  3HOW G;  4FVM A;  1LT3 D;  4NMZ A;  3NE5 B;  1YJ9 A;  1VQJ A;  4KHP L;  2JXM B;  5C0X H;  2UXC L;  1IYJ B;  1DOL A;  4X62 Q;  3EJI A;  2JJQ A;  3U9S A;  2PNR C;  1O80 A;  4H02 A;  4HN7 A;  2L4N A;  1KRS A;  1GXD C;  2N88 A;  1HR0 W;  1Z6H A;  2B2Y C;  1SBB B;  1TWF H;  1WTH A;  3KYH C;  1F77 A;  1WTV A;  1DOM A;  4OX9 L;  1TWC H;  3VR6 A;  1N34 Q;  5C6A A;  5HY6 A;  1F9P A;  4PV1 C;  3P75 A;  2XRS D;  4RFB A;  4RKL A;  1ML0 D;  3VA7 A;  2VY3 A;  1N9W A;  4IFD G;  1A2U A;  1VQO A;  2YTV A;  4C3H G;  4A93 G;  4X62 L;  3K58 A;  3NBH B;  2ICE C;  2G9D A;  3H3V I;  3RD4 A;  5JJZ A;  3C1E A;  1EU3 A;  3I70 A;  2DY7 A;  2EJF C;  4QB4 A;  2F0J A;  3S9W A;  4KKT A;  4H13 C;  4MHE A;  4K5W A;  4RGO S;  2CW0 D;  3DWA A;  1H9K A;  4GN3 B;  4DR5 L;  4KK7 A;  5IYD G;  1F2Z A;  2F0P A;  4BY7 G;  4OO1 G;  3HOV G;  1SYC A;  4XYO A;  1FVI A;  2X69 A;  4PMB A;  4R8N A;  3HZX A;  3I4L A;  4HIO A;  1KNA A;  5M5Y H;  2BA1 A;  3T1H L;  4JOI A;  1K0S A;  2UUC Q;  2F0G A;  2EYF A;  3UDG A;  3MVV A;  1PLF A;  3G7L A;  1YNN D;  4QL5 A;  4IUV A;  1YIJ A;  1IHZ A;  4ZLT F;  3J7A 5;  2K5W A;  1UE7 A;  2EYO A;  4AYB G;  4A3G H;  1MD2 D;  1ONL A;  1F2M A;  1VQC A;  3GTL B;  3HEJ A;  2K52 A;  1LTA D;  1Y8P B;  5EKL A;  3TRE A;  1ASZ A;  2ENB A;  3GV6 A;  4H0L C;  1LYL A;  3JAM i;  5FJ8 H;  4QQB X;  3GTL H;  1H9S A;  1IBL L;  2Y0S G;  2FMM A;  3K0Y A;  3KF8 B;  1PH7 A;  2JA6 H;  4K0K Q;  1ET6 A;  5FO7 B;  4KLK A;  4CJ2 C;  4OEM B;  4RCN A;  2VW9 A;  3CCM A;  2AQ2 B;  4OWW B;  2NTT A;  4NDX A;  2J7Z A;  2L11 A;  4XTC S;  5I9P A;  1B70 B;  2PPB C;  3IAY A;  3OWE B;  1D8L A;  1BF4 A;  4A3J H;  2NVY H;  3J80 i;  4A3C G;  1XWE A;  1K83 H;  3J81 i;  3SGI A;  4XYQ A;  2E2H B;  3NQT A;  4PZ6 A;  2E2D C;  2E5L L;  4DK0 A;  2A6E C;  4RGT A;  4A3K G;  4A3D G;  5C4X B;  5C44 H;  1PH5 A;  4UAI A;  3MFG A;  1B44 D;  2LXJ A;  3Q8D A;  1WTO A;  4NXN Q;  5EPK A;  4TSS A;  1FYC A;  4LF4 L;  4X66 L;  3WOE A;  4RG1 A;  2B2T C;  3JC6 6;  1KD1 C;  4JBK A;  2OEO A;  3K7U C;  4A3M G;  3DWQ A;  2R7Z H;  4HTH A;  1KL9 A;  4PZ8 A;  4EVO A;  2G5D A;  1BDO A;  2AMC B;  1V1O A;  1YI2 A;  3JAM L;  1BBW A;  2LMC B;  1EFW A;  3J80 c;  1SMY C;  1EYG A;  1WI5 A;  3FKI B;  3M7N A;  2K75 A;  3A7A B;  1K73 C;  1M1K C;  1QJO A;  5DNF A;  1E1T A;  2ATW A;  2OTL A;  2F0O A;  2ASB A;  4B3S L;  3GTK B;  5D14 A;  1A0I A;  3CCS A;  1PRT C;  4L5Q A;  2Z1C A;  2NVT B;  1EU4 A;  5A2Q L;  1M90 C;  5IP7 H;  2QDB A;  5DLQ E;  2YTY A;  2RCN A;  1L0W A;  3FHW A;  1QNU A;  2C5C A;  1LTS D;  4DNT B;  3J7A F;  3SK5 A;  1K8A C;  1ESF A;  3ND9 A;  3W2D A;  2K5V A;  1IW7 D;  5EGT A;  4MZ9 A;  4DU9 A;  1K3R A;  3W1G A;  1ZKO A;  4A3G B;  2VB3 X;  3ERQ A;  1I94 Q;  2R93 H;  1TII D;  2F0L A;  4DV7 L;  2ZJQ A;  1UWV A;  1FJG L;  3J7Y W;  1PMR A;  1WCM G;  4M1U B;  1DOK A;  1HTP A;  2D2C C;  4G7H C;  2XN9 C;  4LFA L;  3I56 A;  4B9X A;  1CT1 D;  4YY3 Q;  2QIL A;  1X56 A;  1K8M A;  1GUG A;  4DV5 Q;  4OIK A;  2KEC A;  2PNH A;  3M4Q A;  3HOX G;  3PO3 B;  3K8A A;  4DAY A;  3HFZ B;  1CFM A;  2Y0S E;  1EYA A;  2L9H A;  2WII B;  4FO2 A;  2MFI A;  3F2U A;  3NUC A;  5E4W C;  4GNX B;  4C1N I;  3CD6 A;  1LTT D;  4C1N K;  1EY9 A;  2ZTC A;  5IGC A;  4K2K A;  4GLV B;  2KVM A;  1L1O B;  2YV5 A;  1PDQ A;  1MJC A;  5KYI A;  3ZYY X;  2QA4 A;  4K8I A;  4KHZ A;  4DV1 Q;  5I4D A;  3GQB A;  5CGK A;  1TU2 B;  1XNR L;  2HCI A;  1KRT A;  1HZB A;  1TS3 A;  3CCU A;  2FIN B;  1BVS A;  4A3E B;  3H09 A;  1SYB A;  2B2W C;  1AZQ A;  2D5D A;  1U4M A;  5K36 G;  3VYT A;  1PTO C;  2F0Q A;  3F1Z A;  2K5N A;  4V19 0;  4JI2 L;  2B2T A;  1EWH A;  1BR9 A;  4HSV A;  4A3B H;  1U5K A;  4J8Q A;  4DV5 L;  2CVR A;  3S1N B;  1BO0 A;  4B3M L;  4HIM A;  2N49 A;  1CKN A;  2R7Z B;  2E76 C;  3H91 A;  4A3D B;  1XMQ L;  5C4X G;  1EOT A;  3S15 B;  5I6W A;  1F9Q A;  1WD1 A;  2L5T A;  3J7A V;  1PYS B;  5CYU A;  1FNW A;  2K05 A;  3S17 B;  3TEH B;  4A3I H;  3PO2 B;  4JI7 Q;  3GTP H;  4IUR A;  4UHV A;  1SYG A;  4QUC A;  3CF5 A;  4FF1 A;  5EPL A;  4CDD C;  3PUW A;  2WAQ G;  4N9P A;  5JEA J;  3RMH A;  3QJY A;  4C56 C;  1STG A;  1XX8 A;  2B2W A;  1TWG H;  2KA7 A;  2VQE Q;  2IWH A;  2EJG C;  3PIP A;  2XVS A;  5JPN C;  4XIG S;  3SXH A;  4YHH Q;  5M5X H;  3DXJ C;  1EUJ A;  3L2P A;  4GOP A;  1XPR A;  3TS0 A;  3PO2 G;  1UE6 A;  1VCI A;  1E2Z A;  2F4V Q;  1AEX A;  1XYI A;  4A76 A;  4LUV A;  4A3E G;  1BOS A;  3SK6 A;  3CW2 C;  1E3P A;  1RTO A;  5IYB G;  2A69 D;  1II3 A;  4IUT A;  4RH6 A;  2K1B A;  5CR3 A;  2WV6 D;  1LTG D;  2PO4 A;  5JOB A;  4GZY C;  3CP0 A;  1J6Q A;  1S3O A;  1J5E L;  3MZ5 A;  3NK9 A;  2WB1 E;  2NVY B;  3PCO B;  3PIO A;  4DAY B;  1A3U A;  3D3R A;  1G6Z A;  3GDE A;  2ZXO A;  4X66 Q;  1E7Z A;  1VQN A;  2QGQ A;  1PZJ D;  1PFB A;  4C2M H;  1GUO A;  4DV0 Q;  2EXZ A;  5ELB A;  4DKA C;  2CWA A;  5JJI A;  2N78 A;  3DWP A;  2E8G A;  2E5L Q;  1B3A A;  2B3G A;  5M5Y B;  2N8N A;  4GN5 A;  3G4S A;  1L1O A;  3T1H Q;  1PTO B;  4C3I H;  3S1R B;  4BXX G;  3HOX B;  3H3V C;  4X65 Q;  3C1F A;  3MXP A;  4ULL A;  5GRO A;  4B9W A;  3T13 A;  1PTO D;  2OT2 A;  5CV6 A;  3T53 B;  1HR0 Q;  3T51 B;  1H9J A;  1D6E C;  2ID0 A;  3D4D A;  2NWG A;  1S5C D;  1LT5 D;  4A3F G;  1VMP A;  2BE5 D;  1SRO A;  2FFK B;  3BVM A;  5C3W A;  4HJ9 A;  2MPM A;  3L0O A;  3M4Y A;  1NNX A;  2O5J C;  1PH9 A;  3FPP A;  1SND A;  4K8J A;  4C3J G;  5KGU A;  2PMZ E;  3AU7 A;  3GTO H;  1AP0 A;  3M3Y B;  2FJ2 A;  4KKU A;  3GTP B;  1HH2 P;  3H94 A;  2OCE A;  4JPB W;  4EQO A;  5I2Y A;  1I3Q B;  2VL6 A;  4DUZ L;  1VQ5 A;  4CJ0 B;  3VA5 A;  1YNJ C;  4XT3 B;  1CTM A;  1C8C A;  4GKJ Q;  3KDF A;  4EQP A;  5JJL A;  4R1J A;  4DXG A;  1N8R C;  3NTK A;  5GAG C;  3X3M A;  4DR2 Q;  1VQA A;  2JN4 A;  3F8T A;  3L9A X;  3NEN A;  2KCM A;  5FO9 B;  3MXG A;  4GNX C;  2A6E D;  1ILQ A;  4X3U A;  2C9O A;  1CSQ A;  3TP6 A;  5ELC A;  1XMO Q;  3J7Z C;  2JEB I;  4OEL B;  1LLR D;  2CH4 W;  5C5M A;  3TSS A;  2HQE A;  4ZK9 B;  1AFP A;  4DK3 C;  5M3F B;  3RUZ A;  1XNQ L;  3WWV A;  1E22 A;  3STB C;  4DR2 L;  1I4R A;  1P16 A;  3JAM c;  4CDE C;  1B1Z A;  4JBJ A;  1K8O A;  1S5D D;  4Y7N H;  4K6L A;  4Y52 H;  4OL7 A;  3K7A H;  1H9M A;  1U4P A;  4KD3 A;  2R61 A;  5BR8 L;  5IT9 L;  1EIY B;  4P73 A;  3OMC A;  5FLX E;  1ICW A;  1NCV A;  3ONA B;  3U4V A;  3H0G H;  2HIX A;  4GS3 A;  2HDL A;  5CMD A;  5IGF A;  3ERO A;  5C0X J;  4FDB A;  3H0G B;  1I6H B;  3N52 A;  1V1P B;  4YCW A;  2F0W A;  3J81 j;  2VUM G;  5GAD C;  1PTO H;  4IPG A;  1NJI C;  3A74 A;  2PI2 A;  2L55 A;  3RLN A;  4LF7 L;  3PO2 H;  3M85 A;  1EWC A;  4ZQ3 A;  5EPJ A;  1KDB A;  3A7L A;  3AFQ A;  3QIA A;  3SK8 A;  4B3R Q;  3D0F A;  2AUJ D;  2CW0 C;  3S2H B;  1TR5 A;  1PV4 A;  2A68 D;  1SYF A;  2H5X A;  3GTM H;  4LUO A;  2JA5 B;  3CAM A;  4X65 L;  1X3E A;  2Z6B A;  1Q8I A;  2Q8R E;  4MTK A;  4KV6 A;  1BCP B;  4YIJ A;  2PQA A;  2DN8 A;  4X64 Q;  4BY7 B;  3DM1 A;  1N33 Q;  5M3F H;  4R4I A;  3D31 A;  3ND8 A;  1TY0 A;  3CCE A;  5AJ3 L;  2UUB Q;  3C2P A;  1LAB A;  2A5H A;  4GKK Q;  1Q7Y C;  2D62 A;  3MXN A;  1TVX A;  4CDF C;  4I7A A;  5LMU Q;  1EL0 A;  3EQL C;  2KHI A;  1JC7 A;  5M3M H;  3GTJ B;  5M5X B;  3I4N B;  4LFB L;  1ZXT A;  1GUN A;  3NP8 A;  1IKM A;  4B08 A;  2GN5 A;  4AH6 A;  4AQY L;  1HR0 L;  3CCV A;  5M5W B;  3R3O A;  2QEX A;  3OTO L;  1N32 Q;  1X9N A;  3IL8 A;  3C46 A;  1CQV A;  1HCZ A;  2MO1 A;  1SR3 A;  4BY1 H;  2RDG A;  1I3Q H;  4YWK A;  1MIU A;  3HOY G;  1U9R A;  5FLM H;  4ZUI A;  2JA7 B;  1NSN S;  2PYK A;  4I7Z C;  3ZJY C;  5GAE C;  3GTO B;  4IUQ A;  3VR5 A;  4IJH A;  1EZ6 A;  5CV7 A;  1SAP A;  4OWX B;  1HUN A;  4XQJ A;  3MEH A;  1Y14 B;  1NR4 A;  5IP9 H;  2WAC A;  1CM9 A;  4JI1 L;  1JB7 A;  5CC4 A;  1KHI A;  3QOJ A;  3M4O B;  2BH2 A;  4DXF A;  2E2J H;  3LNN A;  1BCP C;  3URY A;  4ZCK A;  4DUY Q;  4EX5 A;  3HP3 A;  1HZA A;  3HOX H;  1C48 A;  4JYA Q;  3RZO H;  3I4M H;  1MKH A;  3HOU H;  3EA6 A;  4A3J B;  1STY A;  3TME A;  2I5M X;  1YJN A;  2EYM A;  1VQD A;  2CQA A;  4IQZ A;  3D6W A;  1KQS A;  2NZ1 D;  3U4Z A;  2HUG A;  4JI0 Q;  2F0H A;  5JVH 3;  1KAW A;  3C3L A;  3K80 C;  1BCP F;  1KC8 C;  2IL8 A;  5KND A;  1YZ6 A;  1SE8 A;  1TWH H;  1V1Q A;  3PO3 G;  3S2H H;  1SMY D;  1QUQ A;  1DGS A;  2AWO A;  3IRB A;  2DNC A;  5TSS A;  4JI7 L;  1EYD A;  1Y1V G;  4E6I A;  4K14 A;  3EFX D;  4JV5 Q;  4JI4 Q;  4JC0 A;  2PI2 E;  4HJ8 A;  4L5R C;  1TY2 A;  1MI2 A;  4DNR B;  2WB1 B;  1FD7 D;  3Q6S A;  3SVM A;  3OW7 A;  1S72 A;  2GVA A;  2ALY B;  4R4C A;  1XMQ Q;  1RF2 D;  2HIV A;  3G6J B;  1EIH A;  1U0L A;  2JQO A;  3HOZ H;  2Z0S A;  2O2L D;  2AWN A;  2KUM A;  3A8K E;  5I6Y A;  2E75 C;  2M2L A;  3I72 A;  1Q46 A;  3E6Z X;  2VB2 X;  3PUY A;  3S16 B;  2L12 A;  1CI3 M;  2OQK A;  2UU9 Q;  4LFC Q;  4K5X A;  2K7V A;  2QW7 A;  1JJC B;  4RGM A;  3PIO 3;  2IHE A;  5K5P A;  2I0Q A;  2D0P A;  3CQZ B;  2A74 C;  1MGS A;  3FDT A;  4PZ7 A;  1GUT A;  1TQO A;  2R92 H;  3MA2 B;  2UXD L;  2F0F A;  1QB5 D;  2D9U A;  3T4A C;  3P20 A;  2Z9H A;  1HNW Q;  4WJW A;  3W5O A;  2ZT9 C;  4FNF A;  2B63 G;  1XNR Q;  1STA A;  1X65 A;  2F1M A;  3NWT A;  2KED A;  4QY7 A;  4HMI A;  3EIV A;  1Q8K A;  2K5H A;  4TVA B;  2PMZ B;  2I46 A;  4FF4 A;  2O4X A;  4P71 A;  1UE1 A;  4KY5 A;  3M4P A;  3KDF B;  2CCZ A;  1G6P A;  2A8V A;  4P72 A;  3DHQ A;  4UPA A;  2UUA Q;  1J9O A;  1G2S A;  3S1Q B;  2SNS A;  1VQM A;  2N55 A;  2UXD Q;  1HQR D;  4M8A A;  2RHS B;  2MGS A;  3HOW H;  2XSC A;  4FF2 A;  3FKI H;  1QNK A;  4H7B A;  4J6H A;  5FLX L;  2HD3 A;  1Y1V B;  1MBY A;  2NB0 A;  4JI6 L;  2RBM A;  2K03 A;  4G7Z C;  1QZH A;  3CRL C;  2V4D A;  4QJF A;  2F0U A;  3AMU A;  4L8J A;  2HCC A;  4B3S Q;  3HOZ B;  4G57 A;  4NXM Q;  1JIC A;  1KNE A;  4IJL A;  1IL2 A;  3J81 L;  1FJG Q;  2AQ1 B;  3BDL A;  5IGG A;  1CHQ D;  4IN3 A;  5LL6 S;  3U58 A;  4JI5 Q;  1GHK A;  4O0A A;  5CV5 A;  4QUF A;  1JOO A;  1HRJ A;  3S16 H;  1YHB A;  4BA1 I;  1K8G A;  2EQS A;  1SFO H;  1T5X D;  1BNZ A;  4KTA A;  1UE5 A;  4DPG A;  1JOR A;  1SEB D;  4C3H H;  2NVQ H;  4A93 H;  4AIM A;  1ENF A;  3HS0 C;  1NE3 A;  1VQI A;  4KN4 C;  4LF4 Q;  5IYC H;  3FPU B;  4QMG A;  1O78 A;  3GV3 A;  1O7Y A;  1W6J A;  1EQQ A;  1TWA H;  4A3J G;  1CKO A;  2NBF A;  5M9O A;  3FMC A;  1QVC A;  1QWY A;  2LKV A;  3GD7 A;  1A63 A;  1X3P A;  5C4H A;  3NTH A;  2DGY A;  4UDU C;  1ENA A;  1Y8O B;  1MJE A;  1VQL A;  4X3T A;  1GHJ A;  4DN4 M;  4OO1 H;  2K14 A;  2DY8 A;  1S4Z A;  1HA6 A;  4G4K A;  1EY7 A;  2PQA B;  4C3J H;  1ROD A;  3AFP A;  1EQR A;  2BA0 A;  1CKM A;  1TKW B;  1UUP A;  4K0K L;  2Q2H A;  2M9V A;  4J1M A;  4UP9 A;  3E3X A;  1WYD A;  1UAP A;  4DV3 L;  4A3M H;  2D0O A;  3GTK H;  3CXC A;  4PMC A;  5LMU L;  3HOU B;  2CHB D;  4R4O A;  2ZTD A;  1O7L A;  1ENC A;  3TDQ A;  2AHO B;  4DR4 L;  5M5W H;  4NXN L;  1STE A;  4L5T A;  4P2C B;  1R4Q B;  2ZXP A;  3KOJ A;  1RDP D;  2F0I A;  1XTD A;  3KLR A;  4KN7 C;  2NVT H;  2F0K A;  2F3V A;  1PHJ A;  4X64 L;  5E7N A;  1G51 A;  3K5O A;  1TWG B;  2X6G A;  1C0A A;  1QOH A;  2JP1 A;  5DM6 3;  3OTO Q;  3A8J E;  2Y0S B;  1HZ9 A;  5JEA G;  4IPC A;  4LF8 L;  2A73 B;  2B2Y A;  3LWE A;  3T16 A;  1HQM C;  2BCO A;  1S5B D;  1T9H A;  3I3C A;  3BDO A;  1B9N A;  3EBE A;  1IBL Q;  2IX3 A;  1OXS C;  3OOC A;  4ZYS A;  2E74 C;  3OPO A;  3J81 c;  1R4P B;  2KEN A;  4U68 A;  4GKK L;  1HXY D;  4DK6 C;  3T1Y L;  1S5E D;  3TBI B;  1WTX A;  3V2T A;  1JB3 A;  1GOZ A;  5C0X I;  4DR3 Q;  3RN5 A;  1RJT A;  2R7Z G;  5IGE A;  4HR7 B;  3D4W A;  4A3B B;  4L5S A;  4ME5 A;  1L0Y B;  2B8F A;  3MFY A;  3BZK A;  1DXM A;  3BZC A;  1EQT A;  2RF4 A;  2PZT A;  3I4N G;  1AH9 A;  2IY5 B;  4C3H B;  4A93 B;  2NVQ B;  3NXW A;  4DV2 L;  5HGQ A;  3PF4 A;  4B3R L;  1SYE A;  2F3I A;  2R7F A;  2KCC A;  2B2U C;  1VQ8 A;  1CA5 A;  1ASY A;  4LF5 Q;  3PQI A;  1RTN A;  4LAA A;  4F87 A;  1HA5 A;  1GO3 E;  4AYB B;  3IFT A;  1CHP D;  2NN6 H;  1YNN C;  4BBS B;  1B7Y B;  2WP8 J;  2QF7 A;  1ZYR C;  3GO5 A;  1PYB A;  5ELD A;  3CCR A;  2B39 A;  1A2T A;  5CBA E;  3J80 L;  3L3O C;  2B2V C;  3A8I E;  4J15 A;  5KNC A;  4PG3 A;  2BOS A;  4ID6 A;  1X32 A;  5E4X A;  4A3L G;  3KK7 A;  4KJO A;  2FMC A;  1VQH A;  3ER0 A;  5EBC A;  4DV2 Q;  4A3K H;  1G29 1;  3FP9 A;  3I55 A;  3OYY A;  3N6R A;  3VR2 A;  2ES2 A;  1QZG A;  1QCB D;  1SMX A;  2F52 A;  4DUZ Q;  2PW5 A;  1YNX A;  1SNO A;  1D5Z C;  3BYY B;  1VQF A;  3J81 E;  3MTS A;  3QG1 A;  1VQ7 A;  2VS1 A;  2RA4 A;  2O5I C;  2F3W A;  2SEB D;  3CMA A;  2UXC Q;  1VQ9 A;  4KHP Q;  1BQQ T;  3T1Y Q;  5FKA C;  4L63 B;  4YCU A;  1OXV A;  3QOL A;  2XGT A;  3PUV A;  4N9T A;  3BU2 A;  1HPC A;  3NHH A;  3TQY A;  1PXU A;  1RHP A;  3H15 A;  1I4X A;  3TP7 A;  1IYU A;  4LF5 L;  2BDO A;  1P8L A;  1KIX A;  3K57 A;  2UXB Q;  1JWS D;  4GKJ L;  4JI3 L;  1W6K A;  5D3D A;  4ALP A;  1TWC B;  1EZ8 A;  3X3N A;  1RKN A;  2B29 A;  1PRT D;  4LF8 Q;  2K28 A;  4POG A;  4R4Q A;  5FK9 C;  2K4K A;  3P1H A;  3HOY B;  1SNQ A;  4LF9 L;  2RSN A;  2JE6 I;  3TRZ A;  2K50 A;  4UP8 A;  2OWO A;  4GLA C;  1JR0 D;  5C4J H;  1SYD A;  2FXQ A;  3NWS A;  1Y1W G;  3TZU A;  4MNO A;  4JK1 C;  1RL2 A;  2JA8 B;  3F2C A;  1I4P A;  1B9M A;  1B53 A;  4DK1 A;  1WCM H;  3E5S A;  1XXG A;  1IBK Q;  2Q8I B;  5IT9 E;  1XPO A;  5C0X G;  3KLW A;  3KJP A;  4QF4 A;  1NTG A;  4GOP C;  2MO0 A;  2B8G A;  2G9H D;  1AN8 A;  4QCL A;  1HNZ Q;  4I65 A;  4IUN A;  2JA8 H;  4IOA A;  3BG3 A;  2OQ0 A;  2JA5 H;  2F4V L;  3I73 A;  4KI0 A;  2L0C A;  1VS0 A;  5LMN L;  3A56 A;  1WTR A;  2F4I A;  1O7I A;  2KEE A;  2ZXR A;  4DV0 L;  5IY0 A;  4BBR H;  1KLU D;  2QEJ C;  1SE3 A;  5JAV A;  4DFA A;  1TT2 A;  4DR4 Q;  1R9T B;  2HQL A;  5ELO A;  4RHS A;  2RVL A;  1FGB D;  5H1S E;  4C3I B;  5C3E H;  4DV3 Q;  5D3I B;  1LV9 A;  1F9S A;  1JCK B;  2OXP A;  3OSO A;  5DAU A;  1ESR A;  3F2B A;  1G8Z D;  3HOV B;  1ICF B;  4AYB E;  2IX1 A;  1PTO F;  2N3S A;  4ODG A;  1NUC A;  1A6X A;  2C35 B;  2WIN B;  4O42 A;  2AKW B;  2SNM A;  3AB9 A;  3G71 A;  4NXM L;  4F88 A;  2MP1 A;  2IHF A;  4HSP A;  2Q8T A;  4DR1 L;  4EQ5 A;  3KF8 A;  4BY7 H;  4YHH L;  2LY7 A;  2I5H A;  4DAP A;  5C4J B;  3HOV H;  2TSS A;  1Z9F A;  1AE3 A;  2LS0 1;  4IO9 A;  3DMU A;  4GN4 B;  1SXT A;  4A3K B;  1YBY A;  1BCP D;  4WRD A;  5IGD A;  2J4X A;  4HMJ A;  3K7A B;  4A3G G;  4PMW A;  2K01 A;  4ABN A;  4IOC A;  1JWM D;  1PH3 A;  2F0S A;  3F2D A;  1IW7 C;  2EJM A;  3MC0 B;  3K5L A;  3STB D;  2EXD A;  3RNU A;  1RCV D;  1U4R A;  4RGN A;  2B63 B;  2RCF A;  5A2Q E;  1EY6 A;  2MQH A;  5LHY 1;  3MAQ A;  2VQF L;  1WVL A;  3GTQ H;  1E0B A;  1AZP A;  3S15 H;  2OF1 A;  5EJW A;  1VQ6 A;  1EIF A;  2A1A A;  1D5X C;  1AW7 A;  1STH A;  2V1C C;  3PUZ A;  3SDZ A;  3BJU A;  4OIJ A;  2ZM6 L;  3I7F A;  2R93 B;  4BS9 A;  3PGZ A;  3KFU A;  1HNW L;  4A3C H;  2JYO A;  2IX0 A;  3CCQ A;  2EOT A;  3OW2 A;  4JI8 L;  5IT9 c;  3TP8 A;  2Z6K C;  1CK1 A;  2Z6K A;  1U4L A;  4KY7 A;  2EYP A;  3R8B A;  4A3D H;  2F0D A;  3ULP A;  2K32 A;  4NKL A;  4JI8 Q;  1VQG A;  4IZ8 A;  2UUA L;  2L15 A;  1ET9 A;  2WAQ B;  3NEM A;  1N36 L;  4OHJ A;  1DCZ A;  4A3E H;  4DV4 Q;  3V05 A;  4B3T L;  2WKD A;  5GAH C;  4LFA Q;  1IBM Q;  2WFW A;  2LXK A;  1BBX C;  4JBM A;  1Q86 C;  2F03 A;  1A3V A;  1F2Y A;  4RCO A;  4HAE A;  1JE4 A;  1QG7 A;  5KIX A;  4JV5 L;  2JEA I;  1WTW A;  3IKJ A;  2EYJ A;  2A68 C;  1VQB A;  4IFD H;  1BKB A;  3HKZ B;  1EY8 A;  4CBV A;  1GD7 A;  3S14 B;  1KAA A;  1LTI D;  2NVX H;  3DEP A;  3U50 C;  2K5D A;  2XRQ D;  4C3I G;  4NPS A;  4LFC L;  1XJV A;  3Q23 A;  4C2M B;  1D1K A;  3OIQ A;  3VYR A;  3I8Z A;  4DAV A;  1PH4 A;  2PQE A;  1DON A;  2AQ3 B;  3ULL A;  4HCE A;  2CH4 A;  2R93 G;  4Y7N B;  1IYV A;  5KYL A;  2F0E A;  5C44 G;  1FR3 A;  1PYW D;  4CGY B;  5I9O A;  3HGB A;  3BS1 A;  3DEO A;  4JI4 L;  4BBR B;  5IWA Q;  3PSI A;  1E2W A;  1KAB A;  3Q0A A;  5A35 A;  3BVZ A;  1UNS A;  3ULJ A;  3LWU A;  1JT8 A;  1D2B A;  3A5U A;  4A3F B;  4POF A;  4RAU C;  2WKC A;  4LK1 C;  3M9B A;  1S40 A;  1VQP A;  4IFD I;  2YYZ A;  1A3T A;  3K81 C;  2BE5 C;  2E2I H;  4Z9C B;  4CKB A;  3R2I A;  1IKL A;  3FVQ A;  3P7J A;  3G48 A;  1MHW C;  4JW0 A;  4JI0 L;  3G6E A;  4WOR A;  2NTS A;  2VUM B;  1WJJ A;  2EZV A;  4BY1 G;  4QGU A;  2JA6 G;  2NUC A;  2MHV A;  4DUY L;  1VQ4 A;  1GUS A;  4NB3 A;  4PNY A;  5IP7 G;  3E9I A;  3MXN B;  4OO1 I;  5T1G A;  1LT6 D;  3ITP A;  2EY2 A;  3O13 A;  2LFN A;  3LX0 A;  2LSS A;  3OIP A;  2JA7 H;  1SJE D;  2Z4I A;  1WD0 A;  2EDG A;  1YIT A;  3I2Z A;  4OGQ C;  4TRD A;  3JAM E;  1Q1E A;  4MIU A;  1ILP A;  1EOV A;  2DNE A;  3A5Z B;  3QWN A;  3DUZ A;  3KF6 A;  5AJ3 Q;  2UUB L;  1Z7T A;  2A6H D;  2MNA A;  1TS5 A;  1S5F D;  3NSW A;  4HIK A;  4DV6 L;  4IPD A;  2KBN A;  5EAY A;  4LF9 Q;  5LMN Q;  1STB A;  1TWA B;  4DA2 A;  1Q12 A;  1OTC A;  1X3F A;  4YWM A;  2Q2U A;  1AE2 A;  3QR8 A;  1STN A;  2UUC L;  2X6L A;  3BVG A;  1HNZ L;  4AQY Q;  1VF7 A;  3CKI B;  1ZEQ X;  1Q1B A;  2NN6 G;  1C9O A;  4K5V A;  3K59 A;  1UEB A;  2KCT A;  3VYS A;  3FEW X;  2VUM H;  3W3A A;  3HKZ E;  5CBE E;  3Q24 A;  1SE2 A;  3NBH A;  4PQX A;  4F7X A;  3SK4 A;  5BN4 A;  4OWT B;  4HJ5 A;  4UP7 A;  1BUV T;  1Q90 A;  1K83 B;  1SSO A;  1CUK A;  2E2I B;  5DEH A;  1B3Q A;  1B4O A;  1X6O A;  1MSG A;  4A3I G;  3GTM B;  5JPM C;  1VF5 C;  1V1P A;  2IPK D;  2JA6 B;  5D65 A;  4APV A;  1BBU A;  4XXE A;  1CQF A;  5LL6 X;  3HOZ G;  3H6M A;  1QUQ B;  1N34 L;  4O2D A;  1DJR D;  3BZD B;  3NBI A;  4BBS H;  3J80 E;  4YCV A;  2EE1 A;  2PZW A;  3DLL A;  3CQZ H;  5M3F G;  2KHS A;  2M00 A;  1I5F A;  1IXR A;  1C4Q A;  2PW7 A;  2UXB L;  1I6H H;  4X3K A;  3MEF A;  1NR2 A;  4ZKB B;  2JA9 A;  1GM5 A;  2KOL A;  1GUW A;  1XNQ Q;  1CZW A;  4L6T B;  4DR7 Q;  3R2T A;  1RIP A;  2CQO A;  1FNV A;  1E1O A;  2EY1 A;  1H9S B;  1V9P A;  3CCL A;  1SFO B;  5F2D A;  3RR5 A;  3TN2 A;  3RN2 A;  2JSO A;  2GVB A;  1KLG D;  3FRP B;  5DM7 3;  2K33 A;  3KBG A;  2I5L X;  1B2T A;  1VQK A;  5HUR A;  1LAC A;  2ZJR A;  1SE4 A;  5BR8 Q;  4YWL A;  3RLF A;  5ELN A;  2K04 A;  4MTN A;  3HKS A;  1CA6 A;  1T5E A;  4FXD A;  3W1B A;  1WTQ A;  1M8A A;  4TQU S;  4HID A;  1JJG A;  1WOC A;  3M4O H;  1FL0 A;  3A54 A;  3VYU A;  4BXX H;  1X3Q A;  1JMC A;  2IW3 A;  3SHL A;  4TKO B;  1KTK A;  3HOW B;  1XMO L;  1JWU D;  3UDX A;  3S1M B;  2NZH A;  3NPP A;  4DR7 L;  3PIP 3;  1PZI D;  2JA8 G;  2RDH A;  4IFD J;  2HDM A;  5K36 H;  1TS4 A;  4JBW A;  1KDA A;  4ILW A;  3I4M G;  4HJA A;  1UEA B;  4R4T A;  4FP5 D;  1EEI D;  2XIW A;  3I90 A;  3UDI A;  3S2D B;  2H1E A;  3A55 A;  4R9W A;  5BN3 A;  4CKE A;  1YJW A;  4BY1 B;  1SDF A;  5KNB A;  5IYB H;  3NTI A;  2R92 B;  3GTQ B;  2IJ0 A;  1L1O C;  5GQO A;  5COY A;  4QIW B;  1LTR D;  3DM3 A;  4DR6 Q;  4UY8 C;  1KXL A;  2WAQ E;  4XQQ A;  1I50 B;  1KDC A;  2EY5 A;  1I6V C;  1DD2 A;  3RZD H;  1E2V A;  4DR3 L;  2F0N A;  3KLS X;  4RHR A;  3A0J A;  1OXU A;  1QIL A;  1FGU A;  1YVC A;  4OXP A;  5IYC G;  2F0V A;  2YU9 H;  1LM0 A;  1OXT A;  3D6C A;  2RSO A;  1H95 A;  4GOP B;  5G3L D;  2XTI A;  3K5N A;  4HCS A;  4LMQ D;  3GP7 A;  5ELE A;  1CZG A;  3CPW A;  4P75 A;  1X54 A;  1K3B C;  2RQX A;  1SNM A;  3PF5 A;  4NW2 A;  1YHQ A;  3D4R A;  1XTC D;  3E0E A;  2F0T A;  3OWF A;  4U67 3;  4KKS A;  1EY5 A;  3AQQ A;  4HED A;  4X3S A;  5IE8 A;  4A3F H;  3MHB A;  2BH8 A;  5IYD H;  4DV6 Q;  4C3J B;  2R92 G;  5EQ0 A;  1EY0 A;  2J0T D;  1VQE A;  5IOD A;  5ISR A;  1G91 A;  1GVP A;  1I4H A;  5HGT A;  2VQE L;  1Q81 C;  1QVF A;  3PUX A;  4MN3 A;  1HHV A;  1LO5 D;  2NVX B;  1PRT B;  5J3B A;  2NN6 I;  2Z8L A;  4GNX A;  3RZO B;  4FXK C;  1W2B A;  1J5E Q;  2DJF C;  3WOF A;  2HHH Q;  4XDX A;  3L7Z C;  4JG2 A;  2EVB A;  4LF6 L;  2SOB A;  1HZC A;  2VXW A;  2GA4 B;  4IUP A;  4JI5 L;  1SNP A;  3KJO A;  4F8M A;  1WCM B;  1XPU A;  5FJ8 G;  1E24 A;  5C3X A;  4WJ3 M;  5FO8 B;  4DNI A;  4S3S A;  3KLS A;  1TWF B;  4LWC A;  1LUZ A;  2NYZ D;  2AUK A;  4A75 A;  4B3M Q;  1PH1 A;  4WFN 3;  4KHV A;  1F9R A;  2P5Z X;  3K5M A;  4JVZ A;  3K0X A;  3MWY W;  4ZRZ A;  4CKC A;  5M3M B;  3GTJ H;  4JI6 Q;  1TS2 A;  2E2H H;  2QCP X;  4IUU A;  1K28 A;  4RKB A;  1CKN B;  1Y8N B;  5KRU A;  1K9M C;  2SDF A;  2EYH A;  5L37 A;  2F0M A;  4LUZ A;  3UE0 A;  5IOC A;  1M4V A;  4A3M B;  4JCV E;  4CJ1 B;  2K5Q A;  4IPH A;  2L1B A;  1B8A A;  2XWJ B;  3CU7 A;  2ZJP A;  3D8G A;  3CC2 A;  5IWA L;  2DJG C;  1OO9 B;  3HG9 A;  2K6A A;  4NP5 A;  2ICI A;  5CV8 A;  1Q82 C;  4LW1 A;  1TXY A;  5FLX c;  4DF7 A;  4K6D A;  2RHQ B;  1HJP A;  1HNX L;  5BN5 A;  5M3M G;  2KQ3 A;  2EPB A;  4DV1 L;  1CSP A;  1PFS A;  5EKK A;  2VZA A;  1JOK A;  4P74 A;  1NAP A;  1HFG A;  1LTB D;  1SLJ A;  5JVG 3;  1Y69 U;  3T56 B;  2OTJ A;  1OXX K;  2YTX A;  2BDN A;  3CCJ A;  2ZTE A;  4IAL A;  2R6G A;  3TZD A;  3VR3 A;  3LGJ A;  4JI2 Q;  1H9R A;  3S14 H;  1EY4 A;  1NBW A;  4QIW E;  1EWI A;  1NY4 A;  4X6A H;  4V0B A;  2KCN A;  1SJH D;  2Q2I A;  5J22 A;  3OHX C;  1K0R A;  3TP5 A;  1SNC A;  1LTL A;  5LMN W;  3U9O A;  2UU9 L;  1PA6 A;  5AFW A;  1GJX A;  4YY3 L;  1HFN A;  1JJ2 A;  5IIF A;  2QDL A;  3UE1 A;  3HRZ C;  3ERS X;  1FNU A;  1HUM A;  1IBM L;  1HTL D;  2RDF A;  2VQF Q;  2CFM A;  5EKI A;  1GKH A;  1HNX Q;  1EFI D;  4DV4 L;  4B3T Q;  2Q2T A;  4G7O C;  1ZYR D;  3E9H A;  4FYD A;  1N36 Q;  1EYC A;  2QKI C;  1J8I A;  2I07 B;  3H0G G;  1YHA A;  4N8F A;  2JK8 A;  2A69 C;  5J39 A;  5COR A;  5I2X A;  3WDN A;  2TMP A;  1TWH B;  2VNU D;  2MJ8 A;  2IT1 A;  2PZU A;  1WTP A;  3CC7 A;  3AEV A;  5T1I A;  5JEA H;  2ZM6 Q;  1PRT F;  2RKS A;  2H4O A;  3UDF A;  1X55 A;  1Q3L A;  4DR1 Q;  4XQN A;  3GTG B;  2JA7 G;  4ZKC B;  5CV4 A;  5FOB B;  3QB3 A;  4CHT B;  5FLM G;  4JYA L;  1A62 A;  1R9T H;  1Z47 A;  2NZO A;  1PZK D;  5CV9 A;  1W3S A;  3CPF A;  4DV7 Q;  3SE0 A;  4OON A;  4EGV A;  1I94 L;  1PFM A;  5E3F A;  2A6H C;  4LF6 Q;  3MXU A;  1L2F A;  1Y1W B; 
#chains in the Genus database with same CATH homology
 1SFO H;  2A19 A;  1UE5 A;  4DPG A;  4POF A;  3PUW A;  4C3H H;  2NVQ H;  4A93 H;  3M9B A;  1S40 A;  1VQP A;  4AIM A;  2WAQ G;  5JEA J;  4IFD I;  2YYZ A;  3I4O A;  3H3V H;  1NE3 A;  3K81 C;  2E2I H;  1VQI A;  1TWG H;  3CME A;  5IYC H;  4LF4 Q;  2VQE Q;  3G48 A;  1IZ6 A;  3PIP A;  1EQQ A;  1PH8 A;  4XIG S;  4JI0 L;  1TWA H;  3EN2 A;  3G6E A;  4YHH Q;  4A3J G;  3I4N H;  5M5X H;  1CKO A;  3VDY A;  3L2P A;  1EUJ A;  4LNQ A;  1WJJ A;  1I50 H;  1QVC A;  1SRU A;  3GD7 A;  4GOP A;  3HOU G;  1A63 A;  4BY1 G;  3ICE A;  1XPR A;  3TS0 A;  3PO2 G;  1UE6 A;  1VCI A;  4QGU A;  2DGY A;  2F4V Q;  2JA6 G;  1QVG A;  4A3B G;  2DUD A;  1JE5 A;  4LUV A;  4A76 A;  1MJE A;  4DUY L;  1VQL A;  3KF6 B;  4A3E G;  1VQ4 A;  2B63 H;  4NB3 A;  3CW2 C;  5IP7 G;  1E3P A;  2K14 A;  3E9I A;  5IYB G;  3MXN B;  1C7Y A;  4OO1 I;  2HT1 A;  3S2D H;  2PQA B;  4JI1 Q;  4C3J H;  3AFP A;  1EQR A;  2BA0 A;  2LSS A;  4LFB Q;  4WJ4 A;  1CKM A;  5C4X H;  2Q2H A;  3CP0 A;  4UP9 A;  1IBK L;  2JA7 H;  1J6Q A;  4K0K L;  1PVO A;  1WYD A;  3M3Y H;  3HOY H;  1YIT A;  2HHH L;  5C3E G;  4DV3 L;  1S3O A;  2D0O A;  3I2Z A;  4A3M H;  1J5E L;  1Q1E A;  2WB1 E;  3PCO B;  3PIO A;  3CXC A;  5LMU L;  1PH6 A;  3GTK H;  4DAY B;  3TS2 A;  1EOV A;  4R4O A;  3A5Z B;  3GDE A;  3S1M H;  2ZTD A;  4X66 Q;  1E7Z A;  4DAM A;  1Y1W H;  3PV0 A;  2AHO B;  3KF6 A;  4ME3 A;  4DR4 L;  5M5W H;  5AJ3 Q;  2UUB L;  4NXN L;  1VQN A;  2MNA A;  2QGQ A;  4BBS G;  1V43 A;  4A3L H;  4HJ7 A;  4L5T A;  1WFQ A;  4C2M H;  3HKZ G;  4DV0 Q;  3KOJ A;  3S1N H;  4HIK A;  4DV6 L;  4IPD A;  1XTD A;  2KBN A;  5EAY A;  4DKA C;  2NVT H;  2CWA A;  1PHJ A;  2N78 A;  5JJI A;  1PH2 A;  2E8G A;  4X64 L;  5LMN Q;  5E7N A;  2E5L Q;  1G51 A;  4LF9 Q;  1Q12 A;  1OTC A;  2B3G A;  1X3F A;  4YWM A;  3FKI G;  2R7D A;  2Q2U A;  4DR6 L;  1YEZ A;  1C0A A;  1AE2 A;  2UUC L;  2N8N A;  4GN5 A;  3G4S A;  1L1O A;  2WB1 G;  5IP9 G;  4C3I H;  3OTO Q;  3T1H Q;  1N32 L;  4BXX G;  1HZ9 A;  5JEA G;  4IPC A;  4X65 Q;  1HNZ L;  4RMF A;  4LF8 L;  5GRO A;  4GLX A;  3S1R H;  1HR0 Q;  3S24 A;  4AQY Q;  1NMF A;  1D7Q A;  4A4I A;  1Q1B A;  2NN6 G;  1C9O A;  2ID0 A;  1UEB A;  2KCT A;  1T9H A;  4JI3 Q;  2VUM H;  2JA5 G;  4A3F G;  3HKZ E;  4DR5 Q;  3PO2 H;  3EBE A;  1X3G A;  4LF7 Q;  1SRO A;  4OWT B;  1IBL Q;  1OXS C;  4UP7 A;  4HJ5 A;  4HJ9 A;  1NMG A;  3L0O A;  3J81 c;  4BBR G;  1CUK A;  1PH9 A;  2KEN A;  1A8V A;  2EIF A;  3GTG H;  4GKK L;  4DK6 C;  5JJK A;  3T1Y L;  1X6O A;  2PMZ E;  4A3I G;  3GTO H;  3RLO A;  1N33 L;  5C0X I;  3PO3 H;  1HH2 P;  4DR3 Q;  2OCE A;  3RN5 A;  3S17 H;  4BA2 I;  2R7Z G;  4APV A;  1BBU A;  4L5S A;  3B6Y A;  3HOZ G;  1QUQ B;  1SN8 A;  2VL6 A;  4DUZ L;  4O2D A;  1N34 L;  1VQ5 A;  1Y1V H;  4OX9 Q;  3AYH B;  3BZK A;  3CC4 A;  4BBS H;  3BZC A;  4YCV A;  2RF4 A;  3I4N G;  1AH9 A;  2IY5 B;  3DLL A;  3CQZ H;  5M3F G;  2CKZ B;  4DV2 L;  5HGQ A;  3PF4 A;  1I5F A;  4B3R L;  2F3I A;  2R7F A;  1IXR A;  3CF5 A;  3NEL A;  4GKJ Q;  3S1Q H;  3KDF A;  1VQ8 A;  4JOI C;  2KHJ A;  2CWP A;  1I6H H;  2UXB L;  5JJL A;  4R1J A;  1ASY A;  4LF5 Q;  1N8R C;  3MEF A;  5GAG C;  4DR2 Q;  1VQA A;  2JA9 A;  3F8T A;  1GM5 A;  3NEN A;  2KCM A;  1XNQ Q;  1GO3 E;  4DR7 Q;  3HOW G;  4GNX C;  1RIP A;  2CQO A;  1E1O A;  1CSQ A;  1VQJ A;  1YJ9 A;  3CCL A;  1V9P A;  4KHP L;  1B7Y B;  3J7Z C;  1IYJ B;  2JEB I;  1XMO Q;  3RR5 A;  2UXC L;  2WP8 J;  4X62 Q;  3RN2 A;  3GO5 A;  4DK3 C;  1PYB A;  3WWV A;  1XNQ L;  2JJQ A;  3CCR A;  1E22 A;  2GVB A;  3STB C;  4DR2 L;  4H02 A;  1P16 A;  3JAM c;  4JBJ A;  4J15 A;  1KRS A;  4PG3 A;  2I5L X;  4Y7N H;  1VQK A;  4Y52 H;  3K7A H;  1HR0 W;  4A3L G;  1TWF H;  3KYH C;  2ZJR A;  5BR8 Q;  3ER0 A;  1VQH A;  4YWL A;  4DV2 Q;  4A3K H;  3RLF A;  1G29 1;  5ELN A;  5BR8 L;  3FP9 A;  3I55 A;  3OYY A;  1EIY B;  4MTN A;  4P73 A;  1QZG A;  2ES2 A;  3HKS A;  4OX9 L;  3U4V A;  3W1B A;  1TWC H;  1SMX A;  2F52 A;  4DUZ Q;  3H0G H;  1N34 Q;  2HIX A;  4TQU S;  5HY6 A;  4HID A;  1YNX A;  1JJG A;  1WOC A;  3M4O H;  1FL0 A;  2VY3 A;  1N9W A;  4GS3 A;  4BXX H;  4IFD G;  1JMC A;  1VQF A;  1VQO A;  2YTV A;  4A93 G;  5C0X J;  1VQ7 A;  2VS1 A;  4FDB A;  4X62 L;  3CMA A;  3NBH B;  1XMO L;  2UXC Q;  1VQ9 A;  3H3V I;  4YCW A;  3UDX A;  3J81 j;  3T1Y Q;  4KHP Q;  2VUM G;  2NZH A;  4YCU A;  1OXV A;  2XGT A;  5GAD C;  3PUV A;  3BU2 A;  4IPG A;  1NJI C;  4DR7 L;  3TQY A;  3A74 A;  2PI2 A;  2JA8 G;  4IFD J;  3H15 A;  4JBW A;  3RLN A;  3I4M G;  4LF5 L;  1P8L A;  4HJA A;  4R4T A;  1KIX A;  4LF7 L;  3M85 A;  2UXB Q;  4GN3 B;  4DR5 L;  4GKJ L;  3UDI A;  4JI3 L;  4ALP A;  5IYD G;  3AFQ A;  4B3R Q;  3D0F A;  4BY7 G;  1YJW A;  1PV4 A;  3HOV G;  4OO1 G;  2H5X A;  3GTM H;  1FVI A;  4LUO A;  5IYB H;  3CAM A;  2B29 A;  4X65 L;  4LF8 Q;  1X3E A;  4HIO A;  1L1O C;  4R4Q A;  5GQO A;  4POG A;  5M5Y H;  2BA1 A;  3T1H L;  2K4K A;  4JOI A;  2UUC Q;  3DM3 A;  4DR6 Q;  3UDG A;  4UY8 C;  1KXL A;  2WAQ E;  2PQA A;  4QL5 A;  4X64 Q;  4LF9 L;  3RZD H;  2JE6 I;  1YIJ A;  3TRZ A;  4DR3 L;  2K50 A;  4UP8 A;  1N33 Q;  2OWO A;  4GLA C;  3J7A 5;  3A0J A;  1OXU A;  5M3F H;  1UE7 A;  4AYB G;  5C4J H;  1FGU A;  2FXQ A;  4R4I A;  4A3G H;  3D31 A;  1YVC A;  4OXP A;  1VQC A;  5IYC G;  3CCE A;  5AJ3 L;  1Y1W G;  2UUB Q;  2K52 A;  3TRE A;  4MNO A;  1ASZ A;  4GKK Q;  1RL2 A;  1Q7Y C;  2YU9 H;  1LM0 A;  1OXT A;  3F2C A;  1H95 A;  2D62 A;  4GOP B;  1LYL A;  2XTI A;  3JAM i;  5LMU Q;  5FJ8 H;  4QQB X;  3GTL H;  1WCM H;  2KHI A;  1IBL L;  2Y0S G;  5M3M H;  3CPW A;  4P75 A;  3KF8 B;  1PH7 A;  1IBK Q;  2JA6 H;  4K0K Q;  1X54 A;  4KLK A;  4LFB L;  2VW9 A;  1XPO A;  3CCM A;  5C0X G;  3KLW A;  3KJP A;  3PF5 A;  4OWW B;  1YHQ A;  1NTG A;  2GN5 A;  4AH6 A;  4XTC S;  4GOP C;  4AQY L;  1B70 B;  1HR0 L;  2MO0 A;  3CCV A;  1D8L A;  3E0E A;  4A3J H;  1HNZ Q;  2JA8 H;  2QEX A;  2NVY H;  3J80 i;  3OTO L;  4IOA A;  1N32 Q;  2OQ0 A;  1X9N A;  4A3C G;  2MO1 A;  2JA5 H;  2F4V L;  3AQQ A;  1K83 H;  1SR3 A;  5IE8 A;  3J81 i;  3SGI A;  4A3F H;  4BY1 H;  1I3Q H;  4KI0 A;  4PZ6 A;  4YWK A;  1MIU A;  1VS0 A;  5LMN L;  2E5L L;  3HOY G;  2BH8 A;  5IYD H;  5FLM H;  4DV6 Q;  2R92 G;  1O7I A;  4DV0 L;  4A3K G;  5IY0 A;  4BBR H;  4A3D G;  5C44 H;  1PH5 A;  1VQE A;  2LXJ A;  3Q8D A;  3ZJY C;  5GAE C;  4NXN Q;  1GVP A;  4DR4 Q;  2VQE L;  1Q81 C;  1QVF A;  3PUX A;  4LF4 L;  2HQL A;  5ELO A;  4X66 L;  5J3B A;  4IJH A;  3JC6 6;  4RG1 A;  2NN6 I;  1KD1 C;  5H1S E;  4GNX A;  1W2B A;  4JBK A;  3K7U C;  1J5E Q;  5C3E H;  4OWX B;  4DV3 Q;  4A3M G;  2HHH Q;  2R7Z H;  1KL9 A;  3L7Z C;  1Y14 B;  4PZ8 A;  3F2B A;  4JG2 A;  4LF6 L;  2AMC B;  5IP9 H;  4JI1 L;  1YI2 A;  1JB7 A;  1KHI A;  4AYB E;  1HZC A;  2BH2 A;  2IX1 A;  2E2J H;  2N3S A;  1BBW A;  1EFW A;  3J80 c;  1EYG A;  4JI5 L;  1WI5 A;  3M7N A;  3KJO A;  2K75 A;  4DUY Q;  2C35 B;  4EX5 A;  5FJ8 G;  1K73 C;  1HZA A;  3HOX H;  1M1K C;  1XPU A;  4JYA Q;  3RZO H;  1E24 A;  1E1T A;  2AKW B;  3I4M H;  4WJ3 M;  1MKH A;  3HOU H;  4DNI A;  3G71 A;  4NXM L;  2OTL A;  2ATW A;  2ASB A;  4B3S L;  2I5M X;  2IHF A;  4LWC A;  1LUZ A;  1YJN A;  1A0I A;  3CCS A;  1VQD A;  4DR1 L;  4L5Q A;  4A75 A;  4EQ5 A;  4BY7 H;  1KQS A;  3U4Z A;  1PH1 A;  1M90 C;  4YHH L;  4B3M Q;  2I5H A;  3HOV H;  4JI0 Q;  5IP7 H;  1KAW A;  3K80 C;  1Z9F A;  5DLQ E;  2YTY A;  2RCN A;  3K0X A;  1AE3 A;  1L0W A;  1KC8 C;  3FHW A;  3GTJ H;  4JI6 Q;  1YZ6 A;  4IO9 A;  2E2H H;  1SE8 A;  1TWH H;  1V1Q A;  3PO3 G;  1CKN B;  4GN4 B;  1K9M C;  3S2H H;  1YBY A;  1K8A C;  1QUQ A;  4LUZ A;  1DGS A;  2K5V A;  3UE0 A;  2AWO A;  4MZ9 A;  3IRB A;  1K3R A;  4A3G G;  4PMW A;  4JCV E;  4IOC A;  3W1G A;  4JI7 L;  4IPH A;  1PH3 A;  1B8A A;  1Y1V G;  2ZJP A;  3CC2 A;  1I94 Q;  5IWA L;  4JV5 Q;  3F2D A;  4JI4 Q;  4JC0 A;  2PI2 E;  2R93 H;  3STB D;  4HJ8 A;  2EXD A;  3RNU A;  1Q82 C;  4LW1 A;  4DV7 L;  4L5R C;  1TXY A;  5FLX c;  2ZJQ A;  1UWV A;  2RHQ B;  1FJG L;  1HJP A;  1HNX L;  1WCM G;  2MQH A;  5M3M G;  2VQF L;  4DV1 L;  1S72 A;  3GTQ H;  2GVA A;  2ALY B;  4R4C A;  1CSP A;  2HIV A;  1XMQ Q;  1PFS A;  1U0L A;  2JQO A;  2VZA A;  3S15 H;  3HOZ H;  4LFA L;  2Z0S A;  4P74 A;  1VQ6 A;  1EIF A;  1SLJ A;  3I56 A;  2AWN A;  2A1A A;  2V1C C;  3PUZ A;  4YY3 Q;  3BJU A;  1Q46 A;  3PUY A;  2ZM6 L;  1X56 A;  2OQK A;  3I7F A;  4DV5 Q;  1OXX K;  2UU9 Q;  2PNH A;  4LFC Q;  2YTX A;  2OTJ A;  3PGZ A;  3KFU A;  3M4Q A;  3CCJ A;  3HOX G;  1HNW L;  4A3C H;  2IX0 A;  3K8A A;  2ZTE A;  3CCQ A;  2R6G A;  1JJC B;  3HFZ B;  3OW2 A;  4JI8 L;  2IHE A;  5IT9 c;  3LGJ A;  4JI2 Q;  2I0Q A;  2D0P A;  2Y0S E;  3S14 H;  2Z6K C;  1NBW A;  4PZ7 A;  2Z6K A;  4QIW E;  2R92 H;  2UXD L;  2MFI A;  1EWI A;  1NY4 A;  4A3D H;  4X6A H;  3ULP A;  4JI8 Q;  2Q2I A;  1VQG A;  4GNX B;  1K0R A;  2UUA L;  2L15 A;  3CD6 A;  1LTL A;  3NEM A;  5LMN W;  1HNW Q;  1N36 L;  2UU9 L;  1PA6 A;  3W5O A;  4A3E H;  2B63 G;  2ZTC A;  1XNR Q;  1X65 A;  4DV4 Q;  4B3T L;  4GLV B;  4YY3 L;  1L1O B;  2YV5 A;  4QY7 A;  1JJ2 A;  1MJC A;  5GAH C;  2QA4 A;  3UE1 A;  4KHZ A;  4LFA Q;  1IBM Q;  3EIV A;  1Q8K A;  2K5H A;  2LXK A;  2WFW A;  4TVA B;  1Q86 C;  3ERS X;  4JBM A;  1IBM L;  2VQF Q;  4DV1 Q;  2CFM A;  1HNX Q;  1GKH A;  4P71 A;  1UE1 A;  4DV4 L;  3M4P A;  4B3T Q;  3KDF B;  2Q2T A;  1XNR L;  2CCZ A;  1G6P A;  1KRT A;  1HZB A;  3E9H A;  2A8V A;  3CCU A;  1N36 Q;  1BVS A;  4P72 A;  4JV5 L;  4UPA A;  2UUA Q;  2JEA I;  3H0G G;  1YHA A;  2JK8 A;  1VQM A;  5K36 G;  2UXD Q;  2RHS B;  3F1Z A;  1VQB A;  2K5N A;  1BKB A;  4JI2 L;  2VNU D;  1GD7 A;  3HOW H;  2NVX H;  3FKI H;  2IT1 A;  4A3B H;  1U5K A;  3U50 C;  3CC7 A;  4JI6 L;  3AEV A;  4NPS A;  4LFC L;  4DV5 L;  1XJV A;  2ZM6 Q;  1QZH A;  4QJF A;  4B3M L;  4HIM A;  2N49 A;  1CKN A;  1X55 A;  3UDF A;  4DR1 Q;  1PH4 A;  2JA7 G;  1XMQ L;  5C4X G;  4B3S Q;  3ULL A;  4NXM Q;  4IJL A;  1IL2 A;  5FLM G;  4JYA L;  2R93 G;  1A62 A;  1FJG Q;  1R9T H;  1Z47 A;  2NZO A;  1W3S A;  3CPF A;  5C44 G;  4DV7 Q;  3U58 A;  4JI5 Q;  4O0A A;  4OON A;  4JI4 L;  5IWA Q;  1PYS B;  1I94 L;  3PSI A;  3S16 H;  3TEH B;  4A3I H;  1YHB A;  4BA1 I;  4LF6 Q;  4JI7 Q;  1K8G A;  3GTP H;  1L2F A;  2EQS A;  3ULJ A;  1JT8 A;  3A5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...