2ES2A

Crystal structure analysis of the bacillus subtilis cold shock protein bs-cspb in complex with hexathymidine
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
b'MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*TP*TP*TP*T)-3'
molecule tags Gene regulation
source organism Bacillus subtilis
publication title T-rich DNA single strands bind to a preformed site on the bacterial cold shock protein Bs-CspB.
pubmed doi rcsb
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2es2A00
1SFOH 2AWNA 4KHZA 4LUZA 1KXLA 3E9HA 3HOUG 1A62A 3J7ZC 4LFCL 2K5NA 1VQ9A 4J15A 3L0OA 2UU9L 2YV5A 4A3GH 2UXBL 3UE0A 2KCTA 2IHFA 4DR1L 1GD7A 4JC0A 2F4VL 4A3BH 3UDIA 4PZ6A 1K8AC 4YHHQ 3KJPA 3CC2A 4B3ML 3CD6A 4JOIC 3S14H 4BY7G 4OWTB 4DUZL 1EUJA 1L2FA 1KHIA 5M5WH 2BH2A 2KHIA 5JJKA 4LUVA 3S1MH 2EQSA 2A19A 1FL0A 3BZCA 4IOCA 1PH4A 2OQ0A 2L15A 3CCMA 1K83H 1XPRA 2I0QA 4DR4L 1UEBA 4APVA 4RMFA 3CCQA 1WJJA 3M4PA 1U0LA 1IBMQ 1IBKL 2E5LQ 5LMUQ 1B7YB 1KL9A 3HOYG 1A8VA 2WB1E 2QGQA 5FLXc 5C44G 1Y1VH 3HOVH 2XTIA 3K81C 4A75A 1HZBA 3GTLH 2R92H 1E1OA 1VQOA 3PO3H 1SROA 3D31A 4X64L 4EQ5A 3M7NA 1OXTA 4LF4L 1IBLL 4A3FH 1I3QH 2ZJQA 1X3GA 1Y1WH 3TEHB 3AQQA 4JI0L 2ALYB 4HIOA 1TWGH 2C35B 4B3TL 2Q2IA 4LFAQ 3FKIH 3HFZB 3PO2H 4GOPA 1FVIA 1RIPA 1Q86C 2ZTDA 1Y14B 1I50H 1PHJA 4BA2I 1SN8A 2MFIA 1W2BA 2Q2UA 1HNXQ 1QZHA 2UUAL 4GNXA 1SR3A 1K73C 1VCIA 1RL2A 4LF5L 3PCOB 4BBSG 1OXXK 2DGYA 4DV2Q 3RNUA 1VQ7A 4KHPQ 2I5MX 3FKIG 3CW2C 1WFQA 3S16H 1YJ9A 1VQAA 5JJIA 1E7ZA 4A3EH 5IWAQ 4A3IH 4PZ8A 4DV5L 1KQSA 2VQEQ 5IYDG 1I5FA 4HIDA 4IFDJ 4DR3L 2E2JH 4NXML 3M4QA 3H0GG 5EAYA 4DV6Q 3TRZA 3F8TA 2UXBQ 2B29A 4JYAL 2Z6KC 1PH2A 1EWIA 3F1ZA 2R7FA 3RN5A 1S72A 3OW2A 1LYLA 1UE6A 4K0KQ 5JJLA 1NE3A 1KAWA 2OQKA 3CC7A 4EX5A 1X9NA 1X3FA 5GAEC 5HGQA 3A74A 2JA7H 4UP9A 4R4QA 5C4JH 4DR5Q 4LF6Q 3UDGA 1Q81C 1Y1WG 5M3MH 1V1QA 1Q7YC 3J80i 4NXMQ 5BR8Q 2ASBA 2R7ZH 3U4VA 5H1SE 1IBKQ 4JI6L 2VUMH 4L5TA 4DR4Q 2K50A 3J81c 1JMCA 1TWHH 3CCSA 4A93H 2ZM6L 4POFA 5C44H 3CMAA 2GN5A 3K8AA 1N33L 3I4OA 1B8AA 2IX1A 5LMNL 1VQIA 3NELA 1WYDA 4LF6L 4BBSH 1VQJA 1V43A 1L1OC 4GKKL 3I55A 3CCVA 4NPSA 1VQNA 4AH6A 3G6EA 1C9OA 1IYJB 4X64Q 2F4VQ 2NVXH 3NBHB 1G6PA 1C7YA 4HJ8A 2A8VA 3ULPA 1AE2A 2HIXA 1PH8A 1E24A 3HOWG 1SLJA 2KCMA 1PYBA 3KFUA 2ZM6Q 1N33Q 1B70B 3RZDH 1OXVA 2LSSA 1EOVA 2R93G 4P74A 3NEMA 3HOXG 3EIVA 1NMFA 3Q8DA 2A1AA 4YY3Q 2UXCL 2JEAI 2E2HH 3OTOL 4X6AH 2B63H 1YHBA 3TS2A 3FP9A 2IY5B 1JT8A 1YJNA 2H5XA 4IFDG 2MQHA 2R93H 4YWMA 2JA5G 4MNOA 1CSQA 1L0WA 4GOPC 4P71A 3D0FA 5M5YH 2NN6I 2Q2TA 4DR3Q 2F52A 4P75A 1SRUA 5BR8L 1HR0Q 2AMCB 1JE5A 4P73A 1IZ6A 3J81i 4OX9Q 2BA0A 1LUZA 2FXQA 3NENA 5C4XH 3JAMc 3ICEA 3RN2A 3T1YQ 4X66L 5C0XG 1QZGA 2WB1G 5LMNQ 2JE6I 1HNZL 1Q82C 1X3EA 1IXRA 2RCNA 2YTYA 4A3JH 3J80c 1A63A 3CF5A 1HR0W 1NY4A 4P72A 1PH9A 2UXCQ 1S3OA 1BBWA 4DAYB 5C0XJ 3PUZA 1JB7A 2Z6KA 4JI6Q 2B3GA 3PO3G 4IPCA 4OWWB 3JC66 4LFAL 4GOPB 3K7UC 5IWAL 1M90C 4GLXA 2PMZE 2VW9A 3S1NH 1K3RA 4B3TQ 1O7IA 3ER0A 2VQFL 1VQLA 1YEZA 2YYZA 4HJ7A 4B3SL 3OYYA 4DR7Q 1AH9A 1GO3E 4O2DA 2Y0SG 4AQYL 4O0AA 4WJ3M 4WJ4A 3KYHC 4L5SA 1X54A 1TWFH 3W1BA 4OX9L 2HQLA 1HZCA 1U5KA 4QY7A 4JI8Q 3BJUA 3HOUH 3HKZG 3ZJYC 4MZ9A 4A3MG 1VQGA 2PI2A 1OTCA 4GNXC 1N32Q 5LMUL 4IPDA 2ES2A 3I7FA 1YHAA 4GN4B 1N34Q 2F3IA 3SGIA 5IYCH 3PF4A 4KLKA 2NZOA 5IY0A 2HT1A 2VQEL 3A5UA 4A3KH 4JI7Q 3E9IA 3RLFA 3PGZA 1NMGA 2JEBI 3G71A 4DR7L 1XTDA 4JI4Q 3KDFA 2OWOA 1HNWQ 4A3JG 2MNAA 4B3RL 3AFQA 1ASYA 4DUYL 1BBUA 4LF8Q 1GKHA 4A3LG 1YZ6A 4A3CH 1Q1BA 4JV5L 1VQ6A 1HNXL 2UUCL 4AYBG 1KD1C 4JBMA 4X62L 1HZAA 3PUXA 2D0PA 3W1GA 5GAHC 4LFCQ 1LTLA 1TWCH 2UU9Q 2KBNA 2UXDQ 3S1RH 4LUOA 1CKNA 1YITA 1BKBA 3PUVA 1YJWA 1XPOA 1VQBA 4QIWE 2QA4A 1QUQB 2YTVA 1UWVA 1XMQL 5FJ8H 4DV7L 4JCVE 3KDFB 1NTGA 3GDEA 1MJEA 4A3GG 2VL6A 4HJ9A 4A3MH 1L1OA 2IHEA 1W3SA 4POGA 4YWLA 4ALPA 5GQOA 3GTPH 4C3JH 1XMOQ 1QVGA 2R6GA 4DV3L 1XPUA 1EFWA 4DK6C 1EYGA 4R1JA 1TXYA 4JI5L 3T1HQ 1E3PA 2N3SA 3I2ZA 3VDYA 4DUYQ 2GVAA 3L2PA 5LMNW 4UPAA 4BY7H 1H95A 3S17H 4GS3A 4JI3L 1HJPA 3DLLA 4DV7Q 1M1KC 2IT1A 3S2DH 1SE8A 4JI2L 4A76A 5M3MG 1YIJA 4JI1L 1AE3A 1V9PA 1S40A 4LFBQ 4DAMA 1FGUA 4DV0Q 4DV6L 3GTQH 4A3CG 3H15A 1EQQA 2KENA 4DR1Q 5C0XI 1NJIC 4LF9L 3H3VH 4JYAQ 4GKJQ 2AKWB 3E0EA 4JI7L 2IX0A 5E7NA 2OTLA 1XNQQ 2UUCQ 3S15H 1T9HA 5JEAJ 4A3DH 4C2MH 3KF8B 1QVCA 3WWVA 1K8GA 4QQBX 1Q46A 4R4OA 1EIYB 1Z47A 3CCLA 1OXUA 1PV4A 4IJHA 1HZ9A 1UE1A 1K0RA 4GKKQ 4XIGS 3RZOH 4JBJA 2CQOA 5IYDH 3BZKA 4IPGA 2JA9A 2MO1A 1PH5A 3HOZH 1JJ2A 1YVCA 1E22A 4BXXH 2K14A 1I94L 3PIOA 2JQOA 4YHHL 2CCZA 2V1CC 4B3MQ 2JA8G 1XNQL 4QJFA 2VY3A 4PZ7A 4TQUS 2RF4A 1TWAH 2OCEA 5M5XH 3A0JA 4NXNL 4H02A 5AJ3L 2JK8A 3M85A 4X65Q 3PF5A 3HKSA 1N36L 3H3VI 2NZHA 1VQEA 4GLAC 3RLOA 2CWAA 5C3EG 5M3FG 4LF7L 4DR2L 4JI8L 3GTMH 1VQDA 2AHOB 3I4NG 4DV0L 2R7DA 4QL5A 3CPFA 4OWXB 1KRTA 5HY6A 3DM3A 1XMQQ 4DR6Q 4YCUA 4LF4Q 4LW1A 1X6OA 3M9BA 2VQFQ 3U58A 3BU2A 2GVBA 2NN6G 5GADC 3KOJA 4BBRH 1KC8C 2MO0A 2VZAA 1EQRA 3GD7A 4XTCS 4BY1G 1QVFA 3PUWA 4X65L 1N36Q 2HHHL 3ULLA 1SMXA 2QEXA 3CMEA 2UUAQ 4PMWA 4GLVB 4UP8A 4RG1A 2R92G 3M4OH 1MKHA 4B3RQ 3MXNB 5IYBG 1IBML 4A3DG 2D62A 2RHQB 3HOXH 4DV4L 1YI2A 4LF8L 2UUBL 1I94Q 5IP9H 3I4MH 4OO1I 4HJ5A 3JAMi 1HNWL 1J5EL 5IE8A 4ME3A 1VQ4A 3TQYA 4GN5A 3STBC 2JA8H 2VUMG 4QGUA 4DNIA 3TS0A 3EBEA 4KI0A 4DUZQ 1HNZQ 2XGTA 3HOZG 4HJAA 1VQ8A 1G291 3K7AH 3F2CA 3S2HH 1D7QA 3S24A 1J6QA 4DV1L 3KF6B 2UXDL 4OONA 1VQKA 4BBRG 4A4IA 1PH7A 1YNXA 4JBWA 4GKJL 2JA7G 4YCVA 4LFBL 3J7A5 2JA6G 2K75A 2Q2HA 5IT9c 4L5RC 4LF9Q 2BA1A 2E5LL 4X62Q 4HIMA 1MJCA 2NVYH 2B63G 1LM0A 2K5HA 3KLWA 3H0GH 3ERSX 2ZJRA 4AQYQ 4JV5Q 5C4XG 3HKZE 2WP8J 1P16A 1I6HH 2EIFA 2PI2E 1VQCA 2EXDA 3B6YA 4LF7Q 4DR5L 3RR5A 1C0AA 4JBKA 3I56A 1D8LA 4JG2A 1YHQA 2WFWA 1N8RC 4IJLA 4DV4Q 1G51A 4MTNA 4GN3B 3L7ZC 1KRSA 3HOWH 1N34L 1PVOA 1N9WA 1XNRQ 4C3HH 4PG3A 2JA5H 3F2BA 3UE1A 5IP9G 2K5VA 4R4IA 3I4MG 3PUYA 3PIPA 2ZTCA 1VQ5A 1JJCB 2I5HA 4TVAB 5IYBH 2LXKA 1PH6A 3KF6A 4IOAA 5ELOA 3W5OA 2NVQH 4IO9A 4UP7A 4HIKA 1EIFA 2K4KA 4DKAC 1X65A 4Y52H 3GTKH 3CCUA 3CCEA 1VQFA 1HH2P 3HOYH 4A93G 4R4CA 3LGJA 3T1YL 4A3IG 1IL2A 2PNHA 1Q1EA 2E8GA 2Z0SA 4LWCA 3U4ZA 5FJ8G 4A3EG 3CQZH 4A3FG 5IP7G 2YTXA 2N78A 4B3SQ 2R7ZG 4C3IH 3A5ZB 1A0IA 3ULJA 3GTGH 4JI1Q 2D0OA 2HHHQ 2ATWA 3J81j 3S1QH 4JI2Q 1L1OB 1PA6A 1GVPA 1UE7A 3AFPA 3STBD 4AIMA 5GAGC 1R9TH 1MIUA 4JI4L 1PH3A 1CUKA 2VNUD 3RLNA 1J5EQ 2E2IH 1QUQA 2N49A 1UE5A 3CC4A 2JA6H 1GM5A 1Q8KA 2ID0A 1CKMA 1PH1A 3AYHB 3CPWA 3IRBA 4YY3L 4GNXB 1VQPA 2RHSB 4DV3Q 1NBWA 1K9MC 2Y0SE 4DPGA 2AWOA 4JOIA 4L5QA 3GO5A 4OXPA 3CCJA 1N32L 1KIXA 4LNQA 3TREA 1PFSA 2VS1A 3FHWA 1XNRL 3G48A 1DGSA 4DV5Q 1PYSB 1Y1VG 2KHJA 4FDBA 1E1TA 4IFDI 3MEFA 2YU9H 5JEAG 5M3FH 3I4NH 3PSIA 1VQMA 4OO1G 3M3YH 1CSPA 2CFMA 1WOCA 4DR2Q 4LF5Q 3OTOQ 2PQAA 2HIVA 4DV2L 5J3BA 4KHPL 2N8NA 1X56A 2LXJA 4DK3C 3CCRA 1ASZA 4NB3A 4YCWA 2UUBQ 1FJGL 3T1HL 4JI5Q 4BY1H 5GROA 1X55A 3UDXA 4BXXG 1XJVA 4Y7NH 3K0XA 3AEVA 2K52A 1WCMH 4A3BG 3KJOA 3GTJH 4UY8C 2BH8A 3CAMA 4A3KG 2ZTEA 3G4SA 1IBLQ 4R4TA 3CXCA 5C3EH 1VS0A 3CP0A 4JI0Q 4IPHA 3HOVG 4K0KL 4X66Q 5FLMG 2ZJPA 3PO2G 4A3LH 4YWKA 1Q12A 1BVSA 5FLMH 1VQHA 3UDFA 1Z9FA 3U50C 2DUDA 1CKNB 1P8LA 2NVTH 2I5LX 4BA1I 5AJ3Q 4NXNQ 3K80C 1HR0L 5ELNA 4DV1Q 1WI5A 1XMOL 2CWPA 1CKOA 2WAQE 3EN2A 2PQAB 5DLQE 1YBYA 5IYCG 1FJGQ 2CKZB 5K36G 4AYBE 2WAQG 1WCMG 1JJGA 2JJQA 4JI3Q 5IP7H 3F2DA 3PV0A 3GTOH 4DR6L 1OXSC 2OTJA
chains in the Genus database with same CATH superfamily
3C46A 3I4MB 2MP1A 2F0VA 5CV8A 1VQ9A 2UU9L 2UXBL 3H3VC 2B2YA 2KCTA 1TWHB 2F0MA 4JC0A 4JOIC 3ZYYX 1KHIA 5M5WH 4QB4A 1MHWC 3S1MH 3BZCA 1PH4A 4IUPA 1K8MA 3TZUA 3CCQA 3M4PA 5DNFA 1L0YB 1U0LA 1IBKL 1IBMQ 1RKNA 1SXTA 1B7YB 2QILA 3HOYG 1A8VA 5KNCA 5FLXc 3HOVH 4ODGA 4N8FA 3IFDA 4XT1B 1B9MA 1KABA 1IBLL 1MGSA 3NWSA 3BVGA 5C4HA 3DMUA 4RFBA 2Q8TA 5HURA 3QG1A 2C35B 2F0HA 4LFAQ 3BYTB 1Q86C 1Y14B 2K04A 2N55A 2RSOA 1HNXQ 3GTJB 1A6XA 1SR3A 2IL8A 2PW5A 3G6JB 3PCOB 4CHTB 1OXXK 2DGYA 4FYDA 3H6MA 4DV2Q 3RNUA 3CW2C 1WFQA 3S16H 3CU7A 4WORA 2RBMA 3JAML 1UAPA 3T51B 2VQEQ 5IYDG 1I5FA 3VYSA 4DK0A 2E2JH 2DN8A 4DV6Q 3TRZA 2UXBQ 2MUYA 1WTHA 3F8TA 3R93A 1UE6A 5FO7B 2PZUA 5HGTA 3WOEA 2OQKA 4K5WA 3CC7A 1Q81C 1L0XB 2D9UA 4DAVA 1IBKQ 3T13A 1KNEA 4DR4Q 2A69C 1FGBD 1TWHH 3J7YW 3CCSA 4A93H 2ZM6L 1WVLA 2I07B 1B8AA 4K6DA 2EJFC 5LMNL 4B9XA 3VR4A 5JPNC 3C3LA 2AUJD 3CCVA 4NPSA 1VQNA 4AH6A 1QNKA 1C9OA 3VYUA 3KF8A 4X64Q 1PRTC 3BG3A 2A8VA 2F3VA 1PH8A 3K58A 3HOWG 1SLJA 2KCMA 1PYBA 1D2BA 4A3JB 2R93G 1OXVA 2LSSA 3NQTA 4O42A 1KTKA 3NEMA 3HOXG 5ISRA 1TS4A 5KYLA 4KKTA 4YY3Q 2UXCL 2JEAI 4MN3A 4ZQ3A 3OTOL 3FP9A 5D65A 2A74C 1JT8A 3HP3A 1YJNA 2MQHA 1F77A 2XRSD 1L0WA 4P71A 4XXEA 1STYA 1DXMA 1SRUA 5BR8L 3S16B 2SEBD 2H4OA 4TKOB 4CJ0B 3T1YQ 3FDTA 2A68C 3OIQA 2A6HC 2E2JB 2RCNA 1A63A 3J80c 3M4OB 1HR0W 1NY4A 1PH9A 1S3OA 3P75A 4H13C 4EQOA 3PUZA 3K59A 3PO3G 4GOPB 2VW9A 2TSSA 4B3TQ 4B3SL 1YEZA 4DR7Q 2MPMA 1GO3E 5EKLA 2HQLA 4ID6A 4QY7A 4G57A 1NAPA 3MZ5A 4MZ9A 4A3MG 1OTCA 3I90A 1N32Q 4GNXC 1YHAA 3PF4A 4KLKA 5IY0A 1JOQA 4TRDA 2CW0C 4A3KH 3HOWB 4ZAIA 3G71A 1VF5C 1XTDA 4JI4Q 3KDFA 1MBYA 2K01A 2A73B 4A3LG 4JV5L 3S2DB 4AYBG 1CFMA 3PUXA 4DAYA 3W1GA 4S3SA 1NR2A 2UXDQ 5FK9C 3T53B 2RKSA 4DFAA 1EY4A 5BN5A 1YITA 1XPOA 1H9KA 1VQBA 3PMFA 4HCSA 1XMQL 4A3DB 1YNNC 1AZPA 3KDFB 2B63B 1JOOA 4YWLA 2B2WC 3KK7A 4C3JH 2MHVA 4DV3L 4XYQA 3R8BA 4R1JA 1DM0B 2N3SA 4DUYQ 3D3RA 4UPAA 2WIIB 1I6HB 4BY7H 1H95A 1TU2B 1EU4A 1BCPD 1HJPA 3R2TA 4QUCA 2IT1A 1KDAA 5M3MG 5CMDA 1S40A 3S1RB 3KLRA 4DV6L 2KENA 2JA5B 3E0EA 2IX0A 2TMPA 1BF4A 5JEAJ 3M4YA 1BR9A 2J4XA 1K8GA 1LT5D 1PV4A 2DNCA 3RZOH 1EFID 4C3IG 3BZKA 4IPGA 2MO1A 1PH5A 4G4KA 2F0QA 1R4QB 2FINB 5DAUA 3PIOA 3E0JA 4YHHL 4B3MQ 2JA8G 1XNQL 4QJFA 2VY3A 1B3AA 2M9VA 4TQUS 2RF4A 2KJXA 5AJ3L 3H3VI 2EXZA 4X65Q 3PF5A 2EVBA 2EZVA 4IZ8A 2CWAA 4EVOA 3SK6A 4DR2L 3MWYW 2R7DA 4QL5A 1D5ZC 2F0GA 5D3DA 1KRTA 4FF1A 5HY6A 3SDZA 3DM3A 1XMQQ 1AP0A 4LF4Q 1K0SA 1LTTD 5GADC 3KOJA 4BY1G 3FVQA 1FNVA 2HHHL 1AN8A 1SMXA 3BDOA 1QJOA 3DUZA 4H0LC 1MKHA 5IYBG 2D62A 2RHQB 2UUBL 1I94Q 5IP9H 3TSSA 4HJ5A 1HNWL 1EY8A 1VQ4A 1LTSD 4OGQC 2HCCA 3H94A 3TS0A 4DUZQ 2B2VC 1KDBA 5KNDA 3S2HH 1TKWB 3KF6B 5CBAE 4FP5D 4OONA 1VQKA 3OMGA 4RH6A 5T1IA 1E2WA 1PH7A 1YNXA 2I46A 4JBWA 1D1IA 3J7A5 1HA6A 1SE2A 1WCMB 4HIMA 1MJCA 1LM0A 3A8JE 3KLWA 3H0GH 2ZJRA 4AQYQ 1IW7C 1P16A 1S4ZA 4B9WA 1VQCA 2EIFA 2PI2E 5IGGA 4GZYC 4JBKA 2F0PA 3I56A 1AW7A 3RMHA 4XQJA 3L7ZC 1KRSA 1N34L 1PVOA 2JA5H 3Q6SA 1LT3D 1EY9A 4IUVA 3I4MG 1JWUD 2RSNA 1CTMA 4IUQA 2ZTCA 3FMCA 5I4DA 5IYBH 1PH6A 1RHPA 3W5OA 1RD9D 4UP7A 1Y8PB 2FJ2A 3CCUA 1VQFA 1HFNA 4R4CA 3T1YL 1BCPC 3E3XA 4A3EG 2WKCA 1EEFD 1A0IA 3ULJA 3HGBA 4NW2A 1X32A 3TDQA 2QDLA 1PA6A 4AIMA 4JI4L 2VNUD 1PH3A 1CUKA 2X6LA 2O4XA 3HRZC 1QUQA 2N49A 3CC4A 4RWSC 3P7JA 2ICIA 3NBIA 1RTOA 2ID0A 3C1FA 2XRQD 1B2TA 3NTIA 3LWUA 2Z4IA 3VA5A 1QWYA 2Y0SE 1K9MC 2JXMB 4V0BA 2NN6H 4FXDA 2KHJA 1K3BC 3IL8A 1Y69U 5D14A 1ILPA 2YU9H 1IHZA 1CSPA 3M3YH 1WOCA 4F8MA 5KNBA 4C2MB 2XWBB 3I8ZA 4DV2L 3K57A 1G6ZA 2UUBQ 1ILQA 2B8FA 5CV6A 3DEOA 5GROA 4BY1H 3UDXA 4BXXG 1XJVA 1S5ED 5BN3A 2NUCA 2XVSA 5IGDA 1WCMH 3GQBA 1F2ZA 3MC0B 5T1GA 1TWGB 4A3BG 2CH4A 1SMYC 2BH8A 3CAMA 1LLRD 2Q8RE 2ZTEA 3G4SA 1IBLQ 4K5XA 2QW7A 3CP0A 1I50B 4IPHA 4X66Q 2KECA 1DJRD 2D2CC 3QB3A 4IFDH 4YWKA 3TP5A 5F2DA 1JORA 3U50C 2DUDA 3O13A 4BA1I 4RHRA 2AQ2B 4EGVA 3TZDA 3A7AB 2B8GA 4PV1C 5FO9B 5K36G 4DN4M 1IYUA 1JJGA 5C4ZA 2BOSA 2JJQA 3F2DA 2PZWA 3HOUB 4DR6L 4N9PA 3BYYB 1KXLA 5C4JB 4H44C 1A62A 1BXTA 1I4XA 1KLUD 1UNSA 2K5NA 2F0SA 1A3VA 4I7ZC 2IHFA 3C1EA 1QILA 4A3BH 3UDIA 3CC2A 3KJPA 4U673 1CZWA 4OWTB 1L2FA 2DNEA 1CM9A 2KHIA 5JJKA 4LUVA 5KRUA 4QCLA 2EQSA 2A19A 1FD7D 1EU3A 2L15A 4C3HB 1XPRA 4DR4L 1UEBA 3Q23A 1WJJA 2E5LQ 4G7HC 4X3UA 1BOSA 5CORA 2XTIA 3K81C 4C1NI 4A75A 1HPCA 4CDDC 2R92H 1O80A 1VQOA 3D31A 4X64L 1GXDC 1BO0A 3OPOA 4A3FH 3AQQA 4C3IB 2ALYB 1TWGH 4XT3B 2RDHA 5M5YB 1FVIA 1I50H 1LV9A 1PHJA 4BA2I 4HSVA 1W2BA 2F03A 2B2TC 1CA6A 4BBSG 4LF5L 1PTOC 1O7YA 4N8X1 2SOBA 1H9SA 4A3KB 5JPMC 3GTQB 3E5SA 1STBA 4A3IH 5IODA 1TT2A 2KHSA 1B1ZA 5ELBA 4ZYSA 3DEPA 2KQ3A 4DR3L 4NXML 3M4QA 4E6IA 1EZ6A 5EKKA 3K5OA 2WKDA 3IFTA 1PYWD 2R7FA 3RN5A 1LYLA 5JJLA 3A8IE 3MFGA 3RUZA 1E2VA 2B2VA 3NE5B 3PQIA 3N52A 4WFN3 5C4JH 5EQ0A 1PTOH 5M3MH 5M5XB 2F3WA 4KY5A 3J80i 2ASBA 5ELEA 2R7ZH 2CQAA 2XWJB 1XTCD 3U4VA 4JI6L 2VUMH 4L5TA 4K14A 4Y7NB 4A3BB 1MD2D 1N33L 3CMAA 3S17B 4BBSH 3NELA 4LF6L 1I4PA 1V43A 3VR6A 4GKKL 5IGBA 4C56C 3G6EA 1HFGA 5KIXA 4KY7A 1G6PA 4NP5A 1AE2A 2EYPA 1EY0A 1SE4A 1GUSA 4CDCC 1B70B 2G9HD 2LKVA 1GOZA 3NUCA 3RZDH 4P74A 3MHBA 5M9OA 2PMZB 2B63H 3TS2A 2K28A 4B08A 1HUNA 3GV6A 5KYIA 1XYIA 3RZOB 4YWMA 1TS3A 4GOPC 1I3QB 3D0FA 1NR4A 5M5YH 1LT4D 3GTOB 2SNSA 2E74C 4RAUC 4DR3Q 4Q0FA 2CHBD 2XNAC 2KCCA 3J81i 2FXQA 1Y8NB 1JOKA 4X66L 1QZGA 2WB1G 5LMNQ 1HNZL 4A3IB 4A3JH 2GA4B 4RKBA 1HA5A 4P72A 4ZKBB 2UXCQ 2Q8IB 4L8JA 4WRDA 5C0XJ 1H9RA 1T5XD 2Z6KA 4JI6Q 2EPBA 4OWWB 4J6HA 1II3A 2F0OA 1M90C 2PMZE 1K3RA 1O7IA 1Q8IA 1Z7TA 4MHEA 4KN7C 1J8IA 3OYYA 3EFXD 2VUMB 2SDFA 4O0AA 3M7GA 3K7AB 1BUVT 1TWFH 1X54A 5G3LD 3W1BA 1YNJD 3BJUA 1CI3M 3HOUH 3HKZG 3OMCA 1BQQT 1EQVA 3Q0AA 1Y8OB 4IPDA 2ES2A 1CT1D 2F3IA 3SGIA 1BDOA 2N88A 2J0TD 1SNOA 4RGOS 1PZJD 5CR3A 2WV6D 3GP7A 2JEBI 4DR7L 4HN7A 1SDFA 1HNWQ 4A3JG 3AFQA 4OELB 2K1BA 4BBRB 1GKHA 3IKJA 1Q1BA 2K6AA 5JVH3 3QR8A 5JVG3 2UUCL 1O7LA 2D0PA 5EBCA 2UU9Q 2ZT9C 1GHJA 1CQFA 1SYFA 4QIWE 4Z9CB 2QA4A 4DNTB 1TIID 3EA6A 2YTVA 1SNDA 4C3HG 1JWSD 1CHPD 4DV7L 3GDEA 4RGMA 4HJ9A 1PTOF 1W3SA 4DXGA 1AZQA 3GTPH 2R93B 3U9SA 1QVGA 3ERQA 3G7LA 4DK6C 1F9SA 1E3PA 1FNUA 2PO4A 4CDEC 3H0GB 3I2ZA 3VDYA 5LMNW 2ICEC 4JI3L 3DLLA 1M1KC 3S2DH 4JI2L 1YIJA 3K5NA 1V9PA 3GTQH 3H15A 1EQQA 3H3VH 4K6LA 4JI7L 1I6VC 1SE3A 4A3DH 1HCZA 1QVCA 3WWVA 1J9OA 1Q46A 3MVVA 4HMJA 3DHQA 1OXUA 1HHVA 1HZ9A 1K0RA 4JBJA 2CQOA 3S9WA 4M1UB 5IYDH 3HOZH 1YVCA 4BXXH 3VYRA 4RA8A 4KV6A 3ONAB 2MGSA 3K0YA 2OCEA 5M3MB 5M5XH 4H02A 2EYOA 3M85A 1N36L 3HKSA 2NZHA 1Q90A 3SK4A 2A5HA 3GTMH 4LF7L 3I4NG 3SXHA 2RQXA 4K8JA 1SSOA 4OWXB 4YCUA 2F0FA 4LW1A 1X6OA 3M9BA 4ZUJA 4HR7B 1KC8C 4BBRH 2VZAA 3GD7A 1PRTB 4ILWA 4XTCS 1QVFA 3OWEB 2NB0A 2BE5C 2UUAQ 4PMWA 2EYHA 3M4OH 4OO1H 2K05A 4A3DG 3AMUA 1SNMA 4DV4L 1YI2A 4JK1C 2H1EA 5IE8A 3TQYA 1JWMD 3STBC 2VUMG 1U4RA 4QGUA 4KI0A 1A2TA 3HOZG 1SBBB 4AYBB 3E6ZX 4Q5VA 3I3CA 3S14B 1QG7A 1LTID 2JA7G 4LFBL 2JA6G 5E4WC 2AQ3B 5IT9c 4L5RC 5C3XA 5C4XG 4RGTA 2L0CA 3OHXC 2WP8J 4HSPA 2EXDA 3B6YA 4DR5L 3RR5A 1C0AA 4IJLA 4IN3A 4KKUA 2XN9C 3HOWH 1LTAD 1XNRQ 4C3HH 2LY7A 4PG3A 1JJCB 2I5HA 4TVAB 3I4LA 3KF6A 2OF1A 4CKCA 2F0WA 4HIKA 2K4KA 1GHKA 4DKAC 5DEHA 1F9RA 4N9TA 3HEJA 5CC4A 4A3IG 1IL2A 2PNHA 2PNRC 1Q1EA 2E8GA 4BWGB 2R7ZG 2D5DA 3LX0A 4B3SQ 2YTXA 4C3IH 2KEDA 1EQTA 1SFOB 1SMYD 2BDNA 1L1OB 3X3NA 5GAGC 1UE7A 4K2KA 1MIUA 2R3ZA 3RLNA 3NK9A 3MEHA 1CKMA 3V05A 3AYHB 1WTXA 3IRBA 1I4HA 3NP8A 2E2DC 1V1PB 3BVMA 4GNXB 4DV3Q 1EY5A 4DPGA 1ENAA 1N32L 1KIXA 3TREA 2VS1A 3FHWA 3G48A 4LJZC 1M4VA 1K28A 1V8QA 1WTWA 3MEFA 3J7AF 3I4NH 3PSIA 1O7ZA 4J8QA 5KEEA 4LF5Q 2PQAA 2HIVA 2VXWA 5J3BA 1EEID 1LTBD 4YCWA 3MFYA 2AQ1B 1ZYRD 2K5DA 1TWAB 1ENCA 3X3MA 2BE5D 4A3KG 1VS0A 2OEOA 3I91A 4F7XA 2EYLA 5FLMG 2ZJPA 1Q12A 1WTVA 2NVTH 5AJ3Q 1GUNA 3K80C 1HR0L 2YU9B 4DV1Q 2NWGA 1XXGA 1PFMA 3EN2A 4KMUC 3M3YB 5DLQE 5A2QL 3OIPA 2CKZB 1ET9A 4AYBE 1WCMG 3TP6A 2B2YC 4DAPA 2QF7A 3PV0A 2HD3A 5CV5A 1OO9B 1WD0A 1SFOH 1DZ1A 2RDGA 4H7BA 4LUZA 3E9HA 5LL6S 4KD4A 1GUTA 1PXUA 3F2UA 3HOZB 4LFCL 3VR5A 4J15A 3L0OA 3K5MA 2F4VL 5C0XH 3BDCA 4PZ6A 1K8AC 4YHHQ 4B3ML 3CD6A 1UUPA 3R3OA 2BH2A 2HQEA 4KK7A 4WJWA 5J22A 4PQXA 3J81L 4IOCA 1CHQD 1CK1A 3P1HA 2P5ZX 2IJ0A 4RMFA 3C2PA 1SNPA 4A3EB 3I4NB 5LMUQ 3KBXA 3NWTA 2QGQA 5C44G 1E1OA 3PO3H 1SROA 3MXUA 2R61A 4NMZA 3A56A 4LF4L 1I3QH 1X3GA 1Y1WH 2A6ED 4JI0L 3HZXA 4RCOA 1MSHA 3TP8A 4B3TL 3MTSA 2Q2IA 3HFZB 1PRTD 2FMMA 3H91A 4GOPA 1A2UA 1RIPA 2ZTDA 1VF7A 1SN8A 2Q2UA 2UUAL 1GJXA 1K73C 1VCIA 2C5CA 3HS0C 4L6TB 4KHPQ 3NTHA 1VQ7A 4FXGC 3FKIG 5JJIA 1BBXC 4DA2A 4HMIA 1ZYRC 3ND8A 5IGEA 1WTRA 1JE4A 4FF3A 5IWAQ 4PZ8A 4DV5L 1KQSA 2C9OA 1AEXA 4KJNA 4HTHA 1R4PB 1SYBA 2B2UA 3H0GG 1EWCA 4BS9A 2Z6KC 2PYKA 3NTKA 4JPBW 1S72A 3OW2A 1RODA 1KAWA 2JP1A 1SNQA 3K5LA 1X9NA 1X3FA 1G8ZD 5HGQA 2JA7H 4UP9A 1Y1WG 1Q7YC 1VMPA 1PZKD 4KD3A 1SYDA 4XYOA 1JMCA 4POFA 5C44H 2GN5A 3K8AA 5D3IB 3I4OA 2IX1A 5EPLA 1QB5D 1VQIA 1WYDA 1QOHA 1VQJA 1L1OC 2NBFA 3SR1A 3I55A 1DYQA 1JQYD 2F4VQ 2NVXH 2J7ZA 4HEDA 1IKMA 5L37A 2QEJC 1CA5A 2ZM6Q 1K83B 4KKSA 1EOVA 5C5MA 5I2YA 3FPUB 3EIVA 3CKIB 5IT9E 1HRJA 2VB2X 4X6AH 2PZTA 2H5XA 2B2TA 2R93H 3QOJA 2JA5G 4MNOA 1ET6A 4MIUA 3SK8A 2Q2TA 4KTAA 2IWHA 4BBSB 2F52A 2IW3A 2AMCB 1IZ6A 2FFKB 4OX9Q 2BA0A 3NENA 5C4XH 3JAMc 1TY2A 3RN2A 1FR3A 5C0XG 2V4DA 3GTMB 4RKLA 2RDFA 2F4IA 1Q82C 1X3EA 2YTYA 4IALA 4JW0A 3BS1A 4DNRB 5EJWA 4DAYB 5I6WA 1Y1VB 4RGNA 2F1MA 2B3GA 3OW7A 3MA2B 3JC66 3K7UC 3D6CA 5IWAL 3HOVB 4GLXA 3S1NH 3CRLC 2LMCB 2YYZA 1FYCA 2F0TA 3S15B 4O2DA 4AQYL 4ZRZA 1TQOA 3S2HB 4J1MA 2K7VA 1HZCA 1CQVA 1EY7A 1ZKOA 3ZJYC 5JEAH 1VQGA 5J1ZA 5CYUA 3I7FA 2KCNA 1N34Q 5IYCH 2NZOA 2HT1A 1A3UA 3WDNA 3SHLA 3MAQA 2VQEL 3NPPA 3A5UA 3E9IA 3PGZA 1D6EC 1NMGA 5LL6X 1A3TA 1MSGA 3DXJC 2MNAA 1LTGD 1BBUA 2L5TA 4LF8Q 5I6YA 1SEBD 1YZ6A 3HKZB 3FEWX 1HNXL 1IKLA 4JBMA 1HZAA 5GAHC 1GUOA 2Z1CA 2KOLA 1O78A 2Z4HA 4LUOA 2FHTA 1I4GA 1YJWA 1BKBA 3PUVA 1EYCA 3CQZB 1LABA 1TWFB 4ZCKA 1DOKA 1UWVA 2L12A 2RCFA 5ELDA 4JCVE 2EJMA 4P2CB 1MJEA 3PO3B 4A3MH 1L1OA 2IHEA 4POGA 4ALPA 4NKLA 2O2LD 1SYGA 1XMOQ 3NSWA 5CGKA 1Y1WB 1HQMC 1EYGA 4JI5L 5C3EB 2ZXRA 3L2PA 2KEEA 1PMRA 4DGZA 1I4RA 4DV7Q 2NYZD 2OT2A 2NTTA 3ITPA 4A76A 2NVYB 4LK1C 2M00A 4LFBQ 4DAMA 1FGUA 2VB3X 4DV0Q 4DR1Q 1NJIC 2Z6BA 5E7NA 5JJZA 2L9HA 2OTLA 1XNQQ 2UUCQ 3S15H 1T9HA 4R9WA 3KF8B 3W2DA 5CV7A 2WINB 4R4OA 1S5BD 3VR3A 4GKKQ 1UE1A 3GTPB 2K03A 4IUNA 1ONLA 4QMGA 1G2TA 3HOXB 5KGUA 2JA9A 2XSCA 2K14A 3DM1A 1HTLD 2K5QA 2V1CC 2A6HD 4I7AA 4JI7Q 4OO1I 4NXNL 4I65A 3GTGB 3T4AC 1VQEA 4GLAC 4KJOA 5C3EG 5M3FG 1JB3A 3CPFA 1JCKB 5C44B 2VQFQ 3BU2A 2JSOA 2GVBA 1W6JA 1F2MA 4X65L 1LO5D 3ULLA 3CMEA 4K2LA 5NUCA 2HUGA 4RG1A 3Q22A 2R92G 3J80L 4G7OC 1B44D 3EJIA 4A3MB 4LF8L 3I4MH 2E76C 3JAMi 4IUUA 1JC7A 1J5EL 2JA8H 1HNZQ 3D8GA 3EBEA 1BCPB 5ELCA 2L4NA 4K5VA 3F2CA 1WTQA 1U4LA 4DV1L 4BBRG 4HCEA 5E1FA 3RD4A 1DD2A 3TN2A 4LF9Q 2E5LL 2X6GA 4X62Q 2NVYH 4CGYB 2PPBC 4JV5Q 3HKZE 2HDMA 4LF7Q 2K33A 2JYOA 4QUFA 4OIJA 1SNCA 1CZGA 1WD1A 4IQZA 1D8LA 4JG2A 1YHQA 2WFWA 1N8RC 2F0DA 4DV4Q 3VR2A 1N9WA 2G5DA 3VYTA 2K32A 1VMCA 3UE1A 5IP9G 2K5VA 2Y0SB 5IIFA 1WTPA 2R92B 2LXKA 4IOAA 5ELOA 2F0EA 2NVQH 4IO9A 1ESRA 1EIFA 1X65A 4LAAA 4A3FB 4QF4A 1YNJC 3LGJA 1H9MA 1X3PA 2EE1A 1PRTF 3U4ZA 2CVRA 5IP7G 4A3FG 2N78A 3MXNA 1QCBD 1EOTA 3GTGH 4JI1Q 1DCZA 4ZLTF 1WTOA 1PFNA 2ATWA 1B50A 3AB9A 1HUMA 3H09A 3AFPA 4WJ3M 1R9TH 1J5EQ 4V190 2EJGC 2JN4A 3LNNA 2HDLA 4YY3L 1C48A 1VQPA 3D4WA 4ULLA 3TMEA 3CCJA 5TSSA 4LNQA 1PFSA 1XNRL 1DGSA 3BVZA 1PYSB 4FDBA 2PCFB 2WAQB 1DOLA 3U9OA 1ML0D 5JEAG 5M3FH 4OO1G 2CFMA 1PTOD 4KHPL 2JA7B 2O5IC 2PQEA 2N8NA 1X56A 2LXJA 3KBGA 4DK3C 1ASZA 1FJGL 4JI5Q 1DOMA 1X55A 3PO2B 1QE6A 4Y7NH 3K0XA 2ENBA 3AEVA 2K52A 1KDCA 5FKAC 1QNUA 3FKIB 1DONA 3Q24A 1STHA 4R4TA 5EBDA 3URYA 4X3TA 5C3EH 4JI0Q 2MJ8A 3IAYA 3NHHA 3HOVG 2O5JC 3PO2G 1W6KA 4A3LH 5FLMH 1VQHA 3UDFA 1Z9FA 3BZDB 5I9OA 2I5LX 2IPKD 5ELNA 1XMOL 2CWPA 2WAQE 1YBYA 2A68D 2WAQG 4JI3Q 4R8IA 1OXSC 2OTJA 5G3LF 2AWNA 4KHZA 3HOUG 3FRPB 3HOYB 4CJ2C 1YNND 1ZXTA 2FMCA 3J7ZC 1V1OA 3AU7A 3QWNA 2YV5A 4A3GH 3UE0A 3OWFA 4DR1L 1GD7A 4BY7G 3S1QB 3S14H 4DUZL 1G91A 1EUJA 2CW0D 2LFNA 4OEMB 2NVXB 5AFWA 2NVTB 1FL0A 3SK5A 2E2IB 1STNA 2OQ0A 2RVLA 1ICWA 1Q3LA 3CCMA 1K83H 1HXYD 2I0QA 1S5CD 4CKEA 4APVA 1AFPA 5M3FB 1KL9A 2WB1E 1Y1VH 4RCNA 1HZBA 3GTLH 1I4QA 4XDXA 1E2ZA 4EQ5A 3M7NA 1OXTA 4FVMA 1EL0A 1EY6A 4X3SA 4RHSA 2ZJQA 4DK1A 3TEHB 4OHJA 2OXPA 4HIOA 2EDGA 3PO2H 3FKIH 4IURA 3I72A 4ZUIA 3D4DA 2MFIA 1BNZA 1SJED 1PFBA 1QZHA 3W3AA 3PIO3 1H9JA 1V1PA 4GNXA 1RL2A 1LTRD 1LT6D 2I5MX 4ZKCB 1YJ9A 1VQAA 1E7ZA 4A3EH 2DJFC 5DM73 4DF7A 5C3WA 1RTNA 2XIWA 1VDZA 4HIDA 1EYDA 4IFDJ 3QOLA 5EAYA 2B29A 4JYAL 1PH2A 1EWIA 3F1ZA 3D4RA 3T56B 3UI2A 4K0KQ 1NE3A 4EX5A 5GAEC 3A8KE 3A74A 4R4QA 4DR5Q 4LF6Q 5JOBA 3UDGA 4A3GB 1V1QA 4NXMQ 5BR8Q 4F88A 4BY7B 2A6EC 1JR0D 5E3FA 5CV9A 5H1SE 2K50A 5EGTA 3J81c 3MXPA 2B2UC 3VA7A 3NBHA 4PMCA 5M5WB 3CRKC 1ZEQX 1IYJB 4FXKC 3PIP3 3NBHB 1C7YA 4HJ8A 3ULPA 2HIXA 1TY0A 1E24A 3KFUA 2F0IA 4F87A 2CH4W 4M8AA 1N33Q 2RA4A 4EQNA 1TWCB 3JAME 5JAVA 1NMFA 3Q8DA 1ICFB 2A1AA 3EQLC 2E2HH 1YHBA 1ESFA 4C3JG 1SYCA 4G7ZC 2IY5B 3TBIB 4IFDG 1EZ8A 4EQPA 3DWPA 1CSQA 5E4XA 5EPJA 2NN6I 2Z8LA 1HQRD 4P75A 1HR0Q 4P73A 1JE5A 1XX8A 1LUZA 3D6WA 2NZ1D 3ICEA 5J39A 3TP7A 3DWAA 1RCVD 3P20A 2JE6I 1T5EA 1IXRA 5C6AA 2SNMA 2EY2A 4PNYA 5LHY1 3CF5A 2WB1B 5FOBB 1BBWA 4O1NA 1JB7A 4DXFA 3V96A 4IPCA 2KUMA 4LFAL 1IW7D 1LACA 3ER0A 2VQFL 1VQLA 4HJ7A 1D1KA 1B9NA 1PDQA 1AH9A 4WJ4A 1A15A 2Y0SG 1IL8A 5IT9L 3KYHC 2PW7A 3OOCA 4L5SA 4KHVA 4OX9L 2EY1A 1U5KA 3R2IA 4OL7A 4JI8Q 1Z6HA 4MTKA 1KAAA 2PI2A 5C4XB 5LMUL 4HAEA 4PMBA 4DU9A 2F0UA 2EY5A 4GN4B 2LS01 2JA6B 2QDBA 2HCIA 3RLFA 5COYA 2X69A 1K8OA 1SJHD 2OWOA 4YIJA 4B3RL 1ASYA 4DUYL 1F9PA 2EYJA 1S5FD 4A3CH 1VQ6A 3S1NB 1KD1C 4X62L 3EVQA 4LFCQ 4UDUC 1LTLA 1TWCH 1X3QA 2ZXPA 2KBNA 1BCPF 3NQIA 3S1RH 1CKNA 2DY8A 5I9PA 2E2HB 2JA8B 4KY6A 5K5PA 1QUQB 2NVQB 1HTPA 1S5DD 2L55A 5FJ8H 3GTLB 1NTGA 4A3GG 2VL6A 1PTOB 3ND9A 5GQOA 4XQQA 1U4PA 1GUGA 1E0BA 2R6GA 1XPUA 4K8IA 4CBVA 5FLXE 5IOCA 1EFWA 2R7ZB 1TXYA 4UHVA 3T1HQ 5CV4A 5A35A 4FF2A 2F0JA 4CDFC 4ABNA 1EYAA 2GVAA 3S17H 2BDOA 4GS3A 4X3KA 1MI2A 1SE8A 4UAIA 4JI1L 1AE3A 1TS2A 1XWEA 1EIGA 4A3CG 4LF9L 4L63B 5C0XI 2EOTA 4JYAQ 4GKJQ 2AKWB 1F2LA 5BN4A 4QIWB 4C2MH 3N6RA 4QQBX 1EIYB 1Z47A 3CCLA 5EPKA 4IJHA 4BY1B 4XIGS 1STEA 4R8NA 1JJ2A 1E22A 1EWHA 1IYVA 1I94L 2CCZA 2JQOA 2G9DA 3KUPA 2A69D 2NTSA 4OIKA 4PZ7A 4TSSA 1TWAH 3A0JA 3KLSX 5FO8B 2JK8A 4FNFA 4XQNA 5FLXL 3RLOA 1R9TB 4JVZA 3HG9A 1F2YA 3GV3A 1F9QA 4JI8L 1VQDA 2AHOB 4DV0L 1U9RA 5ELFA 1B4OA 1RJTA 4DR6Q 3U58A 2NN6G 2K5WA 3A54A 2MO0A 1EQRA 3PUWA 1NUCA 1N36Q 2QEXA 1EIHA 4GLVB 1PLFA 3BDLA 3QO2A 4UP8A 3V2TA 3L3OC 4B3RQ 3MXNB 3CHBD 5IGCA 1IBML 3HOXH 4ZK9B 2B39A 1C4QA 3I73A 1G2SA 1ENFA 4ME3A 4GN5A 1TR5A 2EYMA 1KLGD 3SE0A 4DNIA 3KLSA 3QIAA 1GUWA 2XGTA 4HJAA 1VQ8A 2WACA 1G291 3K7AH 1D7QA 3EROA 3S24A 1J6QA 1D5XC 2DJGC 2UXDL 1RDPD 5A2QE 4A4IA 4GKJL 3J7AV 3A55A 4YCVA 1U4MA 2K75A 1NSNS 2Q2HA 2BA1A 2B63G 2K5HA 3ERSX 1NCVA 1I6HH 1NNXA 2F0NA 3FPPA 1M8AA 1G51A 4MTNA 4GN3B 4CJ1B 5DM63 3F2BA 2B2WA 4R4IA 3PUYA 3PIPA 1VQ5A 2KVMA 4KN4C 3LWEA 4U68A 1FNWA 2QCPX 3J81E 3A7LA 4Y52H 2F0LA 5CBEE 3J80E 2M2LA 3CCEA 1HH2P 3GTKH 3HOYH 4A93G 4C3JB 3K6OA 1SAPA 4FF4A 2Z0SA 4LWCA 5FJ8G 3CQZH 4A93B 5IGFA 4CKBA 2DY7A 4ME5A 3A5ZB 2AUKA 3T16A 2F0KA 2D0OA 3I70A 2HHHQ 3J81j 3S1QH 4JI2Q 4C1NK 1TS5A 1SYEA 1GVPA 3QJYA 3STBD 2EYFA 3DWQA 2E2IH 1UE5A 3SVMA 2JA6H 1GM5A 3WOFA 3S1MB 1H9SB 1Q8KA 1PH1A 3CPWA 5C5LA 2L11A 2IX3A 2RHSB 2E75C 1NBWA 2AWOA 4JOIA 3GO5A 4OXPA 5I2XA 5EKIA 1STAA 1PZID 4DV5Q 3SEBA 1Y1VG 1STGA 1E1TA 1D5MC 4IFDI 3OSOA 1VQMA 2L1BA 4DR2Q 3NXWA 3OTOQ 3CCRA 2KA7A 4NB3A 3T1HL 1RF2D 4IUTA 1KNAA 4LMQD 5K36H 3KJOA 3GTJH 4UY8C 4NDXA 1C8CA 3CXCA 1B3QA 1JICA 3RZDB 2EY6A 4K0KL 2QKIC 1UEAB 1BVSA 1B53A 1CKNB 1P8LA 4NXNQ 2BCOA 4FO2A 2Z9HA 1WI5A 3MXGA 1CKOA 1TVXA 2PQAB 2ZXOA 5IYCG 1FJGQ 3L9AX 5IP7H 3GTKB 3GTOH 4L5QA
chains in the Genus database with same CATH topology
1SFOH 2AWNA 4KHZA 4LUZA 1KXLA 3E9HA 3HOUG 1A62A 3J7ZC 4LFCL 2K5NA 1VQ9A 4J15A 3L0OA 2UU9L 2YV5A 4A3GH 2UXBL 3UE0A 2KCTA 2IHFA 4DR1L 1GD7A 4JC0A 2F4VL 4A3BH 3UDIA 4PZ6A 1K8AC 4YHHQ 3KJPA 3CC2A 4B3ML 3CD6A 4JOIC 3S14H 4BY7G 4OWTB 4DUZL 1EUJA 1L2FA 1KHIA 5M5WH 2BH2A 2KHIA 5JJKA 4LUVA 3S1MH 2EQSA 2A19A 1FL0A 3BZCA 4IOCA 1PH4A 2OQ0A 2L15A 3CCMA 1K83H 1XPRA 2I0QA 4DR4L 1UEBA 4APVA 4RMFA 3CCQA 1WJJA 3M4PA 1U0LA 1IBMQ 1IBKL 2E5LQ 5LMUQ 1B7YB 1KL9A 3HOYG 1A8VA 2WB1E 2QGQA 5FLXc 5C44G 1Y1VH 3HOVH 2XTIA 3K81C 4A75A 1HZBA 3GTLH 2R92H 1E1OA 1VQOA 3PO3H 1SROA 3D31A 4X64L 4EQ5A 3M7NA 1OXTA 4LF4L 1IBLL 4A3FH 1I3QH 2ZJQA 1X3GA 1Y1WH 3TEHB 3AQQA 4JI0L 2ALYB 4HIOA 1TWGH 2C35B 4B3TL 2Q2IA 4LFAQ 3FKIH 3HFZB 3PO2H 4GOPA 1FVIA 1RIPA 1Q86C 2ZTDA 1Y14B 1I50H 1PHJA 4BA2I 1SN8A 2MFIA 1W2BA 2Q2UA 1HNXQ 1QZHA 2UUAL 4GNXA 1SR3A 1K73C 1VCIA 1RL2A 4LF5L 3PCOB 4BBSG 1OXXK 2DGYA 4DV2Q 3RNUA 1VQ7A 4KHPQ 2I5MX 3FKIG 3CW2C 1WFQA 3S16H 1YJ9A 1VQAA 5JJIA 1E7ZA 4A3EH 5IWAQ 4A3IH 4PZ8A 4DV5L 1KQSA 2VQEQ 5IYDG 1I5FA 4HIDA 4IFDJ 4DR3L 2E2JH 4NXML 3M4QA 3H0GG 5EAYA 4DV6Q 3TRZA 3F8TA 2UXBQ 2B29A 4JYAL 2Z6KC 1PH2A 1EWIA 3F1ZA 2R7FA 3RN5A 1S72A 3OW2A 1LYLA 1UE6A 4K0KQ 5JJLA 1NE3A 1KAWA 2OQKA 3CC7A 4EX5A 1X9NA 1X3FA 5GAEC 5HGQA 3A74A 2JA7H 4UP9A 4R4QA 5C4JH 4DR5Q 4LF6Q 3UDGA 1Q81C 1Y1WG 5M3MH 1V1QA 1Q7YC 3J80i 4NXMQ 5BR8Q 2ASBA 2R7ZH 3U4VA 5H1SE 1IBKQ 4JI6L 2VUMH 4L5TA 4DR4Q 2K50A 3J81c 1JMCA 1TWHH 3CCSA 4A93H 2ZM6L 4POFA 5C44H 3CMAA 2GN5A 3K8AA 1N33L 3I4OA 1B8AA 2IX1A 5LMNL 1VQIA 3NELA 1WYDA 4LF6L 4BBSH 1VQJA 1V43A 1L1OC 4GKKL 3I55A 3CCVA 4NPSA 1VQNA 4AH6A 3G6EA 1C9OA 1IYJB 4X64Q 2F4VQ 2NVXH 3NBHB 1G6PA 1C7YA 4HJ8A 2A8VA 3ULPA 1AE2A 2HIXA 1PH8A 1E24A 3HOWG 1SLJA 2KCMA 1PYBA 3KFUA 2ZM6Q 1N33Q 1B70B 3RZDH 1OXVA 2LSSA 1EOVA 2R93G 4P74A 3NEMA 3HOXG 3EIVA 1NMFA 3Q8DA 2A1AA 4YY3Q 2UXCL 2JEAI 2E2HH 3OTOL 4X6AH 2B63H 1YHBA 3TS2A 3FP9A 2IY5B 1JT8A 1YJNA 2H5XA 4IFDG 2MQHA 2R93H 4YWMA 2JA5G 4MNOA 1CSQA 1L0WA 4GOPC 4P71A 3D0FA 5M5YH 2NN6I 2Q2TA 4DR3Q 2F52A 4P75A 1SRUA 5BR8L 1HR0Q 2AMCB 1JE5A 4P73A 1IZ6A 3J81i 4OX9Q 2BA0A 1LUZA 2FXQA 3NENA 5C4XH 3JAMc 3ICEA 3RN2A 3T1YQ 4X66L 5C0XG 1QZGA 2WB1G 5LMNQ 2JE6I 1HNZL 1Q82C 1X3EA 1IXRA 2RCNA 2YTYA 4A3JH 3J80c 1A63A 3CF5A 1HR0W 1NY4A 4P72A 1PH9A 2UXCQ 1S3OA 1BBWA 4DAYB 5C0XJ 3PUZA 1JB7A 2Z6KA 4JI6Q 2B3GA 3PO3G 4IPCA 4OWWB 3JC66 4LFAL 4GOPB 3K7UC 5IWAL 1M90C 4GLXA 2PMZE 2VW9A 3S1NH 1K3RA 4B3TQ 1O7IA 3ER0A 2VQFL 1VQLA 1YEZA 2YYZA 4HJ7A 4B3SL 3OYYA 4DR7Q 1AH9A 1GO3E 4O2DA 2Y0SG 4AQYL 4O0AA 4WJ3M 4WJ4A 3KYHC 4L5SA 1X54A 1TWFH 3W1BA 4OX9L 2HQLA 1HZCA 1U5KA 4QY7A 4JI8Q 3BJUA 3HOUH 3HKZG 3ZJYC 4MZ9A 4A3MG 1VQGA 2PI2A 1OTCA 4GNXC 1N32Q 5LMUL 4IPDA 2ES2A 3I7FA 1YHAA 4GN4B 1N34Q 2F3IA 3SGIA 5IYCH 3PF4A 4KLKA 2NZOA 5IY0A 2HT1A 2VQEL 3A5UA 4A3KH 4JI7Q 3E9IA 3RLFA 3PGZA 1NMGA 2JEBI 3G71A 4DR7L 1XTDA 4JI4Q 3KDFA 2OWOA 1HNWQ 4A3JG 2MNAA 4B3RL 3AFQA 1ASYA 4DUYL 1BBUA 4LF8Q 1GKHA 4A3LG 1YZ6A 4A3CH 1Q1BA 4JV5L 1VQ6A 1HNXL 2UUCL 4AYBG 1KD1C 4JBMA 4X62L 1HZAA 3PUXA 2D0PA 3W1GA 5GAHC 4LFCQ 1LTLA 1TWCH 2UU9Q 2KBNA 2UXDQ 3S1RH 4LUOA 1CKNA 1YITA 1BKBA 3PUVA 1YJWA 1XPOA 1VQBA 4QIWE 2QA4A 1QUQB 2YTVA 1UWVA 1XMQL 5FJ8H 4DV7L 4JCVE 3KDFB 1NTGA 3GDEA 1MJEA 4A3GG 2VL6A 4HJ9A 4A3MH 1L1OA 2IHEA 1W3SA 4POGA 4YWLA 4ALPA 5GQOA 3GTPH 4C3JH 1XMOQ 1QVGA 2R6GA 4DV3L 1XPUA 1EFWA 4DK6C 1EYGA 4R1JA 1TXYA 4JI5L 3T1HQ 1E3PA 2N3SA 3I2ZA 3VDYA 4DUYQ 2GVAA 3L2PA 5LMNW 4UPAA 4BY7H 1H95A 3S17H 4GS3A 4JI3L 1HJPA 3DLLA 4DV7Q 1M1KC 2IT1A 3S2DH 1SE8A 4JI2L 4A76A 5M3MG 1YIJA 4JI1L 1AE3A 1V9PA 1S40A 4LFBQ 4DAMA 1FGUA 4DV0Q 4DV6L 3GTQH 4A3CG 3H15A 1EQQA 2KENA 4DR1Q 5C0XI 1NJIC 4LF9L 3H3VH 4JYAQ 4GKJQ 2AKWB 3E0EA 4JI7L 2IX0A 5E7NA 2OTLA 1XNQQ 2UUCQ 3S15H 1T9HA 5JEAJ 4A3DH 4C2MH 3KF8B 1QVCA 3WWVA 1K8GA 4QQBX 1Q46A 4R4OA 1EIYB 1Z47A 3CCLA 1OXUA 1PV4A 4IJHA 1HZ9A 1UE1A 1K0RA 4GKKQ 4XIGS 3RZOH 4JBJA 2CQOA 5IYDH 3BZKA 4IPGA 2JA9A 2MO1A 1PH5A 3HOZH 1JJ2A 1YVCA 1E22A 4BXXH 2K14A 1I94L 3PIOA 2JQOA 4YHHL 2CCZA 2V1CC 4B3MQ 2JA8G 1XNQL 4QJFA 2VY3A 4PZ7A 4TQUS 2RF4A 1TWAH 2OCEA 5M5XH 3A0JA 4NXNL 4H02A 5AJ3L 2JK8A 3M85A 4X65Q 3PF5A 3HKSA 1N36L 3H3VI 2NZHA 1VQEA 4GLAC 3RLOA 2CWAA 5C3EG 5M3FG 4LF7L 4DR2L 4JI8L 3GTMH 1VQDA 2AHOB 3I4NG 4DV0L 2R7DA 4QL5A 3CPFA 4OWXB 1KRTA 5HY6A 3DM3A 1XMQQ 4DR6Q 4YCUA 4LF4Q 4LW1A 1X6OA 3M9BA 2VQFQ 3U58A 3BU2A 2GVBA 2NN6G 5GADC 3KOJA 4BBRH 1KC8C 2MO0A 2VZAA 1EQRA 3GD7A 4XTCS 4BY1G 1QVFA 3PUWA 4X65L 1N36Q 2HHHL 3ULLA 1SMXA 2QEXA 3CMEA 2UUAQ 4PMWA 4GLVB 4UP8A 4RG1A 2R92G 3M4OH 1MKHA 4B3RQ 3MXNB 5IYBG 1IBML 4A3DG 2D62A 2RHQB 3HOXH 4DV4L 1YI2A 4LF8L 2UUBL 1I94Q 5IP9H 3I4MH 4OO1I 4HJ5A 3JAMi 1HNWL 1J5EL 5IE8A 4ME3A 1VQ4A 3TQYA 4GN5A 3STBC 2JA8H 2VUMG 4QGUA 4DNIA 3TS0A 3EBEA 4KI0A 4DUZQ 1HNZQ 2XGTA 3HOZG 4HJAA 1VQ8A 1G291 3K7AH 3F2CA 3S2HH 1D7QA 3S24A 1J6QA 4DV1L 3KF6B 2UXDL 4OONA 1VQKA 4BBRG 4A4IA 1PH7A 1YNXA 4JBWA 4GKJL 2JA7G 4YCVA 4LFBL 3J7A5 2JA6G 2K75A 2Q2HA 5IT9c 4L5RC 4LF9Q 2BA1A 2E5LL 4X62Q 4HIMA 1MJCA 2NVYH 2B63G 1LM0A 2K5HA 3KLWA 3H0GH 3ERSX 2ZJRA 4AQYQ 4JV5Q 5C4XG 3HKZE 2WP8J 1P16A 1I6HH 2EIFA 2PI2E 1VQCA 2EXDA 3B6YA 4LF7Q 4DR5L 3RR5A 1C0AA 4JBKA 3I56A 1D8LA 4JG2A 1YHQA 2WFWA 1N8RC 4IJLA 4DV4Q 1G51A 4MTNA 4GN3B 3L7ZC 1KRSA 3HOWH 1N34L 1PVOA 1N9WA 1XNRQ 4C3HH 4PG3A 2JA5H 3F2BA 3UE1A 5IP9G 2K5VA 4R4IA 3I4MG 3PUYA 3PIPA 2ZTCA 1VQ5A 1JJCB 2I5HA 4TVAB 5IYBH 2LXKA 1PH6A 3KF6A 4IOAA 5ELOA 3W5OA 2NVQH 4IO9A 4UP7A 4HIKA 1EIFA 2K4KA 4DKAC 1X65A 4Y52H 3GTKH 3CCUA 3CCEA 1VQFA 1HH2P 3HOYH 4A93G 4R4CA 3LGJA 3T1YL 4A3IG 1IL2A 2PNHA 1Q1EA 2E8GA 2Z0SA 4LWCA 3U4ZA 5FJ8G 4A3EG 3CQZH 4A3FG 5IP7G 2YTXA 2N78A 4B3SQ 2R7ZG 4C3IH 3A5ZB 1A0IA 3ULJA 3GTGH 4JI1Q 2D0OA 2HHHQ 2ATWA 3J81j 3S1QH 4JI2Q 1L1OB 1PA6A 1GVPA 1UE7A 3AFPA 3STBD 4AIMA 5GAGC 1R9TH 1MIUA 4JI4L 1PH3A 1CUKA 2VNUD 3RLNA 1J5EQ 2E2IH 1QUQA 2N49A 1UE5A 3CC4A 2JA6H 1GM5A 1Q8KA 2ID0A 1CKMA 1PH1A 3AYHB 3CPWA 3IRBA 4YY3L 4GNXB 1VQPA 2RHSB 4DV3Q 1NBWA 1K9MC 2Y0SE 4DPGA 2AWOA 4JOIA 4L5QA 3GO5A 4OXPA 3CCJA 1N32L 1KIXA 4LNQA 3TREA 1PFSA 2VS1A 3FHWA 1XNRL 3G48A 1DGSA 4DV5Q 1PYSB 1Y1VG 2KHJA 4FDBA 1E1TA 4IFDI 3MEFA 2YU9H 5JEAG 5M3FH 3I4NH 3PSIA 1VQMA 4OO1G 3M3YH 1CSPA 2CFMA 1WOCA 4DR2Q 4LF5Q 3OTOQ 2PQAA 2HIVA 4DV2L 5J3BA 4KHPL 2N8NA 1X56A 2LXJA 4DK3C 3CCRA 1ASZA 4NB3A 4YCWA 2UUBQ 1FJGL 3T1HL 4JI5Q 4BY1H 5GROA 1X55A 3UDXA 4BXXG 1XJVA 4Y7NH 3K0XA 3AEVA 2K52A 1WCMH 4A3BG 3KJOA 3GTJH 4UY8C 2BH8A 3CAMA 4A3KG 2ZTEA 3G4SA 1IBLQ 4R4TA 3CXCA 5C3EH 1VS0A 3CP0A 4JI0Q 4IPHA 3HOVG 4K0KL 4X66Q 5FLMG 2ZJPA 3PO2G 4A3LH 4YWKA 1Q12A 1BVSA 5FLMH 1VQHA 3UDFA 1Z9FA 3U50C 2DUDA 1CKNB 1P8LA 2NVTH 2I5LX 4BA1I 5AJ3Q 4NXNQ 3K80C 1HR0L 5ELNA 4DV1Q 1WI5A 1XMOL 2CWPA 1CKOA 2WAQE 3EN2A 2PQAB 5DLQE 1YBYA 5IYCG 1FJGQ 2CKZB 5K36G 4AYBE 2WAQG 1WCMG 1JJGA 2JJQA 4JI3Q 5IP7H 3F2DA 3PV0A 3GTOH 4DR6L 1OXSC 2OTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFO H;  2AWN A;  4KHZ A;  4LUZ A;  1KXL A;  3E9H A;  3HOU G;  1A62 A;  3J7Z C;  4LFC L;  2K5N A;  1VQ9 A;  4J15 A;  3L0O A;  2UU9 L;  2YV5 A;  4A3G H;  2UXB L;  3UE0 A;  2KCT A;  2IHF A;  4DR1 L;  1GD7 A;  4JC0 A;  2F4V L;  4A3B H;  3UDI A;  4PZ6 A;  1K8A C;  4YHH Q;  3KJP A;  3CC2 A;  4B3M L;  3CD6 A;  4JOI C;  3S14 H;  4BY7 G;  4OWT B;  4DUZ L;  1EUJ A;  1L2F A;  1KHI A;  5M5W H;  2BH2 A;  2KHI A;  5JJK A;  4LUV A;  3S1M H;  2EQS A;  2A19 A;  1FL0 A;  3BZC A;  4IOC A;  1PH4 A;  2OQ0 A;  2L15 A;  3CCM A;  1K83 H;  1XPR A;  2I0Q A;  4DR4 L;  1UEB A;  4APV A;  4RMF A;  3CCQ A;  1WJJ A;  3M4P A;  1U0L A;  1IBM Q;  1IBK L;  2E5L Q;  5LMU Q;  1B7Y B;  1KL9 A;  3HOY G;  1A8V A;  2WB1 E;  2QGQ A;  5FLX c;  5C44 G;  1Y1V H;  3HOV H;  2XTI A;  3K81 C;  4A75 A;  1HZB A;  3GTL H;  2R92 H;  1E1O A;  1VQO A;  3PO3 H;  1SRO A;  3D31 A;  4X64 L;  4EQ5 A;  3M7N A;  1OXT A;  4LF4 L;  1IBL L;  4A3F H;  1I3Q H;  2ZJQ A;  1X3G A;  1Y1W H;  3TEH B;  3AQQ A;  4JI0 L;  2ALY B;  4HIO A;  1TWG H;  2C35 B;  4B3T L;  2Q2I A;  4LFA Q;  3FKI H;  3HFZ B;  3PO2 H;  4GOP A;  1FVI A;  1RIP A;  1Q86 C;  2ZTD A;  1Y14 B;  1I50 H;  1PHJ A;  4BA2 I;  1SN8 A;  2MFI A;  1W2B A;  2Q2U A;  1HNX Q;  1QZH A;  2UUA L;  4GNX A;  1SR3 A;  1K73 C;  1VCI A;  1RL2 A;  4LF5 L;  3PCO B;  4BBS G;  1OXX K;  2DGY A;  4DV2 Q;  3RNU A;  1VQ7 A;  4KHP Q;  2I5M X;  3FKI G;  3CW2 C;  1WFQ A;  3S16 H;  1YJ9 A;  1VQA A;  5JJI A;  1E7Z A;  4A3E H;  5IWA Q;  4A3I H;  4PZ8 A;  4DV5 L;  1KQS A;  2VQE Q;  5IYD G;  1I5F A;  4HID A;  4IFD J;  4DR3 L;  2E2J H;  4NXM L;  3M4Q A;  3H0G G;  5EAY A;  4DV6 Q;  3TRZ A;  3F8T A;  2UXB Q;  2B29 A;  4JYA L;  2Z6K C;  1PH2 A;  1EWI A;  3F1Z A;  2R7F A;  3RN5 A;  1S72 A;  3OW2 A;  1LYL A;  1UE6 A;  4K0K Q;  5JJL A;  1NE3 A;  1KAW A;  2OQK A;  3CC7 A;  4EX5 A;  1X9N A;  1X3F A;  5GAE C;  5HGQ A;  3A74 A;  2JA7 H;  4UP9 A;  4R4Q A;  5C4J H;  4DR5 Q;  4LF6 Q;  3UDG A;  1Q81 C;  1Y1W G;  5M3M H;  1V1Q A;  1Q7Y C;  3J80 i;  4NXM Q;  5BR8 Q;  2ASB A;  2R7Z H;  3U4V A;  5H1S E;  1IBK Q;  4JI6 L;  2VUM H;  4L5T A;  4DR4 Q;  2K50 A;  3J81 c;  1JMC A;  1TWH H;  3CCS A;  4A93 H;  2ZM6 L;  4POF A;  5C44 H;  3CMA A;  2GN5 A;  3K8A A;  1N33 L;  3I4O A;  1B8A A;  2IX1 A;  5LMN L;  1VQI A;  3NEL A;  1WYD A;  4LF6 L;  4BBS H;  1VQJ A;  1V43 A;  1L1O C;  4GKK L;  3I55 A;  3CCV A;  4NPS A;  1VQN A;  4AH6 A;  3G6E A;  1C9O A;  1IYJ B;  4X64 Q;  2F4V Q;  2NVX H;  3NBH B;  1G6P A;  1C7Y A;  4HJ8 A;  2A8V A;  3ULP A;  1AE2 A;  2HIX A;  1PH8 A;  1E24 A;  3HOW G;  1SLJ A;  2KCM A;  1PYB A;  3KFU A;  2ZM6 Q;  1N33 Q;  1B70 B;  3RZD H;  1OXV A;  2LSS A;  1EOV A;  2R93 G;  4P74 A;  3NEM A;  3HOX G;  3EIV A;  1NMF A;  3Q8D A;  2A1A A;  4YY3 Q;  2UXC L;  2JEA I;  2E2H H;  3OTO L;  4X6A H;  2B63 H;  1YHB A;  3TS2 A;  3FP9 A;  2IY5 B;  1JT8 A;  1YJN A;  2H5X A;  4IFD G;  2MQH A;  2R93 H;  4YWM A;  2JA5 G;  4MNO A;  1CSQ A;  1L0W A;  4GOP C;  4P71 A;  3D0F A;  5M5Y H;  2NN6 I;  2Q2T A;  4DR3 Q;  2F52 A;  4P75 A;  1SRU A;  5BR8 L;  1HR0 Q;  2AMC B;  1JE5 A;  4P73 A;  1IZ6 A;  3J81 i;  4OX9 Q;  2BA0 A;  1LUZ A;  2FXQ A;  3NEN A;  5C4X H;  3JAM c;  3ICE A;  3RN2 A;  3T1Y Q;  4X66 L;  5C0X G;  1QZG A;  2WB1 G;  5LMN Q;  2JE6 I;  1HNZ L;  1Q82 C;  1X3E A;  1IXR A;  2RCN A;  2YTY A;  4A3J H;  3J80 c;  1A63 A;  3CF5 A;  1HR0 W;  1NY4 A;  4P72 A;  1PH9 A;  2UXC Q;  1S3O A;  1BBW A;  4DAY B;  5C0X J;  3PUZ A;  1JB7 A;  2Z6K A;  4JI6 Q;  2B3G A;  3PO3 G;  4IPC A;  4OWW B;  3JC6 6;  4LFA L;  4GOP B;  3K7U C;  5IWA L;  1M90 C;  4GLX A;  2PMZ E;  2VW9 A;  3S1N H;  1K3R A;  4B3T Q;  1O7I A;  3ER0 A;  2VQF L;  1VQL A;  1YEZ A;  2YYZ A;  4HJ7 A;  4B3S L;  3OYY A;  4DR7 Q;  1AH9 A;  1GO3 E;  4O2D A;  2Y0S G;  4AQY L;  4O0A A;  4WJ3 M;  4WJ4 A;  3KYH C;  4L5S A;  1X54 A;  1TWF H;  3W1B A;  4OX9 L;  2HQL A;  1HZC A;  1U5K A;  4QY7 A;  4JI8 Q;  3BJU A;  3HOU H;  3HKZ G;  3ZJY C;  4MZ9 A;  4A3M G;  1VQG A;  2PI2 A;  1OTC A;  4GNX C;  1N32 Q;  5LMU L;  4IPD A;  2ES2 A;  3I7F A;  1YHA A;  4GN4 B;  1N34 Q;  2F3I A;  3SGI A;  5IYC H;  3PF4 A;  4KLK A;  2NZO A;  5IY0 A;  2HT1 A;  2VQE L;  3A5U A;  4A3K H;  4JI7 Q;  3E9I A;  3RLF A;  3PGZ A;  1NMG A;  2JEB I;  3G71 A;  4DR7 L;  1XTD A;  4JI4 Q;  3KDF A;  2OWO A;  1HNW Q;  4A3J G;  2MNA A;  4B3R L;  3AFQ A;  1ASY A;  4DUY L;  1BBU A;  4LF8 Q;  1GKH A;  4A3L G;  1YZ6 A;  4A3C H;  1Q1B A;  4JV5 L;  1VQ6 A;  1HNX L;  2UUC L;  4AYB G;  1KD1 C;  4JBM A;  4X62 L;  1HZA A;  3PUX A;  2D0P A;  3W1G A;  5GAH C;  4LFC Q;  1LTL A;  1TWC H;  2UU9 Q;  2KBN A;  2UXD Q;  3S1R H;  4LUO A;  1CKN A;  1YIT A;  1BKB A;  3PUV A;  1YJW A;  1XPO A;  1VQB A;  4QIW E;  2QA4 A;  1QUQ B;  2YTV A;  1UWV A;  1XMQ L;  5FJ8 H;  4DV7 L;  4JCV E;  3KDF B;  1NTG A;  3GDE A;  1MJE A;  4A3G G;  2VL6 A;  4HJ9 A;  4A3M H;  1L1O A;  2IHE A;  1W3S A;  4POG A;  4YWL A;  4ALP A;  5GQO A;  3GTP H;  4C3J H;  1XMO Q;  1QVG A;  2R6G A;  4DV3 L;  1XPU A;  1EFW A;  4DK6 C;  1EYG A;  4R1J A;  1TXY A;  4JI5 L;  3T1H Q;  1E3P A;  2N3S A;  3I2Z A;  3VDY A;  4DUY Q;  2GVA A;  3L2P A;  5LMN W;  4UPA A;  4BY7 H;  1H95 A;  3S17 H;  4GS3 A;  4JI3 L;  1HJP A;  3DLL A;  4DV7 Q;  1M1K C;  2IT1 A;  3S2D H;  1SE8 A;  4JI2 L;  4A76 A;  5M3M G;  1YIJ A;  4JI1 L;  1AE3 A;  1V9P A;  1S40 A;  4LFB Q;  4DAM A;  1FGU A;  4DV0 Q;  4DV6 L;  3GTQ H;  4A3C G;  3H15 A;  1EQQ A;  2KEN A;  4DR1 Q;  5C0X I;  1NJI C;  4LF9 L;  3H3V H;  4JYA Q;  4GKJ Q;  2AKW B;  3E0E A;  4JI7 L;  2IX0 A;  5E7N A;  2OTL A;  1XNQ Q;  2UUC Q;  3S15 H;  1T9H A;  5JEA J;  4A3D H;  4C2M H;  3KF8 B;  1QVC A;  3WWV A;  1K8G A;  4QQB X;  1Q46 A;  4R4O A;  1EIY B;  1Z47 A;  3CCL A;  1OXU A;  1PV4 A;  4IJH A;  1HZ9 A;  1UE1 A;  1K0R A;  4GKK Q;  4XIG S;  3RZO H;  4JBJ A;  2CQO A;  5IYD H;  3BZK A;  4IPG A;  2JA9 A;  2MO1 A;  1PH5 A;  3HOZ H;  1JJ2 A;  1YVC A;  1E22 A;  4BXX H;  2K14 A;  1I94 L;  3PIO A;  2JQO A;  4YHH L;  2CCZ A;  2V1C C;  4B3M Q;  2JA8 G;  1XNQ L;  4QJF A;  2VY3 A;  4PZ7 A;  4TQU S;  2RF4 A;  1TWA H;  2OCE A;  5M5X H;  3A0J A;  4NXN L;  4H02 A;  5AJ3 L;  2JK8 A;  3M85 A;  4X65 Q;  3PF5 A;  3HKS A;  1N36 L;  3H3V I;  2NZH A;  1VQE A;  4GLA C;  3RLO A;  2CWA A;  5C3E G;  5M3F G;  4LF7 L;  4DR2 L;  4JI8 L;  3GTM H;  1VQD A;  2AHO B;  3I4N G;  4DV0 L;  2R7D A;  4QL5 A;  3CPF A;  4OWX B;  1KRT A;  5HY6 A;  3DM3 A;  1XMQ Q;  4DR6 Q;  4YCU A;  4LF4 Q;  4LW1 A;  1X6O A;  3M9B A;  2VQF Q;  3U58 A;  3BU2 A;  2GVB A;  2NN6 G;  5GAD C;  3KOJ A;  4BBR H;  1KC8 C;  2MO0 A;  2VZA A;  1EQR A;  3GD7 A;  4XTC S;  4BY1 G;  1QVF A;  3PUW A;  4X65 L;  1N36 Q;  2HHH L;  3ULL A;  1SMX A;  2QEX A;  3CME A;  2UUA Q;  4PMW A;  4GLV B;  4UP8 A;  4RG1 A;  2R92 G;  3M4O H;  1MKH A;  4B3R Q;  3MXN B;  5IYB G;  1IBM L;  4A3D G;  2D62 A;  2RHQ B;  3HOX H;  4DV4 L;  1YI2 A;  4LF8 L;  2UUB L;  1I94 Q;  5IP9 H;  3I4M H;  4OO1 I;  4HJ5 A;  3JAM i;  1HNW L;  1J5E L;  5IE8 A;  4ME3 A;  1VQ4 A;  3TQY A;  4GN5 A;  3STB C;  2JA8 H;  2VUM G;  4QGU A;  4DNI A;  3TS0 A;  3EBE A;  4KI0 A;  4DUZ Q;  1HNZ Q;  2XGT A;  3HOZ G;  4HJA A;  1VQ8 A;  1G29 1;  3K7A H;  3F2C A;  3S2H H;  1D7Q A;  3S24 A;  1J6Q A;  4DV1 L;  3KF6 B;  2UXD L;  4OON A;  1VQK A;  4BBR G;  4A4I A;  1PH7 A;  1YNX A;  4JBW A;  4GKJ L;  2JA7 G;  4YCV A;  4LFB L;  3J7A 5;  2JA6 G;  2K75 A;  2Q2H A;  5IT9 c;  4L5R C;  4LF9 Q;  2BA1 A;  2E5L L;  4X62 Q;  4HIM A;  1MJC A;  2NVY H;  2B63 G;  1LM0 A;  2K5H A;  3KLW A;  3H0G H;  3ERS X;  2ZJR A;  4AQY Q;  4JV5 Q;  5C4X G;  3HKZ E;  2WP8 J;  1P16 A;  1I6H H;  2EIF A;  2PI2 E;  1VQC A;  2EXD A;  3B6Y A;  4LF7 Q;  4DR5 L;  3RR5 A;  1C0A A;  4JBK A;  3I56 A;  1D8L A;  4JG2 A;  1YHQ A;  2WFW A;  1N8R C;  4IJL A;  4DV4 Q;  1G51 A;  4MTN A;  4GN3 B;  3L7Z C;  1KRS A;  3HOW H;  1N34 L;  1PVO A;  1N9W A;  1XNR Q;  4C3H H;  4PG3 A;  2JA5 H;  3F2B A;  3UE1 A;  5IP9 G;  2K5V A;  4R4I A;  3I4M G;  3PUY A;  3PIP A;  2ZTC A;  1VQ5 A;  1JJC B;  2I5H A;  4TVA B;  5IYB H;  2LXK A;  1PH6 A;  3KF6 A;  4IOA A;  5ELO A;  3W5O A;  2NVQ H;  4IO9 A;  4UP7 A;  4HIK A;  1EIF A;  2K4K A;  4DKA C;  1X65 A;  4Y52 H;  3GTK H;  3CCU A;  3CCE A;  1VQF A;  1HH2 P;  3HOY H;  4A93 G;  4R4C A;  3LGJ A;  3T1Y L;  4A3I G;  1IL2 A;  2PNH A;  1Q1E A;  2E8G A;  2Z0S A;  4LWC A;  3U4Z A;  5FJ8 G;  4A3E G;  3CQZ H;  4A3F G;  5IP7 G;  2YTX A;  2N78 A;  4B3S Q;  2R7Z G;  4C3I H;  3A5Z B;  1A0I A;  3ULJ A;  3GTG H;  4JI1 Q;  2D0O A;  2HHH Q;  2ATW A;  3J81 j;  3S1Q H;  4JI2 Q;  1L1O B;  1PA6 A;  1GVP A;  1UE7 A;  3AFP A;  3STB D;  4AIM A;  5GAG C;  1R9T H;  1MIU A;  4JI4 L;  1PH3 A;  1CUK A;  2VNU D;  3RLN A;  1J5E Q;  2E2I H;  1QUQ A;  2N49 A;  1UE5 A;  3CC4 A;  2JA6 H;  1GM5 A;  1Q8K A;  2ID0 A;  1CKM A;  1PH1 A;  3AYH B;  3CPW A;  3IRB A;  4YY3 L;  4GNX B;  1VQP A;  2RHS B;  4DV3 Q;  1NBW A;  1K9M C;  2Y0S E;  4DPG A;  2AWO A;  4JOI A;  4L5Q A;  3GO5 A;  4OXP A;  3CCJ A;  1N32 L;  1KIX A;  4LNQ A;  3TRE A;  1PFS A;  2VS1 A;  3FHW A;  1XNR L;  3G48 A;  1DGS A;  4DV5 Q;  1PYS B;  1Y1V G;  2KHJ A;  4FDB A;  1E1T A;  4IFD I;  3MEF A;  2YU9 H;  5JEA G;  5M3F H;  3I4N H;  3PSI A;  1VQM A;  4OO1 G;  3M3Y H;  1CSP A;  2CFM A;  1WOC A;  4DR2 Q;  4LF5 Q;  3OTO Q;  2PQA A;  2HIV A;  4DV2 L;  5J3B A;  4KHP L;  2N8N A;  1X56 A;  2LXJ A;  4DK3 C;  3CCR A;  1ASZ A;  4NB3 A;  4YCW A;  2UUB Q;  1FJG L;  3T1H L;  4JI5 Q;  4BY1 H;  5GRO A;  1X55 A;  3UDX A;  4BXX G;  1XJV A;  4Y7N H;  3K0X A;  3AEV A;  2K52 A;  1WCM H;  4A3B G;  3KJO A;  3GTJ H;  4UY8 C;  2BH8 A;  3CAM A;  4A3K G;  2ZTE A;  3G4S A;  1IBL Q;  4R4T A;  3CXC A;  5C3E H;  1VS0 A;  3CP0 A;  4JI0 Q;  4IPH A;  3HOV G;  4K0K L;  4X66 Q;  5FLM G;  2ZJP A;  3PO2 G;  4A3L H;  4YWK A;  1Q12 A;  1BVS A;  5FLM H;  1VQH A;  3UDF A;  1Z9F A;  3U50 C;  2DUD A;  1CKN B;  1P8L A;  2NVT H;  2I5L X;  4BA1 I;  5AJ3 Q;  4NXN Q;  3K80 C;  1HR0 L;  5ELN A;  4DV1 Q;  1WI5 A;  1XMO L;  2CWP A;  1CKO A;  2WAQ E;  3EN2 A;  2PQA B;  5DLQ E;  1YBY A;  5IYC G;  1FJG Q;  2CKZ B;  5K36 G;  4AYB E;  2WAQ G;  1WCM G;  1JJG A;  2JJQ A;  4JI3 Q;  5IP7 H;  3F2D A;  3PV0 A;  3GTO H;  4DR6 L;  1OXS C;  2OTJ A; 
#chains in the Genus database with same CATH topology
 3C46 A;  3I4M B;  2MP1 A;  2F0V A;  5CV8 A;  1VQ9 A;  2UU9 L;  2UXB L;  3H3V C;  2B2Y A;  2KCT A;  1TWH B;  2F0M A;  4JC0 A;  4JOI C;  3ZYY X;  1KHI A;  5M5W H;  4QB4 A;  1MHW C;  3S1M H;  3BZC A;  1PH4 A;  4IUP A;  1K8M A;  3TZU A;  3CCQ A;  3M4P A;  5DNF A;  1L0Y B;  1U0L A;  1IBK L;  1IBM Q;  1RKN A;  1SXT A;  1B7Y B;  2QIL A;  3HOY G;  1A8V A;  5KNC A;  5FLX c;  3HOV H;  4ODG A;  4N8F A;  3IFD A;  4XT1 B;  1B9M A;  1KAB A;  1IBL L;  1MGS A;  3NWS A;  3BVG A;  5C4H A;  3DMU A;  4RFB A;  2Q8T A;  5HUR A;  3QG1 A;  2C35 B;  2F0H A;  4LFA Q;  3BYT B;  1Q86 C;  1Y14 B;  2K04 A;  2N55 A;  2RSO A;  1HNX Q;  3GTJ B;  1A6X A;  1SR3 A;  2IL8 A;  2PW5 A;  3G6J B;  3PCO B;  4CHT B;  1OXX K;  2DGY A;  4FYD A;  3H6M A;  4DV2 Q;  3RNU A;  3CW2 C;  1WFQ A;  3S16 H;  3CU7 A;  4WOR A;  2RBM A;  3JAM L;  1UAP A;  3T51 B;  2VQE Q;  5IYD G;  1I5F A;  3VYS A;  4DK0 A;  2E2J H;  2DN8 A;  4DV6 Q;  3TRZ A;  2UXB Q;  2MUY A;  1WTH A;  3F8T A;  3R93 A;  1UE6 A;  5FO7 B;  2PZU A;  5HGT A;  3WOE A;  2OQK A;  4K5W A;  3CC7 A;  1Q81 C;  1L0X B;  2D9U A;  4DAV A;  1IBK Q;  3T13 A;  1KNE A;  4DR4 Q;  2A69 C;  1FGB D;  1TWH H;  3J7Y W;  3CCS A;  4A93 H;  2ZM6 L;  1WVL A;  2I07 B;  1B8A A;  4K6D A;  2EJF C;  5LMN L;  4B9X A;  3VR4 A;  5JPN C;  3C3L A;  2AUJ D;  3CCV A;  4NPS A;  1VQN A;  4AH6 A;  1QNK A;  1C9O A;  3VYU A;  3KF8 A;  4X64 Q;  1PRT C;  3BG3 A;  2A8V A;  2F3V A;  1PH8 A;  3K58 A;  3HOW G;  1SLJ A;  2KCM A;  1PYB A;  1D2B A;  4A3J B;  2R93 G;  1OXV A;  2LSS A;  3NQT A;  4O42 A;  1KTK A;  3NEM A;  3HOX G;  5ISR A;  1TS4 A;  5KYL A;  4KKT A;  4YY3 Q;  2UXC L;  2JEA I;  4MN3 A;  4ZQ3 A;  3OTO L;  3FP9 A;  5D65 A;  2A74 C;  1JT8 A;  3HP3 A;  1YJN A;  2MQH A;  1F77 A;  2XRS D;  1L0W A;  4P71 A;  4XXE A;  1STY A;  1DXM A;  1SRU A;  5BR8 L;  3S16 B;  2SEB D;  2H4O A;  4TKO B;  4CJ0 B;  3T1Y Q;  3FDT A;  2A68 C;  3OIQ A;  2A6H C;  2E2J B;  2RCN A;  1A63 A;  3J80 c;  3M4O B;  1HR0 W;  1NY4 A;  1PH9 A;  1S3O A;  3P75 A;  4H13 C;  4EQO A;  3PUZ A;  3K59 A;  3PO3 G;  4GOP B;  2VW9 A;  2TSS A;  4B3T Q;  4B3S L;  1YEZ A;  4DR7 Q;  2MPM A;  1GO3 E;  5EKL A;  2HQL A;  4ID6 A;  4QY7 A;  4G57 A;  1NAP A;  3MZ5 A;  4MZ9 A;  4A3M G;  1OTC A;  3I90 A;  1N32 Q;  4GNX C;  1YHA A;  3PF4 A;  4KLK A;  5IY0 A;  1JOQ A;  4TRD A;  2CW0 C;  4A3K H;  3HOW B;  4ZAI A;  3G71 A;  1VF5 C;  1XTD A;  4JI4 Q;  3KDF A;  1MBY A;  2K01 A;  2A73 B;  4A3L G;  4JV5 L;  3S2D B;  4AYB G;  1CFM A;  3PUX A;  4DAY A;  3W1G A;  4S3S A;  1NR2 A;  2UXD Q;  5FK9 C;  3T53 B;  2RKS A;  4DFA A;  1EY4 A;  5BN5 A;  1YIT A;  1XPO A;  1H9K A;  1VQB A;  3PMF A;  4HCS A;  1XMQ L;  4A3D B;  1YNN C;  1AZP A;  3KDF B;  2B63 B;  1JOO A;  4YWL A;  2B2W C;  3KK7 A;  4C3J H;  2MHV A;  4DV3 L;  4XYQ A;  3R8B A;  4R1J A;  1DM0 B;  2N3S A;  4DUY Q;  3D3R A;  4UPA A;  2WII B;  1I6H B;  4BY7 H;  1H95 A;  1TU2 B;  1EU4 A;  1BCP D;  1HJP A;  3R2T A;  4QUC A;  2IT1 A;  1KDA A;  5M3M G;  5CMD A;  1S40 A;  3S1R B;  3KLR A;  4DV6 L;  2KEN A;  2JA5 B;  3E0E A;  2IX0 A;  2TMP A;  1BF4 A;  5JEA J;  3M4Y A;  1BR9 A;  2J4X A;  1K8G A;  1LT5 D;  1PV4 A;  2DNC A;  3RZO H;  1EFI D;  4C3I G;  3BZK A;  4IPG A;  2MO1 A;  1PH5 A;  4G4K A;  2F0Q A;  1R4Q B;  2FIN B;  5DAU A;  3PIO A;  3E0J A;  4YHH L;  4B3M Q;  2JA8 G;  1XNQ L;  4QJF A;  2VY3 A;  1B3A A;  2M9V A;  4TQU S;  2RF4 A;  2KJX A;  5AJ3 L;  3H3V I;  2EXZ A;  4X65 Q;  3PF5 A;  2EVB A;  2EZV A;  4IZ8 A;  2CWA A;  4EVO A;  3SK6 A;  4DR2 L;  3MWY W;  2R7D A;  4QL5 A;  1D5Z C;  2F0G A;  5D3D A;  1KRT A;  4FF1 A;  5HY6 A;  3SDZ A;  3DM3 A;  1XMQ Q;  1AP0 A;  4LF4 Q;  1K0S A;  1LTT D;  5GAD C;  3KOJ A;  4BY1 G;  3FVQ A;  1FNV A;  2HHH L;  1AN8 A;  1SMX A;  3BDO A;  1QJO A;  3DUZ A;  4H0L C;  1MKH A;  5IYB G;  2D62 A;  2RHQ B;  2UUB L;  1I94 Q;  5IP9 H;  3TSS A;  4HJ5 A;  1HNW L;  1EY8 A;  1VQ4 A;  1LTS D;  4OGQ C;  2HCC A;  3H94 A;  3TS0 A;  4DUZ Q;  2B2V C;  1KDB A;  5KND A;  3S2H H;  1TKW B;  3KF6 B;  5CBA E;  4FP5 D;  4OON A;  1VQK A;  3OMG A;  4RH6 A;  5T1I A;  1E2W A;  1PH7 A;  1YNX A;  2I46 A;  4JBW A;  1D1I A;  3J7A 5;  1HA6 A;  1SE2 A;  1WCM B;  4HIM A;  1MJC A;  1LM0 A;  3A8J E;  3KLW A;  3H0G H;  2ZJR A;  4AQY Q;  1IW7 C;  1P16 A;  1S4Z A;  4B9W A;  1VQC A;  2EIF A;  2PI2 E;  5IGG A;  4GZY C;  4JBK A;  2F0P A;  3I56 A;  1AW7 A;  3RMH A;  4XQJ A;  3L7Z C;  1KRS A;  1N34 L;  1PVO A;  2JA5 H;  3Q6S A;  1LT3 D;  1EY9 A;  4IUV A;  3I4M G;  1JWU D;  2RSN A;  1CTM A;  4IUQ A;  2ZTC A;  3FMC A;  5I4D A;  5IYB H;  1PH6 A;  1RHP A;  3W5O A;  1RD9 D;  4UP7 A;  1Y8P B;  2FJ2 A;  3CCU A;  1VQF A;  1HFN A;  4R4C A;  3T1Y L;  1BCP C;  3E3X A;  4A3E G;  2WKC A;  1EEF D;  1A0I A;  3ULJ A;  3HGB A;  4NW2 A;  1X32 A;  3TDQ A;  2QDL A;  1PA6 A;  4AIM A;  4JI4 L;  2VNU D;  1PH3 A;  1CUK A;  2X6L A;  2O4X A;  3HRZ C;  1QUQ A;  2N49 A;  3CC4 A;  4RWS C;  3P7J A;  2ICI A;  3NBI A;  1RTO A;  2ID0 A;  3C1F A;  2XRQ D;  1B2T A;  3NTI A;  3LWU A;  2Z4I A;  3VA5 A;  1QWY A;  2Y0S E;  1K9M C;  2JXM B;  4V0B A;  2NN6 H;  4FXD A;  2KHJ A;  1K3B C;  3IL8 A;  1Y69 U;  5D14 A;  1ILP A;  2YU9 H;  1IHZ A;  1CSP A;  3M3Y H;  1WOC A;  4F8M A;  5KNB A;  4C2M B;  2XWB B;  3I8Z A;  4DV2 L;  3K57 A;  1G6Z A;  2UUB Q;  1ILQ A;  2B8F A;  5CV6 A;  3DEO A;  5GRO A;  4BY1 H;  3UDX A;  4BXX G;  1XJV A;  1S5E D;  5BN3 A;  2NUC A;  2XVS A;  5IGD A;  1WCM H;  3GQB A;  1F2Z A;  3MC0 B;  5T1G A;  1TWG B;  4A3B G;  2CH4 A;  1SMY C;  2BH8 A;  3CAM A;  1LLR D;  2Q8R E;  2ZTE A;  3G4S A;  1IBL Q;  4K5X A;  2QW7 A;  3CP0 A;  1I50 B;  4IPH A;  4X66 Q;  2KEC A;  1DJR D;  2D2C C;  3QB3 A;  4IFD H;  4YWK A;  3TP5 A;  5F2D A;  1JOR A;  3U50 C;  2DUD A;  3O13 A;  4BA1 I;  4RHR A;  2AQ2 B;  4EGV A;  3TZD A;  3A7A B;  2B8G A;  4PV1 C;  5FO9 B;  5K36 G;  4DN4 M;  1IYU A;  1JJG A;  5C4Z A;  2BOS A;  2JJQ A;  3F2D A;  2PZW A;  3HOU B;  4DR6 L;  4N9P A;  3BYY B;  1KXL A;  5C4J B;  4H44 C;  1A62 A;  1BXT A;  1I4X A;  1KLU D;  1UNS A;  2K5N A;  2F0S A;  1A3V A;  4I7Z C;  2IHF A;  3C1E A;  1QIL A;  4A3B H;  3UDI A;  3CC2 A;  3KJP A;  4U67 3;  1CZW A;  4OWT B;  1L2F A;  2DNE A;  1CM9 A;  2KHI A;  5JJK A;  4LUV A;  5KRU A;  4QCL A;  2EQS A;  2A19 A;  1FD7 D;  1EU3 A;  2L15 A;  4C3H B;  1XPR A;  4DR4 L;  1UEB A;  3Q23 A;  1WJJ A;  2E5L Q;  4G7H C;  4X3U A;  1BOS A;  5COR A;  2XTI A;  3K81 C;  4C1N I;  4A75 A;  1HPC A;  4CDD C;  2R92 H;  1O80 A;  1VQO A;  3D31 A;  4X64 L;  1GXD C;  1BO0 A;  3OPO A;  4A3F H;  3AQQ A;  4C3I B;  2ALY B;  1TWG H;  4XT3 B;  2RDH A;  5M5Y B;  1FVI A;  1I50 H;  1LV9 A;  1PHJ A;  4BA2 I;  4HSV A;  1W2B A;  2F03 A;  2B2T C;  1CA6 A;  4BBS G;  4LF5 L;  1PTO C;  1O7Y A;  4N8X 1;  2SOB A;  1H9S A;  4A3K B;  5JPM C;  3GTQ B;  3E5S A;  1STB A;  4A3I H;  5IOD A;  1TT2 A;  2KHS A;  1B1Z A;  5ELB A;  4ZYS A;  3DEP A;  2KQ3 A;  4DR3 L;  4NXM L;  3M4Q A;  4E6I A;  1EZ6 A;  5EKK A;  3K5O A;  2WKD A;  3IFT A;  1PYW D;  2R7F A;  3RN5 A;  1LYL A;  5JJL A;  3A8I E;  3MFG A;  3RUZ A;  1E2V A;  2B2V A;  3NE5 B;  3PQI A;  3N52 A;  4WFN 3;  5C4J H;  5EQ0 A;  1PTO H;  5M3M H;  5M5X B;  2F3W A;  4KY5 A;  3J80 i;  2ASB A;  5ELE A;  2R7Z H;  2CQA A;  2XWJ B;  1XTC D;  3U4V A;  4JI6 L;  2VUM H;  4L5T A;  4K14 A;  4Y7N B;  4A3B B;  1MD2 D;  1N33 L;  3CMA A;  3S17 B;  4BBS H;  3NEL A;  4LF6 L;  1I4P A;  1V43 A;  3VR6 A;  4GKK L;  5IGB A;  4C56 C;  3G6E A;  1HFG A;  5KIX A;  4KY7 A;  1G6P A;  4NP5 A;  1AE2 A;  2EYP A;  1EY0 A;  1SE4 A;  1GUS A;  4CDC C;  1B70 B;  2G9H D;  2LKV A;  1GOZ A;  3NUC A;  3RZD H;  4P74 A;  3MHB A;  5M9O A;  2PMZ B;  2B63 H;  3TS2 A;  2K28 A;  4B08 A;  1HUN A;  3GV6 A;  5KYI A;  1XYI A;  3RZO B;  4YWM A;  1TS3 A;  4GOP C;  1I3Q B;  3D0F A;  1NR4 A;  5M5Y H;  1LT4 D;  3GTO B;  2SNS A;  2E74 C;  4RAU C;  4DR3 Q;  4Q0F A;  2CHB D;  2XNA C;  2KCC A;  3J81 i;  2FXQ A;  1Y8N B;  1JOK A;  4X66 L;  1QZG A;  2WB1 G;  5LMN Q;  1HNZ L;  4A3I B;  4A3J H;  2GA4 B;  4RKB A;  1HA5 A;  4P72 A;  4ZKB B;  2UXC Q;  2Q8I B;  4L8J A;  4WRD A;  5C0X J;  1H9R A;  1T5X D;  2Z6K A;  4JI6 Q;  2EPB A;  4OWW B;  4J6H A;  1II3 A;  2F0O A;  1M90 C;  2PMZ E;  1K3R A;  1O7I A;  1Q8I A;  1Z7T A;  4MHE A;  4KN7 C;  1J8I A;  3OYY A;  3EFX D;  2VUM B;  2SDF A;  4O0A A;  3M7G A;  3K7A B;  1BUV T;  1TWF H;  1X54 A;  5G3L D;  3W1B A;  1YNJ D;  3BJU A;  1CI3 M;  3HOU H;  3HKZ G;  3OMC A;  1BQQ T;  1EQV A;  3Q0A A;  1Y8O B;  4IPD A;  2ES2 A;  1CT1 D;  2F3I A;  3SGI A;  1BDO A;  2N88 A;  2J0T D;  1SNO A;  4RGO S;  1PZJ D;  5CR3 A;  2WV6 D;  3GP7 A;  2JEB I;  4DR7 L;  4HN7 A;  1SDF A;  1HNW Q;  4A3J G;  3AFQ A;  4OEL B;  2K1B A;  4BBR B;  1GKH A;  3IKJ A;  1Q1B A;  2K6A A;  5JVH 3;  3QR8 A;  5JVG 3;  2UUC L;  1O7L A;  2D0P A;  5EBC A;  2UU9 Q;  2ZT9 C;  1GHJ A;  1CQF A;  1SYF A;  4QIW E;  4Z9C B;  2QA4 A;  4DNT B;  1TII D;  3EA6 A;  2YTV A;  1SND A;  4C3H G;  1JWS D;  1CHP D;  4DV7 L;  3GDE A;  4RGM A;  4HJ9 A;  1PTO F;  1W3S A;  4DXG A;  1AZQ A;  3GTP H;  2R93 B;  3U9S A;  1QVG A;  3ERQ A;  3G7L A;  4DK6 C;  1F9S A;  1E3P A;  1FNU A;  2PO4 A;  4CDE C;  3H0G B;  3I2Z A;  3VDY A;  5LMN W;  2ICE C;  4JI3 L;  3DLL A;  1M1K C;  3S2D H;  4JI2 L;  1YIJ A;  3K5N A;  1V9P A;  3GTQ H;  3H15 A;  1EQQ A;  3H3V H;  4K6L A;  4JI7 L;  1I6V C;  1SE3 A;  4A3D H;  1HCZ A;  1QVC A;  3WWV A;  1J9O A;  1Q46 A;  3MVV A;  4HMJ A;  3DHQ A;  1OXU A;  1HHV A;  1HZ9 A;  1K0R A;  4JBJ A;  2CQO A;  3S9W A;  4M1U B;  5IYD H;  3HOZ H;  1YVC A;  4BXX H;  3VYR A;  4RA8 A;  4KV6 A;  3ONA B;  2MGS A;  3K0Y A;  2OCE A;  5M3M B;  5M5X H;  4H02 A;  2EYO A;  3M85 A;  1N36 L;  3HKS A;  2NZH A;  1Q90 A;  3SK4 A;  2A5H A;  3GTM H;  4LF7 L;  3I4N G;  3SXH A;  2RQX A;  4K8J A;  1SSO A;  4OWX B;  4YCU A;  2F0F A;  4LW1 A;  1X6O A;  3M9B A;  4ZUJ A;  4HR7 B;  1KC8 C;  4BBR H;  2VZA A;  3GD7 A;  1PRT B;  4ILW A;  4XTC S;  1QVF A;  3OWE B;  2NB0 A;  2BE5 C;  2UUA Q;  4PMW A;  2EYH A;  3M4O H;  4OO1 H;  2K05 A;  4A3D G;  3AMU A;  1SNM A;  4DV4 L;  1YI2 A;  4JK1 C;  2H1E A;  5IE8 A;  3TQY A;  1JWM D;  3STB C;  2VUM G;  1U4R A;  4QGU A;  4KI0 A;  1A2T A;  3HOZ G;  1SBB B;  4AYB B;  3E6Z X;  4Q5V A;  3I3C A;  3S14 B;  1QG7 A;  1LTI D;  2JA7 G;  4LFB L;  2JA6 G;  5E4W C;  2AQ3 B;  5IT9 c;  4L5R C;  5C3X A;  5C4X G;  4RGT A;  2L0C A;  3OHX C;  2WP8 J;  4HSP A;  2EXD A;  3B6Y A;  4DR5 L;  3RR5 A;  1C0A A;  4IJL A;  4IN3 A;  4KKU A;  2XN9 C;  3HOW H;  1LTA D;  1XNR Q;  4C3H H;  2LY7 A;  4PG3 A;  1JJC B;  2I5H A;  4TVA B;  3I4L A;  3KF6 A;  2OF1 A;  4CKC A;  2F0W A;  4HIK A;  2K4K A;  1GHK A;  4DKA C;  5DEH A;  1F9R A;  4N9T A;  3HEJ A;  5CC4 A;  4A3I G;  1IL2 A;  2PNH A;  2PNR C;  1Q1E A;  2E8G A;  4BWG B;  2R7Z G;  2D5D A;  3LX0 A;  4B3S Q;  2YTX A;  4C3I H;  2KED A;  1EQT A;  1SFO B;  1SMY D;  2BDN A;  1L1O B;  3X3N A;  5GAG C;  1UE7 A;  4K2K A;  1MIU A;  2R3Z A;  3RLN A;  3NK9 A;  3MEH A;  1CKM A;  3V05 A;  3AYH B;  1WTX A;  3IRB A;  1I4H A;  3NP8 A;  2E2D C;  1V1P B;  3BVM A;  4GNX B;  4DV3 Q;  1EY5 A;  4DPG A;  1ENA A;  1N32 L;  1KIX A;  3TRE A;  2VS1 A;  3FHW A;  3G48 A;  4LJZ C;  1M4V A;  1K28 A;  1V8Q A;  1WTW A;  3MEF A;  3J7A F;  3I4N H;  3PSI A;  1O7Z A;  4J8Q A;  5KEE A;  4LF5 Q;  2PQA A;  2HIV A;  2VXW A;  5J3B A;  1EEI D;  1LTB D;  4YCW A;  3MFY A;  2AQ1 B;  1ZYR D;  2K5D A;  1TWA B;  1ENC A;  3X3M A;  2BE5 D;  4A3K G;  1VS0 A;  2OEO A;  3I91 A;  4F7X A;  2EYL A;  5FLM G;  2ZJP A;  1Q12 A;  1WTV A;  2NVT H;  5AJ3 Q;  1GUN A;  3K80 C;  1HR0 L;  2YU9 B;  4DV1 Q;  2NWG A;  1XXG A;  1PFM A;  3EN2 A;  4KMU C;  3M3Y B;  5DLQ E;  5A2Q L;  3OIP A;  2CKZ B;  1ET9 A;  4AYB E;  1WCM G;  3TP6 A;  2B2Y C;  4DAP A;  2QF7 A;  3PV0 A;  2HD3 A;  5CV5 A;  1OO9 B;  1WD0 A;  1SFO H;  1DZ1 A;  2RDG A;  4H7B A;  4LUZ A;  3E9H A;  5LL6 S;  4KD4 A;  1GUT A;  1PXU A;  3F2U A;  3HOZ B;  4LFC L;  3VR5 A;  4J15 A;  3L0O A;  3K5M A;  2F4V L;  5C0X H;  3BDC A;  4PZ6 A;  1K8A C;  4YHH Q;  4B3M L;  3CD6 A;  1UUP A;  3R3O A;  2BH2 A;  2HQE A;  4KK7 A;  4WJW A;  5J22 A;  4PQX A;  3J81 L;  4IOC A;  1CHQ D;  1CK1 A;  3P1H A;  2P5Z X;  2IJ0 A;  4RMF A;  3C2P A;  1SNP A;  4A3E B;  3I4N B;  5LMU Q;  3KBX A;  3NWT A;  2QGQ A;  5C44 G;  1E1O A;  3PO3 H;  1SRO A;  3MXU A;  2R61 A;  4NMZ A;  3A56 A;  4LF4 L;  1I3Q H;  1X3G A;  1Y1W H;  2A6E D;  4JI0 L;  3HZX A;  4RCO A;  1MSH A;  3TP8 A;  4B3T L;  3MTS A;  2Q2I A;  3HFZ B;  1PRT D;  2FMM A;  3H91 A;  4GOP A;  1A2U A;  1RIP A;  2ZTD A;  1VF7 A;  1SN8 A;  2Q2U A;  2UUA L;  1GJX A;  1K73 C;  1VCI A;  2C5C A;  3HS0 C;  4L6T B;  4KHP Q;  3NTH A;  1VQ7 A;  4FXG C;  3FKI G;  5JJI A;  1BBX C;  4DA2 A;  4HMI A;  1ZYR C;  3ND8 A;  5IGE A;  1WTR A;  1JE4 A;  4FF3 A;  5IWA Q;  4PZ8 A;  4DV5 L;  1KQS A;  2C9O A;  1AEX A;  4KJN A;  4HTH A;  1R4P B;  1SYB A;  2B2U A;  3H0G G;  1EWC A;  4BS9 A;  2Z6K C;  2PYK A;  3NTK A;  4JPB W;  1S72 A;  3OW2 A;  1ROD A;  1KAW A;  2JP1 A;  1SNQ A;  3K5L A;  1X9N A;  1X3F A;  1G8Z D;  5HGQ A;  2JA7 H;  4UP9 A;  1Y1W G;  1Q7Y C;  1VMP A;  1PZK D;  4KD3 A;  1SYD A;  4XYO A;  1JMC A;  4POF A;  5C44 H;  2GN5 A;  3K8A A;  5D3I B;  3I4O A;  2IX1 A;  5EPL A;  1QB5 D;  1VQI A;  1WYD A;  1QOH A;  1VQJ A;  1L1O C;  2NBF A;  3SR1 A;  3I55 A;  1DYQ A;  1JQY D;  2F4V Q;  2NVX H;  2J7Z A;  4HED A;  1IKM A;  5L37 A;  2QEJ C;  1CA5 A;  2ZM6 Q;  1K83 B;  4KKS A;  1EOV A;  5C5M A;  5I2Y A;  3FPU B;  3EIV A;  3CKI B;  5IT9 E;  1HRJ A;  2VB2 X;  4X6A H;  2PZT A;  2H5X A;  2B2T A;  2R93 H;  3QOJ A;  2JA5 G;  4MNO A;  1ET6 A;  4MIU A;  3SK8 A;  2Q2T A;  4KTA A;  2IWH A;  4BBS B;  2F52 A;  2IW3 A;  2AMC B;  1IZ6 A;  2FFK B;  4OX9 Q;  2BA0 A;  3NEN A;  5C4X H;  3JAM c;  1TY2 A;  3RN2 A;  1FR3 A;  5C0X G;  2V4D A;  3GTM B;  4RKL A;  2RDF A;  2F4I A;  1Q82 C;  1X3E A;  2YTY A;  4IAL A;  4JW0 A;  3BS1 A;  4DNR B;  5EJW A;  4DAY B;  5I6W A;  1Y1V B;  4RGN A;  2F1M A;  2B3G A;  3OW7 A;  3MA2 B;  3JC6 6;  3K7U C;  3D6C A;  5IWA L;  3HOV B;  4GLX A;  3S1N H;  3CRL C;  2LMC B;  2YYZ A;  1FYC A;  2F0T A;  3S15 B;  4O2D A;  4AQY L;  4ZRZ A;  1TQO A;  3S2H B;  4J1M A;  2K7V A;  1HZC A;  1CQV A;  1EY7 A;  1ZKO A;  3ZJY C;  5JEA H;  1VQG A;  5J1Z A;  5CYU A;  3I7F A;  2KCN A;  1N34 Q;  5IYC H;  2NZO A;  2HT1 A;  1A3U A;  3WDN A;  3SHL A;  3MAQ A;  2VQE L;  3NPP A;  3A5U A;  3E9I A;  3PGZ A;  1D6E C;  1NMG A;  5LL6 X;  1A3T A;  1MSG A;  3DXJ C;  2MNA A;  1LTG D;  1BBU A;  2L5T A;  4LF8 Q;  5I6Y A;  1SEB D;  1YZ6 A;  3HKZ B;  3FEW X;  1HNX L;  1IKL A;  4JBM A;  1HZA A;  5GAH C;  1GUO A;  2Z1C A;  2KOL A;  1O78 A;  2Z4H A;  4LUO A;  2FHT A;  1I4G A;  1YJW A;  1BKB A;  3PUV A;  1EYC A;  3CQZ B;  1LAB A;  1TWF B;  4ZCK A;  1DOK A;  1UWV A;  2L12 A;  2RCF A;  5ELD A;  4JCV E;  2EJM A;  4P2C B;  1MJE A;  3PO3 B;  4A3M H;  1L1O A;  2IHE A;  4POG A;  4ALP A;  4NKL A;  2O2L D;  1SYG A;  1XMO Q;  3NSW A;  5CGK A;  1Y1W B;  1HQM C;  1EYG A;  4JI5 L;  5C3E B;  2ZXR A;  3L2P A;  2KEE A;  1PMR A;  4DGZ A;  1I4R A;  4DV7 Q;  2NYZ D;  2OT2 A;  2NTT A;  3ITP A;  4A76 A;  2NVY B;  4LK1 C;  2M00 A;  4LFB Q;  4DAM A;  1FGU A;  2VB3 X;  4DV0 Q;  4DR1 Q;  1NJI C;  2Z6B A;  5E7N A;  5JJZ A;  2L9H A;  2OTL A;  1XNQ Q;  2UUC Q;  3S15 H;  1T9H A;  4R9W A;  3KF8 B;  3W2D A;  5CV7 A;  2WIN B;  4R4O A;  1S5B D;  3VR3 A;  4GKK Q;  1UE1 A;  3GTP B;  2K03 A;  4IUN A;  1ONL A;  4QMG A;  1G2T A;  3HOX B;  5KGU A;  2JA9 A;  2XSC A;  2K14 A;  3DM1 A;  1HTL D;  2K5Q A;  2V1C C;  2A6H D;  4I7A A;  4JI7 Q;  4OO1 I;  4NXN L;  4I65 A;  3GTG B;  3T4A C;  1VQE A;  4GLA C;  4KJO A;  5C3E G;  5M3F G;  1JB3 A;  3CPF A;  1JCK B;  5C44 B;  2VQF Q;  3BU2 A;  2JSO A;  2GVB A;  1W6J A;  1F2M A;  4X65 L;  1LO5 D;  3ULL A;  3CME A;  4K2L A;  5NUC A;  2HUG A;  4RG1 A;  3Q22 A;  2R92 G;  3J80 L;  4G7O C;  1B44 D;  3EJI A;  4A3M B;  4LF8 L;  3I4M H;  2E76 C;  3JAM i;  4IUU A;  1JC7 A;  1J5E L;  2JA8 H;  1HNZ Q;  3D8G A;  3EBE A;  1BCP B;  5ELC A;  2L4N A;  4K5V A;  3F2C A;  1WTQ A;  1U4L A;  4DV1 L;  4BBR G;  4HCE A;  5E1F A;  3RD4 A;  1DD2 A;  3TN2 A;  4LF9 Q;  2E5L L;  2X6G A;  4X62 Q;  2NVY H;  4CGY B;  2PPB C;  4JV5 Q;  3HKZ E;  2HDM A;  4LF7 Q;  2K33 A;  2JYO A;  4QUF A;  4OIJ A;  1SNC A;  1CZG A;  1WD1 A;  4IQZ A;  1D8L A;  4JG2 A;  1YHQ A;  2WFW A;  1N8R C;  2F0D A;  4DV4 Q;  3VR2 A;  1N9W A;  2G5D A;  3VYT A;  2K32 A;  1VMC A;  3UE1 A;  5IP9 G;  2K5V A;  2Y0S B;  5IIF A;  1WTP A;  2R92 B;  2LXK A;  4IOA A;  5ELO A;  2F0E A;  2NVQ H;  4IO9 A;  1ESR A;  1EIF A;  1X65 A;  4LAA A;  4A3F B;  4QF4 A;  1YNJ C;  3LGJ A;  1H9M A;  1X3P A;  2EE1 A;  1PRT F;  3U4Z A;  2CVR A;  5IP7 G;  4A3F G;  2N78 A;  3MXN A;  1QCB D;  1EOT A;  3GTG H;  4JI1 Q;  1DCZ A;  4ZLT F;  1WTO A;  1PFN A;  2ATW A;  1B50 A;  3AB9 A;  1HUM A;  3H09 A;  3AFP A;  4WJ3 M;  1R9T H;  1J5E Q;  4V19 0;  2EJG C;  2JN4 A;  3LNN A;  2HDL A;  4YY3 L;  1C48 A;  1VQP A;  3D4W A;  4ULL A;  3TME A;  3CCJ A;  5TSS A;  4LNQ A;  1PFS A;  1XNR L;  1DGS A;  3BVZ A;  1PYS B;  4FDB A;  2PCF B;  2WAQ B;  1DOL A;  3U9O A;  1ML0 D;  5JEA G;  5M3F H;  4OO1 G;  2CFM A;  1PTO D;  4KHP L;  2JA7 B;  2O5I C;  2PQE A;  2N8N A;  1X56 A;  2LXJ A;  3KBG A;  4DK3 C;  1ASZ A;  1FJG L;  4JI5 Q;  1DOM A;  1X55 A;  3PO2 B;  1QE6 A;  4Y7N H;  3K0X A;  2ENB A;  3AEV A;  2K52 A;  1KDC A;  5FKA C;  1QNU A;  3FKI B;  1DON A;  3Q24 A;  1STH A;  4R4T A;  5EBD A;  3URY A;  4X3T A;  5C3E H;  4JI0 Q;  2MJ8 A;  3IAY A;  3NHH A;  3HOV G;  2O5J C;  3PO2 G;  1W6K A;  4A3L H;  5FLM H;  1VQH A;  3UDF A;  1Z9F A;  3BZD B;  5I9O A;  2I5L X;  2IPK D;  5ELN A;  1XMO L;  2CWP A;  2WAQ E;  1YBY A;  2A68 D;  2WAQ G;  4JI3 Q;  4R8I A;  1OXS C;  2OTJ A;  5G3L F;  2AWN A;  4KHZ A;  3HOU G;  3FRP B;  3HOY B;  4CJ2 C;  1YNN D;  1ZXT A;  2FMC A;  3J7Z C;  1V1O A;  3AU7 A;  3QWN A;  2YV5 A;  4A3G H;  3UE0 A;  3OWF A;  4DR1 L;  1GD7 A;  4BY7 G;  3S1Q B;  3S14 H;  4DUZ L;  1G91 A;  1EUJ A;  2CW0 D;  2LFN A;  4OEM B;  2NVX B;  5AFW A;  2NVT B;  1FL0 A;  3SK5 A;  2E2I B;  1STN A;  2OQ0 A;  2RVL A;  1ICW A;  1Q3L A;  3CCM A;  1K83 H;  1HXY D;  2I0Q A;  1S5C D;  4CKE A;  4APV A;  1AFP A;  5M3F B;  1KL9 A;  2WB1 E;  1Y1V H;  4RCN A;  1HZB A;  3GTL H;  1I4Q A;  4XDX A;  1E2Z A;  4EQ5 A;  3M7N A;  1OXT A;  4FVM A;  1EL0 A;  1EY6 A;  4X3S A;  4RHS A;  2ZJQ A;  4DK1 A;  3TEH B;  4OHJ A;  2OXP A;  4HIO A;  2EDG A;  3PO2 H;  3FKI H;  4IUR A;  3I72 A;  4ZUI A;  3D4D A;  2MFI A;  1BNZ A;  1SJE D;  1PFB A;  1QZH A;  3W3A A;  3PIO 3;  1H9J A;  1V1P A;  4GNX A;  1RL2 A;  1LTR D;  1LT6 D;  2I5M X;  4ZKC B;  1YJ9 A;  1VQA A;  1E7Z A;  4A3E H;  2DJF C;  5DM7 3;  4DF7 A;  5C3W A;  1RTN A;  2XIW A;  1VDZ A;  4HID A;  1EYD A;  4IFD J;  3QOL A;  5EAY A;  2B29 A;  4JYA L;  1PH2 A;  1EWI A;  3F1Z A;  3D4R A;  3T56 B;  3UI2 A;  4K0K Q;  1NE3 A;  4EX5 A;  5GAE C;  3A8K E;  3A74 A;  4R4Q A;  4DR5 Q;  4LF6 Q;  5JOB A;  3UDG A;  4A3G B;  1V1Q A;  4NXM Q;  5BR8 Q;  4F88 A;  4BY7 B;  2A6E C;  1JR0 D;  5E3F A;  5CV9 A;  5H1S E;  2K50 A;  5EGT A;  3J81 c;  3MXP A;  2B2U C;  3VA7 A;  3NBH A;  4PMC A;  5M5W B;  3CRK C;  1ZEQ X;  1IYJ B;  4FXK C;  3PIP 3;  3NBH B;  1C7Y A;  4HJ8 A;  3ULP A;  2HIX A;  1TY0 A;  1E24 A;  3KFU A;  2F0I A;  4F87 A;  2CH4 W;  4M8A A;  1N33 Q;  2RA4 A;  4EQN A;  1TWC B;  3JAM E;  5JAV A;  1NMF A;  3Q8D A;  1ICF B;  2A1A A;  3EQL C;  2E2H H;  1YHB A;  1ESF A;  4C3J G;  1SYC A;  4G7Z C;  2IY5 B;  3TBI B;  4IFD G;  1EZ8 A;  4EQP A;  3DWP A;  1CSQ A;  5E4X A;  5EPJ A;  2NN6 I;  2Z8L A;  1HQR D;  4P75 A;  1HR0 Q;  4P73 A;  1JE5 A;  1XX8 A;  1LUZ A;  3D6W A;  2NZ1 D;  3ICE A;  5J39 A;  3TP7 A;  3DWA A;  1RCV D;  3P20 A;  2JE6 I;  1T5E A;  1IXR A;  5C6A A;  2SNM A;  2EY2 A;  4PNY A;  5LHY 1;  3CF5 A;  2WB1 B;  5FOB B;  1BBW A;  4O1N A;  1JB7 A;  4DXF A;  3V96 A;  4IPC A;  2KUM A;  4LFA L;  1IW7 D;  1LAC A;  3ER0 A;  2VQF L;  1VQL A;  4HJ7 A;  1D1K A;  1B9N A;  1PDQ A;  1AH9 A;  4WJ4 A;  1A15 A;  2Y0S G;  1IL8 A;  5IT9 L;  3KYH C;  2PW7 A;  3OOC A;  4L5S A;  4KHV A;  4OX9 L;  2EY1 A;  1U5K A;  3R2I A;  4OL7 A;  4JI8 Q;  1Z6H A;  4MTK A;  1KAA A;  2PI2 A;  5C4X B;  5LMU L;  4HAE A;  4PMB A;  4DU9 A;  2F0U A;  2EY5 A;  4GN4 B;  2LS0 1;  2JA6 B;  2QDB A;  2HCI A;  3RLF A;  5COY A;  2X69 A;  1K8O A;  1SJH D;  2OWO A;  4YIJ A;  4B3R L;  1ASY A;  4DUY L;  1F9P A;  2EYJ A;  1S5F D;  4A3C H;  1VQ6 A;  3S1N B;  1KD1 C;  4X62 L;  3EVQ A;  4LFC Q;  4UDU C;  1LTL A;  1TWC H;  1X3Q A;  2ZXP A;  2KBN A;  1BCP F;  3NQI A;  3S1R H;  1CKN A;  2DY8 A;  5I9P A;  2E2H B;  2JA8 B;  4KY6 A;  5K5P A;  1QUQ B;  2NVQ B;  1HTP A;  1S5D D;  2L55 A;  5FJ8 H;  3GTL B;  1NTG A;  4A3G G;  2VL6 A;  1PTO B;  3ND9 A;  5GQO A;  4XQQ A;  1U4P A;  1GUG A;  1E0B A;  2R6G A;  1XPU A;  4K8I A;  4CBV A;  5FLX E;  5IOC A;  1EFW A;  2R7Z B;  1TXY A;  4UHV A;  3T1H Q;  5CV4 A;  5A35 A;  4FF2 A;  2F0J A;  4CDF C;  4ABN A;  1EYA A;  2GVA A;  3S17 H;  2BDO A;  4GS3 A;  4X3K A;  1MI2 A;  1SE8 A;  4UAI A;  4JI1 L;  1AE3 A;  1TS2 A;  1XWE A;  1EIG A;  4A3C G;  4LF9 L;  4L63 B;  5C0X I;  2EOT A;  4JYA Q;  4GKJ Q;  2AKW B;  1F2L A;  5BN4 A;  4QIW B;  4C2M H;  3N6R A;  4QQB X;  1EIY B;  1Z47 A;  3CCL A;  5EPK A;  4IJH A;  4BY1 B;  4XIG S;  1STE A;  4R8N A;  1JJ2 A;  1E22 A;  1EWH A;  1IYV A;  1I94 L;  2CCZ A;  2JQO A;  2G9D A;  3KUP A;  2A69 D;  2NTS A;  4OIK A;  4PZ7 A;  4TSS A;  1TWA H;  3A0J A;  3KLS X;  5FO8 B;  2JK8 A;  4FNF A;  4XQN A;  5FLX L;  3RLO A;  1R9T B;  4JVZ A;  3HG9 A;  1F2Y A;  3GV3 A;  1F9Q A;  4JI8 L;  1VQD A;  2AHO B;  4DV0 L;  1U9R A;  5ELF A;  1B4O A;  1RJT A;  4DR6 Q;  3U58 A;  2NN6 G;  2K5W A;  3A54 A;  2MO0 A;  1EQR A;  3PUW A;  1NUC A;  1N36 Q;  2QEX A;  1EIH A;  4GLV B;  1PLF A;  3BDL A;  3QO2 A;  4UP8 A;  3V2T A;  3L3O C;  4B3R Q;  3MXN B;  3CHB D;  5IGC A;  1IBM L;  3HOX H;  4ZK9 B;  2B39 A;  1C4Q A;  3I73 A;  1G2S A;  1ENF A;  4ME3 A;  4GN5 A;  1TR5 A;  2EYM A;  1KLG D;  3SE0 A;  4DNI A;  3KLS A;  3QIA A;  1GUW A;  2XGT A;  4HJA A;  1VQ8 A;  2WAC A;  1G29 1;  3K7A H;  1D7Q A;  3ERO A;  3S24 A;  1J6Q A;  1D5X C;  2DJG C;  2UXD L;  1RDP D;  5A2Q E;  4A4I A;  4GKJ L;  3J7A V;  3A55 A;  4YCV A;  1U4M A;  2K75 A;  1NSN S;  2Q2H A;  2BA1 A;  2B63 G;  2K5H A;  3ERS X;  1NCV A;  1I6H H;  1NNX A;  2F0N A;  3FPP A;  1M8A A;  1G51 A;  4MTN A;  4GN3 B;  4CJ1 B;  5DM6 3;  3F2B A;  2B2W A;  4R4I A;  3PUY A;  3PIP A;  1VQ5 A;  2KVM A;  4KN4 C;  3LWE A;  4U68 A;  1FNW A;  2QCP X;  3J81 E;  3A7L A;  4Y52 H;  2F0L A;  5CBE E;  3J80 E;  2M2L A;  3CCE A;  1HH2 P;  3GTK H;  3HOY H;  4A93 G;  4C3J B;  3K6O A;  1SAP A;  4FF4 A;  2Z0S A;  4LWC A;  5FJ8 G;  3CQZ H;  4A93 B;  5IGF A;  4CKB A;  2DY7 A;  4ME5 A;  3A5Z B;  2AUK A;  3T16 A;  2F0K A;  2D0O A;  3I70 A;  2HHH Q;  3J81 j;  3S1Q H;  4JI2 Q;  4C1N K;  1TS5 A;  1SYE A;  1GVP A;  3QJY A;  3STB D;  2EYF A;  3DWQ A;  2E2I H;  1UE5 A;  3SVM A;  2JA6 H;  1GM5 A;  3WOF A;  3S1M B;  1H9S B;  1Q8K A;  1PH1 A;  3CPW A;  5C5L A;  2L11 A;  2IX3 A;  2RHS B;  2E75 C;  1NBW A;  2AWO A;  4JOI A;  3GO5 A;  4OXP A;  5I2X A;  5EKI A;  1STA A;  1PZI D;  4DV5 Q;  3SEB A;  1Y1V G;  1STG A;  1E1T A;  1D5M C;  4IFD I;  3OSO A;  1VQM A;  2L1B A;  4DR2 Q;  3NXW A;  3OTO Q;  3CCR A;  2KA7 A;  4NB3 A;  3T1H L;  1RF2 D;  4IUT A;  1KNA A;  4LMQ D;  5K36 H;  3KJO A;  3GTJ H;  4UY8 C;  4NDX A;  1C8C A;  3CXC A;  1B3Q A;  1JIC A;  3RZD B;  2EY6 A;  4K0K L;  2QKI C;  1UEA B;  1BVS A;  1B53 A;  1CKN B;  1P8L A;  4NXN Q;  2BCO A;  4FO2 A;  2Z9H A;  1WI5 A;  3MXG A;  1CKO A;  1TVX A;  2PQA B;  2ZXO A;  5IYC G;  1FJG Q;  3L9A X;  5IP7 H;  3GTK B;  3GTO H;  4L5Q A; 
#chains in the Genus database with same CATH homology
 1SFO H;  2AWN A;  4KHZ A;  4LUZ A;  1KXL A;  3E9H A;  3HOU G;  1A62 A;  3J7Z C;  4LFC L;  2K5N A;  1VQ9 A;  4J15 A;  3L0O A;  2UU9 L;  2YV5 A;  4A3G H;  2UXB L;  3UE0 A;  2KCT A;  2IHF A;  4DR1 L;  1GD7 A;  4JC0 A;  2F4V L;  4A3B H;  3UDI A;  4PZ6 A;  1K8A C;  4YHH Q;  3KJP A;  3CC2 A;  4B3M L;  3CD6 A;  4JOI C;  3S14 H;  4BY7 G;  4OWT B;  4DUZ L;  1EUJ A;  1L2F A;  1KHI A;  5M5W H;  2BH2 A;  2KHI A;  5JJK A;  4LUV A;  3S1M H;  2EQS A;  2A19 A;  1FL0 A;  3BZC A;  4IOC A;  1PH4 A;  2OQ0 A;  2L15 A;  3CCM A;  1K83 H;  1XPR A;  2I0Q A;  4DR4 L;  1UEB A;  4APV A;  4RMF A;  3CCQ A;  1WJJ A;  3M4P A;  1U0L A;  1IBM Q;  1IBK L;  2E5L Q;  5LMU Q;  1B7Y B;  1KL9 A;  3HOY G;  1A8V A;  2WB1 E;  2QGQ A;  5FLX c;  5C44 G;  1Y1V H;  3HOV H;  2XTI A;  3K81 C;  4A75 A;  1HZB A;  3GTL H;  2R92 H;  1E1O A;  1VQO A;  3PO3 H;  1SRO A;  3D31 A;  4X64 L;  4EQ5 A;  3M7N A;  1OXT A;  4LF4 L;  1IBL L;  4A3F H;  1I3Q H;  2ZJQ A;  1X3G A;  1Y1W H;  3TEH B;  3AQQ A;  4JI0 L;  2ALY B;  4HIO A;  1TWG H;  2C35 B;  4B3T L;  2Q2I A;  4LFA Q;  3FKI H;  3HFZ B;  3PO2 H;  4GOP A;  1FVI A;  1RIP A;  1Q86 C;  2ZTD A;  1Y14 B;  1I50 H;  1PHJ A;  4BA2 I;  1SN8 A;  2MFI A;  1W2B A;  2Q2U A;  1HNX Q;  1QZH A;  2UUA L;  4GNX A;  1SR3 A;  1K73 C;  1VCI A;  1RL2 A;  4LF5 L;  3PCO B;  4BBS G;  1OXX K;  2DGY A;  4DV2 Q;  3RNU A;  1VQ7 A;  4KHP Q;  2I5M X;  3FKI G;  3CW2 C;  1WFQ A;  3S16 H;  1YJ9 A;  1VQA A;  5JJI A;  1E7Z A;  4A3E H;  5IWA Q;  4A3I H;  4PZ8 A;  4DV5 L;  1KQS A;  2VQE Q;  5IYD G;  1I5F A;  4HID A;  4IFD J;  4DR3 L;  2E2J H;  4NXM L;  3M4Q A;  3H0G G;  5EAY A;  4DV6 Q;  3TRZ A;  3F8T A;  2UXB Q;  2B29 A;  4JYA L;  2Z6K C;  1PH2 A;  1EWI A;  3F1Z A;  2R7F A;  3RN5 A;  1S72 A;  3OW2 A;  1LYL A;  1UE6 A;  4K0K Q;  5JJL A;  1NE3 A;  1KAW A;  2OQK A;  3CC7 A;  4EX5 A;  1X9N A;  1X3F A;  5GAE C;  5HGQ A;  3A74 A;  2JA7 H;  4UP9 A;  4R4Q A;  5C4J H;  4DR5 Q;  4LF6 Q;  3UDG A;  1Q81 C;  1Y1W G;  5M3M H;  1V1Q A;  1Q7Y C;  3J80 i;  4NXM Q;  5BR8 Q;  2ASB A;  2R7Z H;  3U4V A;  5H1S E;  1IBK Q;  4JI6 L;  2VUM H;  4L5T A;  4DR4 Q;  2K50 A;  3J81 c;  1JMC A;  1TWH H;  3CCS A;  4A93 H;  2ZM6 L;  4POF A;  5C44 H;  3CMA A;  2GN5 A;  3K8A A;  1N33 L;  3I4O A;  1B8A A;  2IX1 A;  5LMN L;  1VQI A;  3NEL A;  1WYD A;  4LF6 L;  4BBS H;  1VQJ A;  1V43 A;  1L1O C;  4GKK L;  3I55 A;  3CCV A;  4NPS A;  1VQN A;  4AH6 A;  3G6E A;  1C9O A;  1IYJ B;  4X64 Q;  2F4V Q;  2NVX H;  3NBH B;  1G6P A;  1C7Y A;  4HJ8 A;  2A8V A;  3ULP A;  1AE2 A;  2HIX A;  1PH8 A;  1E24 A;  3HOW G;  1SLJ A;  2KCM A;  1PYB A;  3KFU A;  2ZM6 Q;  1N33 Q;  1B70 B;  3RZD H;  1OXV A;  2LSS A;  1EOV A;  2R93 G;  4P74 A;  3NEM A;  3HOX G;  3EIV A;  1NMF A;  3Q8D A;  2A1A A;  4YY3 Q;  2UXC L;  2JEA I;  2E2H H;  3OTO L;  4X6A H;  2B63 H;  1YHB A;  3TS2 A;  3FP9 A;  2IY5 B;  1JT8 A;  1YJN A;  2H5X A;  4IFD G;  2MQH A;  2R93 H;  4YWM A;  2JA5 G;  4MNO A;  1CSQ A;  1L0W A;  4GOP C;  4P71 A;  3D0F A;  5M5Y H;  2NN6 I;  2Q2T A;  4DR3 Q;  2F52 A;  4P75 A;  1SRU A;  5BR8 L;  1HR0 Q;  2AMC B;  1JE5 A;  4P73 A;  1IZ6 A;  3J81 i;  4OX9 Q;  2BA0 A;  1LUZ A;  2FXQ A;  3NEN A;  5C4X H;  3JAM c;  3ICE A;  3RN2 A;  3T1Y Q;  4X66 L;  5C0X G;  1QZG A;  2WB1 G;  5LMN Q;  2JE6 I;  1HNZ L;  1Q82 C;  1X3E A;  1IXR A;  2RCN A;  2YTY A;  4A3J H;  3J80 c;  1A63 A;  3CF5 A;  1HR0 W;  1NY4 A;  4P72 A;  1PH9 A;  2UXC Q;  1S3O A;  1BBW A;  4DAY B;  5C0X J;  3PUZ A;  1JB7 A;  2Z6K A;  4JI6 Q;  2B3G A;  3PO3 G;  4IPC A;  4OWW B;  3JC6 6;  4LFA L;  4GOP B;  3K7U C;  5IWA L;  1M90 C;  4GLX A;  2PMZ E;  2VW9 A;  3S1N H;  1K3R A;  4B3T Q;  1O7I A;  3ER0 A;  2VQF L;  1VQL A;  1YEZ A;  2YYZ A;  4HJ7 A;  4B3S L;  3OYY A;  4DR7 Q;  1AH9 A;  1GO3 E;  4O2D A;  2Y0S G;  4AQY L;  4O0A A;  4WJ3 M;  4WJ4 A;  3KYH C;  4L5S A;  1X54 A;  1TWF H;  3W1B A;  4OX9 L;  2HQL A;  1HZC A;  1U5K A;  4QY7 A;  4JI8 Q;  3BJU A;  3HOU H;  3HKZ G;  3ZJY C;  4MZ9 A;  4A3M G;  1VQG A;  2PI2 A;  1OTC A;  4GNX C;  1N32 Q;  5LMU L;  4IPD A;  2ES2 A;  3I7F A;  1YHA A;  4GN4 B;  1N34 Q;  2F3I A;  3SGI A;  5IYC H;  3PF4 A;  4KLK A;  2NZO A;  5IY0 A;  2HT1 A;  2VQE L;  3A5U A;  4A3K H;  4JI7 Q;  3E9I A;  3RLF A;  3PGZ A;  1NMG A;  2JEB I;  3G71 A;  4DR7 L;  1XTD A;  4JI4 Q;  3KDF A;  2OWO A;  1HNW Q;  4A3J G;  2MNA A;  4B3R L;  3AFQ A;  1ASY A;  4DUY L;  1BBU A;  4LF8 Q;  1GKH A;  4A3L G;  1YZ6 A;  4A3C H;  1Q1B A;  4JV5 L;  1VQ6 A;  1HNX L;  2UUC L;  4AYB G;  1KD1 C;  4JBM A;  4X62 L;  1HZA A;  3PUX A;  2D0P A;  3W1G A;  5GAH C;  4LFC Q;  1LTL A;  1TWC H;  2UU9 Q;  2KBN A;  2UXD Q;  3S1R H;  4LUO A;  1CKN A;  1YIT A;  1BKB A;  3PUV A;  1YJW A;  1XPO A;  1VQB A;  4QIW E;  2QA4 A;  1QUQ B;  2YTV A;  1UWV A;  1XMQ L;  5FJ8 H;  4DV7 L;  4JCV E;  3KDF B;  1NTG A;  3GDE A;  1MJE A;  4A3G G;  2VL6 A;  4HJ9 A;  4A3M H;  1L1O A;  2IHE A;  1W3S A;  4POG A;  4YWL A;  4ALP A;  5GQO A;  3GTP H;  4C3J H;  1XMO Q;  1QVG A;  2R6G A;  4DV3 L;  1XPU A;  1EFW A;  4DK6 C;  1EYG A;  4R1J A;  1TXY A;  4JI5 L;  3T1H Q;  1E3P A;  2N3S A;  3I2Z A;  3VDY A;  4DUY Q;  2GVA A;  3L2P A;  5LMN W;  4UPA A;  4BY7 H;  1H95 A;  3S17 H;  4GS3 A;  4JI3 L;  1HJP A;  3DLL A;  4DV7 Q;  1M1K C;  2IT1 A;  3S2D H;  1SE8 A;  4JI2 L;  4A76 A;  5M3M G;  1YIJ A;  4JI1 L;  1AE3 A;  1V9P A;  1S40 A;  4LFB Q;  4DAM A;  1FGU A;  4DV0 Q;  4DV6 L;  3GTQ H;  4A3C G;  3H15 A;  1EQQ A;  2KEN A;  4DR1 Q;  5C0X I;  1NJI C;  4LF9 L;  3H3V H;  4JYA Q;  4GKJ Q;  2AKW B;  3E0E A;  4JI7 L;  2IX0 A;  5E7N A;  2OTL A;  1XNQ Q;  2UUC Q;  3S15 H;  1T9H A;  5JEA J;  4A3D H;  4C2M H;  3KF8 B;  1QVC A;  3WWV A;  1K8G A;  4QQB X;  1Q46 A;  4R4O A;  1EIY B;  1Z47 A;  3CCL A;  1OXU A;  1PV4 A;  4IJH A;  1HZ9 A;  1UE1 A;  1K0R A;  4GKK Q;  4XIG S;  3RZO H;  4JBJ A;  2CQO A;  5IYD H;  3BZK A;  4IPG A;  2JA9 A;  2MO1 A;  1PH5 A;  3HOZ H;  1JJ2 A;  1YVC A;  1E22 A;  4BXX H;  2K14 A;  1I94 L;  3PIO A;  2JQO A;  4YHH L;  2CCZ A;  2V1C C;  4B3M Q;  2JA8 G;  1XNQ L;  4QJF A;  2VY3 A;  4PZ7 A;  4TQU S;  2RF4 A;  1TWA H;  2OCE A;  5M5X H;  3A0J A;  4NXN L;  4H02 A;  5AJ3 L;  2JK8 A;  3M85 A;  4X65 Q;  3PF5 A;  3HKS A;  1N36 L;  3H3V I;  2NZH A;  1VQE A;  4GLA C;  3RLO A;  2CWA A;  5C3E G;  5M3F G;  4LF7 L;  4DR2 L;  4JI8 L;  3GTM H;  1VQD A;  2AHO B;  3I4N G;  4DV0 L;  2R7D A;  4QL5 A;  3CPF A;  4OWX B;  1KRT A;  5HY6 A;  3DM3 A;  1XMQ Q;  4DR6 Q;  4YCU A;  4LF4 Q;  4LW1 A;  1X6O A;  3M9B A;  2VQF Q;  3U58 A;  3BU2 A;  2GVB A;  2NN6 G;  5GAD C;  3KOJ A;  4BBR H;  1KC8 C;  2MO0 A;  2VZA A;  1EQR A;  3GD7 A;  4XTC S;  4BY1 G;  1QVF A;  3PUW A;  4X65 L;  1N36 Q;  2HHH L;  3ULL A;  1SMX A;  2QEX A;  3CME A;  2UUA Q;  4PMW A;  4GLV B;  4UP8 A;  4RG1 A;  2R92 G;  3M4O H;  1MKH A;  4B3R Q;  3MXN B;  5IYB G;  1IBM L;  4A3D G;  2D62 A;  2RHQ B;  3HOX H;  4DV4 L;  1YI2 A;  4LF8 L;  2UUB L;  1I94 Q;  5IP9 H;  3I4M H;  4OO1 I;  4HJ5 A;  3JAM i;  1HNW L;  1J5E L;  5IE8 A;  4ME3 A;  1VQ4 A;  3TQY A;  4GN5 A;  3STB C;  2JA8 H;  2VUM G;  4QGU A;  4DNI A;  3TS0 A;  3EBE A;  4KI0 A;  4DUZ Q;  1HNZ Q;  2XGT A;  3HOZ G;  4HJA A;  1VQ8 A;  1G29 1;  3K7A H;  3F2C A;  3S2H H;  1D7Q A;  3S24 A;  1J6Q A;  4DV1 L;  3KF6 B;  2UXD L;  4OON A;  1VQK A;  4BBR G;  4A4I A;  1PH7 A;  1YNX A;  4JBW A;  4GKJ L;  2JA7 G;  4YCV A;  4LFB L;  3J7A 5;  2JA6 G;  2K75 A;  2Q2H A;  5IT9 c;  4L5R C;  4LF9 Q;  2BA1 A;  2E5L L;  4X62 Q;  4HIM A;  1MJC A;  2NVY H;  2B63 G;  1LM0 A;  2K5H A;  3KLW A;  3H0G H;  3ERS X;  2ZJR A;  4AQY Q;  4JV5 Q;  5C4X G;  3HKZ E;  2WP8 J;  1P16 A;  1I6H H;  2EIF A;  2PI2 E;  1VQC A;  2EXD A;  3B6Y A;  4LF7 Q;  4DR5 L;  3RR5 A;  1C0A A;  4JBK A;  3I56 A;  1D8L A;  4JG2 A;  1YHQ A;  2WFW A;  1N8R C;  4IJL A;  4DV4 Q;  1G51 A;  4MTN A;  4GN3 B;  3L7Z C;  1KRS A;  3HOW H;  1N34 L;  1PVO A;  1N9W A;  1XNR Q;  4C3H H;  4PG3 A;  2JA5 H;  3F2B A;  3UE1 A;  5IP9 G;  2K5V A;  4R4I A;  3I4M G;  3PUY A;  3PIP A;  2ZTC A;  1VQ5 A;  1JJC B;  2I5H A;  4TVA B;  5IYB H;  2LXK A;  1PH6 A;  3KF6 A;  4IOA A;  5ELO A;  3W5O A;  2NVQ H;  4IO9 A;  4UP7 A;  4HIK A;  1EIF A;  2K4K A;  4DKA C;  1X65 A;  4Y52 H;  3GTK H;  3CCU A;  3CCE A;  1VQF A;  1HH2 P;  3HOY H;  4A93 G;  4R4C A;  3LGJ A;  3T1Y L;  4A3I G;  1IL2 A;  2PNH A;  1Q1E A;  2E8G A;  2Z0S A;  4LWC A;  3U4Z A;  5FJ8 G;  4A3E G;  3CQZ H;  4A3F G;  5IP7 G;  2YTX A;  2N78 A;  4B3S Q;  2R7Z G;  4C3I H;  3A5Z B;  1A0I A;  3ULJ A;  3GTG H;  4JI1 Q;  2D0O A;  2HHH Q;  2ATW A;  3J81 j;  3S1Q H;  4JI2 Q;  1L1O B;  1PA6 A;  1GVP A;  1UE7 A;  3AFP A;  3STB D;  4AIM A;  5GAG C;  1R9T H;  1MIU A;  4JI4 L;  1PH3 A;  1CUK A;  2VNU D;  3RLN A;  1J5E Q;  2E2I H;  1QUQ A;  2N49 A;  1UE5 A;  3CC4 A;  2JA6 H;  1GM5 A;  1Q8K A;  2ID0 A;  1CKM A;  1PH1 A;  3AYH B;  3CPW A;  3IRB A;  4YY3 L;  4GNX B;  1VQP A;  2RHS B;  4DV3 Q;  1NBW A;  1K9M C;  2Y0S E;  4DPG A;  2AWO A;  4JOI A;  4L5Q A;  3GO5 A;  4OXP A;  3CCJ A;  1N32 L;  1KIX A;  4LNQ A;  3TRE A;  1PFS A;  2VS1 A;  3FHW A;  1XNR L;  3G48 A;  1DGS A;  4DV5 Q;  1PYS B;  1Y1V G;  2KHJ A;  4FDB A;  1E1T A;  4IFD I;  3MEF A;  2YU9 H;  5JEA G;  5M3F H;  3I4N H;  3PSI A;  1VQM A;  4OO1 G;  3M3Y H;  1CSP A;  2CFM A;  1WOC A;  4DR2 Q;  4LF5 Q;  3OTO Q;  2PQA A;  2HIV A;  4DV2 L;  5J3B A;  4KHP L;  2N8N A;  1X56 A;  2LXJ A;  4DK3 C;  3CCR A;  1ASZ A;  4NB3 A;  4YCW A;  2UUB Q;  1FJG L;  3T1H L;  4JI5 Q;  4BY1 H;  5GRO A;  1X55 A;  3UDX A;  4BXX G;  1XJV A;  4Y7N H;  3K0X A;  3AEV A;  2K52 A;  1WCM H;  4A3B G;  3KJO A;  3GTJ H;  4UY8 C;  2BH8 A;  3CAM A;  4A3K G;  2ZTE A;  3G4S A;  1IBL Q;  4R4T A;  3CXC A;  5C3E H;  1VS0 A;  3CP0 A;  4JI0 Q;  4IPH A;  3HOV G;  4K0K L;  4X66 Q;  5FLM G;  2ZJP A;  3PO2 G;  4A3L H;  4YWK A;  1Q12 A;  1BVS A;  5FLM H;  1VQH A;  3UDF A;  1Z9F A;  3U50 C;  2DUD A;  1CKN B;  1P8L A;  2NVT H;  2I5L X;  4BA1 I;  5AJ3 Q;  4NXN Q;  3K80 C;  1HR0 L;  5ELN A;  4DV1 Q;  1WI5 A;  1XMO L;  2CWP A;  1CKO A;  2WAQ E;  3EN2 A;  2PQA B;  5DLQ E;  1YBY A;  5IYC G;  1FJG Q;  2CKZ B;  5K36 G;  4AYB E;  2WAQ G;  1WCM G;  1JJG A;  2JJQ A;  4JI3 Q;  5IP7 H;  3F2D A;  3PV0 A;  3GTO H;  4DR6 L;  1OXS C;  2OTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...