2ES2A

Crystal structure analysis of the bacillus subtilis cold shock protein bs-cspb in complex with hexathymidine
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
b'MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*TP*TP*TP*T)-3'
publication title T-rich DNA single strands bind to a preformed site on the bacterial cold shock protein Bs-CspB.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2es2A00
3J81i 4DUYQ 2Q2IA 1Y1VH 1DGSA 4MTNA 1OXTA 2PQAB 1PH2A 3NEMA 3U4ZA 5GAEC 4HJ8A 3KDFA 4QL5A 5EAYA 2RF4A 3S1NH 4JOIA 4JI2Q 2E2HH 2Q2UA 2AMCB 1YI2A 2MO0A 4BY7H 1EWIA 1X3GA 2UXBQ 5IP9G 3T1HL 1XNQL 3BZKA 5GAHC 4GKKL 4DV0L 3PO2H 1K83H 1N33L 1GVPA 3I56A 1VCIA 4NXML 4B3RL 1CSQA 4POFA 5FLMG 1N9WA 1NTGA 2LXJA 2ASBA 5IT9c 3K0XA 3RN5A 1L1OB 2OQ0A 2YV5A 2A19A 4DV7L 4DR5L 1W3SA 4DNIA 5IWAQ 4P73A 3PUYA 1AE2A 3S14H 4EQ5A 4LNQA 3M9BA 1JE5A 1PH1A 5HY6A 1C0AA 2IX1A 1EUJA 2D0PA 4GOPC 5JEAG 4HIOA 3ULPA 2JEAI 4IOAA 4GN5A 3U50C 1Y1WG 3CPFA 4R4OA 1VS0A 3TEHB 2NZOA 1YITA 3M85A 1V43A 4JG2A 2AHOB 1V1QA 3MEFA 4LUOA 3WWVA 4IJHA 4C2MH 3DLLA 3CCRA 1Q46A 1KAWA 4LF5L 1PVOA 1K9MC 2GVAA 4H02A 3CMEA 4A3CH 4AYBE 3CCVA 1XPOA 1WCMH 2ZJQA 1UE7A 1V9PA 1G51A 1TWHH 3AQQA 4LFAQ 4DUZL 5IYDH 4Y52H 1XNRL 4A3FG 4IPGA 2CFMA 1Z9FA 2VNUD 1TWFH 2ZTDA 4KHPQ 4HJ9A 1FJGL 2UXDL 1QZHA 3GDEA 3H3VI 1ASYA 2DGYA 4LF8L 3U4VA 3J81j 1PV4A 2VUMH 1KRTA 2VZAA 3OW2A 1X55A 4AYBG 3MXNB 4A3IG 1YHQA 4JI0L 1E1OA 1OXXK 2VQEL 4DV1L 4K0KL 2RCNA 1NY4A 3KF8B 5C44H 1YIJA 3HOXH 1QZGA 3HOVH 4L5TA 1I6HH 1PH5A 4GOPA 1XJVA 3TRZA 4IO9A 2JA9A 4TVAB 3T1HQ 3ZJYC 1XNQQ 4LUZA 4LW1A 5FLXc 5AJ3L 4DV0Q 2HHHL 4LWCA 5IYCG 4GKKQ 1N32Q 1L2FA 4NXMQ 2MQHA 2V1CC 1IBKL 3HKZE 4IFDG 4B3RQ 1MIUA 3PCOB 4WJ4A 1Q1BA 3S1MH 5C4XG 2OQKA 3KLWA 2PNHA 3NELA 1GD7A 2NVYH 3KJOA 1BKBA 4DV6Q 5IYBH 3HOWG 2ATWA 3S2HH 1SFOH 4QQBX 1B70B 2EIFA 3K81C 2K5VA 4GS3A 5LMNW 5LMUL 4DV7Q 4DR5Q 1K73C 3M4PA 1M1KC 4OO1G 3FHWA 5M3FG 1A8VA 1W2BA 5DLQE 4B3TQ 2QEXA 1EIFA 1JJ2A 1VQIA 2FXQA 5H1SE 1VQKA 3HKZG 1VQAA 1Y1VG 3GTJH 4LFBL 3PF4A 2WB1E 2AWNA 1L0WA 4A3EH 3CD6A 4DV2L 3J7ZC 1P16A 1GO3E 2JA6H 5GAGC 3SGIA 2NVXH 4LF5Q 4PZ7A 1EIYB 4GLAC 4BY1G 3PO2G 1Y14B 4XIGS 4DUZQ 4X65L 2ES2A 1UWVA 1XTDA 1XNRQ 4OX9L 1WI5A 2JA7H 4DR4L 1CUKA 2WB1G 4LF7Q 5BR8L 2KHJA 3Q8DA 4JI3L 1UE6A 4X66Q 2UXDQ 2N78A 2PQAA 3CF5A 1A62A 3IRBA 2WP8J 1EQQA 3H3VH 4JV5L 4BA1I 4Y7NH 4LF8Q 4LF9Q 1YBYA 4IPHA 1S72A 1P8LA 1JB7A 1PYSB 4JI0Q 1CKOA 1TWGH 2N3SA 1T9HA 5C3EG 4BBSH 2VQEQ 4YWLA 4DV1Q 1KRSA 3UDXA 5M3MH 4YY3L 5C0XG 2VQFL 3K7UC 3HOZH 4DR6L 2YTVA 4LFCL 2UXCL 2IHFA 3S16H 3GTPH 2CWPA 2UUBL 4DV3L 1HR0Q 5JEAJ 4OWWB 3GTMH 1SN8A 1TXYA 3I2ZA 3W5OA 2HHHQ 5K36G 2NN6G 3PUZA 5ELNA 1IBKQ 3TS2A 1L1OA 1G291 3STBD 4A3CG 1WCMG 1Z47A 2R92H 2ZJRA 4YHHL 1KC8C 1VQ6A 5IYDG 4JYAQ 2K5NA 1OXSC 4C3JH 4DR3Q 1IZ6A 2EQSA 4IOCA 3PGZA 1FVIA 3TQYA 4KI0A 3I4OA 4P75A 2R93H 2VS1A 4C3HH 3L2PA 3E0EA 4HJAA 2BH2A 5JJIA 2JJQA 2JK8A 3AYHB 3J7A5 1XPUA 4LFBQ 3AFPA 2PI2E 3OTOL 4JYAL 3PO3G 2N49A 1SR3A 4TQUS 1HZBA 4HJ7A 4JI8L 1VQBA 3GO5A 4DV2Q 2AWOA 4L5QA 2C35B 3KOJA 2ID0A 3ER0A 5C44G 1X65A 4UP9A 3HOXG 3HOVG 1B8AA 4X64L 4GN3B 3RZDH 2R7DA 3CCEA 4RMFA 2IT1A 3HFZB 1HZCA 5GROA 1HJPA 1K8AC 1NMGA 3CC2A 2JA8H 4XTCS 1FGUA 2Y0SE 3PUWA 3PUVA 1Q7YC 4PZ8A 1VQJA 4OX9Q 1MKHA 4DR4Q 1N36L 1VQGA 5BR8Q 3H0GH 2OTJA 2B29A 2DUDA 1S3OA 2IHEA 3G48A 4JCVE 3CCMA 1IBLL 5IYBG 1EFWA 4JI3Q 2B63H 4R4QA 4A3DH 4JV5Q 1HNXL 4A4IA 3M7NA 3EN2A 1KQSA 1VQHA 2XTIA 1VQOA 1AH9A 1C7YA 2UUCQ 2HIXA 2Y0SG 4A3MH 1UE1A 2WFWA 3A5ZB 1X6OA 2Q2TA 3U58A 4DKAC 1YHAA 2NZHA 3CW2C 2MNAA 3RN2A 3KFUA 4QGUA 1CKMA 4LFCQ 4A3EG 1HZ9A 2K5HA 4DV5L 3RLOA 4LF4L 3GTGH 3CP0A 1IBML 1XMQL 2E5LL 4A3BH 4JI1L 2JA6G 3KYHC 1O7IA 3JC66 1OXUA 1WJJA 1KD1C 2ZJPA 4YWMA 3S1QH 1HNWL 2UUAL 2JA7G 1N32L 4LUVA 1N33Q 1HH2P 1C9OA 2HIVA 1VQFA 1PFSA 5GQOA 4A3JH 4BXXH 4GKJL 5FLMH 1YEZA 3BZCA 5E7NA 3ULJA 4JI4L 4LF6L 1NBWA 1J6QA 2R6GA 4JBWA 2E2JH 1VQNA 4QJFA 1Q1EA 2E2IH 4YCVA 4YCUA 4B3SL 3OTOQ 1NMFA 1D7QA 2F52A 1QVCA 1RL2A 4GLVB 2F4VL 3L0OA 4BBSG 4B3ML 3NENA 1U0LA 4JI8Q 4ALPA 2KBNA 5C4JH 5M3MG 2NVTH 3HOUH 4JI5L 2K4KA 2XGTA 4R1JA 3KF6A 3HOZG 3CCQA 4GNXB 4A3GH 3K7AH 4OXPA 3ULLA 5J3BA 1PA6A 4JBMA 5FJ8H 1YVCA 1I50H 4A75A 4MNOA 1VQDA 4JBKA 2WAQE 4DR7L 3T1YL 4BBRH 2UXBL 2R92G 2F3IA 2H5XA 3CCSA 4BY7G 1N8RC 1HNXQ 3M4QA 1PHJA 2K14A 2Q2HA 3D0FA 4NXNL 4PG3A 4A3KH 2A1AA 1OTCA 4JI7L 3AEVA 3ICEA 4JBJA 1CKNB 4DR1L 3PSIA 4R4IA 3CC7A 2CKZB 3RZOH 2R93G 3D31A 1FJGQ 4R4TA 4QY7A 4AQYL 2WAQG 1JMCA 4JI6L 5IE8A 1PH6A 2I5LX 1E3PA 4L5SA 2LXKA 3G71A 3PF5A 4PMWA 3M3YH 4DK3C 3G4SA 2OCEA 4DV5Q 1Q8KA 4LF4Q 3PIPA 1Q12A 1XMQQ 2E5LQ 2K50A 4K0KQ 1KHIA 1YJ9A 2OWOA 3PUXA 1LUZA 1YJWA 3AFQA 1HNWQ 1QVFA 4APVA 1HZAA 4EX5A 2PMZE 2UUAQ 2HT1A 2BA0A 3LGJA 5AJ3Q 3B6YA 3PIOA 3H0GG 1TWAH 2N8NA 2ZTCA 5HGQA 4GKJQ 2R7ZG 1JT8A 2QA4A 2RHQB 1XPRA 1HR0W 2VW9A 2B63G 4A3DG 4BA2I 3CC4A 1LYLA 3HOWH 3HKSA 4X62L 4DK6C 3VDYA 1MJCA 4IPDA 4B3SQ 5LMUQ 3I4NH 3S15H 1IYJB 2JEBI 1KIXA 4KHPL 1YNXA 2KCMA 1NE3A 4A3MG 4B3MQ 4OWXB 1N34L 1PH3A 2ALYB 3CXCA 4JI5Q 1X9NA 1QUQB 2JE6I 3EBEA 4P74A 3S1RH 4IFDJ 2R7ZH 2VUMG 1X56A 3H15A 1A0IA 2I0QA 4UP8A 1HNZL 4YCWA 2IY5B 5JJKA 2KCTA 2YYZA 4A3BG 2D0OA 4DR7Q 3T1YQ 3GD7A 3I7FA 3F2CA 1U5KA 2GN5A 1X54A 2VY3A 3DM3A 4BY1H 1YHBA 2QGQA 4NXNQ 1PH4A 4X65Q 1I5FA 4A3JG 4JI7Q 4BXXG 3RLNA 5LMNL 1Q81C 4GNXC 2HQLA 4DV6L 1D8LA 4DR1Q 3KDFB 4IPCA 5IP7H 1EYGA 2JA5H 1IL2A 3S2DH 4A93H 4AQYQ 3UE1A 4JI6Q 1R9TH 1UEBA 3RNUA 4A3LH 4DV4L 1QVGA 1EOVA 3M4OH 2Z6KC 3CCUA 4B3TL 1RIPA 2Z0SA 3J80i 5C3EH 3HOUG 1M90C 1JJCB 2NVQH 1GM5A 4AH6A 1Q82C 1ASZA 3FKIH 3F8TA 4YY3Q 1PH9A 4UY8C 3HOYH 3I4MH 3JAMc 4MZ9A 3GTQH 3KJPA 2ZM6L 3I55A 2VQFQ 3UDFA 4A3GG 3A74A 1K0RA 1XMOL 4DR6Q 4DAYB 3CPWA 1PYBA 2UXCQ 3S24A 1K8GA 3A0JA 2A8VA 3TREA 5FJ8G 2D62A 4DV3Q 1J5EL 2UUBQ 1I3QH 4O2DA 2R7FA 4OWTB 3GTLH 3CQZH 2E8GA 2EXDA 4KLKA 4BBRG 2CQOA 1EQRA 1G6PA 4X62Q 1VQ9A 2MFIA 2KHIA 5IP9H 1LTLA 3E9HA 4YHHQ 4DR2L 4A3KG 1VQPA 1VQ8A 3OYYA 4NPSA 4LF7L 1AE3A 2PI2A 3F2DA 1S40A 4DPGA 2K52A 2K75A 2RHSB 2BH8A 4X66L 4GNXA 1I94L 4IFDI 4HIMA 3STBC 1N34Q 1E24A 4HIKA 1TWCH 4UP7A 3L7ZC 5GADC 4WJ3M 4O0AA 4LF9L 3UDIA 2IX0A 1X3EA 3PO3H 2UU9L 4OO1I 4AIMA 2Z6KA 1JJGA 3J81c 1IXRA 2I5HA 1HNZQ 1E22A 4ME3A 5M5WH 4GN4B 1VQCA 1SMXA 3CAMA 2YU9H 2VL6A 1GKHA 3FP9A 4P71A 2MO1A 4X64Q 4DUYL 5C0XJ 4J15A 1BVSA 1HR0L 1CKNA 1FL0A 1YZ6A 2JQOA 1UE5A 1Q86C 1Y1WH 3A5UA 1BBWA 1VQLA 4POGA 2I5MX 1BBUA 4OONA 2LSSA 3F2BA 5LMNQ 1N36Q 4QIWE 4JI2L 2CWAA 1KXLA 1PH8A 1B7YB 1IBLQ 4NB3A 1VQEA 5M5XH 2CCZA 3K8AA 3UDGA 2B3GA 3TS0A 3I4NG 3EIVA 4DV4Q 4GOPB 3RLFA 4DR3L 4A3FH 3S17H 3NBHB 4GLXA 1A63A 4P72A 3RR5A 1H95A 1E1TA 3J80c 1WYDA 2ZM6Q 4PZ6A 3BU2A 2GVBA 1XMOQ 5IWAL 3K80C 4A3IH 1OXVA 1J5EQ 3ERSX 3JAMi 3G6EA 1IBMQ 1L1OC 1E7ZA 1YJNA 5C0XI 4JI1Q 1VQ4A 3GTKH 4JOIC 4KHZA 4UPAA 1LM0A 1KL9A 4L5RC 1CSPA 4X6AH 1WOCA 2ZTEA 4A76A 3UE0A 1SROA 3KF6B 2JA8G 1VQ5A 4DR2Q 1SRUA 1PH7A 3BJUA 5M5YH 5IYCH 3F1ZA 1SLJA 2KENA 2NN6I 4IJLA 1QUQA 3CMAA 2YTYA 1SE8A 2BA1A 3E9IA 1I94Q 5IP7G 2JA5G 5C4XH 5ELOA 4C3IH 4DAMA 1NJIC 1MJEA 4JI4Q 3W1GA 5IY0A 4LF6Q 3PV0A 1WFQA 3CCLA 3GTOH 5JJLA 4A3LG 4LFAL 3W1BA 2UUCL 2UU9Q 4HJ5A 4RG1A 2AKWB 5M3FH 2OTLA 2YTXA 4YWKA 2F4VQ 2L15A 4HIDA 4A93G 3HOYG 4JC0A 3FKIG 3CCJA 1VQMA 1VQ7A 3I4MG 1X3FA 4FDBA 4R4CA 1K3RA
chains in the Genus database with same CATH superfamily
2FINB 2Q2IA 1Y1VH 3BS1A 1GUNA 1OXTA 2PQAB 1PH2A 1XX8A 3NEMA 5GAEC 4YIJA 4QL5A 3TN2A 3K5LA 4JOIA 2A69D 4BY7H 1SYCA 1X3GA 1BCPB 1XNQL 1RKNA 3BZKA 5CV5A 5IGEA 5GAHC 4GKKL 1K83H 1N33L 4KK7A 3S1RB 4B3RL 1KABA 1L0YB 3A7AB 2K5DA 2MJ8A 1NTGA 4LMQD 3RN5A 1L1OB 4DR5L 1W3SA 1ET6A 4P73A 1TVXA 3I72A 1FGBD 4NMZA 1B44D 3TP8A 5C0XH 3FPPA 1EUJA 2D0PA 4I7AA 4GOPC 3ND9A 2JEAI 2L5TA 4J1MA 1T5EA 1Y1WG 4R4OA 3TEHB 1YITA 4CJ1B 3M85A 1H9SB 2AHOB 3MEFA 1Q46A 2EYLA 2SDFA 1WCMH 5EGTA 4A3MB 4HSPA 1V9PA 1TWHH 3FKIB 1AFPA 5IYDH 4OIJA 3FRPB 1FJGL 1GUOA 1HA5A 5NUCA 2VUMH 3GTLB 3MXNB 4JI0L 1E1OA 1MD2D 1XXGA 3MC0B 1GUSA 3HOVH 2B2YA 1I6HH 1JOKA 1XJVA 4LJZC 3VYRA 2JA9A 1STYA 4TVAB 3NBHA 4MTKA 3V2TA 5AJ3L 4IFDG 2EE1A 1FNUA 3PCOB 1PXUA 3KLWA 1GD7A 4JW0A 5J1ZA 2ATWA 3S2HH 3NTIA 2EIFA 1M1KC 5M3FG 1A8VA 5KYIA 2B2VC 2QEXA 1JJ2A 5EPJA 3VR5A 1WTOA 5ELDA 2PZWA 1UNSA 1VQAA 1Y8PB 5KNCA 2WB1E 4A3EH 4R9WA 2XRQD 2XNAC 1RODA 3MXGA 3H94A 5GAGC 2NVXH 1DXMA 4BY1G 1Y14B 3VYTA 4IUTA 1RD9D 2NUCA 1H9JA 1IW7D 2UXDQ 2WP8J 2Z9HA 4KN7C 4BA1I 1S4ZA 2SOBA 2LKVA 4EQPA 2QCPX 1B50A 3SDZA 4DNRB 1PYSB 4KV6A 1CZWA 1TWGH 1T9HA 1JC7A 4NP5A 4YY3L 3BG3A 3V05A 1AN8A 3K7UC 3HOZH 1RHPA 2F0VA 3N6RA 3S16H 2A68D 3GTPH 2OEOA 1SBBB 4DV3L 5JEAJ 1EQVA 1SN8A 1TXYA 3I2ZA 2NN6G 3GTOB 3QIAA 3TS2A 1G291 2K01A 3K5MA 4A3CG 4YHHL 1KC8C 1VQ6A 5KNBA 4JYAQ 2K5NA 1IZ6A 4IOCA 1F9QA 1G2SA 5FLXE 3OWEB 5KGUA 4P75A 2BH2A 1LT5D 4IZ8A 1ICFB 1SR3A 3E6ZX 1HZBA 1NAPA 3GO5A 4DV2Q 2XWBB 1S5BD 4BY1B 4UP9A 4NW2A 3BVGA 1SNOA 4GN3B 1GJXA 2IT1A 2KVMA 5GROA 1HJPA 1K8AC 4HCSA 2JA8H 1BR9A 1DD2A 3M4YA 2Z4HA 1S5CD 3LWEA 3S2DB 2HCCA 1Q7YC 1VQJA 1MKHA 1RTNA 1SE4A 1N36L 1VQGA 2DUDA 2IHEA 4ILWA 2B63H 2I07B 1HNXL 4A4IA 3EN2A 1F2MA 3I4MB 3HOYB 1AH9A 2HIXA 3H91A 2Y0SG 4ZKBB 3BDCA 2BOSA 1HRJA 1STAA 3U58A 4DKAC 3KFUA 4C2MB 4QMGA 3OSOA 3TZUA 1HZ9A 2K5HA 3D6CA 3GTGH 1XMQL 2JA6G 1K0SA 2X6LA 5J39A 3MHBA 2ZJPA 4YWMA 2CH4W 1HNWL 1C9OA 2HQEA 4A3JH 3VA7A 5FLMH 1YEZA 3BZCA 1NBWA 1J6QA 3W2DA 4XDXA 1D7QA 2F52A 4FO2A 2DNCA 4TKOB 4BBSG 2QEJC 3KK7A 2PPBC 1BDOA 3V96A 2XGTA 4R1JA 4A3GH 2QF7A 3A55A 4RKLA 5J3BA 4FF3A 3QO2A 5FJ8H 2KQ3A 2XRSD 5M5XB 1I50H 2OT2A 1IYUA 1O7LA 5D14A 1GHJA 3TZDA 4BBRH 4K14A 4U673 4BY7G 2UXBL 4B9WA 3M4QA 3WOFA 2WINB 4A3KH 2A1AA 3AEVA 3ICEA 4JBJA 1STBA 3J7AF 4DR1L 3RZOH 1KTKA 2L0CA 2WAQG 3NP8A 1PZJD 4ID6A 4LAAA 2SEBD 1E3PA 5IE8A 3PF5A 1R4PB 1CI3M 2OCEA 2E5LQ 4K0KQ 5IGFA 1KHIA 4CKCA 1EY7A 2F4IA 1TS4A 1QVFA 4KD3A 1NSNS 4EX5A 1EIHA 4Y7NB 1BNZA 2N8NA 1BUVT 1WTVA 4GKJQ 2K7VA 4ZYSA 1FD7D 2QA4A 2VW9A 4KN4C 4A3DG 2M2LA 4DK6C 5FK9C 2RCFA 3VDYA 1MJCA 1UEAB 1JWSD 1TQOA 3KLRA 1IYJB 1KIXA 1EY0A 1YNXA 2FFKB 3NWSA 1B53A 4OWXB 4K6DA 3CXCA 3S1RH 3EBEA 5K5PA 1S5DD 3SR1A 2VUMG 3H15A 1H9KA 4BY7B 1F9RA 4ZAIA 5LHY1 4DR7Q 1U5KA 3KLSX 2VY3A 5E1FA 1GHKA 3DM3A 1A3TA 2QGQA 1A3UA 1PH4A 1I5FA 2WAQB 4BXXG 5LMNL 4GNXC 5IGDA 4IPCA 3NQTA 1NCVA 4C1NK 1K3BC 1VMPA 1R9TH 3K59A 1STHA 4DV4L 3S9WA 4FVMA 1LTTD 1QVGA 4J8QA 4B3TL 5L37A 1M90C 2MHVA 4LK1C 4AH6A 4G7HC 1GM5A 3FKIH 3JAMc 3KJPA 2ZM6L 3I55A 2HUGA 5FKAC 3TP5A 3J80E 5C5LA 1PYBA 3CPWA 2UXCQ 4A3DB 3MWYW 1GOZA 4HAEA 1WCMB 1I3QH 3I8ZA 2EY5A 4O2DA 1TWHB 3GTLH 3CQZH 3ND8A 2EXDA 3C46A 1ZXTA 2PMZB 2L4NA 1G6PA 1VQ9A 1VQ8A 1SNDA 2WKCA 5DM63 4LF7L 2O2LD 3F2DA 1S40A 3CRKC 4DPGA 1I94L 4IFDI 2VUMB 1YNJC 1N34Q 3STBC 1E24A 4WJ3M 3L7ZC 3HS0C 3KBXA 1B2TA 3UDIA 1X3EA 5KNDA 3PO3H 2Z6KA 5KIXA 2F0PA 3NK9A 4RAUC 1BCPF 1B3AA 1I6HB 3PMFA 3I70A 4C56C 5M5WH 1SAPA 4GN4B 1VQCA 3CAMA 1IL8A 2KCCA 3FP9A 4P71A 4DUYL 1ENAA 3MFGA 1Y1WH 3VR3A 3S2HB 4POGA 2CWAA 1KXLA 1PH8A 1IBLQ 1VQEA 2NVTB 2B3GA 3TS0A 4GOPB 1V1PA 3K7AB 4NDXA 2QKIC 1QNKA 2F0JA 1A63A 2HDLA 1MGSA 1I4XA 1LT3D 4ZQ3A 5IT9E 1XMOQ 4DXFA 3MAQA 1QWYA 2EJMA 2F0HA 3G6EA 1YJNA 1PLFA 1LM0A 1B3QA 1KL9A 5HGTA 2JA8G 3KF6B 3DMUA 4ZUIA 4N8FA 1IKMA 1N32Q 1AZPA 2NN6I 3OIPA 1SE8A 4IFDH 1G2TA 3NQIA 1DOKA 4XQQA 3URYA 1CHPD 2KOLA 1MJEA 3P20A 1A2TA 5AFWA 3GTOH 5JJLA 2VB3X 4HJ5A 1JE4A 5M3FH 3HOZB 4IUVA 1JQYD 4A93G 1R4QB 3CCJA 1VQMA 3EVQA 5HGQA 3J81i 1PRTC 2F0TA 3OMCA 3U4ZA 3DWQA 1S5ED 2RF4A 4QUFA 2RVLA 3S1NH 4PMCA 3A8IE 2E2HH 2Q2UA 1SXTA 3OIQA 5IGBA 4DV0L 2NBFA 1VCIA 1ONLA 5FLMG 2LXJA 3H6MA 3BYTB 1SYDA 3K0XA 1JCKB 2A19A 4DV7L 4DNIA 1AE2A 3S14H 4KY7A 1JE5A 2JA8B 2JYOA 5HY6A 1CT1D 1TS5A 1F77A 2IX1A 4HIOA 3SHLA 4IOAA 2PZUA 3U50C 1LTBD 3CPFA 1VS0A 2NN6H 4JG2A 1BXTA 4C2MH 1V1QA 4LUOA 3CCMA 1HA6A 4IJHA 4LF5L 2K32A 3SXHA 4BS9A 2GVAA 4H02A 2F0KA 4A3CH 1FR3A 5IOCA 3S1QB 2B2UA 2B8GA 4UDUC 4Z9CB 4DUZL 1XNRL 4A3FG 3SK8A 1Z9FA 4EQNA 1JWUD 2ZTDA 4N8X1 1A15A 1V1OA 4R8NA 3H3VI 2E76C 4LF8L 2Q8RE 1PV4A 1X55A 1VF7A 4A3IG 1YHQA 1ILPA 4P2CB 1I6VC 2VQEL 1EYDA 2RCNA 2A6EC 1NY4A 3KF8B 3RMHA 2KHSA 1U9RA 4L5TA 4XQJA 4A3JB 4IO9A 1XNQQ 3DM1A 4LUZA 5FLXc 1TWCB 4GKKQ 2HHHL 1PTOF 2HCIA 4HSVA 3T13A 5IYCG 3C3LA 4B3RQ 2V1CC 1MIUA 3MFYA 1Q1BA 5C4XG 2OQKA 3KJOA 2PNHA 4DV6Q 2NVYH 4K5VA 1SFOH 1B70B 3K81C 2J7ZA 4DR5Q 5G3LF 4A3GB 5DLQE 5HURA 1EIFA 4JK1C 1BO0A 5H1SE 1VDZA 1G6ZA 3K58A 1L0WA 3CD6A 1LV9A 4BBRB 4V0BA 1P16A 2JA6H 4A3FB 4PZ7A 5CV7A 4GLAC 3PO2G 3G7LA 2ES2A 4X65L 1GUWA 2PW5A 4DR4L 1F9PA 1TS3A 4MHEA 2RDGA 4A3IB 2K5QA 2PQAA 3CF5A 3H3VH 2WACA 4Y7NH 4OELB 1QJOA 4JI0Q 4OGQC 2N3SA 4BBSH 4CHTB 4YWLA 1Q3LA 5M9OA 1I4PA 2VQFL 4KD4A 5A2QL 1XWEA 4DR6L 2PQEA 4LFCL 4G7ZC 3EFXD 1E0BA 2UUBL 1EYAA 3U9SA 5CGKA 1BF4A 1HR0Q 3W5OA 3MEHA 1ESRA 5ELNA 1DJRD 2K05A 1L1OA 4HEDA 4RHSA 1YNJD 1ILQA 3STBD 3X3MA 3DHQA 3JAML 1NR2A 3CRLC 2BE5C 4RGMA 1OXSC 2EQSA 1FVIA 3I4OA 2VS1A 4DAYA 5JJIA 4HTHA 3J7A5 4GZYC 1H9SA 3PO3G 4HJ7A 4JI8L 1IYVA 2AWOA 3KOJA 5JAVA 5C44G 1SDFA 3HOXG 4X64L 2WV6D 1SE3A 3CC2A 1RTOA 4X3UA 2HDMA 1H9RA 2Y0SE 1R9TB 3DEOA 2F0WA 1EY4A 4JCVE 4A3DH 3SE0A 4K5XA 1U4LA 3M7NA 1RF2D 1KQSA 1VQHA 1VQOA 5T1IA 3NWTA 2UUCQ 2KJXA 1WD1A 5E4WC 1RCVD 4B9XA 1UE1A 3A5ZB 1X6OA 5ELEA 4MIUA 2Q2TA 2NZHA 3A8KE 1ZYRC 5LL6X 5JPMC 1I3QB 4RGTA 4OHJA 3ONAB 3I91A 3CQZB 1SYFA 1ML0D 4HR7B 4DV5L 4LF4L 3K5OA 1IBML 1E2WA 5D3DA 4JI1L 2TMPA 3KYHC 1O7IA 1CA6A 1WJJA 3CKIB 1ESFA 5GQOA 1HCZA 1VQFA 1X32A 4BXXH 3PO3B 4DK1A 1ENCA 2R6GA 2E2JH 5M5WB 3NUCA 1PRTD 1Q1EA 4Q0FA 4O1NA 5C44B 3HOXB 1QVCA 1SSOA 4GLVB 2F4VL 3TP7A 3L0OA 1Y69U 1KAAA 1QB5D 1U0LA 1ZEQX 2EJFC 5C4JH 4ALPA 4B3ML 2FMMA 2NVTH 4JI5L 3EROA 1NUCA 4K6LA 1Y1WB 1I4GA 3CCQA 4GNXB 3K7AH 4OXPA 1A3VA 1YVCA 3BYYB 2WAQE 2A5HA 2HD3A 3T1YL 2P5ZX 2R92G 2IWHA 1HNXQ 3R93A 5I2XA 2K14A 2Q2HA 1LTRD 2K33A 4C3JG 3TP6A 5ISRA 1CKNB 4Q5VA 4ODGA 4C3HG 3D31A 4QY7A 4AQYL 4KY5A 1B9NA 4I65A 2RA4A 2CHBD 4X3KA 1Q8KA 3SVMA 2G5DA 5FOBB 1XMQQ 4XYOA 2K03A 1YJ9A 3PUXA 1F9SA 3AFQA 2BDOA 1EIGA 1HNWQ 2PMZE 2BA0A 3LGJA 3NSWA 3AB9A 2NB0A 4KKSA 3E0JA 3H0GG 2ZTCA 5C3XA 3P1HA 2R7ZG 2RHQB 2EPBA 5BN4A 1HR0W 5M3FB 3CC4A 3HOWH 3Q6SA 3HKSA 1KDCA 2V4DA 5LMUQ 2KCMA 1STEA 2NTSA 4X3TA 2A6ED 1EWHA 2ALYB 2SNSA 1QUQB 2B2WC 3K6OA 4EGVA 2KECA 3S1NB 2I0QA 3LNNA 1HNZL 2E2HB 4YCWA 2R92B 1O80A 3F2CA 4C3HB 1YHBA 3X3NA 1DZ1A 2EDGA 4ZK9B 4DR1Q 2HQLA 1EYGA 3KDFB 3R2TA 1TT2A 3S14B 2F0OA 3UE1A 4H13C 3RNUA 2EXZA 3M4OH 3SEBA 3CCUA 2M00A 2Z0SA 3HOUG 5FLXL 3PF4A 1JJCB 2BDNA 2NVQH 1Q82C 3S1QH 4A93H 2O4XA 2ZXPA 4MZ9A 3GTQH 5EJWA 1K0RA 3H0GB 3S24A 1K8GA 2R7ZB 3A0JA 5D3IB 1STNA 1SNCA 1J5EL 2F0LA 1CA5A 1SEBD 2E8GA 1IKLA 4RGNA 1CHQD 2KHIA 3E9HA 1PRTB 3OYYA 2K52A 1HHVA 4HIKA 1TWCH 5E4XA 5GADC 4MN3A 2LFNA 4JVZA 1FYCA 4ME3A 1EU3A 2EYJA 2F0QA 2D2CC 5CR3A 1BBXC 2VL6A 2MO1A 2EYHA 1BVSA 1Q86C 1G8ZD 2H4OA 1V8QA 2NVYB 2BE5D 1BBWA 4IQZA 1SFOB 3F2BA 5LMNQ 2LSSA 1QE6A 1UUPA 4JI2L 2SNMA 4NB3A 2Y0SB 2K5WA 3UDGA 1LLRD 2B8FA 3I4NG 4DV4Q 2FHTA 4A3FH 3S17H 1LTAD 3W3AA 1BCPC 1E1TA 4N9TA 5CV8A 1WYDA 2ZM6Q 2MUYA 2GVBA 2BCOA 5IWAL 2RSNA 3MVVA 4A3IH 2JA6B 3NTKA 2XSCA 2QW7A 5FO7B 2IW3A 1JR0D 4RCNA 1L1OC 2QDBA 4XXEA 1K28A 5BN3A 4FXGC 3NPPA 4JOIC 4L5RC 3UE0A 2QILA 5ELFA 3BJUA 5IYCH 1SLJA 3D3RA 3QG1A 4IJLA 2F0NA 1ET9A 1I94Q 2JA5G 5C4XH 4C3IH 1NJIC 1D1KA 1ZYRD 4JI4Q 4LF6Q 4BBSB 4A3LG 4LFAL 3J7YW 5CV6A 2L15A 2E74C 4JC0A 4PMBA 1EOTA 1O7YA 4R4CA 4DUYQ 1TWAB 1TR5A 5JJZA 1DGSA 4MTNA 2Z6BA 4HJ8A 5EAYA 1EFID 1U4RA 2PNRC 3J81E 2D5DA 3I4NB 1XTCD 3KUPA 5DEHA 2AMCB 1YI2A 2MO0A 1KNEA 1EWIA 3T1HL 3PO2H 3D4RA 1F2ZA 4IALA 3I56A 4QIWB 4NXML 2ASBA 3Q23A 2PO4A 4WORA 3Q24A 2YV5A 1JWMD 3EJIA 1MHWC 4O42A 4EQ5A 3M9BA 2F0UA 5CORA 3NHHA 4DFAA 1C0AA 2B2YC 5JEAG 2ZXRA 2JSOA 4GN5A 2JA5B 2IL8A 2KUMA 2NZOA 5J22A 5C4ZA 4FNFA 1PVOA 1KAWA 1K9MC 1LACA 3M7GA 1UE7A 5EPKA 3AQQA 4QUCA 1G91A 1Y8NB 4IPGA 5LL6S 1K8OA 2CFMA 3C2PA 4NKLA 4KHPQ 1QZHA 3GDEA 4S3SA 4RH6A 3GV3A 2DGYA 2IJ0A 2VZAA 4AYBG 3FDTA 4WJWA 1D2BA 2ENBA 4KMUC 4DV1L 4K0KL 5C44H 1YIJA 3HOXH 4GOPA 3J80L 4OEMB 2DJGC 5D65A 1E2ZA 4LW1A 4DV0Q 1FNWA 1L2FA 1PFNA 2MQHA 1IBKL 2E2JB 4RWSC 4WJ4A 5I9OA 2NTTA 3NELA 1C8CA 2OTJA 1BKBA 3HOWG 3OPOA 1TU2B 5C4JB 4QQBX 4H7BA 5LMNW 4OO1G 4DV7Q 3M4PA 3MA2B 1VQIA 3NE5B 1H9MA 3HKZG 4LFBL 1TY2A 1I4QA 1PFBA 2AWNA 2IX3A 3J7ZC 3KBGA 3Q0AA 1PTOC 4LF5Q 2XIWA 2EY1A 2RKSA 1MSGA 2EYOA 1EU4A 1EIYB 4XIGS 4G4KA 4DUZQ 1XTDA 3VA5A 4OX9L 1WI5A 1XNRQ 1CUKA 5F2DA 5BR8L 4JI3L 1UE6A 4X66Q 2ZT9C 1A62A 3IRBA 4JV5L 4LF8Q 4LF9Q 1YBYA 4IPHA 1PDQA 1JB7A 2VQEQ 4CKEA 3QJYA 5EKLA 2YTVA 5IT9L 2UXCL 2IHFA 1KDBA 3TMEA 4OWWB 3GTMH 1EL0A 5K36G 2HHHQ 3HOWB 3PUZA 1JICA 2EOTA 2AQ3B 2H1EA 2KEEA 2OXPA 2X6GA 1X3QA 1QOHA 5A35A 5E3FA 2R92H 3A56A 2ZJRA 1TS2A 5FO8B 1PZKD 4C3JH 4DR3Q 3PGZA 4C3HH 2JJQA 3AYHB 4QF4A 2RBMA 1XPUA 2C5CA 3AFPA 2PI2E 3OTOL 4FF4A 2N49A 4TQUS 3TSSA 1VQBA 4L5QA 2C35B 2G9HD 5CBEE 1C48A 1B8AA 3RZDH 3CCEA 5JOBA 3VR2A 4RMFA 1HZCA 1NMGA 4XTCS 1EY9A 1FGUA 2A6HC 3PUVA 1LABA 4PZ8A 4DR4Q 3H0GH 2B29A 4IFDJ 1S3OA 4PV1C 2R7ZH 2JP1A 5C3WA 1IBLL 5IYBG 3M4OB 1NNXA 1PFMA 4R4QA 2JXMB 1JOOA 2F0FA 2NVQB 3SK5A 4A93B 2XTIA 3K57A 3KF8A 4IN3A 4C1NI 4DAVA 1C7YA 3GTQB 2WFWA 3AU7A 1YHAA 2MNAA 3PIO3 1CKMA 4LFCQ 1EY5A 3RLOA 3IL8A 3OMGA 2L9HA 2RDHA 3D8GA 1F2LA 4XYQA 1OXUA 2XN9C 1KD1C 3RUZA 4JPBW 2A74C 4KJNA 3F2UA 5C6AA 2UUAL 1QCBD 2JA7G 1N32L 1N33Q 1HH2P 2HIVA 3VR4A 5EPLA 2IPKD 1EZ6A 1BOSA 3ULJA 4C3IG 3MTSA 1DOLA 1VQNA 1J9OA 3A8JE 4QJFA 2E2IH 4YCUA 4B3SL 1NMFA 2PZTA 1DYQA 3NENA 4JI8Q 1HFNA 2KBNA 2DY7A 5M3MG 3HOUH 2F0EA 2K4KA 1VMCA 1AW7A 3ULLA 3S1MB 2DNEA 1WTQA 1DCZA 1Q8IA 4MNOA 1VQDA 3K0YA 2F0DA 5BN5A 1M8AA 2H5XA 3CCSA 3S17B 1PHJA 3D0FA 4NXNL 4PG3A 5JVH3 1OTCA 4JI7L 2O5JC 3GTJB 1X3PA 2LMCB 2R93G 1FJGQ 4R4TA 2MGSA 4N9PA 1JMCA 4JI6L 1PH6A 2I5LX 3GQBA 1SYEA 3G71A 4PMWA 3VYUA 3M3YH 4DV5Q 4LF4Q 2RDFA 1PRTF 2K50A 1LTID 2XVSA 2L11A 2OWOA 1YJWA 4ME5A 1HZAA 2B2TA 2EYMA 2F3WA 5C4XB 1IHZA 4C3IB 3LWUA 5AJ3Q 1TWAH 4DA2A 1SNMA 1L0XB 2XWJB 4BA2I 1LYLA 4X62L 3NTHA 3DEPA 4IPDA 3S15H 4FP5D 3I4NH 2JEBI 3D6WA 1J8IA 4A3MG 4B3MQ 1PH3A 4JI5Q 1X9NA 1I4RA 4P74A 1MBYA 5CYUA 2EY2A 2R61A 1X56A 1GXDC 1A0IA 4K8IA 1KLUD 3C1FA 2NZ1D 2NWGA 5JJKA 1JOQA 2KCTA 2YYZA 4A3BG 3PO2B 2D0OA 3T1YQ 3GD7A 2MP1A 2GN5A 1X54A 2R93B 5EQ0A 3ITPA 2E75C 2QDLA 4DF7A 4F8MA 2B39A 1YNNC 3QR8A 4DV6L 4XT1B 2JA5H 3A54A 2ICEC 1DONA 5IGCA 3L3OC 2LY7A 3MXNA 4AQYQ 1UEBA 3UI2A 4L6TB 4A3LH 4CBVA 2Z6KC 3P75A 5C3EH 1ASZA 5I6WA 4YY3Q 1PH9A 4UY8C 1PTOD 3U9OA 3UDFA 3ERQA 4U68A 4DAYB 4DV3Q 4M8AA 1MI2A 2FJ2A 1WD0A 5G3LD 3E5SA 2LS01 2Z8LA 4DR2L 1VQPA 4YHHQ 4DXGA 2PI2A 4GNXA 2BH8A 4HIMA 1QG7A 4A3BB 3BDLA 2UU9L 4OO1I 3J81c 1Q90A 1IXRA 3FVQA 1HNZQ 1E22A 2GA4B 1WTXA 1SMXA 2N88A 5IGGA 5C0XJ 4J15A 5JEAH 1HR0L 1CKNA 3A5UA 1HUMA 2I5MX 4OONA 1N36Q 4QIWE 2K28A 1O78A 1B7YB 3IKJA 2L1BA 1RDPD 2CCZA 3K8AA 1MSHA 3AMUA 3EIVA 5DAUA 3RLFA 4IUNA 1SNQA 3NBHB 4CJ2C 4EVOA 2F0GA 3MXPA 3RR5A 3WOEA 1H95A 4DK0A 3J80c 1CFMA 4CGYB 1GUTA 1EYCA 5COYA 1OXVA 2A6HD 1J5EQ 3ERSX 3T16A 3JAMi 1VQ4A 1D6EC 2ZXOA 3HGBA 1HQRD 4X6AH 2VXWA 3FEWX 1WVLA 4L63B 3DUZA 5EBCA 5M5YH 1VF5C 3CMAA 2KENA 1U4PA 1QUQA 2YTYA 3E9IA 4OL7A 5IP7G 1C4QA 1HUNA 3W1GA 5IY0A 2I46A 1DOMA 5IIFA 3W1BA 2UUCL 4OO1H 1TIID 5CMDA 2OTLA 4OIKA 3HOYG 3DXJC 3I4MG 3GTMB 1X3FA 2D9UA 4QGUA 2EJGC 1QILA 2Q8TA 1Z7TA 3N52A 3R2IA 3QOLA 3TDQA 1ICWA 3KDFA 4J6HA 1O7ZA 2DN8A 1D5MC 3OW7A 4JI2Q 1TY0A 4K2LA 4C3JB 5I2YA 2AUKA 2UXBQ 5IP9G 2A73B 2R3ZA 2B2UC 3FPUB 1GVPA 3EQLC 4KHVA 1CSQA 2EVBA 4POFA 1N9WA 5IT9c 3IAYA 3EA6A 1PTOB 2OQ0A 1SJHD 5IWAQ 3PUYA 3RZDB 2AQ1B 4F88A 4LNQA 2L12A 4FF1A 1EY8A 2CW0C 1PH1A 4L8JA 3ULPA 1I4HA 1NR4A 4DU9A 4ZLTF 5K36H 1V43A 3DLLA 3WWVA 1Q81C 1M4VA 3CCRA 1DM0B 4H0LC 1EY6A 3HRZC 3CMEA 3WDNA 4AYBE 3CCVA 1XPOA 2ZJQA 4CJ0B 1G51A 4LFAQ 4Y52H 2K1BA 4BWGB 1AZQA 2VNUD 1TWFH 1CTMA 4UAIA 4HJ9A 5EKKA 2UXDL 1ASYA 4HMIA 1OO9B 3U4VA 3J81j 1KRTA 3OW2A 1JORA 3R3OA 1Y8OB 1OXXK 3P7JA 5FO9B 1QZGA 2NYZD 3IFTA 3T53B 1PH5A 3TRZA 1KLGD 3T1HQ 3ZJYC 4XQNA 4LWCA 2CVRA 3NXWA 4NXMQ 5T1GA 3HKZE 3OWFA 2E2IB 3S1MH 4KJOA 4DN4M 1KNAA 5IYBH 3HOUB 1QNUA 4GS3A 4H44C 2K5VA 2EYFA 5LMUL 4JYAL 3HG9A 2YU9B 1K73C 2FMCA 3FHWA 1W2BA 5DM73 4B3TQ 1PZID 2FXQA 1VQKA 2C9OA 1Y1VG 2KCNA 3GTJH 4M1UB 3I90A 2B2TC 3SK4A 1S5FD 4DV2L 4HCEA 1B1ZA 2E2DC 1SMYC 1GO3E 1K8MA 1YNND 3SGIA 1D5ZC 3RD4A 1HTPA 1UWVA 2JA7H 2WB1G 4LF7Q 3J7AV 2K6AA 2KHJA 3Q8DA 3SK6A 2RQXA 2N78A 3M3YB 4F7XA 3IFDA 4ABNA 1EQQA 4G7OC 4PNYA 4DGZA 4I7ZC 1S72A 3GTKB 1P8LA 2OF1A 1KDAA 4PQXA 1CKOA 5C3EG 1Z6HA 5DNFA 4DV1Q 1D5XC 1KRSA 3UDXA 5M3MH 1LTGD 5C0XG 3GP7A 3T51B 3E3XA 1D1IA 2F03A 2CWPA 1II3A 2EZVA 3BVZA 4CDFC 2F0MA 3QOJA 1IBKQ 3S15B 1UAPA 5I4DA 1WCMG 1CQVA 1Z47A 1AP0A 1RJTA 4K2KA 5EKIA 5IYDG 2F1MA 1CQFA 1Y1VB 2F3VA 3TQYA 4KI0A 2R93H 4ZKCB 3L2PA 3E0EA 4HJAA 2CH4A 2JK8A 5CBAE 3K5NA 2L55A 5KRUA 4LFBQ 4B08A 3QB3A 3ZYYX 3G6JB 3T56B 3DWAA 1PMRA 2ID0A 1K83B 3ER0A 1X65A 3NBIA 3HOVG 2R7DA 2WB1B 3HFZB 2Q8IB 1CM9A 1PYWD 3FMCA 3PUWA 4OX9Q 5BR8Q 3L9AX 3J81L 4FXDA 4JI3Q 4KTAA 3G48A 3GV6A 1EFWA 2G9DA 4JV5Q 2EY6A 5C3EB 4RCOA 4CDCC 4QCLA 2J0TD 3BDOA 4A3MH 4G57A 4HN7A 3CW2C 3RN2A 4X3SA 5TSSA 4A3EG 2JN4A 1LT6D 4E6IA 3CP0A 2E5LL 5KYLA 4QB4A 4A3BH 3DWPA 3JC66 4LUVA 3VR6A 4RGOS 1PFSA 2AUJD 3I73A 4GKJL 1SE2A 5E7NA 3O13A 2A69C 4JI4L 4LF6L 4JBWA 1WTRA 1JB3A 1SYBA 4YCVA 4IUQA 3OTOQ 1SYGA 1HPCA 3HOVB 1RL2A 2N55A 2TSSA 3R8BA 5IODA 4FYDA 3KF6A 3HOZG 2F0SA 2PCFB 2Z4IA 1PA6A 4TSSA 4JBMA 2CQAA 3Q22A 4A75A 2WKDA 3HP3A 1A2UA 4JBKA 3H09A 4DR7L 2ICIA 1T5XD 2F3IA 1N8RC 4IURA 1WTHA 4KKTA 3PSIA 4R4IA 3CC7A 2CKZB 3D4WA 4AYBB 4A3EB 2CW0D 4CDDC 4DNTB 1ZKOA 4FXKC 3D4DA 4R8IA 4L5SA 2LXKA 2NVXB 4DK3C 3G4SA 2B2VA 3PIPA 1Q12A 1SNPA 4DAPA 3I3CA 1V1PB 2F0IA 5CV9A 5M5YB 4IUPA 3PQIA 1LUZA 2WIIB 4APVA 2UUAQ 2HT1A 1XYIA 4HMJA 3B6YA 3PIOA 1JT8A 1XPRA 2B63G 1TWGB 3BZDB 1HTLD 3MZ5A 3T4AC 4K5WA 4B3SQ 3HKZB 2Z1CA 2KEDA 4KHPL 1NE3A 3S16B 5C4HA 3BVMA 3GTPB 1N34L 3KLSA 4RKBA 3OOCA 3HEJA 2JE6I 1HQMC 4UP8A 1GUGA 5CC4A 2IY5B 1PTOH 1A6XA 1AEXA 2RSOA 3CHBD 1LO5D 3I7FA 4K8JA 2DY8A 3C1EA 1EEID 4BY1H 4NXNQ 1ENFA 4KY6A 4X65Q 4A3JG 4JI7Q 1EEFD 3RLNA 1IL2A 1D8LA 3MXUA 5IP7H 3S2DH 1BCPD 2PW7A 1E2VA 3OHXC 4JI6Q 3PIP3 1EOVA 5JPNC 5EBDA 1RIPA 1EWCA 3J80i 1IW7C 3A7LA 3HOYH 3I4MH 3F8TA 5ELCA 1SMYD 4F87A 2DJFC 1WTWA 5CV4A 4A3GG 2B2WA 2VQFQ 3A74A 1XMOL 4DR6Q 1WTPA 1SJED 2A8VA 2B63B 3TREA 5FJ8G 2D62A 2UUBQ 2J4XA 5I9PA 2R7FA 4OWTB 4BBRG 1W6KA 4KLKA 2CQOA 1TWFB 1EQRA 4V190 1BQQT 4X62Q 2A68C 2MFIA 5IP9H 1LTLA 4A3KG 4ZUJA 4NPSA 1AE3A 4UHVA 2RHSB 2K75A 4X66L 1B4OA 4UP7A 3QWNA 3GTGB 4O0AA 4LF9L 3H3VC 5I6YA 2IX0A 1LTSD 4AIMA 1JJGA 2I5HA 4RHRA 4WFN3 2YU9H 1GKHA 1HFGA 4X64Q 5C5MA 3HZXA 2MPMA 4ZRZA 1FL0A 1B9MA 1YZ6A 2JQOA 1UE5A 3TBIB 1VQLA 1EQTA 2X69A 1BBUA 1LT4D 1CZGA 5M5XH 5JVG3 4KKUA 2O5IC 1U4MA 4DR3L 4GLXA 4P72A 4WRDA 4TRDA 4CKBA 2M9VA 5A2QE 1W6JA 4PZ6A 1I50B 3BU2A 4ULLA 2PYKA 2EYPA 3K80C 4RA8A 1EZ8A 4FF2A 4CDEC 1IBMQ 1F2YA 1FNVA 5ELBA 1STGA 1E7ZA 4A3KB 5C0XI 4JI1Q 3GTKH 2JA7B 4KHZA 4UPAA 4IUUA 1CSPA 1WOCA 2ZTEA 3RZOB 4A76A 1SROA 3JAME 1VQ5A 4DR2Q 1SRUA 3LX0A 1PH7A 3F1ZA 4EQOA 2BA1A 2KA7A 4ZCKA 2VB2X 5ELOA 4DAMA 3PV0A 1WFQA 3VYSA 3CCLA 3CU7A 5M3MB 1HXYD 2AQ2B 4RFBA 2UU9Q 4RG1A 3I4LA 2AKWB 4XT3B 5KEEA 2YTXA 4YWKA 2F4VQ 4HIDA 1TKWB 3FKIG 1VQ7A 1CK1A 4FDBA 2K04A 1K3RA
chains in the Genus database with same CATH topology
3J81i 4DUYQ 2Q2IA 1Y1VH 1DGSA 4MTNA 1OXTA 2PQAB 1PH2A 3NEMA 3U4ZA 5GAEC 4HJ8A 3KDFA 4QL5A 5EAYA 2RF4A 3S1NH 4JOIA 4JI2Q 2E2HH 2Q2UA 2AMCB 1YI2A 2MO0A 4BY7H 1EWIA 1X3GA 2UXBQ 5IP9G 3T1HL 1XNQL 3BZKA 5GAHC 4GKKL 4DV0L 3PO2H 1K83H 1N33L 1GVPA 3I56A 1VCIA 4NXML 4B3RL 1CSQA 4POFA 5FLMG 1N9WA 1NTGA 2LXJA 2ASBA 5IT9c 3K0XA 3RN5A 1L1OB 2OQ0A 2YV5A 2A19A 4DV7L 4DR5L 1W3SA 4DNIA 5IWAQ 4P73A 3PUYA 1AE2A 3S14H 4EQ5A 4LNQA 3M9BA 1JE5A 1PH1A 5HY6A 1C0AA 2IX1A 1EUJA 2D0PA 4GOPC 5JEAG 4HIOA 3ULPA 2JEAI 4IOAA 4GN5A 3U50C 1Y1WG 3CPFA 4R4OA 1VS0A 3TEHB 2NZOA 1YITA 3M85A 1V43A 4JG2A 2AHOB 1V1QA 3MEFA 4LUOA 3WWVA 4IJHA 4C2MH 3DLLA 3CCRA 1Q46A 1KAWA 4LF5L 1PVOA 1K9MC 2GVAA 4H02A 3CMEA 4A3CH 4AYBE 3CCVA 1XPOA 1WCMH 2ZJQA 1UE7A 1V9PA 1G51A 1TWHH 3AQQA 4LFAQ 4DUZL 5IYDH 4Y52H 1XNRL 4A3FG 4IPGA 2CFMA 1Z9FA 2VNUD 1TWFH 2ZTDA 4KHPQ 4HJ9A 1FJGL 2UXDL 1QZHA 3GDEA 3H3VI 1ASYA 2DGYA 4LF8L 3U4VA 3J81j 1PV4A 2VUMH 1KRTA 2VZAA 3OW2A 1X55A 4AYBG 3MXNB 4A3IG 1YHQA 4JI0L 1E1OA 1OXXK 2VQEL 4DV1L 4K0KL 2RCNA 1NY4A 3KF8B 5C44H 1YIJA 3HOXH 1QZGA 3HOVH 4L5TA 1I6HH 1PH5A 4GOPA 1XJVA 3TRZA 4IO9A 2JA9A 4TVAB 3T1HQ 3ZJYC 1XNQQ 4LUZA 4LW1A 5FLXc 5AJ3L 4DV0Q 2HHHL 4LWCA 5IYCG 4GKKQ 1N32Q 1L2FA 4NXMQ 2MQHA 2V1CC 1IBKL 3HKZE 4IFDG 4B3RQ 1MIUA 3PCOB 4WJ4A 1Q1BA 3S1MH 5C4XG 2OQKA 3KLWA 2PNHA 3NELA 1GD7A 2NVYH 3KJOA 1BKBA 4DV6Q 5IYBH 3HOWG 2ATWA 3S2HH 1SFOH 4QQBX 1B70B 2EIFA 3K81C 2K5VA 4GS3A 5LMNW 5LMUL 4DV7Q 4DR5Q 1K73C 3M4PA 1M1KC 4OO1G 3FHWA 5M3FG 1A8VA 1W2BA 5DLQE 4B3TQ 2QEXA 1EIFA 1JJ2A 1VQIA 2FXQA 5H1SE 1VQKA 3HKZG 1VQAA 1Y1VG 3GTJH 4LFBL 3PF4A 2WB1E 2AWNA 1L0WA 4A3EH 3CD6A 4DV2L 3J7ZC 1P16A 1GO3E 2JA6H 5GAGC 3SGIA 2NVXH 4LF5Q 4PZ7A 1EIYB 4GLAC 4BY1G 3PO2G 1Y14B 4XIGS 4DUZQ 4X65L 2ES2A 1UWVA 1XTDA 1XNRQ 4OX9L 1WI5A 2JA7H 4DR4L 1CUKA 2WB1G 4LF7Q 5BR8L 2KHJA 3Q8DA 4JI3L 1UE6A 4X66Q 2UXDQ 2N78A 2PQAA 3CF5A 1A62A 3IRBA 2WP8J 1EQQA 3H3VH 4JV5L 4BA1I 4Y7NH 4LF8Q 4LF9Q 1YBYA 4IPHA 1S72A 1P8LA 1JB7A 1PYSB 4JI0Q 1CKOA 1TWGH 2N3SA 1T9HA 5C3EG 4BBSH 2VQEQ 4YWLA 4DV1Q 1KRSA 3UDXA 5M3MH 4YY3L 5C0XG 2VQFL 3K7UC 3HOZH 4DR6L 2YTVA 4LFCL 2UXCL 2IHFA 3S16H 3GTPH 2CWPA 2UUBL 4DV3L 1HR0Q 5JEAJ 4OWWB 3GTMH 1SN8A 1TXYA 3I2ZA 3W5OA 2HHHQ 5K36G 2NN6G 3PUZA 5ELNA 1IBKQ 3TS2A 1L1OA 1G291 3STBD 4A3CG 1WCMG 1Z47A 2R92H 2ZJRA 4YHHL 1KC8C 1VQ6A 5IYDG 4JYAQ 2K5NA 1OXSC 4C3JH 4DR3Q 1IZ6A 2EQSA 4IOCA 3PGZA 1FVIA 3TQYA 4KI0A 3I4OA 4P75A 2R93H 2VS1A 4C3HH 3L2PA 3E0EA 4HJAA 2BH2A 5JJIA 2JJQA 2JK8A 3AYHB 3J7A5 1XPUA 4LFBQ 3AFPA 2PI2E 3OTOL 4JYAL 3PO3G 2N49A 1SR3A 4TQUS 1HZBA 4HJ7A 4JI8L 1VQBA 3GO5A 4DV2Q 2AWOA 4L5QA 2C35B 3KOJA 2ID0A 3ER0A 5C44G 1X65A 4UP9A 3HOXG 3HOVG 1B8AA 4X64L 4GN3B 3RZDH 2R7DA 3CCEA 4RMFA 2IT1A 3HFZB 1HZCA 5GROA 1HJPA 1K8AC 1NMGA 3CC2A 2JA8H 4XTCS 1FGUA 2Y0SE 3PUWA 3PUVA 1Q7YC 4PZ8A 1VQJA 4OX9Q 1MKHA 4DR4Q 1N36L 1VQGA 5BR8Q 3H0GH 2OTJA 2B29A 2DUDA 1S3OA 2IHEA 3G48A 4JCVE 3CCMA 1IBLL 5IYBG 1EFWA 4JI3Q 2B63H 4R4QA 4A3DH 4JV5Q 1HNXL 4A4IA 3M7NA 3EN2A 1KQSA 1VQHA 2XTIA 1VQOA 1AH9A 1C7YA 2UUCQ 2HIXA 2Y0SG 4A3MH 1UE1A 2WFWA 3A5ZB 1X6OA 2Q2TA 3U58A 4DKAC 1YHAA 2NZHA 3CW2C 2MNAA 3RN2A 3KFUA 4QGUA 1CKMA 4LFCQ 4A3EG 1HZ9A 2K5HA 4DV5L 3RLOA 4LF4L 3GTGH 3CP0A 1IBML 1XMQL 2E5LL 4A3BH 4JI1L 2JA6G 3KYHC 1O7IA 3JC66 1OXUA 1WJJA 1KD1C 2ZJPA 4YWMA 3S1QH 1HNWL 2UUAL 2JA7G 1N32L 4LUVA 1N33Q 1HH2P 1C9OA 2HIVA 1VQFA 1PFSA 5GQOA 4A3JH 4BXXH 4GKJL 5FLMH 1YEZA 3BZCA 5E7NA 3ULJA 4JI4L 4LF6L 1NBWA 1J6QA 2R6GA 4JBWA 2E2JH 1VQNA 4QJFA 1Q1EA 2E2IH 4YCVA 4YCUA 4B3SL 3OTOQ 1NMFA 1D7QA 2F52A 1QVCA 1RL2A 4GLVB 2F4VL 3L0OA 4BBSG 4B3ML 3NENA 1U0LA 4JI8Q 4ALPA 2KBNA 5C4JH 5M3MG 2NVTH 3HOUH 4JI5L 2K4KA 2XGTA 4R1JA 3KF6A 3HOZG 3CCQA 4GNXB 4A3GH 3K7AH 4OXPA 3ULLA 5J3BA 1PA6A 4JBMA 5FJ8H 1YVCA 1I50H 4A75A 4MNOA 1VQDA 4JBKA 2WAQE 4DR7L 3T1YL 4BBRH 2UXBL 2R92G 2F3IA 2H5XA 3CCSA 4BY7G 1N8RC 1HNXQ 3M4QA 1PHJA 2K14A 2Q2HA 3D0FA 4NXNL 4PG3A 4A3KH 2A1AA 1OTCA 4JI7L 3AEVA 3ICEA 4JBJA 1CKNB 4DR1L 3PSIA 4R4IA 3CC7A 2CKZB 3RZOH 2R93G 3D31A 1FJGQ 4R4TA 4QY7A 4AQYL 2WAQG 1JMCA 4JI6L 5IE8A 1PH6A 2I5LX 1E3PA 4L5SA 2LXKA 3G71A 3PF5A 4PMWA 3M3YH 4DK3C 3G4SA 2OCEA 4DV5Q 1Q8KA 4LF4Q 3PIPA 1Q12A 1XMQQ 2E5LQ 2K50A 4K0KQ 1KHIA 1YJ9A 2OWOA 3PUXA 1LUZA 1YJWA 3AFQA 1HNWQ 1QVFA 4APVA 1HZAA 4EX5A 2PMZE 2UUAQ 2HT1A 2BA0A 3LGJA 5AJ3Q 3B6YA 3PIOA 3H0GG 1TWAH 2N8NA 2ZTCA 5HGQA 4GKJQ 2R7ZG 1JT8A 2QA4A 2RHQB 1XPRA 1HR0W 2VW9A 2B63G 4A3DG 4BA2I 3CC4A 1LYLA 3HOWH 3HKSA 4X62L 4DK6C 3VDYA 1MJCA 4IPDA 4B3SQ 5LMUQ 3I4NH 3S15H 1IYJB 2JEBI 1KIXA 4KHPL 1YNXA 2KCMA 1NE3A 4A3MG 4B3MQ 4OWXB 1N34L 1PH3A 2ALYB 3CXCA 4JI5Q 1X9NA 1QUQB 2JE6I 3EBEA 4P74A 3S1RH 4IFDJ 2R7ZH 2VUMG 1X56A 3H15A 1A0IA 2I0QA 4UP8A 1HNZL 4YCWA 2IY5B 5JJKA 2KCTA 2YYZA 4A3BG 2D0OA 4DR7Q 3T1YQ 3GD7A 3I7FA 3F2CA 1U5KA 2GN5A 1X54A 2VY3A 3DM3A 4BY1H 1YHBA 2QGQA 4NXNQ 1PH4A 4X65Q 1I5FA 4A3JG 4JI7Q 4BXXG 3RLNA 5LMNL 1Q81C 4GNXC 2HQLA 4DV6L 1D8LA 4DR1Q 3KDFB 4IPCA 5IP7H 1EYGA 2JA5H 1IL2A 3S2DH 4A93H 4AQYQ 3UE1A 4JI6Q 1R9TH 1UEBA 3RNUA 4A3LH 4DV4L 1QVGA 1EOVA 3M4OH 2Z6KC 3CCUA 4B3TL 1RIPA 2Z0SA 3J80i 5C3EH 3HOUG 1M90C 1JJCB 2NVQH 1GM5A 4AH6A 1Q82C 1ASZA 3FKIH 3F8TA 4YY3Q 1PH9A 4UY8C 3HOYH 3I4MH 3JAMc 4MZ9A 3GTQH 3KJPA 2ZM6L 3I55A 2VQFQ 3UDFA 4A3GG 3A74A 1K0RA 1XMOL 4DR6Q 4DAYB 3CPWA 1PYBA 2UXCQ 3S24A 1K8GA 3A0JA 2A8VA 3TREA 5FJ8G 2D62A 4DV3Q 1J5EL 2UUBQ 1I3QH 4O2DA 2R7FA 4OWTB 3GTLH 3CQZH 2E8GA 2EXDA 4KLKA 4BBRG 2CQOA 1EQRA 1G6PA 4X62Q 1VQ9A 2MFIA 2KHIA 5IP9H 1LTLA 3E9HA 4YHHQ 4DR2L 4A3KG 1VQPA 1VQ8A 3OYYA 4NPSA 4LF7L 1AE3A 2PI2A 3F2DA 1S40A 4DPGA 2K52A 2K75A 2RHSB 2BH8A 4X66L 4GNXA 1I94L 4IFDI 4HIMA 3STBC 1N34Q 1E24A 4HIKA 1TWCH 4UP7A 3L7ZC 5GADC 4WJ3M 4O0AA 4LF9L 3UDIA 2IX0A 1X3EA 3PO3H 2UU9L 4OO1I 4AIMA 2Z6KA 1JJGA 3J81c 1IXRA 2I5HA 1HNZQ 1E22A 4ME3A 5M5WH 4GN4B 1VQCA 1SMXA 3CAMA 2YU9H 2VL6A 1GKHA 3FP9A 4P71A 2MO1A 4X64Q 4DUYL 5C0XJ 4J15A 1BVSA 1HR0L 1CKNA 1FL0A 1YZ6A 2JQOA 1UE5A 1Q86C 1Y1WH 3A5UA 1BBWA 1VQLA 4POGA 2I5MX 1BBUA 4OONA 2LSSA 3F2BA 5LMNQ 1N36Q 4QIWE 4JI2L 2CWAA 1KXLA 1PH8A 1B7YB 1IBLQ 4NB3A 1VQEA 5M5XH 2CCZA 3K8AA 3UDGA 2B3GA 3TS0A 3I4NG 3EIVA 4DV4Q 4GOPB 3RLFA 4DR3L 4A3FH 3S17H 3NBHB 4GLXA 1A63A 4P72A 3RR5A 1H95A 1E1TA 3J80c 1WYDA 2ZM6Q 4PZ6A 3BU2A 2GVBA 1XMOQ 5IWAL 3K80C 4A3IH 1OXVA 1J5EQ 3ERSX 3JAMi 3G6EA 1IBMQ 1L1OC 1E7ZA 1YJNA 5C0XI 4JI1Q 1VQ4A 3GTKH 4JOIC 4KHZA 4UPAA 1LM0A 1KL9A 4L5RC 1CSPA 4X6AH 1WOCA 2ZTEA 4A76A 3UE0A 1SROA 3KF6B 2JA8G 1VQ5A 4DR2Q 1SRUA 1PH7A 3BJUA 5M5YH 5IYCH 3F1ZA 1SLJA 2KENA 2NN6I 4IJLA 1QUQA 3CMAA 2YTYA 1SE8A 2BA1A 3E9IA 1I94Q 5IP7G 2JA5G 5C4XH 5ELOA 4C3IH 4DAMA 1NJIC 1MJEA 4JI4Q 3W1GA 5IY0A 4LF6Q 3PV0A 1WFQA 3CCLA 3GTOH 5JJLA 4A3LG 4LFAL 3W1BA 2UUCL 2UU9Q 4HJ5A 4RG1A 2AKWB 5M3FH 2OTLA 2YTXA 4YWKA 2F4VQ 2L15A 4HIDA 4A93G 3HOYG 4JC0A 3FKIG 3CCJA 1VQMA 1VQ7A 3I4MG 1X3FA 4FDBA 4R4CA 1K3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 i;  4DUY Q;  2Q2I A;  1Y1V H;  1DGS A;  4MTN A;  1OXT A;  2PQA B;  1PH2 A;  3NEM A;  3U4Z A;  5GAE C;  4HJ8 A;  3KDF A;  4QL5 A;  5EAY A;  2RF4 A;  3S1N H;  4JOI A;  4JI2 Q;  2E2H H;  2Q2U A;  2AMC B;  1YI2 A;  2MO0 A;  4BY7 H;  1EWI A;  1X3G A;  2UXB Q;  5IP9 G;  3T1H L;  1XNQ L;  3BZK A;  5GAH C;  4GKK L;  4DV0 L;  3PO2 H;  1K83 H;  1N33 L;  1GVP A;  3I56 A;  1VCI A;  4NXM L;  4B3R L;  1CSQ A;  4POF A;  5FLM G;  1N9W A;  1NTG A;  2LXJ A;  2ASB A;  5IT9 c;  3K0X A;  3RN5 A;  1L1O B;  2OQ0 A;  2YV5 A;  2A19 A;  4DV7 L;  4DR5 L;  1W3S A;  4DNI A;  5IWA Q;  4P73 A;  3PUY A;  1AE2 A;  3S14 H;  4EQ5 A;  4LNQ A;  3M9B A;  1JE5 A;  1PH1 A;  5HY6 A;  1C0A A;  2IX1 A;  1EUJ A;  2D0P A;  4GOP C;  5JEA G;  4HIO A;  3ULP A;  2JEA I;  4IOA A;  4GN5 A;  3U50 C;  1Y1W G;  3CPF A;  4R4O A;  1VS0 A;  3TEH B;  2NZO A;  1YIT A;  3M85 A;  1V43 A;  4JG2 A;  2AHO B;  1V1Q A;  3MEF A;  4LUO A;  3WWV A;  4IJH A;  4C2M H;  3DLL A;  3CCR A;  1Q46 A;  1KAW A;  4LF5 L;  1PVO A;  1K9M C;  2GVA A;  4H02 A;  3CME A;  4A3C H;  4AYB E;  3CCV A;  1XPO A;  1WCM H;  2ZJQ A;  1UE7 A;  1V9P A;  1G51 A;  1TWH H;  3AQQ A;  4LFA Q;  4DUZ L;  5IYD H;  4Y52 H;  1XNR L;  4A3F G;  4IPG A;  2CFM A;  1Z9F A;  2VNU D;  1TWF H;  2ZTD A;  4KHP Q;  4HJ9 A;  1FJG L;  2UXD L;  1QZH A;  3GDE A;  3H3V I;  1ASY A;  2DGY A;  4LF8 L;  3U4V A;  3J81 j;  1PV4 A;  2VUM H;  1KRT A;  2VZA A;  3OW2 A;  1X55 A;  4AYB G;  3MXN B;  4A3I G;  1YHQ A;  4JI0 L;  1E1O A;  1OXX K;  2VQE L;  4DV1 L;  4K0K L;  2RCN A;  1NY4 A;  3KF8 B;  5C44 H;  1YIJ A;  3HOX H;  1QZG A;  3HOV H;  4L5T A;  1I6H H;  1PH5 A;  4GOP A;  1XJV A;  3TRZ A;  4IO9 A;  2JA9 A;  4TVA B;  3T1H Q;  3ZJY C;  1XNQ Q;  4LUZ A;  4LW1 A;  5FLX c;  5AJ3 L;  4DV0 Q;  2HHH L;  4LWC A;  5IYC G;  4GKK Q;  1N32 Q;  1L2F A;  4NXM Q;  2MQH A;  2V1C C;  1IBK L;  3HKZ E;  4IFD G;  4B3R Q;  1MIU A;  3PCO B;  4WJ4 A;  1Q1B A;  3S1M H;  5C4X G;  2OQK A;  3KLW A;  2PNH A;  3NEL A;  1GD7 A;  2NVY H;  3KJO A;  1BKB A;  4DV6 Q;  5IYB H;  3HOW G;  2ATW A;  3S2H H;  1SFO H;  4QQB X;  1B70 B;  2EIF A;  3K81 C;  2K5V A;  4GS3 A;  5LMN W;  5LMU L;  4DV7 Q;  4DR5 Q;  1K73 C;  3M4P A;  1M1K C;  4OO1 G;  3FHW A;  5M3F G;  1A8V A;  1W2B A;  5DLQ E;  4B3T Q;  2QEX A;  1EIF A;  1JJ2 A;  1VQI A;  2FXQ A;  5H1S E;  1VQK A;  3HKZ G;  1VQA A;  1Y1V G;  3GTJ H;  4LFB L;  3PF4 A;  2WB1 E;  2AWN A;  1L0W A;  4A3E H;  3CD6 A;  4DV2 L;  3J7Z C;  1P16 A;  1GO3 E;  2JA6 H;  5GAG C;  3SGI A;  2NVX H;  4LF5 Q;  4PZ7 A;  1EIY B;  4GLA C;  4BY1 G;  3PO2 G;  1Y14 B;  4XIG S;  4DUZ Q;  4X65 L;  2ES2 A;  1UWV A;  1XTD A;  1XNR Q;  4OX9 L;  1WI5 A;  2JA7 H;  4DR4 L;  1CUK A;  2WB1 G;  4LF7 Q;  5BR8 L;  2KHJ A;  3Q8D A;  4JI3 L;  1UE6 A;  4X66 Q;  2UXD Q;  2N78 A;  2PQA A;  3CF5 A;  1A62 A;  3IRB A;  2WP8 J;  1EQQ A;  3H3V H;  4JV5 L;  4BA1 I;  4Y7N H;  4LF8 Q;  4LF9 Q;  1YBY A;  4IPH A;  1S72 A;  1P8L A;  1JB7 A;  1PYS B;  4JI0 Q;  1CKO A;  1TWG H;  2N3S A;  1T9H A;  5C3E G;  4BBS H;  2VQE Q;  4YWL A;  4DV1 Q;  1KRS A;  3UDX A;  5M3M H;  4YY3 L;  5C0X G;  2VQF L;  3K7U C;  3HOZ H;  4DR6 L;  2YTV A;  4LFC L;  2UXC L;  2IHF A;  3S16 H;  3GTP H;  2CWP A;  2UUB L;  4DV3 L;  1HR0 Q;  5JEA J;  4OWW B;  3GTM H;  1SN8 A;  1TXY A;  3I2Z A;  3W5O A;  2HHH Q;  5K36 G;  2NN6 G;  3PUZ A;  5ELN A;  1IBK Q;  3TS2 A;  1L1O A;  1G29 1;  3STB D;  4A3C G;  1WCM G;  1Z47 A;  2R92 H;  2ZJR A;  4YHH L;  1KC8 C;  1VQ6 A;  5IYD G;  4JYA Q;  2K5N A;  1OXS C;  4C3J H;  4DR3 Q;  1IZ6 A;  2EQS A;  4IOC A;  3PGZ A;  1FVI A;  3TQY A;  4KI0 A;  3I4O A;  4P75 A;  2R93 H;  2VS1 A;  4C3H H;  3L2P A;  3E0E A;  4HJA A;  2BH2 A;  5JJI A;  2JJQ A;  2JK8 A;  3AYH B;  3J7A 5;  1XPU A;  4LFB Q;  3AFP A;  2PI2 E;  3OTO L;  4JYA L;  3PO3 G;  2N49 A;  1SR3 A;  4TQU S;  1HZB A;  4HJ7 A;  4JI8 L;  1VQB A;  3GO5 A;  4DV2 Q;  2AWO A;  4L5Q A;  2C35 B;  3KOJ A;  2ID0 A;  3ER0 A;  5C44 G;  1X65 A;  4UP9 A;  3HOX G;  3HOV G;  1B8A A;  4X64 L;  4GN3 B;  3RZD H;  2R7D A;  3CCE A;  4RMF A;  2IT1 A;  3HFZ B;  1HZC A;  5GRO A;  1HJP A;  1K8A C;  1NMG A;  3CC2 A;  2JA8 H;  4XTC S;  1FGU A;  2Y0S E;  3PUW A;  3PUV A;  1Q7Y C;  4PZ8 A;  1VQJ A;  4OX9 Q;  1MKH A;  4DR4 Q;  1N36 L;  1VQG A;  5BR8 Q;  3H0G H;  2OTJ A;  2B29 A;  2DUD A;  1S3O A;  2IHE A;  3G48 A;  4JCV E;  3CCM A;  1IBL L;  5IYB G;  1EFW A;  4JI3 Q;  2B63 H;  4R4Q A;  4A3D H;  4JV5 Q;  1HNX L;  4A4I A;  3M7N A;  3EN2 A;  1KQS A;  1VQH A;  2XTI A;  1VQO A;  1AH9 A;  1C7Y A;  2UUC Q;  2HIX A;  2Y0S G;  4A3M H;  1UE1 A;  2WFW A;  3A5Z B;  1X6O A;  2Q2T A;  3U58 A;  4DKA C;  1YHA A;  2NZH A;  3CW2 C;  2MNA A;  3RN2 A;  3KFU A;  4QGU A;  1CKM A;  4LFC Q;  4A3E G;  1HZ9 A;  2K5H A;  4DV5 L;  3RLO A;  4LF4 L;  3GTG H;  3CP0 A;  1IBM L;  1XMQ L;  2E5L L;  4A3B H;  4JI1 L;  2JA6 G;  3KYH C;  1O7I A;  3JC6 6;  1OXU A;  1WJJ A;  1KD1 C;  2ZJP A;  4YWM A;  3S1Q H;  1HNW L;  2UUA L;  2JA7 G;  1N32 L;  4LUV A;  1N33 Q;  1HH2 P;  1C9O A;  2HIV A;  1VQF A;  1PFS A;  5GQO A;  4A3J H;  4BXX H;  4GKJ L;  5FLM H;  1YEZ A;  3BZC A;  5E7N A;  3ULJ A;  4JI4 L;  4LF6 L;  1NBW A;  1J6Q A;  2R6G A;  4JBW A;  2E2J H;  1VQN A;  4QJF A;  1Q1E A;  2E2I H;  4YCV A;  4YCU A;  4B3S L;  3OTO Q;  1NMF A;  1D7Q A;  2F52 A;  1QVC A;  1RL2 A;  4GLV B;  2F4V L;  3L0O A;  4BBS G;  4B3M L;  3NEN A;  1U0L A;  4JI8 Q;  4ALP A;  2KBN A;  5C4J H;  5M3M G;  2NVT H;  3HOU H;  4JI5 L;  2K4K A;  2XGT A;  4R1J A;  3KF6 A;  3HOZ G;  3CCQ A;  4GNX B;  4A3G H;  3K7A H;  4OXP A;  3ULL A;  5J3B A;  1PA6 A;  4JBM A;  5FJ8 H;  1YVC A;  1I50 H;  4A75 A;  4MNO A;  1VQD A;  4JBK A;  2WAQ E;  4DR7 L;  3T1Y L;  4BBR H;  2UXB L;  2R92 G;  2F3I A;  2H5X A;  3CCS A;  4BY7 G;  1N8R C;  1HNX Q;  3M4Q A;  1PHJ A;  2K14 A;  2Q2H A;  3D0F A;  4NXN L;  4PG3 A;  4A3K H;  2A1A A;  1OTC A;  4JI7 L;  3AEV A;  3ICE A;  4JBJ A;  1CKN B;  4DR1 L;  3PSI A;  4R4I A;  3CC7 A;  2CKZ B;  3RZO H;  2R93 G;  3D31 A;  1FJG Q;  4R4T A;  4QY7 A;  4AQY L;  2WAQ G;  1JMC A;  4JI6 L;  5IE8 A;  1PH6 A;  2I5L X;  1E3P A;  4L5S A;  2LXK A;  3G71 A;  3PF5 A;  4PMW A;  3M3Y H;  4DK3 C;  3G4S A;  2OCE A;  4DV5 Q;  1Q8K A;  4LF4 Q;  3PIP A;  1Q12 A;  1XMQ Q;  2E5L Q;  2K50 A;  4K0K Q;  1KHI A;  1YJ9 A;  2OWO A;  3PUX A;  1LUZ A;  1YJW A;  3AFQ A;  1HNW Q;  1QVF A;  4APV A;  1HZA A;  4EX5 A;  2PMZ E;  2UUA Q;  2HT1 A;  2BA0 A;  3LGJ A;  5AJ3 Q;  3B6Y A;  3PIO A;  3H0G G;  1TWA H;  2N8N A;  2ZTC A;  5HGQ A;  4GKJ Q;  2R7Z G;  1JT8 A;  2QA4 A;  2RHQ B;  1XPR A;  1HR0 W;  2VW9 A;  2B63 G;  4A3D G;  4BA2 I;  3CC4 A;  1LYL A;  3HOW H;  3HKS A;  4X62 L;  4DK6 C;  3VDY A;  1MJC A;  4IPD A;  4B3S Q;  5LMU Q;  3I4N H;  3S15 H;  1IYJ B;  2JEB I;  1KIX A;  4KHP L;  1YNX A;  2KCM A;  1NE3 A;  4A3M G;  4B3M Q;  4OWX B;  1N34 L;  1PH3 A;  2ALY B;  3CXC A;  4JI5 Q;  1X9N A;  1QUQ B;  2JE6 I;  3EBE A;  4P74 A;  3S1R H;  4IFD J;  2R7Z H;  2VUM G;  1X56 A;  3H15 A;  1A0I A;  2I0Q A;  4UP8 A;  1HNZ L;  4YCW A;  2IY5 B;  5JJK A;  2KCT A;  2YYZ A;  4A3B G;  2D0O A;  4DR7 Q;  3T1Y Q;  3GD7 A;  3I7F A;  3F2C A;  1U5K A;  2GN5 A;  1X54 A;  2VY3 A;  3DM3 A;  4BY1 H;  1YHB A;  2QGQ A;  4NXN Q;  1PH4 A;  4X65 Q;  1I5F A;  4A3J G;  4JI7 Q;  4BXX G;  3RLN A;  5LMN L;  1Q81 C;  4GNX C;  2HQL A;  4DV6 L;  1D8L A;  4DR1 Q;  3KDF B;  4IPC A;  5IP7 H;  1EYG A;  2JA5 H;  1IL2 A;  3S2D H;  4A93 H;  4AQY Q;  3UE1 A;  4JI6 Q;  1R9T H;  1UEB A;  3RNU A;  4A3L H;  4DV4 L;  1QVG A;  1EOV A;  3M4O H;  2Z6K C;  3CCU A;  4B3T L;  1RIP A;  2Z0S A;  3J80 i;  5C3E H;  3HOU G;  1M90 C;  1JJC B;  2NVQ H;  1GM5 A;  4AH6 A;  1Q82 C;  1ASZ A;  3FKI H;  3F8T A;  4YY3 Q;  1PH9 A;  4UY8 C;  3HOY H;  3I4M H;  3JAM c;  4MZ9 A;  3GTQ H;  3KJP A;  2ZM6 L;  3I55 A;  2VQF Q;  3UDF A;  4A3G G;  3A74 A;  1K0R A;  1XMO L;  4DR6 Q;  4DAY B;  3CPW A;  1PYB A;  2UXC Q;  3S24 A;  1K8G A;  3A0J A;  2A8V A;  3TRE A;  5FJ8 G;  2D62 A;  4DV3 Q;  1J5E L;  2UUB Q;  1I3Q H;  4O2D A;  2R7F A;  4OWT B;  3GTL H;  3CQZ H;  2E8G A;  2EXD A;  4KLK A;  4BBR G;  2CQO A;  1EQR A;  1G6P A;  4X62 Q;  1VQ9 A;  2MFI A;  2KHI A;  5IP9 H;  1LTL A;  3E9H A;  4YHH Q;  4DR2 L;  4A3K G;  1VQP A;  1VQ8 A;  3OYY A;  4NPS A;  4LF7 L;  1AE3 A;  2PI2 A;  3F2D A;  1S40 A;  4DPG A;  2K52 A;  2K75 A;  2RHS B;  2BH8 A;  4X66 L;  4GNX A;  1I94 L;  4IFD I;  4HIM A;  3STB C;  1N34 Q;  1E24 A;  4HIK A;  1TWC H;  4UP7 A;  3L7Z C;  5GAD C;  4WJ3 M;  4O0A A;  4LF9 L;  3UDI A;  2IX0 A;  1X3E A;  3PO3 H;  2UU9 L;  4OO1 I;  4AIM A;  2Z6K A;  1JJG A;  3J81 c;  1IXR A;  2I5H A;  1HNZ Q;  1E22 A;  4ME3 A;  5M5W H;  4GN4 B;  1VQC A;  1SMX A;  3CAM A;  2YU9 H;  2VL6 A;  1GKH A;  3FP9 A;  4P71 A;  2MO1 A;  4X64 Q;  4DUY L;  5C0X J;  4J15 A;  1BVS A;  1HR0 L;  1CKN A;  1FL0 A;  1YZ6 A;  2JQO A;  1UE5 A;  1Q86 C;  1Y1W H;  3A5U A;  1BBW A;  1VQL A;  4POG A;  2I5M X;  1BBU A;  4OON A;  2LSS A;  3F2B A;  5LMN Q;  1N36 Q;  4QIW E;  4JI2 L;  2CWA A;  1KXL A;  1PH8 A;  1B7Y B;  1IBL Q;  4NB3 A;  1VQE A;  5M5X H;  2CCZ A;  3K8A A;  3UDG A;  2B3G A;  3TS0 A;  3I4N G;  3EIV A;  4DV4 Q;  4GOP B;  3RLF A;  4DR3 L;  4A3F H;  3S17 H;  3NBH B;  4GLX A;  1A63 A;  4P72 A;  3RR5 A;  1H95 A;  1E1T A;  3J80 c;  1WYD A;  2ZM6 Q;  4PZ6 A;  3BU2 A;  2GVB A;  1XMO Q;  5IWA L;  3K80 C;  4A3I H;  1OXV A;  1J5E Q;  3ERS X;  3JAM i;  3G6E A;  1IBM Q;  1L1O C;  1E7Z A;  1YJN A;  5C0X I;  4JI1 Q;  1VQ4 A;  3GTK H;  4JOI C;  4KHZ A;  4UPA A;  1LM0 A;  1KL9 A;  4L5R C;  1CSP A;  4X6A H;  1WOC A;  2ZTE A;  4A76 A;  3UE0 A;  1SRO A;  3KF6 B;  2JA8 G;  1VQ5 A;  4DR2 Q;  1SRU A;  1PH7 A;  3BJU A;  5M5Y H;  5IYC H;  3F1Z A;  1SLJ A;  2KEN A;  2NN6 I;  4IJL A;  1QUQ A;  3CMA A;  2YTY A;  1SE8 A;  2BA1 A;  3E9I A;  1I94 Q;  5IP7 G;  2JA5 G;  5C4X H;  5ELO A;  4C3I H;  4DAM A;  1NJI C;  1MJE A;  4JI4 Q;  3W1G A;  5IY0 A;  4LF6 Q;  3PV0 A;  1WFQ A;  3CCL A;  3GTO H;  5JJL A;  4A3L G;  4LFA L;  3W1B A;  2UUC L;  2UU9 Q;  4HJ5 A;  4RG1 A;  2AKW B;  5M3F H;  2OTL A;  2YTX A;  4YWK A;  2F4V Q;  2L15 A;  4HID A;  4A93 G;  3HOY G;  4JC0 A;  3FKI G;  3CCJ A;  1VQM A;  1VQ7 A;  3I4M G;  1X3F A;  4FDB A;  4R4C A;  1K3R A; 
#chains in the Genus database with same CATH topology
 2FIN B;  2Q2I A;  1Y1V H;  3BS1 A;  1GUN A;  1OXT A;  2PQA B;  1PH2 A;  1XX8 A;  3NEM A;  5GAE C;  4YIJ A;  4QL5 A;  3TN2 A;  3K5L A;  4JOI A;  2A69 D;  4BY7 H;  1SYC A;  1X3G A;  1BCP B;  1XNQ L;  1RKN A;  3BZK A;  5CV5 A;  5IGE A;  5GAH C;  4GKK L;  1K83 H;  1N33 L;  4KK7 A;  3S1R B;  4B3R L;  1KAB A;  1L0Y B;  3A7A B;  2K5D A;  2MJ8 A;  1NTG A;  4LMQ D;  3RN5 A;  1L1O B;  4DR5 L;  1W3S A;  1ET6 A;  4P73 A;  1TVX A;  3I72 A;  1FGB D;  4NMZ A;  1B44 D;  3TP8 A;  5C0X H;  3FPP A;  1EUJ A;  2D0P A;  4I7A A;  4GOP C;  3ND9 A;  2JEA I;  2L5T A;  4J1M A;  1T5E A;  1Y1W G;  4R4O A;  3TEH B;  1YIT A;  4CJ1 B;  3M85 A;  1H9S B;  2AHO B;  3MEF A;  1Q46 A;  2EYL A;  2SDF A;  1WCM H;  5EGT A;  4A3M B;  4HSP A;  1V9P A;  1TWH H;  3FKI B;  1AFP A;  5IYD H;  4OIJ A;  3FRP B;  1FJG L;  1GUO A;  1HA5 A;  5NUC A;  2VUM H;  3GTL B;  3MXN B;  4JI0 L;  1E1O A;  1MD2 D;  1XXG A;  3MC0 B;  1GUS A;  3HOV H;  2B2Y A;  1I6H H;  1JOK A;  1XJV A;  4LJZ C;  3VYR A;  2JA9 A;  1STY A;  4TVA B;  3NBH A;  4MTK A;  3V2T A;  5AJ3 L;  4IFD G;  2EE1 A;  1FNU A;  3PCO B;  1PXU A;  3KLW A;  1GD7 A;  4JW0 A;  5J1Z A;  2ATW A;  3S2H H;  3NTI A;  2EIF A;  1M1K C;  5M3F G;  1A8V A;  5KYI A;  2B2V C;  2QEX A;  1JJ2 A;  5EPJ A;  3VR5 A;  1WTO A;  5ELD A;  2PZW A;  1UNS A;  1VQA A;  1Y8P B;  5KNC A;  2WB1 E;  4A3E H;  4R9W A;  2XRQ D;  2XNA C;  1ROD A;  3MXG A;  3H94 A;  5GAG C;  2NVX H;  1DXM A;  4BY1 G;  1Y14 B;  3VYT A;  4IUT A;  1RD9 D;  2NUC A;  1H9J A;  1IW7 D;  2UXD Q;  2WP8 J;  2Z9H A;  4KN7 C;  4BA1 I;  1S4Z A;  2SOB A;  2LKV A;  4EQP A;  2QCP X;  1B50 A;  3SDZ A;  4DNR B;  1PYS B;  4KV6 A;  1CZW A;  1TWG H;  1T9H A;  1JC7 A;  4NP5 A;  4YY3 L;  3BG3 A;  3V05 A;  1AN8 A;  3K7U C;  3HOZ H;  1RHP A;  2F0V A;  3N6R A;  3S16 H;  2A68 D;  3GTP H;  2OEO A;  1SBB B;  4DV3 L;  5JEA J;  1EQV A;  1SN8 A;  1TXY A;  3I2Z A;  2NN6 G;  3GTO B;  3QIA A;  3TS2 A;  1G29 1;  2K01 A;  3K5M A;  4A3C G;  4YHH L;  1KC8 C;  1VQ6 A;  5KNB A;  4JYA Q;  2K5N A;  1IZ6 A;  4IOC A;  1F9Q A;  1G2S A;  5FLX E;  3OWE B;  5KGU A;  4P75 A;  2BH2 A;  1LT5 D;  4IZ8 A;  1ICF B;  1SR3 A;  3E6Z X;  1HZB A;  1NAP A;  3GO5 A;  4DV2 Q;  2XWB B;  1S5B D;  4BY1 B;  4UP9 A;  4NW2 A;  3BVG A;  1SNO A;  4GN3 B;  1GJX A;  2IT1 A;  2KVM A;  5GRO A;  1HJP A;  1K8A C;  4HCS A;  2JA8 H;  1BR9 A;  1DD2 A;  3M4Y A;  2Z4H A;  1S5C D;  3LWE A;  3S2D B;  2HCC A;  1Q7Y C;  1VQJ A;  1MKH A;  1RTN A;  1SE4 A;  1N36 L;  1VQG A;  2DUD A;  2IHE A;  4ILW A;  2B63 H;  2I07 B;  1HNX L;  4A4I A;  3EN2 A;  1F2M A;  3I4M B;  3HOY B;  1AH9 A;  2HIX A;  3H91 A;  2Y0S G;  4ZKB B;  3BDC A;  2BOS A;  1HRJ A;  1STA A;  3U58 A;  4DKA C;  3KFU A;  4C2M B;  4QMG A;  3OSO A;  3TZU A;  1HZ9 A;  2K5H A;  3D6C A;  3GTG H;  1XMQ L;  2JA6 G;  1K0S A;  2X6L A;  5J39 A;  3MHB A;  2ZJP A;  4YWM A;  2CH4 W;  1HNW L;  1C9O A;  2HQE A;  4A3J H;  3VA7 A;  5FLM H;  1YEZ A;  3BZC A;  1NBW A;  1J6Q A;  3W2D A;  4XDX A;  1D7Q A;  2F52 A;  4FO2 A;  2DNC A;  4TKO B;  4BBS G;  2QEJ C;  3KK7 A;  2PPB C;  1BDO A;  3V96 A;  2XGT A;  4R1J A;  4A3G H;  2QF7 A;  3A55 A;  4RKL A;  5J3B A;  4FF3 A;  3QO2 A;  5FJ8 H;  2KQ3 A;  2XRS D;  5M5X B;  1I50 H;  2OT2 A;  1IYU A;  1O7L A;  5D14 A;  1GHJ A;  3TZD A;  4BBR H;  4K14 A;  4U67 3;  4BY7 G;  2UXB L;  4B9W A;  3M4Q A;  3WOF A;  2WIN B;  4A3K H;  2A1A A;  3AEV A;  3ICE A;  4JBJ A;  1STB A;  3J7A F;  4DR1 L;  3RZO H;  1KTK A;  2L0C A;  2WAQ G;  3NP8 A;  1PZJ D;  4ID6 A;  4LAA A;  2SEB D;  1E3P A;  5IE8 A;  3PF5 A;  1R4P B;  1CI3 M;  2OCE A;  2E5L Q;  4K0K Q;  5IGF A;  1KHI A;  4CKC A;  1EY7 A;  2F4I A;  1TS4 A;  1QVF A;  4KD3 A;  1NSN S;  4EX5 A;  1EIH A;  4Y7N B;  1BNZ A;  2N8N A;  1BUV T;  1WTV A;  4GKJ Q;  2K7V A;  4ZYS A;  1FD7 D;  2QA4 A;  2VW9 A;  4KN4 C;  4A3D G;  2M2L A;  4DK6 C;  5FK9 C;  2RCF A;  3VDY A;  1MJC A;  1UEA B;  1JWS D;  1TQO A;  3KLR A;  1IYJ B;  1KIX A;  1EY0 A;  1YNX A;  2FFK B;  3NWS A;  1B53 A;  4OWX B;  4K6D A;  3CXC A;  3S1R H;  3EBE A;  5K5P A;  1S5D D;  3SR1 A;  2VUM G;  3H15 A;  1H9K A;  4BY7 B;  1F9R A;  4ZAI A;  5LHY 1;  4DR7 Q;  1U5K A;  3KLS X;  2VY3 A;  5E1F A;  1GHK A;  3DM3 A;  1A3T A;  2QGQ A;  1A3U A;  1PH4 A;  1I5F A;  2WAQ B;  4BXX G;  5LMN L;  4GNX C;  5IGD A;  4IPC A;  3NQT A;  1NCV A;  4C1N K;  1K3B C;  1VMP A;  1R9T H;  3K59 A;  1STH A;  4DV4 L;  3S9W A;  4FVM A;  1LTT D;  1QVG A;  4J8Q A;  4B3T L;  5L37 A;  1M90 C;  2MHV A;  4LK1 C;  4AH6 A;  4G7H C;  1GM5 A;  3FKI H;  3JAM c;  3KJP A;  2ZM6 L;  3I55 A;  2HUG A;  5FKA C;  3TP5 A;  3J80 E;  5C5L A;  1PYB A;  3CPW A;  2UXC Q;  4A3D B;  3MWY W;  1GOZ A;  4HAE A;  1WCM B;  1I3Q H;  3I8Z A;  2EY5 A;  4O2D A;  1TWH B;  3GTL H;  3CQZ H;  3ND8 A;  2EXD A;  3C46 A;  1ZXT A;  2PMZ B;  2L4N A;  1G6P A;  1VQ9 A;  1VQ8 A;  1SND A;  2WKC A;  5DM6 3;  4LF7 L;  2O2L D;  3F2D A;  1S40 A;  3CRK C;  4DPG A;  1I94 L;  4IFD I;  2VUM B;  1YNJ C;  1N34 Q;  3STB C;  1E24 A;  4WJ3 M;  3L7Z C;  3HS0 C;  3KBX A;  1B2T A;  3UDI A;  1X3E A;  5KND A;  3PO3 H;  2Z6K A;  5KIX A;  2F0P A;  3NK9 A;  4RAU C;  1BCP F;  1B3A A;  1I6H B;  3PMF A;  3I70 A;  4C56 C;  5M5W H;  1SAP A;  4GN4 B;  1VQC A;  3CAM A;  1IL8 A;  2KCC A;  3FP9 A;  4P71 A;  4DUY L;  1ENA A;  3MFG A;  1Y1W H;  3VR3 A;  3S2H B;  4POG A;  2CWA A;  1KXL A;  1PH8 A;  1IBL Q;  1VQE A;  2NVT B;  2B3G A;  3TS0 A;  4GOP B;  1V1P A;  3K7A B;  4NDX A;  2QKI C;  1QNK A;  2F0J A;  1A63 A;  2HDL A;  1MGS A;  1I4X A;  1LT3 D;  4ZQ3 A;  5IT9 E;  1XMO Q;  4DXF A;  3MAQ A;  1QWY A;  2EJM A;  2F0H A;  3G6E A;  1YJN A;  1PLF A;  1LM0 A;  1B3Q A;  1KL9 A;  5HGT A;  2JA8 G;  3KF6 B;  3DMU A;  4ZUI A;  4N8F A;  1IKM A;  1N32 Q;  1AZP A;  2NN6 I;  3OIP A;  1SE8 A;  4IFD H;  1G2T A;  3NQI A;  1DOK A;  4XQQ A;  3URY A;  1CHP D;  2KOL A;  1MJE A;  3P20 A;  1A2T A;  5AFW A;  3GTO H;  5JJL A;  2VB3 X;  4HJ5 A;  1JE4 A;  5M3F H;  3HOZ B;  4IUV A;  1JQY D;  4A93 G;  1R4Q B;  3CCJ A;  1VQM A;  3EVQ A;  5HGQ A;  3J81 i;  1PRT C;  2F0T A;  3OMC A;  3U4Z A;  3DWQ A;  1S5E D;  2RF4 A;  4QUF A;  2RVL A;  3S1N H;  4PMC A;  3A8I E;  2E2H H;  2Q2U A;  1SXT A;  3OIQ A;  5IGB A;  4DV0 L;  2NBF A;  1VCI A;  1ONL A;  5FLM G;  2LXJ A;  3H6M A;  3BYT B;  1SYD A;  3K0X A;  1JCK B;  2A19 A;  4DV7 L;  4DNI A;  1AE2 A;  3S14 H;  4KY7 A;  1JE5 A;  2JA8 B;  2JYO A;  5HY6 A;  1CT1 D;  1TS5 A;  1F77 A;  2IX1 A;  4HIO A;  3SHL A;  4IOA A;  2PZU A;  3U50 C;  1LTB D;  3CPF A;  1VS0 A;  2NN6 H;  4JG2 A;  1BXT A;  4C2M H;  1V1Q A;  4LUO A;  3CCM A;  1HA6 A;  4IJH A;  4LF5 L;  2K32 A;  3SXH A;  4BS9 A;  2GVA A;  4H02 A;  2F0K A;  4A3C H;  1FR3 A;  5IOC A;  3S1Q B;  2B2U A;  2B8G A;  4UDU C;  4Z9C B;  4DUZ L;  1XNR L;  4A3F G;  3SK8 A;  1Z9F A;  4EQN A;  1JWU D;  2ZTD A;  4N8X 1;  1A15 A;  1V1O A;  4R8N A;  3H3V I;  2E76 C;  4LF8 L;  2Q8R E;  1PV4 A;  1X55 A;  1VF7 A;  4A3I G;  1YHQ A;  1ILP A;  4P2C B;  1I6V C;  2VQE L;  1EYD A;  2RCN A;  2A6E C;  1NY4 A;  3KF8 B;  3RMH A;  2KHS A;  1U9R A;  4L5T A;  4XQJ A;  4A3J B;  4IO9 A;  1XNQ Q;  3DM1 A;  4LUZ A;  5FLX c;  1TWC B;  4GKK Q;  2HHH L;  1PTO F;  2HCI A;  4HSV A;  3T13 A;  5IYC G;  3C3L A;  4B3R Q;  2V1C C;  1MIU A;  3MFY A;  1Q1B A;  5C4X G;  2OQK A;  3KJO A;  2PNH A;  4DV6 Q;  2NVY H;  4K5V A;  1SFO H;  1B70 B;  3K81 C;  2J7Z A;  4DR5 Q;  5G3L F;  4A3G B;  5DLQ E;  5HUR A;  1EIF A;  4JK1 C;  1BO0 A;  5H1S E;  1VDZ A;  1G6Z A;  3K58 A;  1L0W A;  3CD6 A;  1LV9 A;  4BBR B;  4V0B A;  1P16 A;  2JA6 H;  4A3F B;  4PZ7 A;  5CV7 A;  4GLA C;  3PO2 G;  3G7L A;  2ES2 A;  4X65 L;  1GUW A;  2PW5 A;  4DR4 L;  1F9P A;  1TS3 A;  4MHE A;  2RDG A;  4A3I B;  2K5Q A;  2PQA A;  3CF5 A;  3H3V H;  2WAC A;  4Y7N H;  4OEL B;  1QJO A;  4JI0 Q;  4OGQ C;  2N3S A;  4BBS H;  4CHT B;  4YWL A;  1Q3L A;  5M9O A;  1I4P A;  2VQF L;  4KD4 A;  5A2Q L;  1XWE A;  4DR6 L;  2PQE A;  4LFC L;  4G7Z C;  3EFX D;  1E0B A;  2UUB L;  1EYA A;  3U9S A;  5CGK A;  1BF4 A;  1HR0 Q;  3W5O A;  3MEH A;  1ESR A;  5ELN A;  1DJR D;  2K05 A;  1L1O A;  4HED A;  4RHS A;  1YNJ D;  1ILQ A;  3STB D;  3X3M A;  3DHQ A;  3JAM L;  1NR2 A;  3CRL C;  2BE5 C;  4RGM A;  1OXS C;  2EQS A;  1FVI A;  3I4O A;  2VS1 A;  4DAY A;  5JJI A;  4HTH A;  3J7A 5;  4GZY C;  1H9S A;  3PO3 G;  4HJ7 A;  4JI8 L;  1IYV A;  2AWO A;  3KOJ A;  5JAV A;  5C44 G;  1SDF A;  3HOX G;  4X64 L;  2WV6 D;  1SE3 A;  3CC2 A;  1RTO A;  4X3U A;  2HDM A;  1H9R A;  2Y0S E;  1R9T B;  3DEO A;  2F0W A;  1EY4 A;  4JCV E;  4A3D H;  3SE0 A;  4K5X A;  1U4L A;  3M7N A;  1RF2 D;  1KQS A;  1VQH A;  1VQO A;  5T1I A;  3NWT A;  2UUC Q;  2KJX A;  1WD1 A;  5E4W C;  1RCV D;  4B9X A;  1UE1 A;  3A5Z B;  1X6O A;  5ELE A;  4MIU A;  2Q2T A;  2NZH A;  3A8K E;  1ZYR C;  5LL6 X;  5JPM C;  1I3Q B;  4RGT A;  4OHJ A;  3ONA B;  3I91 A;  3CQZ B;  1SYF A;  1ML0 D;  4HR7 B;  4DV5 L;  4LF4 L;  3K5O A;  1IBM L;  1E2W A;  5D3D A;  4JI1 L;  2TMP A;  3KYH C;  1O7I A;  1CA6 A;  1WJJ A;  3CKI B;  1ESF A;  5GQO A;  1HCZ A;  1VQF A;  1X32 A;  4BXX H;  3PO3 B;  4DK1 A;  1ENC A;  2R6G A;  2E2J H;  5M5W B;  3NUC A;  1PRT D;  1Q1E A;  4Q0F A;  4O1N A;  5C44 B;  3HOX B;  1QVC A;  1SSO A;  4GLV B;  2F4V L;  3TP7 A;  3L0O A;  1Y69 U;  1KAA A;  1QB5 D;  1U0L A;  1ZEQ X;  2EJF C;  5C4J H;  4ALP A;  4B3M L;  2FMM A;  2NVT H;  4JI5 L;  3ERO A;  1NUC A;  4K6L A;  1Y1W B;  1I4G A;  3CCQ A;  4GNX B;  3K7A H;  4OXP A;  1A3V A;  1YVC A;  3BYY B;  2WAQ E;  2A5H A;  2HD3 A;  3T1Y L;  2P5Z X;  2R92 G;  2IWH A;  1HNX Q;  3R93 A;  5I2X A;  2K14 A;  2Q2H A;  1LTR D;  2K33 A;  4C3J G;  3TP6 A;  5ISR A;  1CKN B;  4Q5V A;  4ODG A;  4C3H G;  3D31 A;  4QY7 A;  4AQY L;  4KY5 A;  1B9N A;  4I65 A;  2RA4 A;  2CHB D;  4X3K A;  1Q8K A;  3SVM A;  2G5D A;  5FOB B;  1XMQ Q;  4XYO A;  2K03 A;  1YJ9 A;  3PUX A;  1F9S A;  3AFQ A;  2BDO A;  1EIG A;  1HNW Q;  2PMZ E;  2BA0 A;  3LGJ A;  3NSW A;  3AB9 A;  2NB0 A;  4KKS A;  3E0J A;  3H0G G;  2ZTC A;  5C3X A;  3P1H A;  2R7Z G;  2RHQ B;  2EPB A;  5BN4 A;  1HR0 W;  5M3F B;  3CC4 A;  3HOW H;  3Q6S A;  3HKS A;  1KDC A;  2V4D A;  5LMU Q;  2KCM A;  1STE A;  2NTS A;  4X3T A;  2A6E D;  1EWH A;  2ALY B;  2SNS A;  1QUQ B;  2B2W C;  3K6O A;  4EGV A;  2KEC A;  3S1N B;  2I0Q A;  3LNN A;  1HNZ L;  2E2H B;  4YCW A;  2R92 B;  1O80 A;  3F2C A;  4C3H B;  1YHB A;  3X3N A;  1DZ1 A;  2EDG A;  4ZK9 B;  4DR1 Q;  2HQL A;  1EYG A;  3KDF B;  3R2T A;  1TT2 A;  3S14 B;  2F0O A;  3UE1 A;  4H13 C;  3RNU A;  2EXZ A;  3M4O H;  3SEB A;  3CCU A;  2M00 A;  2Z0S A;  3HOU G;  5FLX L;  3PF4 A;  1JJC B;  2BDN A;  2NVQ H;  1Q82 C;  3S1Q H;  4A93 H;  2O4X A;  2ZXP A;  4MZ9 A;  3GTQ H;  5EJW A;  1K0R A;  3H0G B;  3S24 A;  1K8G A;  2R7Z B;  3A0J A;  5D3I B;  1STN A;  1SNC A;  1J5E L;  2F0L A;  1CA5 A;  1SEB D;  2E8G A;  1IKL A;  4RGN A;  1CHQ D;  2KHI A;  3E9H A;  1PRT B;  3OYY A;  2K52 A;  1HHV A;  4HIK A;  1TWC H;  5E4X A;  5GAD C;  4MN3 A;  2LFN A;  4JVZ A;  1FYC A;  4ME3 A;  1EU3 A;  2EYJ A;  2F0Q A;  2D2C C;  5CR3 A;  1BBX C;  2VL6 A;  2MO1 A;  2EYH A;  1BVS A;  1Q86 C;  1G8Z D;  2H4O A;  1V8Q A;  2NVY B;  2BE5 D;  1BBW A;  4IQZ A;  1SFO B;  3F2B A;  5LMN Q;  2LSS A;  1QE6 A;  1UUP A;  4JI2 L;  2SNM A;  4NB3 A;  2Y0S B;  2K5W A;  3UDG A;  1LLR D;  2B8F A;  3I4N G;  4DV4 Q;  2FHT A;  4A3F H;  3S17 H;  1LTA D;  3W3A A;  1BCP C;  1E1T A;  4N9T A;  5CV8 A;  1WYD A;  2ZM6 Q;  2MUY A;  2GVB A;  2BCO A;  5IWA L;  2RSN A;  3MVV A;  4A3I H;  2JA6 B;  3NTK A;  2XSC A;  2QW7 A;  5FO7 B;  2IW3 A;  1JR0 D;  4RCN A;  1L1O C;  2QDB A;  4XXE A;  1K28 A;  5BN3 A;  4FXG C;  3NPP A;  4JOI C;  4L5R C;  3UE0 A;  2QIL A;  5ELF A;  3BJU A;  5IYC H;  1SLJ A;  3D3R A;  3QG1 A;  4IJL A;  2F0N A;  1ET9 A;  1I94 Q;  2JA5 G;  5C4X H;  4C3I H;  1NJI C;  1D1K A;  1ZYR D;  4JI4 Q;  4LF6 Q;  4BBS B;  4A3L G;  4LFA L;  3J7Y W;  5CV6 A;  2L15 A;  2E74 C;  4JC0 A;  4PMB A;  1EOT A;  1O7Y A;  4R4C A;  4DUY Q;  1TWA B;  1TR5 A;  5JJZ A;  1DGS A;  4MTN A;  2Z6B A;  4HJ8 A;  5EAY A;  1EFI D;  1U4R A;  2PNR C;  3J81 E;  2D5D A;  3I4N B;  1XTC D;  3KUP A;  5DEH A;  2AMC B;  1YI2 A;  2MO0 A;  1KNE A;  1EWI A;  3T1H L;  3PO2 H;  3D4R A;  1F2Z A;  4IAL A;  3I56 A;  4QIW B;  4NXM L;  2ASB A;  3Q23 A;  2PO4 A;  4WOR A;  3Q24 A;  2YV5 A;  1JWM D;  3EJI A;  1MHW C;  4O42 A;  4EQ5 A;  3M9B A;  2F0U A;  5COR A;  3NHH A;  4DFA A;  1C0A A;  2B2Y C;  5JEA G;  2ZXR A;  2JSO A;  4GN5 A;  2JA5 B;  2IL8 A;  2KUM A;  2NZO A;  5J22 A;  5C4Z A;  4FNF A;  1PVO A;  1KAW A;  1K9M C;  1LAC A;  3M7G A;  1UE7 A;  5EPK A;  3AQQ A;  4QUC A;  1G91 A;  1Y8N B;  4IPG A;  5LL6 S;  1K8O A;  2CFM A;  3C2P A;  4NKL A;  4KHP Q;  1QZH A;  3GDE A;  4S3S A;  4RH6 A;  3GV3 A;  2DGY A;  2IJ0 A;  2VZA A;  4AYB G;  3FDT A;  4WJW A;  1D2B A;  2ENB A;  4KMU C;  4DV1 L;  4K0K L;  5C44 H;  1YIJ A;  3HOX H;  4GOP A;  3J80 L;  4OEM B;  2DJG C;  5D65 A;  1E2Z A;  4LW1 A;  4DV0 Q;  1FNW A;  1L2F A;  1PFN A;  2MQH A;  1IBK L;  2E2J B;  4RWS C;  4WJ4 A;  5I9O A;  2NTT A;  3NEL A;  1C8C A;  2OTJ A;  1BKB A;  3HOW G;  3OPO A;  1TU2 B;  5C4J B;  4QQB X;  4H7B A;  5LMN W;  4OO1 G;  4DV7 Q;  3M4P A;  3MA2 B;  1VQI A;  3NE5 B;  1H9M A;  3HKZ G;  4LFB L;  1TY2 A;  1I4Q A;  1PFB A;  2AWN A;  2IX3 A;  3J7Z C;  3KBG A;  3Q0A A;  1PTO C;  4LF5 Q;  2XIW A;  2EY1 A;  2RKS A;  1MSG A;  2EYO A;  1EU4 A;  1EIY B;  4XIG S;  4G4K A;  4DUZ Q;  1XTD A;  3VA5 A;  4OX9 L;  1WI5 A;  1XNR Q;  1CUK A;  5F2D A;  5BR8 L;  4JI3 L;  1UE6 A;  4X66 Q;  2ZT9 C;  1A62 A;  3IRB A;  4JV5 L;  4LF8 Q;  4LF9 Q;  1YBY A;  4IPH A;  1PDQ A;  1JB7 A;  2VQE Q;  4CKE A;  3QJY A;  5EKL A;  2YTV A;  5IT9 L;  2UXC L;  2IHF A;  1KDB A;  3TME A;  4OWW B;  3GTM H;  1EL0 A;  5K36 G;  2HHH Q;  3HOW B;  3PUZ A;  1JIC A;  2EOT A;  2AQ3 B;  2H1E A;  2KEE A;  2OXP A;  2X6G A;  1X3Q A;  1QOH A;  5A35 A;  5E3F A;  2R92 H;  3A56 A;  2ZJR A;  1TS2 A;  5FO8 B;  1PZK D;  4C3J H;  4DR3 Q;  3PGZ A;  4C3H H;  2JJQ A;  3AYH B;  4QF4 A;  2RBM A;  1XPU A;  2C5C A;  3AFP A;  2PI2 E;  3OTO L;  4FF4 A;  2N49 A;  4TQU S;  3TSS A;  1VQB A;  4L5Q A;  2C35 B;  2G9H D;  5CBE E;  1C48 A;  1B8A A;  3RZD H;  3CCE A;  5JOB A;  3VR2 A;  4RMF A;  1HZC A;  1NMG A;  4XTC S;  1EY9 A;  1FGU A;  2A6H C;  3PUV A;  1LAB A;  4PZ8 A;  4DR4 Q;  3H0G H;  2B29 A;  4IFD J;  1S3O A;  4PV1 C;  2R7Z H;  2JP1 A;  5C3W A;  1IBL L;  5IYB G;  3M4O B;  1NNX A;  1PFM A;  4R4Q A;  2JXM B;  1JOO A;  2F0F A;  2NVQ B;  3SK5 A;  4A93 B;  2XTI A;  3K57 A;  3KF8 A;  4IN3 A;  4C1N I;  4DAV A;  1C7Y A;  3GTQ B;  2WFW A;  3AU7 A;  1YHA A;  2MNA A;  3PIO 3;  1CKM A;  4LFC Q;  1EY5 A;  3RLO A;  3IL8 A;  3OMG A;  2L9H A;  2RDH A;  3D8G A;  1F2L A;  4XYQ A;  1OXU A;  2XN9 C;  1KD1 C;  3RUZ A;  4JPB W;  2A74 C;  4KJN A;  3F2U A;  5C6A A;  2UUA L;  1QCB D;  2JA7 G;  1N32 L;  1N33 Q;  1HH2 P;  2HIV A;  3VR4 A;  5EPL A;  2IPK D;  1EZ6 A;  1BOS A;  3ULJ A;  4C3I G;  3MTS A;  1DOL A;  1VQN A;  1J9O A;  3A8J E;  4QJF A;  2E2I H;  4YCU A;  4B3S L;  1NMF A;  2PZT A;  1DYQ A;  3NEN A;  4JI8 Q;  1HFN A;  2KBN A;  2DY7 A;  5M3M G;  3HOU H;  2F0E A;  2K4K A;  1VMC A;  1AW7 A;  3ULL A;  3S1M B;  2DNE A;  1WTQ A;  1DCZ A;  1Q8I A;  4MNO A;  1VQD A;  3K0Y A;  2F0D A;  5BN5 A;  1M8A A;  2H5X A;  3CCS A;  3S17 B;  1PHJ A;  3D0F A;  4NXN L;  4PG3 A;  5JVH 3;  1OTC A;  4JI7 L;  2O5J C;  3GTJ B;  1X3P A;  2LMC B;  2R93 G;  1FJG Q;  4R4T A;  2MGS A;  4N9P A;  1JMC A;  4JI6 L;  1PH6 A;  2I5L X;  3GQB A;  1SYE A;  3G71 A;  4PMW A;  3VYU A;  3M3Y H;  4DV5 Q;  4LF4 Q;  2RDF A;  1PRT F;  2K50 A;  1LTI D;  2XVS A;  2L11 A;  2OWO A;  1YJW A;  4ME5 A;  1HZA A;  2B2T A;  2EYM A;  2F3W A;  5C4X B;  1IHZ A;  4C3I B;  3LWU A;  5AJ3 Q;  1TWA H;  4DA2 A;  1SNM A;  1L0X B;  2XWJ B;  4BA2 I;  1LYL A;  4X62 L;  3NTH A;  3DEP A;  4IPD A;  3S15 H;  4FP5 D;  3I4N H;  2JEB I;  3D6W A;  1J8I A;  4A3M G;  4B3M Q;  1PH3 A;  4JI5 Q;  1X9N A;  1I4R A;  4P74 A;  1MBY A;  5CYU A;  2EY2 A;  2R61 A;  1X56 A;  1GXD C;  1A0I A;  4K8I A;  1KLU D;  3C1F A;  2NZ1 D;  2NWG A;  5JJK A;  1JOQ A;  2KCT A;  2YYZ A;  4A3B G;  3PO2 B;  2D0O A;  3T1Y Q;  3GD7 A;  2MP1 A;  2GN5 A;  1X54 A;  2R93 B;  5EQ0 A;  3ITP A;  2E75 C;  2QDL A;  4DF7 A;  4F8M A;  2B39 A;  1YNN C;  3QR8 A;  4DV6 L;  4XT1 B;  2JA5 H;  3A54 A;  2ICE C;  1DON A;  5IGC A;  3L3O C;  2LY7 A;  3MXN A;  4AQY Q;  1UEB A;  3UI2 A;  4L6T B;  4A3L H;  4CBV A;  2Z6K C;  3P75 A;  5C3E H;  1ASZ A;  5I6W A;  4YY3 Q;  1PH9 A;  4UY8 C;  1PTO D;  3U9O A;  3UDF A;  3ERQ A;  4U68 A;  4DAY B;  4DV3 Q;  4M8A A;  1MI2 A;  2FJ2 A;  1WD0 A;  5G3L D;  3E5S A;  2LS0 1;  2Z8L A;  4DR2 L;  1VQP A;  4YHH Q;  4DXG A;  2PI2 A;  4GNX A;  2BH8 A;  4HIM A;  1QG7 A;  4A3B B;  3BDL A;  2UU9 L;  4OO1 I;  3J81 c;  1Q90 A;  1IXR A;  3FVQ A;  1HNZ Q;  1E22 A;  2GA4 B;  1WTX A;  1SMX A;  2N88 A;  5IGG A;  5C0X J;  4J15 A;  5JEA H;  1HR0 L;  1CKN A;  3A5U A;  1HUM A;  2I5M X;  4OON A;  1N36 Q;  4QIW E;  2K28 A;  1O78 A;  1B7Y B;  3IKJ A;  2L1B A;  1RDP D;  2CCZ A;  3K8A A;  1MSH A;  3AMU A;  3EIV A;  5DAU A;  3RLF A;  4IUN A;  1SNQ A;  3NBH B;  4CJ2 C;  4EVO A;  2F0G A;  3MXP A;  3RR5 A;  3WOE A;  1H95 A;  4DK0 A;  3J80 c;  1CFM A;  4CGY B;  1GUT A;  1EYC A;  5COY A;  1OXV A;  2A6H D;  1J5E Q;  3ERS X;  3T16 A;  3JAM i;  1VQ4 A;  1D6E C;  2ZXO A;  3HGB A;  1HQR D;  4X6A H;  2VXW A;  3FEW X;  1WVL A;  4L63 B;  3DUZ A;  5EBC A;  5M5Y H;  1VF5 C;  3CMA A;  2KEN A;  1U4P A;  1QUQ A;  2YTY A;  3E9I A;  4OL7 A;  5IP7 G;  1C4Q A;  1HUN A;  3W1G A;  5IY0 A;  2I46 A;  1DOM A;  5IIF A;  3W1B A;  2UUC L;  4OO1 H;  1TII D;  5CMD A;  2OTL A;  4OIK A;  3HOY G;  3DXJ C;  3I4M G;  3GTM B;  1X3F A;  2D9U A;  4QGU A;  2EJG C;  1QIL A;  2Q8T A;  1Z7T A;  3N52 A;  3R2I A;  3QOL A;  3TDQ A;  1ICW A;  3KDF A;  4J6H A;  1O7Z A;  2DN8 A;  1D5M C;  3OW7 A;  4JI2 Q;  1TY0 A;  4K2L A;  4C3J B;  5I2Y A;  2AUK A;  2UXB Q;  5IP9 G;  2A73 B;  2R3Z A;  2B2U C;  3FPU B;  1GVP A;  3EQL C;  4KHV A;  1CSQ A;  2EVB A;  4POF A;  1N9W A;  5IT9 c;  3IAY A;  3EA6 A;  1PTO B;  2OQ0 A;  1SJH D;  5IWA Q;  3PUY A;  3RZD B;  2AQ1 B;  4F88 A;  4LNQ A;  2L12 A;  4FF1 A;  1EY8 A;  2CW0 C;  1PH1 A;  4L8J A;  3ULP A;  1I4H A;  1NR4 A;  4DU9 A;  4ZLT F;  5K36 H;  1V43 A;  3DLL A;  3WWV A;  1Q81 C;  1M4V A;  3CCR A;  1DM0 B;  4H0L C;  1EY6 A;  3HRZ C;  3CME A;  3WDN A;  4AYB E;  3CCV A;  1XPO A;  2ZJQ A;  4CJ0 B;  1G51 A;  4LFA Q;  4Y52 H;  2K1B A;  4BWG B;  1AZQ A;  2VNU D;  1TWF H;  1CTM A;  4UAI A;  4HJ9 A;  5EKK A;  2UXD L;  1ASY A;  4HMI A;  1OO9 B;  3U4V A;  3J81 j;  1KRT A;  3OW2 A;  1JOR A;  3R3O A;  1Y8O B;  1OXX K;  3P7J A;  5FO9 B;  1QZG A;  2NYZ D;  3IFT A;  3T53 B;  1PH5 A;  3TRZ A;  1KLG D;  3T1H Q;  3ZJY C;  4XQN A;  4LWC A;  2CVR A;  3NXW A;  4NXM Q;  5T1G A;  3HKZ E;  3OWF A;  2E2I B;  3S1M H;  4KJO A;  4DN4 M;  1KNA A;  5IYB H;  3HOU B;  1QNU A;  4GS3 A;  4H44 C;  2K5V A;  2EYF A;  5LMU L;  4JYA L;  3HG9 A;  2YU9 B;  1K73 C;  2FMC A;  3FHW A;  1W2B A;  5DM7 3;  4B3T Q;  1PZI D;  2FXQ A;  1VQK A;  2C9O A;  1Y1V G;  2KCN A;  3GTJ H;  4M1U B;  3I90 A;  2B2T C;  3SK4 A;  1S5F D;  4DV2 L;  4HCE A;  1B1Z A;  2E2D C;  1SMY C;  1GO3 E;  1K8M A;  1YNN D;  3SGI A;  1D5Z C;  3RD4 A;  1HTP A;  1UWV A;  2JA7 H;  2WB1 G;  4LF7 Q;  3J7A V;  2K6A A;  2KHJ A;  3Q8D A;  3SK6 A;  2RQX A;  2N78 A;  3M3Y B;  4F7X A;  3IFD A;  4ABN A;  1EQQ A;  4G7O C;  4PNY A;  4DGZ A;  4I7Z C;  1S72 A;  3GTK B;  1P8L A;  2OF1 A;  1KDA A;  4PQX A;  1CKO A;  5C3E G;  1Z6H A;  5DNF A;  4DV1 Q;  1D5X C;  1KRS A;  3UDX A;  5M3M H;  1LTG D;  5C0X G;  3GP7 A;  3T51 B;  3E3X A;  1D1I A;  2F03 A;  2CWP A;  1II3 A;  2EZV A;  3BVZ A;  4CDF C;  2F0M A;  3QOJ A;  1IBK Q;  3S15 B;  1UAP A;  5I4D A;  1WCM G;  1CQV A;  1Z47 A;  1AP0 A;  1RJT A;  4K2K A;  5EKI A;  5IYD G;  2F1M A;  1CQF A;  1Y1V B;  2F3V A;  3TQY A;  4KI0 A;  2R93 H;  4ZKC B;  3L2P A;  3E0E A;  4HJA A;  2CH4 A;  2JK8 A;  5CBA E;  3K5N A;  2L55 A;  5KRU A;  4LFB Q;  4B08 A;  3QB3 A;  3ZYY X;  3G6J B;  3T56 B;  3DWA A;  1PMR A;  2ID0 A;  1K83 B;  3ER0 A;  1X65 A;  3NBI A;  3HOV G;  2R7D A;  2WB1 B;  3HFZ B;  2Q8I B;  1CM9 A;  1PYW D;  3FMC A;  3PUW A;  4OX9 Q;  5BR8 Q;  3L9A X;  3J81 L;  4FXD A;  4JI3 Q;  4KTA A;  3G48 A;  3GV6 A;  1EFW A;  2G9D A;  4JV5 Q;  2EY6 A;  5C3E B;  4RCO A;  4CDC C;  4QCL A;  2J0T D;  3BDO A;  4A3M H;  4G57 A;  4HN7 A;  3CW2 C;  3RN2 A;  4X3S A;  5TSS A;  4A3E G;  2JN4 A;  1LT6 D;  4E6I A;  3CP0 A;  2E5L L;  5KYL A;  4QB4 A;  4A3B H;  3DWP A;  3JC6 6;  4LUV A;  3VR6 A;  4RGO S;  1PFS A;  2AUJ D;  3I73 A;  4GKJ L;  1SE2 A;  5E7N A;  3O13 A;  2A69 C;  4JI4 L;  4LF6 L;  4JBW A;  1WTR A;  1JB3 A;  1SYB A;  4YCV A;  4IUQ A;  3OTO Q;  1SYG A;  1HPC A;  3HOV B;  1RL2 A;  2N55 A;  2TSS A;  3R8B A;  5IOD A;  4FYD A;  3KF6 A;  3HOZ G;  2F0S A;  2PCF B;  2Z4I A;  1PA6 A;  4TSS A;  4JBM A;  2CQA A;  3Q22 A;  4A75 A;  2WKD A;  3HP3 A;  1A2U A;  4JBK A;  3H09 A;  4DR7 L;  2ICI A;  1T5X D;  2F3I A;  1N8R C;  4IUR A;  1WTH A;  4KKT A;  3PSI A;  4R4I A;  3CC7 A;  2CKZ B;  3D4W A;  4AYB B;  4A3E B;  2CW0 D;  4CDD C;  4DNT B;  1ZKO A;  4FXK C;  3D4D A;  4R8I A;  4L5S A;  2LXK A;  2NVX B;  4DK3 C;  3G4S A;  2B2V A;  3PIP A;  1Q12 A;  1SNP A;  4DAP A;  3I3C A;  1V1P B;  2F0I A;  5CV9 A;  5M5Y B;  4IUP A;  3PQI A;  1LUZ A;  2WII B;  4APV A;  2UUA Q;  2HT1 A;  1XYI A;  4HMJ A;  3B6Y A;  3PIO A;  1JT8 A;  1XPR A;  2B63 G;  1TWG B;  3BZD B;  1HTL D;  3MZ5 A;  3T4A C;  4K5W A;  4B3S Q;  3HKZ B;  2Z1C A;  2KED A;  4KHP L;  1NE3 A;  3S16 B;  5C4H A;  3BVM A;  3GTP B;  1N34 L;  3KLS A;  4RKB A;  3OOC A;  3HEJ A;  2JE6 I;  1HQM C;  4UP8 A;  1GUG A;  5CC4 A;  2IY5 B;  1PTO H;  1A6X A;  1AEX A;  2RSO A;  3CHB D;  1LO5 D;  3I7F A;  4K8J A;  2DY8 A;  3C1E A;  1EEI D;  4BY1 H;  4NXN Q;  1ENF A;  4KY6 A;  4X65 Q;  4A3J G;  4JI7 Q;  1EEF D;  3RLN A;  1IL2 A;  1D8L A;  3MXU A;  5IP7 H;  3S2D H;  1BCP D;  2PW7 A;  1E2V A;  3OHX C;  4JI6 Q;  3PIP 3;  1EOV A;  5JPN C;  5EBD A;  1RIP A;  1EWC A;  3J80 i;  1IW7 C;  3A7L A;  3HOY H;  3I4M H;  3F8T A;  5ELC A;  1SMY D;  4F87 A;  2DJF C;  1WTW A;  5CV4 A;  4A3G G;  2B2W A;  2VQF Q;  3A74 A;  1XMO L;  4DR6 Q;  1WTP A;  1SJE D;  2A8V A;  2B63 B;  3TRE A;  5FJ8 G;  2D62 A;  2UUB Q;  2J4X A;  5I9P A;  2R7F A;  4OWT B;  4BBR G;  1W6K A;  4KLK A;  2CQO A;  1TWF B;  1EQR A;  4V19 0;  1BQQ T;  4X62 Q;  2A68 C;  2MFI A;  5IP9 H;  1LTL A;  4A3K G;  4ZUJ A;  4NPS A;  1AE3 A;  4UHV A;  2RHS B;  2K75 A;  4X66 L;  1B4O A;  4UP7 A;  3QWN A;  3GTG B;  4O0A A;  4LF9 L;  3H3V C;  5I6Y A;  2IX0 A;  1LTS D;  4AIM A;  1JJG A;  2I5H A;  4RHR A;  4WFN 3;  2YU9 H;  1GKH A;  1HFG A;  4X64 Q;  5C5M A;  3HZX A;  2MPM A;  4ZRZ A;  1FL0 A;  1B9M A;  1YZ6 A;  2JQO A;  1UE5 A;  3TBI B;  1VQL A;  1EQT A;  2X69 A;  1BBU A;  1LT4 D;  1CZG A;  5M5X H;  5JVG 3;  4KKU A;  2O5I C;  1U4M A;  4DR3 L;  4GLX A;  4P72 A;  4WRD A;  4TRD A;  4CKB A;  2M9V A;  5A2Q E;  1W6J A;  4PZ6 A;  1I50 B;  3BU2 A;  4ULL A;  2PYK A;  2EYP A;  3K80 C;  4RA8 A;  1EZ8 A;  4FF2 A;  4CDE C;  1IBM Q;  1F2Y A;  1FNV A;  5ELB A;  1STG A;  1E7Z A;  4A3K B;  5C0X I;  4JI1 Q;  3GTK H;  2JA7 B;  4KHZ A;  4UPA A;  4IUU A;  1CSP A;  1WOC A;  2ZTE A;  3RZO B;  4A76 A;  1SRO A;  3JAM E;  1VQ5 A;  4DR2 Q;  1SRU A;  3LX0 A;  1PH7 A;  3F1Z A;  4EQO A;  2BA1 A;  2KA7 A;  4ZCK A;  2VB2 X;  5ELO A;  4DAM A;  3PV0 A;  1WFQ A;  3VYS A;  3CCL A;  3CU7 A;  5M3M B;  1HXY D;  2AQ2 B;  4RFB A;  2UU9 Q;  4RG1 A;  3I4L A;  2AKW B;  4XT3 B;  5KEE A;  2YTX A;  4YWK A;  2F4V Q;  4HID A;  1TKW B;  3FKI G;  1VQ7 A;  1CK1 A;  4FDB A;  2K04 A;  1K3R A; 
#chains in the Genus database with same CATH homology
 3J81 i;  4DUY Q;  2Q2I A;  1Y1V H;  1DGS A;  4MTN A;  1OXT A;  2PQA B;  1PH2 A;  3NEM A;  3U4Z A;  5GAE C;  4HJ8 A;  3KDF A;  4QL5 A;  5EAY A;  2RF4 A;  3S1N H;  4JOI A;  4JI2 Q;  2E2H H;  2Q2U A;  2AMC B;  1YI2 A;  2MO0 A;  4BY7 H;  1EWI A;  1X3G A;  2UXB Q;  5IP9 G;  3T1H L;  1XNQ L;  3BZK A;  5GAH C;  4GKK L;  4DV0 L;  3PO2 H;  1K83 H;  1N33 L;  1GVP A;  3I56 A;  1VCI A;  4NXM L;  4B3R L;  1CSQ A;  4POF A;  5FLM G;  1N9W A;  1NTG A;  2LXJ A;  2ASB A;  5IT9 c;  3K0X A;  3RN5 A;  1L1O B;  2OQ0 A;  2YV5 A;  2A19 A;  4DV7 L;  4DR5 L;  1W3S A;  4DNI A;  5IWA Q;  4P73 A;  3PUY A;  1AE2 A;  3S14 H;  4EQ5 A;  4LNQ A;  3M9B A;  1JE5 A;  1PH1 A;  5HY6 A;  1C0A A;  2IX1 A;  1EUJ A;  2D0P A;  4GOP C;  5JEA G;  4HIO A;  3ULP A;  2JEA I;  4IOA A;  4GN5 A;  3U50 C;  1Y1W G;  3CPF A;  4R4O A;  1VS0 A;  3TEH B;  2NZO A;  1YIT A;  3M85 A;  1V43 A;  4JG2 A;  2AHO B;  1V1Q A;  3MEF A;  4LUO A;  3WWV A;  4IJH A;  4C2M H;  3DLL A;  3CCR A;  1Q46 A;  1KAW A;  4LF5 L;  1PVO A;  1K9M C;  2GVA A;  4H02 A;  3CME A;  4A3C H;  4AYB E;  3CCV A;  1XPO A;  1WCM H;  2ZJQ A;  1UE7 A;  1V9P A;  1G51 A;  1TWH H;  3AQQ A;  4LFA Q;  4DUZ L;  5IYD H;  4Y52 H;  1XNR L;  4A3F G;  4IPG A;  2CFM A;  1Z9F A;  2VNU D;  1TWF H;  2ZTD A;  4KHP Q;  4HJ9 A;  1FJG L;  2UXD L;  1QZH A;  3GDE A;  3H3V I;  1ASY A;  2DGY A;  4LF8 L;  3U4V A;  3J81 j;  1PV4 A;  2VUM H;  1KRT A;  2VZA A;  3OW2 A;  1X55 A;  4AYB G;  3MXN B;  4A3I G;  1YHQ A;  4JI0 L;  1E1O A;  1OXX K;  2VQE L;  4DV1 L;  4K0K L;  2RCN A;  1NY4 A;  3KF8 B;  5C44 H;  1YIJ A;  3HOX H;  1QZG A;  3HOV H;  4L5T A;  1I6H H;  1PH5 A;  4GOP A;  1XJV A;  3TRZ A;  4IO9 A;  2JA9 A;  4TVA B;  3T1H Q;  3ZJY C;  1XNQ Q;  4LUZ A;  4LW1 A;  5FLX c;  5AJ3 L;  4DV0 Q;  2HHH L;  4LWC A;  5IYC G;  4GKK Q;  1N32 Q;  1L2F A;  4NXM Q;  2MQH A;  2V1C C;  1IBK L;  3HKZ E;  4IFD G;  4B3R Q;  1MIU A;  3PCO B;  4WJ4 A;  1Q1B A;  3S1M H;  5C4X G;  2OQK A;  3KLW A;  2PNH A;  3NEL A;  1GD7 A;  2NVY H;  3KJO A;  1BKB A;  4DV6 Q;  5IYB H;  3HOW G;  2ATW A;  3S2H H;  1SFO H;  4QQB X;  1B70 B;  2EIF A;  3K81 C;  2K5V A;  4GS3 A;  5LMN W;  5LMU L;  4DV7 Q;  4DR5 Q;  1K73 C;  3M4P A;  1M1K C;  4OO1 G;  3FHW A;  5M3F G;  1A8V A;  1W2B A;  5DLQ E;  4B3T Q;  2QEX A;  1EIF A;  1JJ2 A;  1VQI A;  2FXQ A;  5H1S E;  1VQK A;  3HKZ G;  1VQA A;  1Y1V G;  3GTJ H;  4LFB L;  3PF4 A;  2WB1 E;  2AWN A;  1L0W A;  4A3E H;  3CD6 A;  4DV2 L;  3J7Z C;  1P16 A;  1GO3 E;  2JA6 H;  5GAG C;  3SGI A;  2NVX H;  4LF5 Q;  4PZ7 A;  1EIY B;  4GLA C;  4BY1 G;  3PO2 G;  1Y14 B;  4XIG S;  4DUZ Q;  4X65 L;  2ES2 A;  1UWV A;  1XTD A;  1XNR Q;  4OX9 L;  1WI5 A;  2JA7 H;  4DR4 L;  1CUK A;  2WB1 G;  4LF7 Q;  5BR8 L;  2KHJ A;  3Q8D A;  4JI3 L;  1UE6 A;  4X66 Q;  2UXD Q;  2N78 A;  2PQA A;  3CF5 A;  1A62 A;  3IRB A;  2WP8 J;  1EQQ A;  3H3V H;  4JV5 L;  4BA1 I;  4Y7N H;  4LF8 Q;  4LF9 Q;  1YBY A;  4IPH A;  1S72 A;  1P8L A;  1JB7 A;  1PYS B;  4JI0 Q;  1CKO A;  1TWG H;  2N3S A;  1T9H A;  5C3E G;  4BBS H;  2VQE Q;  4YWL A;  4DV1 Q;  1KRS A;  3UDX A;  5M3M H;  4YY3 L;  5C0X G;  2VQF L;  3K7U C;  3HOZ H;  4DR6 L;  2YTV A;  4LFC L;  2UXC L;  2IHF A;  3S16 H;  3GTP H;  2CWP A;  2UUB L;  4DV3 L;  1HR0 Q;  5JEA J;  4OWW B;  3GTM H;  1SN8 A;  1TXY A;  3I2Z A;  3W5O A;  2HHH Q;  5K36 G;  2NN6 G;  3PUZ A;  5ELN A;  1IBK Q;  3TS2 A;  1L1O A;  1G29 1;  3STB D;  4A3C G;  1WCM G;  1Z47 A;  2R92 H;  2ZJR A;  4YHH L;  1KC8 C;  1VQ6 A;  5IYD G;  4JYA Q;  2K5N A;  1OXS C;  4C3J H;  4DR3 Q;  1IZ6 A;  2EQS A;  4IOC A;  3PGZ A;  1FVI A;  3TQY A;  4KI0 A;  3I4O A;  4P75 A;  2R93 H;  2VS1 A;  4C3H H;  3L2P A;  3E0E A;  4HJA A;  2BH2 A;  5JJI A;  2JJQ A;  2JK8 A;  3AYH B;  3J7A 5;  1XPU A;  4LFB Q;  3AFP A;  2PI2 E;  3OTO L;  4JYA L;  3PO3 G;  2N49 A;  1SR3 A;  4TQU S;  1HZB A;  4HJ7 A;  4JI8 L;  1VQB A;  3GO5 A;  4DV2 Q;  2AWO A;  4L5Q A;  2C35 B;  3KOJ A;  2ID0 A;  3ER0 A;  5C44 G;  1X65 A;  4UP9 A;  3HOX G;  3HOV G;  1B8A A;  4X64 L;  4GN3 B;  3RZD H;  2R7D A;  3CCE A;  4RMF A;  2IT1 A;  3HFZ B;  1HZC A;  5GRO A;  1HJP A;  1K8A C;  1NMG A;  3CC2 A;  2JA8 H;  4XTC S;  1FGU A;  2Y0S E;  3PUW A;  3PUV A;  1Q7Y C;  4PZ8 A;  1VQJ A;  4OX9 Q;  1MKH A;  4DR4 Q;  1N36 L;  1VQG A;  5BR8 Q;  3H0G H;  2OTJ A;  2B29 A;  2DUD A;  1S3O A;  2IHE A;  3G48 A;  4JCV E;  3CCM A;  1IBL L;  5IYB G;  1EFW A;  4JI3 Q;  2B63 H;  4R4Q A;  4A3D H;  4JV5 Q;  1HNX L;  4A4I A;  3M7N A;  3EN2 A;  1KQS A;  1VQH A;  2XTI A;  1VQO A;  1AH9 A;  1C7Y A;  2UUC Q;  2HIX A;  2Y0S G;  4A3M H;  1UE1 A;  2WFW A;  3A5Z B;  1X6O A;  2Q2T A;  3U58 A;  4DKA C;  1YHA A;  2NZH A;  3CW2 C;  2MNA A;  3RN2 A;  3KFU A;  4QGU A;  1CKM A;  4LFC Q;  4A3E G;  1HZ9 A;  2K5H A;  4DV5 L;  3RLO A;  4LF4 L;  3GTG H;  3CP0 A;  1IBM L;  1XMQ L;  2E5L L;  4A3B H;  4JI1 L;  2JA6 G;  3KYH C;  1O7I A;  3JC6 6;  1OXU A;  1WJJ A;  1KD1 C;  2ZJP A;  4YWM A;  3S1Q H;  1HNW L;  2UUA L;  2JA7 G;  1N32 L;  4LUV A;  1N33 Q;  1HH2 P;  1C9O A;  2HIV A;  1VQF A;  1PFS A;  5GQO A;  4A3J H;  4BXX H;  4GKJ L;  5FLM H;  1YEZ A;  3BZC A;  5E7N A;  3ULJ A;  4JI4 L;  4LF6 L;  1NBW A;  1J6Q A;  2R6G A;  4JBW A;  2E2J H;  1VQN A;  4QJF A;  1Q1E A;  2E2I H;  4YCV A;  4YCU A;  4B3S L;  3OTO Q;  1NMF A;  1D7Q A;  2F52 A;  1QVC A;  1RL2 A;  4GLV B;  2F4V L;  3L0O A;  4BBS G;  4B3M L;  3NEN A;  1U0L A;  4JI8 Q;  4ALP A;  2KBN A;  5C4J H;  5M3M G;  2NVT H;  3HOU H;  4JI5 L;  2K4K A;  2XGT A;  4R1J A;  3KF6 A;  3HOZ G;  3CCQ A;  4GNX B;  4A3G H;  3K7A H;  4OXP A;  3ULL A;  5J3B A;  1PA6 A;  4JBM A;  5FJ8 H;  1YVC A;  1I50 H;  4A75 A;  4MNO A;  1VQD A;  4JBK A;  2WAQ E;  4DR7 L;  3T1Y L;  4BBR H;  2UXB L;  2R92 G;  2F3I A;  2H5X A;  3CCS A;  4BY7 G;  1N8R C;  1HNX Q;  3M4Q A;  1PHJ A;  2K14 A;  2Q2H A;  3D0F A;  4NXN L;  4PG3 A;  4A3K H;  2A1A A;  1OTC A;  4JI7 L;  3AEV A;  3ICE A;  4JBJ A;  1CKN B;  4DR1 L;  3PSI A;  4R4I A;  3CC7 A;  2CKZ B;  3RZO H;  2R93 G;  3D31 A;  1FJG Q;  4R4T A;  4QY7 A;  4AQY L;  2WAQ G;  1JMC A;  4JI6 L;  5IE8 A;  1PH6 A;  2I5L X;  1E3P A;  4L5S A;  2LXK A;  3G71 A;  3PF5 A;  4PMW A;  3M3Y H;  4DK3 C;  3G4S A;  2OCE A;  4DV5 Q;  1Q8K A;  4LF4 Q;  3PIP A;  1Q12 A;  1XMQ Q;  2E5L Q;  2K50 A;  4K0K Q;  1KHI A;  1YJ9 A;  2OWO A;  3PUX A;  1LUZ A;  1YJW A;  3AFQ A;  1HNW Q;  1QVF A;  4APV A;  1HZA A;  4EX5 A;  2PMZ E;  2UUA Q;  2HT1 A;  2BA0 A;  3LGJ A;  5AJ3 Q;  3B6Y A;  3PIO A;  3H0G G;  1TWA H;  2N8N A;  2ZTC A;  5HGQ A;  4GKJ Q;  2R7Z G;  1JT8 A;  2QA4 A;  2RHQ B;  1XPR A;  1HR0 W;  2VW9 A;  2B63 G;  4A3D G;  4BA2 I;  3CC4 A;  1LYL A;  3HOW H;  3HKS A;  4X62 L;  4DK6 C;  3VDY A;  1MJC A;  4IPD A;  4B3S Q;  5LMU Q;  3I4N H;  3S15 H;  1IYJ B;  2JEB I;  1KIX A;  4KHP L;  1YNX A;  2KCM A;  1NE3 A;  4A3M G;  4B3M Q;  4OWX B;  1N34 L;  1PH3 A;  2ALY B;  3CXC A;  4JI5 Q;  1X9N A;  1QUQ B;  2JE6 I;  3EBE A;  4P74 A;  3S1R H;  4IFD J;  2R7Z H;  2VUM G;  1X56 A;  3H15 A;  1A0I A;  2I0Q A;  4UP8 A;  1HNZ L;  4YCW A;  2IY5 B;  5JJK A;  2KCT A;  2YYZ A;  4A3B G;  2D0O A;  4DR7 Q;  3T1Y Q;  3GD7 A;  3I7F A;  3F2C A;  1U5K A;  2GN5 A;  1X54 A;  2VY3 A;  3DM3 A;  4BY1 H;  1YHB A;  2QGQ A;  4NXN Q;  1PH4 A;  4X65 Q;  1I5F A;  4A3J G;  4JI7 Q;  4BXX G;  3RLN A;  5LMN L;  1Q81 C;  4GNX C;  2HQL A;  4DV6 L;  1D8L A;  4DR1 Q;  3KDF B;  4IPC A;  5IP7 H;  1EYG A;  2JA5 H;  1IL2 A;  3S2D H;  4A93 H;  4AQY Q;  3UE1 A;  4JI6 Q;  1R9T H;  1UEB A;  3RNU A;  4A3L H;  4DV4 L;  1QVG A;  1EOV A;  3M4O H;  2Z6K C;  3CCU A;  4B3T L;  1RIP A;  2Z0S A;  3J80 i;  5C3E H;  3HOU G;  1M90 C;  1JJC B;  2NVQ H;  1GM5 A;  4AH6 A;  1Q82 C;  1ASZ A;  3FKI H;  3F8T A;  4YY3 Q;  1PH9 A;  4UY8 C;  3HOY H;  3I4M H;  3JAM c;  4MZ9 A;  3GTQ H;  3KJP A;  2ZM6 L;  3I55 A;  2VQF Q;  3UDF A;  4A3G G;  3A74 A;  1K0R A;  1XMO L;  4DR6 Q;  4DAY B;  3CPW A;  1PYB A;  2UXC Q;  3S24 A;  1K8G A;  3A0J A;  2A8V A;  3TRE A;  5FJ8 G;  2D62 A;  4DV3 Q;  1J5E L;  2UUB Q;  1I3Q H;  4O2D A;  2R7F A;  4OWT B;  3GTL H;  3CQZ H;  2E8G A;  2EXD A;  4KLK A;  4BBR G;  2CQO A;  1EQR A;  1G6P A;  4X62 Q;  1VQ9 A;  2MFI A;  2KHI A;  5IP9 H;  1LTL A;  3E9H A;  4YHH Q;  4DR2 L;  4A3K G;  1VQP A;  1VQ8 A;  3OYY A;  4NPS A;  4LF7 L;  1AE3 A;  2PI2 A;  3F2D A;  1S40 A;  4DPG A;  2K52 A;  2K75 A;  2RHS B;  2BH8 A;  4X66 L;  4GNX A;  1I94 L;  4IFD I;  4HIM A;  3STB C;  1N34 Q;  1E24 A;  4HIK A;  1TWC H;  4UP7 A;  3L7Z C;  5GAD C;  4WJ3 M;  4O0A A;  4LF9 L;  3UDI A;  2IX0 A;  1X3E A;  3PO3 H;  2UU9 L;  4OO1 I;  4AIM A;  2Z6K A;  1JJG A;  3J81 c;  1IXR A;  2I5H A;  1HNZ Q;  1E22 A;  4ME3 A;  5M5W H;  4GN4 B;  1VQC A;  1SMX A;  3CAM A;  2YU9 H;  2VL6 A;  1GKH A;  3FP9 A;  4P71 A;  2MO1 A;  4X64 Q;  4DUY L;  5C0X J;  4J15 A;  1BVS A;  1HR0 L;  1CKN A;  1FL0 A;  1YZ6 A;  2JQO A;  1UE5 A;  1Q86 C;  1Y1W H;  3A5U A;  1BBW A;  1VQL A;  4POG A;  2I5M X;  1BBU A;  4OON A;  2LSS A;  3F2B A;  5LMN Q;  1N36 Q;  4QIW E;  4JI2 L;  2CWA A;  1KXL A;  1PH8 A;  1B7Y B;  1IBL Q;  4NB3 A;  1VQE A;  5M5X H;  2CCZ A;  3K8A A;  3UDG A;  2B3G A;  3TS0 A;  3I4N G;  3EIV A;  4DV4 Q;  4GOP B;  3RLF A;  4DR3 L;  4A3F H;  3S17 H;  3NBH B;  4GLX A;  1A63 A;  4P72 A;  3RR5 A;  1H95 A;  1E1T A;  3J80 c;  1WYD A;  2ZM6 Q;  4PZ6 A;  3BU2 A;  2GVB A;  1XMO Q;  5IWA L;  3K80 C;  4A3I H;  1OXV A;  1J5E Q;  3ERS X;  3JAM i;  3G6E A;  1IBM Q;  1L1O C;  1E7Z A;  1YJN A;  5C0X I;  4JI1 Q;  1VQ4 A;  3GTK H;  4JOI C;  4KHZ A;  4UPA A;  1LM0 A;  1KL9 A;  4L5R C;  1CSP A;  4X6A H;  1WOC A;  2ZTE A;  4A76 A;  3UE0 A;  1SRO A;  3KF6 B;  2JA8 G;  1VQ5 A;  4DR2 Q;  1SRU A;  1PH7 A;  3BJU A;  5M5Y H;  5IYC H;  3F1Z A;  1SLJ A;  2KEN A;  2NN6 I;  4IJL A;  1QUQ A;  3CMA A;  2YTY A;  1SE8 A;  2BA1 A;  3E9I A;  1I94 Q;  5IP7 G;  2JA5 G;  5C4X H;  5ELO A;  4C3I H;  4DAM A;  1NJI C;  1MJE A;  4JI4 Q;  3W1G A;  5IY0 A;  4LF6 Q;  3PV0 A;  1WFQ A;  3CCL A;  3GTO H;  5JJL A;  4A3L G;  4LFA L;  3W1B A;  2UUC L;  2UU9 Q;  4HJ5 A;  4RG1 A;  2AKW B;  5M3F H;  2OTL A;  2YTX A;  4YWK A;  2F4V Q;  2L15 A;  4HID A;  4A93 G;  3HOY G;  4JC0 A;  3FKI G;  3CCJ A;  1VQM A;  1VQ7 A;  3I4M G;  1X3F A;  4FDB A;  4R4C A;  1K3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...