2ES2A

Crystal structure analysis of the bacillus subtilis cold shock protein bs-cspb in complex with hexathymidine
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-rich DNA single strands bind to a preformed site on the bacterial cold shock protein Bs-CspB.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation
molecule keywords 5'-D(*TP*TP*TP*TP*TP*T)-3'
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2es2A00
1E24A 4GNXB 1S72A 3F2BA 1PV4A 1SFOH 1GD7A 2I5HA 2JA9A 1EQQA 4LNQA 2IX1A 2EQSA 1WCMG 4YCWA 2JQOA 3F8TA 1VQGA 4NXML 3A5ZB 3L7ZC 1HJPA 3I56A 3CCRA 4JI0L 1VQFA 5M5XH 3GTJH 2LXJA 5LMUL 4GLAC 2VUMG 1IBLL 4LF7L 1YHQA 1HNXQ 1A8VA 2MO1A 1GVPA 1VQ5A 4HIKA 1XNQL 3T1YQ 2F52A 2JK8A 4ME3A 2D62A 5IY0A 4JI1Q 5HGQA 1VQIA 3CAMA 4A3MG 1XPRA 3AFQA 3NBHB 4HJ5A 2R93G 4YY3L 4GOPC 2A8VA 5IYCG 3PO2G 1UE5A 1EWIA 3HOWH 3PF4A 4KI0A 4A3IG 1KQSA 1IBMQ 3M4OH 1K83H 4WJ4A 2IHEA 4OO1G 2RCNA 3JC66 4HIDA 2NZOA 2WAQG 1VQ4A 3RLNA 3HFZB 1VQKA 4JI6Q 4LF5L 1JT8A 3OYYA 4POGA 1HNXL 1HZAA 4R4IA 1ASYA 3AFPA 2UXBL 3UDFA 3CCQA 2XGTA 2R7ZH 4YCUA 2PI2E 3J80i 2JA7H 1IBKQ 3L2PA 3M4PA 4DAYB 3J81c 4XTCS 3GO5A 3BU2A 5AJ3Q 2JEBI 2IHFA 1YI2A 1Q7YC 1PH8A 2AWNA 1RL2A 3CPWA 3HOVG 1Y1WH 3PO3H 3CQZH 2IY5B 5GQOA 4BXXH 3G48A 1RIPA 2PQAA 1HZCA 4ALPA 1I5FA 2IX0A 4JI0Q 4JG2A 1BKBA 1CKMA 2HQLA 4A3BG 1UEBA 4A3DG 1UE6A 3H15A 5C0XJ 4QIWE 4DUYQ 2B63G 4R4CA 1AE3A 3I4NG 3CCJA 1K0RA 1VQHA 3G4SA 1YIJA 3T1YL 1XNRL 3H3VH 4LFAL 1VQLA 2BA0A 1X55A 4BBRG 3RZDH 4JYAQ 1P8LA 3S1MH 3I55A 1IBKL 3I7FA 2UUCQ 4DR6Q 3E9IA 2LSSA 1I94L 2HHHQ 1VQ7A 4DR2Q 4DV6Q 4GN5A 4LW1A 4X64Q 1Q82C 4K0KL 5IP7H 1JE5A 1VCIA 4PMWA 2C35B 1N9WA 1M1KC 4KLKA 1K3RA 1I50H 2JA5G 1HNZQ 2Y0SG 3U50C 3CC4A 2ZJRA 1CUKA 2VW9A 1GO3E 1X65A 1NTGA 4B3TQ 2VL6A 1YITA 2ASBA 4YHHQ 1IZ6A 4DV5Q 4DR3Q 4YWMA 3KOJA 4A75A 4JYAL 4JI2L 1WYDA 3PSIA 2JA6H 1D7QA 4NB3A 3U4VA 4IFDG 3GTKH 2D0OA 5FJ8H 1IL2A 3PO2H 1PYBA 3HOWG 1X9NA 4JC0A 4TVAB 4BY1G 1N34L 2VNUD 3J7ZC 4LF8L 3IRBA 3K80C 4GLXA 2F4VQ 1B8AA 1L2FA 1VQAA 3J81j 1N32L 5IT9c 3KFUA 3HKZG 1Z9FA 2AHOB 3LGJA 1XNRQ 1YJ9A 4LF6Q 4DPGA 2CFMA 1HR0L 2JA7G 2ZTCA 1GM5A 3GDEA 3NEMA 2JJQA 1VQNA 1CKNB 2Q2IA 2OTLA 1HH2P 4DR1Q 1KRTA 4X66L 4TQUS 1Y1WG 5M5YH 1U5KA 1KL9A 2KENA 2YYZA 4A3LH 1FVIA 2NVQH 1J5EL 3FHWA 1NMGA 5JEAG 2UU9Q 2OQ0A 4X64L 4A3BH 2F4VL 2K5NA 1IXRA 2ZTDA 2RF4A 4R4QA 2XTIA 1OTCA 4DV0Q 5JJKA 3I2ZA 1CSQA 5C3EH 3E9HA 2JA8G 3I4NH 5GAHC 3KDFA 4LF9Q 4LUOA 1JJGA 3S1RH 3KF6B 5E7NA 4DR3L 1NJIC 5GROA 1C7YA 1DGSA 2Q2TA 2ZTEA 4DUZQ 1Q12A 1N36L 1HR0W 4B3RQ 4QL5A 5ELNA 2QA4A 1MJCA 4DAMA 4DV2L 3OW2A 4IPGA 4IJLA 4LF4L 3ULLA 3PIOA 2R7DA 4WJ3M 5IWAQ 3JAMc 2ZM6L 1UE1A 4J15A 1N32Q 1NMFA 2UUAQ 3CC7A 4DV7L 2VUMH 2UUBL 4IO9A 4A4IA 5JEAJ 1YHAA 1X54A 4JBWA 1JMCA 1AH9A 5FLXc 1KRSA 4LF6L 3K7AH 1QUQA 1HR0Q 4JBKA 2UXCL 4GOPA 4GNXC 2A19A 2JA6G 1Q1BA 2VS1A 3S2DH 1VQ8A 1OXVA 1TWFH 5GADC 3HOUH 3CCMA 1E7ZA 4LUVA 4OX9Q 4C3JH 1WFQA 1NY4A 2I5MX 1BVSA 4DV1L 3S17H 1XJVA 3TREA 3BZKA 4LFBQ 2CQOA 3KJOA 3PGZA 2UU9L 3MEFA 1PH4A 2NVTH 2I0QA 1UWVA 1KHIA 1PH5A 5M3FH 4R1JA 4DV0L 4DR5L 3PV0A 2PMZE 2DUDA 4DV7Q 4L5SA 4QJFA 4O2DA 3CMEA 3UDXA 2NN6G 1B7YB 5LMNQ 4IPDA 4X62Q 1NE3A 4A3CH 1EQRA 3ER0A 5M5WH 3TEHB 1N36Q 4OO1I 1QVFA 2WB1E 1N8RC 2CKZB 3PO3G 3TS2A 3ULPA 3BZCA 2L15A 1Z47A 1VQPA 5JJIA 3K8AA 4BXXG 1JB7A 1C9OA 4A3KH 5FLMG 4LUZA 3S24A 1VQ9A 3CCLA 2UUAL 4A3DH 1IBLQ 3PCOB 4DK6C 1GKHA 2NZHA 3KLWA 5C3EG 1Q86C 4JBMA 1L1OB 1MJEA 2AMCB 3GTGH 1XTDA 5GAGC 4A3GG 1W2BA 2BH2A 1FGUA 4NXNQ 2OTJA 4JI1L 4X62L 4MTNA 4C3HH 5GAEC 1OXSC 1V1QA 4DNIA 3RN2A 4JBJA 4L5TA 4C3IH 5C0XI 1G291 4IJHA 5IYDH 4A3JG 5H1SE 3J80c 2Q2HA 1HNWL 3PUZA 4LFBL 1PH7A 3K81C 2ALYB 4BY7G 4KHZA 1ASZA 2NVYH 1QVCA 4JI8L 1VQ6A 4X6AH 4GN3B 1LM0A 4PZ6A 3HKSA 4LF5Q 1BBUA 1YJWA 1XMQL 2E5LL 1HZ9A 2E8GA 5JJLA 3T1HL 2LXKA 3AEVA 2YTYA 4OWWB 1HZBA 1X3FA 4JOIA 1Q46A 3GTOH 1TXYA 3W1GA 4IOCA 4QQBX 4EQ5A 2KHJA 2ATWA 1L1OA 5EAYA 3M3YH 5IYBG 3H0GH 1J6QA 5AJ3L 4UP9A 4YWKA 4HJ9A 5LMNW 3HOUG 5FJ8G 1VQBA 4P74A 4PZ8A 4L5RC 4BBSH 2K14A 4KHPL 1M90C 1L1OC 1HNWQ 4OWXB 1OXTA 3PUWA 4GKKQ 2K4KA 4DV4Q 4JCVE 4HIMA 4JOIC 4MNOA 4JV5Q 4MZ9A 1NBWA 3G6EA 3S2HH 3KYHC 4JI3L 3RNUA 5M3FG 4DV3L 5K36G 2UXBQ 3DM3A 2K5VA 1A62A 2DGYA 1XMQQ 3SGIA 4A93G 3CD6A 4A3EG 1VQEA 1SRUA 1C0AA 3K7UC 2B29A 5M3MH 3F1ZA 4EX5A 1Q81C 3PUYA 1A0IA 4POFA 3CCEA 4JI4Q 1I94Q 2HHHL 1PA6A 2GVAA 1PHJA 3RZOH 1SMXA 2KCTA 2RHSB 4DKAC 1VQOA 3RLOA 5BR8Q 1N33L 2ES2A 2Y0SE 3S1QH 4JI8Q 1YBYA 1LUZA 1L0WA 1Y1VH 3D0FA 3Q8DA 3U58A 3OTOL 4DR7L 2B3GA 3TS0A 1B70B 3CW2C 3A74A 2ZJPA 1QVGA 4DV3Q 3A5UA 3K0XA 2YU9H 2JA8H 4A3GH 3GD7A 1XPOA 2AKWB 1EUJA 2RHQB 2CWAA 2UUCL 5ELOA 1QZGA 4OWTB 3GTMH 2NVXH 3I4OA 4YY3Q 1VS0A 5C4XH 5IYDG 1X3EA 1OXUA 3STBD 3W1BA 1YJNA 1PH9A 1G6PA 1OXXK 3FP9A 1FJGL 1N34Q 4NXMQ 1Y14B 4BY7H 4DV4L 1CKOA 3RLFA 3UDGA 1XPUA 3M4QA 4LF7Q 3OTOQ 2KBNA 4UP7A 3CP0A 3F2CA 3CCUA 1XNQQ 3HOYH 4YHHL 4DV5L 5IE8A 1K8GA 3EN2A 2AWOA 3EBEA 2R6GA 2NN6I 2Z6KC 3GTQH 4GLVB 3BJUA 2MFIA 5IYBH 2I5LX 4P71A 2D0PA 2PNHA 3H3VI 3PF5A 1PH1A 2K75A 1PVOA 4YCVA 4AQYQ 4GN4B 2R92H 3UE0A 4GKJL 2Z0SA 3RR5A 5IP9G 1IBML 1SR3A 4AYBG 5BR8L 1PH6A 3S1NH 2YTVA 4H02A 2ID0A 4L5QA 2HT1A 4QGUA 3J7A5 2E2HH 1KIXA 3WWVA 4P75A 1G51A 1CKNA 4X65L 2GN5A 4LF9L 3JAMi 4R4TA 3HKZE 1E22A 4LFAQ 2CCZA 4LFCQ 4IPHA 4A3CG 4XIGS 3CC2A 5M3MG 3CMAA 2BH8A 3D31A 4B3ML 1YHBA 1KC8C 4Y7NH 4DR6L 2YV5A 3UDIA 1WCMH 4DV2Q 4P72A 2N8NA 1A63A 1FJGQ 4GKJQ 2WAQE 3VDYA 1U0LA 4DV6L 1LTLA 3TQYA 2PQAB 4A3KG 5FLMH 5C44G 3HOZG 4BA1I 4K0KQ 1TWHH 2JEAI 5J3BA 3FKIG 2MO0A 3E0EA 4DUYL 1EFWA 3J81i 1XMOL 3M9BA 2N49A 1MIUA 3PIPA 1KD1C 5HY6A 1E1TA 4X65Q 4HJ7A 2GVBA 1BBWA 4GOPB 3M7NA 2JE6I 4DK3C 4DUZL 1VQDA 2FXQA 2N3SA 3I4MG 5IYCH 3RN5A 2YTXA 3AYHB 2Q2UA 3L0OA 4B3MQ 5C4XG 1E1OA 4LF4Q 2EIFA 4AIMA 4AQYL 4A3FG 4A3JH 1R9TH 4DR2L 4PZ7A 1Q1EA 1JJ2A 1KAWA 1JJCB 4LF8Q 2KHIA 2BA1A 3GTPH 1YEZA 4JI7L 2UUBQ 4AH6A 1QUQB 1HNZL 2VZAA 3U4ZA 2V1CC 1QZHA 2R7ZG 1V43A 3HOYG 4B3TL 4OXPA 4RG1A 1SLJA 1TWGH 3CCVA 2OWOA 1P16A 4LFCL 3CCSA 2EXDA 2UXCQ 4JI2Q 3HOXG 1LYLA 4C2MH 3AQQA 3GTLH 4BA2I 1W3SA 2K5HA 1KXLA 1T9HA 2OQKA 3ZJYC 3CF5A 3H0GG 1PH3A 1X3GA 1EIYB 3G71A 2ZJQA 4UY8C 2HIXA 3HOVH 2PI2A 2R92G 1D8LA 1WOCA 2MQHA 1CSPA 5IP9H 3PUXA 4GS3A 1IYJB 4DV1Q 4BBSG 5C0XG 2WP8J 3B6YA 3F2DA 4P73A 2MNAA 3CPFA 1I6HH 3KF8B 1VQMA 4JI7Q 1XMOQ 3NENA 4AYBE 1S40A 1PYSB 1SN8A 4A93H 4BBRH 4R4OA 3ULJA 3PUVA 3A0JA 3DLLA 4HJAA 4A3EH 2E2IH 2K52A 2VQFQ 1K8AC 3NELA 3KF6A 1YVCA 3ERSX 4PG3A 4DR1L 4JI5Q 1O7IA 4X66Q 1WJJA 1YNXA 1VQCA 3S14H 1PFSA 2WB1G 2Z6KA 4NPSA 3ICEA 1SE8A 1J5EQ 5IP7G 2QEXA 1S3OA 2A1AA 1E3PA 2WFWA 1EOVA 1Q8KA 1SROA 2N78A 5IWAL 5C44H 1EYGA 2VQEQ 1Y1VG 2JA5H 3HOZH 3FKIH 4DR4L 2E5LQ 4IFDI 4APVA 1FL0A 4B3SQ 3S16H 4NXNL 4UP8A 4IFDJ 3KDFB 2UXDL 4A3MH 4Y52H 4UPAA 3I4MH 4B3RL 2R93H 3W5OA 2E2JH 3M85A 1YZ6A 1WI5A 4JI5L 3STBC 4A3FH 4BY1H 2IT1A 4A3IH 3KJPA 5DLQE 2F3IA 1TWCH 2ZM6Q 4A76A 1TWAH 2VY3A 5LMUQ 4HJ8A 4JV5L 4GNXA 4FDBA 3MXNB 2VQEL 1K73C 3S15H 3T1HQ 1I3QH 4DR5Q 4RMFA 4O0AA 5LMNL 2HIVA 2K50A 4OONA 1AE2A 3UE1A 1UE7A 3HOXH 2VQFL 2UXDQ 1VQJA 4IPCA 1EIFA 1MKHA 1X6OA 4JI4L 1PH2A 1H95A 5C4JH 3CXCA 4A3LG 4KHPQ 1X56A 4OX9L 2KCMA 3EIVA 2CWPA 4GKKL 1N33Q 4QY7A 2R7FA 1K9MC 4JI3Q 2QGQA 4DR7Q 1V9PA 4JI6L 2H5XA 2OCEA 4LWCA 2B63H 3TRZA 4DR4Q 4B3SL 4IOAA 4YWLA 4HIOA
chains in the Genus database with same CATH superfamily
2EOTA 5LL6X 4CGYB 2JSOA 4ZK9B 1SFOH 1EIHA 5LL6S 3CRKC 1TR5A 1CFMA 4LNQA 3EFXD 1TY0A 3I56A 2B2VC 2HCCA 3VYRA 5LMUL 2VUMG 4YIJA 4PV1C 1IBLL 1EWHA 2MO1A 1GVPA 1SE3A 2D62A 1LT5D 5T1IA 3D8GA 1NNXA 1VQIA 3AFQA 4IUNA 2A8VA 4IQZA 2EYHA 3U9SA 5M5WB 3PO2G 3H91A 1EWIA 1ILPA 2F0MA 4KI0A 1KQSA 1IBMQ 4WJ4A 4F8MA 4OO1G 5M3FB 1EQTA 3PIO3 2WAQG 1WTQA 3HFZB 5BN5A 3N52A 3OYYA 4Z9CB 1HNXL 4R4IA 3EJIA 2UXBL 5CR3A 2XGTA 4YCUA 2PI2E 2JA7H 1ET9A 1ESRA 3GO5A 1PH8A 2JEBI 4HCEA 3PO3H 2IY5B 1M8AA 2KECA 3CQZH 1DJRD 1RIPA 4IUTA 1HZCA 4ALPA 4JI0Q 2FMCA 2KCCA 2IX3A 1UEBA 3CU7A 3MAQA 1EYDA 3I4NG 4NDXA 4MN3A 3T1YL 4DFAA 1VQLA 2BA0A 2MGSA 3RZDH 3HEJA 1U4RA 5FOBB 3I55A 1NUCA 4DXGA 4DR6Q 3A8JE 2EY2A 2HHHQ 1CTMA 4CJ2C 4DR2Q 3M4OB 3J81E 2F0DA 4GN5A 1H9JA 4X64Q 4KKUA 1A2UA 1JE5A 4PMWA 2C35B 1M1KC 1DZ1A 1K3RA 2AQ3B 3GV6A 2Y0SG 3S9WA 2ZJRA 4ABNA 2VW9A 1X65A 4BS9A 2C5CA 4L6TB 3OIQA 4A75A 1KABA 1MGSA 3T51B 4JI2L 1HRJA 1GUTA 1CM9A 3GTJB 3PSIA 4IFDG 2D0OA 1AEXA 5FJ8H 3DWQA 3AB9A 1SYEA 1R4QB 4KY5A 1X9NA 5CV9A 2VNUD 2EYMA 1V1PB 4LF8L 1B8AA 1EY4A 1VQAA 2EYOA 4G4KA 1X3PA 4FO2A 1HXYD 2AHOB 2NVXB 2PZTA 1HR0L 1RDPD 3KLSA 3LX0A 2JA7G 2ZTCA 1JOOA 3R2IA 2Q2IA 1C8CA 2G9DA 3I72A 2MP1A 2OTLA 4DR1Q 4TQUS 1KL9A 2KENA 3NQIA 1FVIA 3AMUA 2B2UA 1PFMA 2F4VL 1IXRA 4FXKC 1JWMD 3E9HA 1G6ZA 3LNNA 3Q24A 3KF6B 5E7NA 2EXZA 1K8OA 1HR0W 5C4ZA 1O78A 5KNCA 2QA4A 3OW2A 4IJLA 3S2HB 1EL0A 2R7DA 4WJ3M 4FF3A 2EJMA 1CQFA 2VUMH 1YHAA 4R8IA 1X54A 1AH9A 5CYUA 1GUGA 2NWGA 2B8GA 2F0VA 4GOPA 4GNXC 2AUKA 2JA5B 3SK6A 2JA6G 3MHBA 1Q1BA 3S2DH 2K01A 5GADC 4Q0FA 3CCMA 1F77A 2K32A 4DV1L 1WFQA 1NY4A 2I5MX 4KJNA 4LFBQ 4L8JA 2CQOA 2UU9L 3J80L 2NVTH 1UWVA 5M3FH 4QJFA 2ZXPA 2K03A 3UDXA 4HSPA 1HTLD 5LMNQ 1BUVT 2AQ2B 3ER0A 3SEBA 4ZKCB 5HURA 2IL8A 1N36Q 3VYUA 4C56C 1D2BA 3BZCA 1VQPA 4NP5A 4BXXG 2XN9C 4A3KH 3U9OA 1Y69U 4A3DH 5E4WC 4DK6C 1Q86C 2G5DA 3KLWA 4JBMA 4N8FA 5ELBA 2Z4HA 5BN4A 3N6RA 4NXNQ 1CT1D 2O2LD 3C3LA 5GAEC 1EIGA 4KKSA 1PFNA 1V1QA 2NUCA 3GTPB 2K5QA 4JBJA 3RN2A 3J80c 4ZKBB 2L4NA 2NVTB 1KNAA 1U4PA 2XWJB 4JI8L 5E3FA 4GN3B 4LF5Q 4PZ6A 4MIUA 1F9PA 2E5LL 1DOMA 2E8GA 1CZWA 4IUUA 4TRDA 2NTTA 3AEVA 4OWWB 3ONAB 1HZBA 1Q46A 5C5LA 4IOCA 1STEA 3MXNA 4N9TA 5KYIA 5CMDA 3UI2A 4HJ9A 5LMNW 3HOUG 1VQBA 2VUMB 1JOKA 4L5RC 3OMGA 4KHPL 4C1NK 1S4ZA 1HNWQ 2L9HA 4GKKQ 2K4KA 4DV4Q 4HIMA 3S15B 1J9OA 3G6EA 3KYHC 5I9PA 4XQNA 4LAAA 5K36G 2A6ED 1A62A 2RSOA 3SGIA 3VA7A 1W6JA 2F0QA 1RHPA 1SRUA 2E2JB 3PUYA 4POFA 1MHWC 3CCEA 3D6WA 4JI4Q 1XYIA 2GVAA 1PA6A 1PHJA 3RZOH 5D3IB 4DKAC 4NMZA 2ES2A 2OXPA 1L0WA 2ZJPA 1QVGA 4DV3Q 2SNSA 2BE5D 2NVYB 5ELOA 4OWTB 2EZVA 3GTMH 2SNMA 2E75C 3W1BA 1YJNA 5EKLA 1G6PA 5G3LD 3NQTA 4X3TA 5C4XB 1CKOA 1QG7A 3RLFA 3GTMB 1XPUA 3OTOQ 1Y8OB 3D6CA 2R6GA 2Z6KC 1H9RA 3GTQH 2R61A 4C2MB 2ICEC 2D0PA 3IFTA 1PXUA 2HCIA 2K75A 3GQBA 2Z0SA 1IBML 1ONLA 4AYBG 1A3UA 1Q90A 4L5QA 4U68A 2HT1A 3J7A5 1LABA 1STNA 2E2HH 2P5ZX 4P75A 3GP7A 1G51A 5CGKA 1KDAA 4X65L 4LF9L 3JAMi 4R4TA 4LFCQ 2BE5C 5CV6A 2BH8A 2J4XA 4ODGA 2F0EA 3M4YA 3V05A 1KC8C 4DR6L 4DV2Q 4P72A 5D65A 4GKJQ 2F3WA 1PTOD 2B8FA 1SNMA 4A3KG 4WFN3 2MPMA 1CK1A 5FLMH 5C44G 4BA1I 5J22A 1E2WA 5J3BA 3E0EA 1PLFA 3DWPA 2N49A 4HJ7A 1BBWA 4B9XA 2LFNA 1QNUA 3H94A 4KN4C 1STHA 1GJXA 2SEBD 2Q2UA 2A6EC 1E1OA 2KA7A 1WTRA 3Q23A 4DR2L 3NE5B 4V0BA 1JJCB 4LF8Q 4RCOA 3GTPH 1YEZA 2DY7A 4JI7L 1O7ZA 4AH6A 2VZAA 3U4ZA 3T16A 1TU2B 1V43A 1K8MA 1SLJA 4K5WA 1TWGH 3A8IE 2H1EA 3F2UA 2OWOA 2R92B 2NVQB 4JI2Q 4A3DB 1IW7D 1T9HA 3HGBA 1PH3A 1X3GA 3BDOA 3G71A 3HOVH 2ENBA 5IP9H 4GS3A 4UHVA 1ZXTA 2WP8J 3B6YA 4KJOA 3F2DA 2MNAA 2M00A 3CPFA 2PQEA 1SYBA 2K5WA 4DXFA 4ZCKA 1WVLA 5G3LF 2JN4A 1SYGA 1QWYA 1XMOQ 1QJOA 1PYSB 1SN8A 1BCPD 3MXUA 4R4OA 3DLLA 4HJAA 5D3DA 2C9OA 1TIID 1I4GA 1Y8NB 4DR1L 2IWHA 1VQCA 3J7AV 3S14H 1SE8A 1TWFB 2QEXA 1S3OA 1GXDC 2N78A 1HUNA 5C44H 4RFBA 3VR6A 1EYGA 1ET6A 1VDZA 4CKCA 3MXGA 5M9OA 1MBYA 3S16H 2A68C 1SDFA 4IFDJ 2UXDL 4A3MH 1QOHA 3I4MH 1GHKA 5CV8A 2E2JH 2RDHA 4X3SA 2DNEA 3SXHA 2FFKB 4A3FH 2F3VA 4A3IH 4OO1H 5DLQE 1HHVA 3J7YW 1TWAH 4HJ8A 2VQEL 3T1HQ 4XQQA 4RMFA 1EU3A 2D2CC 3I4LA 5IGEA 5LMNL 2EE1A 4OONA 1AE2A 3NTHA 4XYQA 1UE7A 2XSCA 2VQFL 3LWEA 4V190 1B44D 1MKHA 3S16B 3TP7A 4S3SA 3KK7A 1PH2A 1E0BA 5C44B 3EIVA 1I6VC 2PNRC 3QO2A 2RVLA 4HCSA 1ZEQX 4QY7A 4JI3Q 3OSOA 4JI6L 4DR4Q 2MUYA 2OF1A 1FNWA 4B3SL 1F2YA 4K5VA 4FF4A 4DNTB 2B2YA 3MVVA 2I5HA 1PRTF 2EYLA 1EQQA 3HOWB 1FYCA 5KGUA 3L7ZC 3CCRA 5M5XH 1ICFB 3SK8A 1YHQA 1HNXQ 4EQNA 4ME3A 2JK8A 3CAMA 1G2SA 4HJ5A 4GOPC 3EQLC 3K58A 5EKKA 1UE5A 4U673 2TMPA 4HMIA 4G7HC 4RCNA 4A3IG 1SFOB 3DHQA 2RCNA 5EQ0A 3KUPA 2NZOA 4LF5L 3L9AX 4K6DA 1BF4A 1VQKA 3S1MB 1PZJD 1HZAA 2QILA 1ASYA 1DD2A 4E6IA 3I8ZA 4KV6A 1SYCA 3J81c 4XTCS 2IHFA 2AWNA 1RL2A 3HOVG 4ME5A 5GQOA 2F0NA 2PYKA 1Y1WB 2IX0A 2BCOA 4JG2A 1SNPA 1BKBA 4B9WA 1UE6A 5C0XJ 4QIWE 2B63G 4Y7NB 2HDLA 2MHVA 3VA5A 1F9RA 3JAML 1K0RA 1PZID 4CKBA 1XNRL 3H3VH 4LFAL 1XXGA 3S1MH 1IBKL 3I7FA 1V1PA 4JK1C 3E9IA 5FKAC 4RHSA 3BS1A 4KN7C 5C3EB 4LW1A 1Q82C 5IP7H 3NBIA 1VCIA 1N9WA 4PNYA 3MC0B 1I50H 1HNZQ 3H3VC 1CUKA 1DM0B 1PRTD 1GO3E 1NTGA 1I4XA 3HG9A 2ASBA 1IZ6A 4DR3Q 4JYAL 5JPNC 1EOTA 1WYDA 4DF7A 3U4VA 4JPBW 4N9PA 1IL2A 3PO2H 4FP5D 4JC0A 4TVAB 4BY1G 1B2TA 1QILA 2RCFA 2RDGA 2F4VQ 1L2FA 3J81j 1L0YB 1LTAD 5IT9c 2E76C 4RAUC 2Z4IA 3HKZG 1Z9FA 1MD2D 4CHTB 1YJ9A 4DPGA 2L12A 1GM5A 3GDEA 4HAEA 2JJQA 3C1FA 3SR1A 5EPKA 5C6AA 1Y1WG 2YYZA 4CJ0B 3FRPB 5C4JB 3S1QB 2NVQH 1J5EL 4A3BH 4QCLA 5JJKA 3HOXB 4DV0Q 2WB1B 2JA8G 1SMYC 3I4NH 5EJWA 4LF9Q 3KDFA 1IHZA 3K6OA 5GROA 2EVBA 1R9TB 1MJCA 4DAMA 4DV2L 2X69A 4IPGA 4ZUIA 3PIOA 2KHSA 2RBMA 1PTOH 4J15A 1N32Q 1NMFA 2UUAQ 3CC7A 4BBSB 1T5XD 3VR3A 4IO9A 4X3UA 5FLXc 1KRSA 2K7VA 4LF6L 1CHQD 3CQZB 4JBKA 4DAPA 2J7ZA 2VS1A 1RD9D 2JP1A 3FDTA 3I90A 1BQQT 1SJHD 1E7ZA 3URYA 2R7ZB 1JC7A 2F0UA 3S17H 1BVSA 3TN2A 3TREA 3P20A 5A2QL 4QUCA 1GUOA 3MEFA 1KHIA 1PTOF 1PH5A 4L5SA 4DR5L 5K36H 4O2DA 3G6JB 4A3CH 2PCFB 2NTSA 1IYUA 3GV3A 1F2ZA 1F9SA 2F0WA 4UDUC 1QVFA 3MEHA 3RMHA 1EY8A 2CKZB 2PMZB 3ULPA 3PO3G 3TS2A 2L15A 5JJIA 1XTCD 4XYOA 3CCLA 4XQJA 1ZYRC 1IL8A 1SEBD 2K04A 3PCOB 1GOZA 3GTGH 5GAGC 2BH2A 1XX8A 4RGOS 4X62L 3TP5A 2KOLA 4C3HH 3K57A 2IPKD 4L5TA 5JVG3 1G291 1HNWL 5F2DA 4FF1A 2KCNA 3SE0A 2PZWA 2O5JC 3K81C 2JXMB 1ASZA 5KNDA 3S17B 5EPLA 3HKSA 1BBUA 3S2DB 1H9MA 3T1HL 2LXKA 2TSSA 3GTOH 3DXJC 1BCPB 2WINB 1G91A 2ATWA 1J6QA 1CQVA 1ENAA 5AJ3L 4UP9A 4YWKA 2Y0SB 5FJ8G 4PZ8A 1NAPA 3A54A 1STGA 1I3QB 2N55A 4JCVE 3S2HH 4JI3L 4DV3L 1LACA 3DM3A 1XMQQ 1A2TA 4A93G 2FINB 3CD6A 3R3OA 3K7UC 1ILQA 2B29A 3S1RB 5M3MH 1SSOA 4GZYC 1A0IA 3I4NB 1I94Q 1SMXA 2FMMA 2A69C 3RLOA 5BR8Q 1MSGA 3BVMA 1YBYA 5JEAH 3OTOL 5M5YB 3TS0A 3FEWX 3A5UA 3K0XA 2YU9H 4A3GH 5DAUA 4Q5VA 2Q8RE 5D14A 4M1UB 4WJWA 4DNRB 2NVXH 2K05A 3I4OA 1VS0A 1IYVA 3SDZA 5IYDG 1A3TA 1Q8IA 1OXXK 1FJGL 3MTSA 4C3HB 2EY5A 4BY7H 3JAME 3IFDA 2F1MA 3M4QA 2SDFA 3PO2B 3BYTB 1JOQA 3F2CA 3GTKB 1QE6A 3E0JA 4A3GB 4YHHL 5IE8A 3SHLA 2O4XA 2XIWA 3EBEA 2K6AA 1S5ED 2NN6I 2MFIA 2I5LX 4IZ8A 4YCVA 4GKJL 5DNFA 3BZDB 2EJGC 1KIXA 3WWVA 5I2XA 5TSSA 1HPCA 1S5CD 2M2LA 4LFAQ 4A3CG 2Z8LA 3SK4A 1PFBA 4Y7NH 2CQAA 3UDIA 1GUWA 4AYBB 2EY1A 2X6LA 2XVSA 1A63A 2WAQE 1HQRD 1LTLA 3I70A 3TQYA 3NWTA 5FO8B 3HOZG 3NK9A 2JEAI 2XRQD 1EFWA 1MIUA 2F0LA 4R9WA 2GVBA 4CBVA 5L37A 2JE6I 1A15A 4DK3C 2B2UC 5I4DA 3PIP3 1EQVA 5IYCH 2YTXA 5C4XG 1OO9B 2EIFA 4AIMA 4AQYL 4A3JH 1MSHA 1KAWA 1CZGA 2KHIA 1SYDA 2DJFC 2UUBQ 2HDMA 1QUQB 1HNZL 1FGBD 3A8KE 4OXPA 4OELB 4H13C 3CCVA 4QB4A 2UXCQ 5C3WA 1EWCA 1KNEA 4BA2I 2K5HA 3R2TA 5IIFA 2ZJQA 3CF5A 5C0XG 4P73A 1EZ8A 1VQMA 2EYJA 4A93H 4RA8A 2RA4A 1K8AC 5ELCA 5EKIA 4QMGA 1O7IA 1WJJA 5A35A 4IALA 2GA4B 4NW2A 4NPSA 1J5EQ 1UUPA 5NUCA 1E3PA 1EOVA 4WORA 2VQEQ 4APVA 5JAVA 2AQ1B 3NTIA 1SE2A 3KDFB 4Y52H 3TZUA 1NR2A 3W5OA 5CV7A 1EY6A 2EYPA 4ZAIA 4FF2A 2N88A 3KJPA 1TWCH 1HA5A 5EPJA 5LMUQ 4A3IB 2LMCB 4RKLA 4IUVA 1I3QH 4DR5Q 1HUMA 3BDLA 2HIVA 2K50A 1KTKA 5EBCA 1CI3M 1EIFA 4A3BB 1TS4A 5C4JH 4A3LG 3BYYB 2F4IA 2KCMA 4H7BA 4DK0A 4EVOA 5CC4A 1N33Q 2CW0C 4DR7Q 1I4PA 1V9PA 2OCEA 4LWCA 3TRZA 1NR4A 3PMFA 2LY7A 4IOAA 4YWLA 2B2VA 4A3EB 2E2IB 4G7ZC 3F2BA 1PV4A 4QIWB 1ICWA 4DK1A 3NHHA 4F87A 2IX1A 1WCMG 4YCWA 5LHY1 3A5ZB 3R8BA 3IL8A 4JI0L 1EY0A 1EEID 2LXJA 1O7YA 3FPUB 4LF7L 1EY7A 4EGVA 4HIKA 1VQ5A 1XNQL 3GTLB 3T1YQ 2F52A 5CORA 4ZUJA 5IY0A 1QB5D 2IW3A 4H0LC 5HGQA 1B50A 3MFGA 1B9NA 2R93G 4YY3L 1DOKA 2D9UA 2E2DC 5IYCG 3K59A 3HOWH 4C3JG 3M4OH 1K83H 2IHEA 3X3MA 3JC66 1JB3A 3RLNA 4HEDA 1JT8A 4KD3A 4POGA 2HQEA 3UDFA 2R7ZH 1IBKQ 1X32A 3M4PA 4DAYB 1AW7A 1SMYD 3BU2A 5AJ3Q 1Q7YC 1YI2A 1XWEA 1Y1WH 3IAYA 3NPPA 3HZXA 3G48A 2PQAA 3PO3B 1I5FA 3K0YA 1CKMA 4CDCC 4X3KA 3H15A 4DUYQ 2JA7B 1AE3A 3G4SA 2B39A 5KEEA 1YIJA 1LTGD 1X55A 4JYAQ 1FNVA 1SNQA 1UAPA 4G7OC 2LSSA 1I94L 1TQOA 1VQ7A 3D3RA 4K8JA 3A55A 2R93B 2DN8A 3WOEA 4K6LA 1PDQA 4G57A 4KLKA 1SE4A 3CC4A 3U50C 3EROA 4B3TQ 1FR3A 3P1HA 2PW7A 2VL6A 4YHHQ 4YWMA 3VR4A 1KAAA 5C3XA 1B4OA 1TT2A 3ZYYX 1RJTA 4IURA 2BOSA 1LT4D 3IRBA 4GLXA 3KF8A 4BBRB 5IOCA 1SAPA 1U4LA 4WRDA 2NYZD 3KFUA 1V1OA 1I4HA 3CRLC 3LGJA 4KKTA 1I6HB 2CFMA 1VQNA 1L0XB 3I73A 1KRTA 4X66L 5M5YH 1U5KA 4A3LH 1UNSA 1NMGA 2EY6A 5JEAG 2UU9Q 4X64L 3AU7A 3FMCA 2RF4A 4DAVA 2XTIA 1OTCA 2MJ8A 3I2ZA 2DJGC 5C3EH 2XRSD 1WD1A 4LUOA 1JJGA 2HD3A 1C7YA 1VMPA 2Z9HA 2ZTEA 1N36L 4B3RQ 4QL5A 1BXTA 1JWUD 3ULLA 4HSVA 4DU9A 1SYFA 1UE1A 3OPOA 4ZQ3A 2UUBL 1LTSD 4A4IA 4JBWA 3RUZA 3M3YB 1QUQA 1HR0Q 4O1NA 2WV6D 1JR0D 2UXCL 1VF7A 2QDBA 1TWFH 3HOUH 4OX9Q 1WTOA 1XJVA 3BZKA 3KJOA 3PGZA 1KLGD 1F2LA 1TVXA 4R1JA 3PV0A 4DV7Q 2DUDA 3CMEA 1B7YB 1DXMA 4X62Q 1NE3A 4CDFC 1SXTA 1EQRA 3QIAA 1BNZA 3GTGB 4OO1I 3Q6SA 1SNCA 2ICIA 2WB1E 1N8RC 2J0TD 1DONA 1JE4A 1Z47A 3K8AA 4KY6A 1JB7A 1C9OA 4P2CB 4LUZA 1CA5A 4KHVA 4RGNA 1GKHA 2NZHA 5C3EG 2A69D 2G9HD 1DOLA 1XTDA 1B9MA 4RH6A 1W2BA 1FGUA 2A74C 4JI1L 4MTNA 4K2LA 2I07B 1YNND 3TSSA 5IYDH 4A3JG 3OHXC 5H1SE 2Q2HA 3K5LA 1NCVA 4IUPA 1EY5A 1PH7A 4LFBL 4X6AH 1QVCA 2K28A 3X3NA 1XMQL 4ILWA 1R4PB 4J8QA 1U4MA 3OW7A 1Y1VB 2M9VA 2YTYA 1X3FA 2DNCA 4M8AA 4QQBX 3W1GA 2ZT9C 4EQ5A 3M3YH 1L1OA 5EAYA 1ESFA 3H0GH 5IYBG 3A7LA 4F7XA 2KEDA 5JJZA 5A2QE 2B2TC 1M90C 1PTOB 2B2YC 1OXTA 3PUWA 4OWXB 4JOIC 2EYFA 4EQPA 4MZ9A 1Z6HA 2K5VA 2KEEA 4A3EG 1LLRD 3ITPA 2KCTA 4KK7A 1N33L 2Y0SE 3S1QH 4JI8Q 4L63B 3D0FA 1FNUA 4DR7L 2NZ1D 2B3GA 2QCPX 1B70B 2Z1CA 2XNAC 2JA8H 3HOYB 4OIJA 1EY9A 1JWSD 2AKWB 1EUJA 2CWAA 5ELDA 4C3HG 2UUCL 1QZGA 5CV4A 4YY3Q 1X3EA 1OXUA 1QNKA 3I91A 3STBD 1PH9A 2K33A 1N34Q 1Y14B 1HCZA 4DV4L 5DEHA 2QW7A 3UDGA 3T13A 4LF7Q 2KBNA 5EGTA 3CCUA 2L5TA 1XNQQ 3HOYH 4DV5L 4J1MA 3EN2A 2WKCA 4GLVB 3QB3A 1AP0A 2PNHA 2F03A 1I50B 1CHPD 3UE0A 2Z6BA 3J80E 2RKSA 1D7QA 1SR3A 3RD4A 1PH6A 2YTVA 5E4XA 3W3AA 2F0PA 3T53B 3EA6A 5K5PA 1WTWA 1CKNA 3SVMA 2GN5A 4A3JB 3HKZE 1E22A 3EVQA 3RZDB 5IGCA 3CC2A 3LWUA 4JW0A 2RSNA 2YV5A 5DM63 2LKVA 3KBXA 3FVQA 1A3VA 3ND8A 2N8NA 2L1BA 4LJZC 1U0LA 3TDQA 1SJED 2PQAB 1X3QA 1TWHB 3ND9A 5KNBA 4DUYL 1XMOL 3M9BA 4EQOA 3PIPA 4XT1B 5E1FA 1KD1C 1E1TA 3QOJA 1WCMB 5FLXL 4DUZL 4RKBA 3I4MG 3TZDA 3RN5A 3AYHB 4B3MQ 4LF4Q 4A3FG 1R9TH 4RWSC 2CH4W 1B53A 2F0SA 2VB3X 2SOBA 4FVMA 2V1CC 4XDXA 1BOSA 1QZHA 4B3TL 1P16A 4LFCL 2EXDA 2OT2A 5CV5A 4C1NI 1LYLA 4C2MH 3AQQA 4HMJA 2OQKA 4A3KB 1EIYB 4UY8C 2E74C 2HIXA 1G2TA 2R92G 4BWGB 1CSPA 4BBSG 2BDOA 2HUGA 1F2MA 1W6KA 5CBEE 3QJYA 3KF8B 3NXWA 1JORA 4BY7B 4AYBE 1DYQA 1S40A 2NBFA 2WAQB 4OL7A 3A0JA 2K52A 2VQFQ 1TS5A 3NELA 4CDDC 1STYA 5IT9L 1YVCA 4HTHA 4X66Q 1YNXA 2YU9B 2Z6KA 1EYCA 5IP7G 2WFWA 4HN7A 5HGTA 1Y1VG 3FKIH 2NB0A 4DR4L 1BDOA 2B2WA 4IFDI 4B3SQ 4UP8A 3OIPA 1HA6A 3NP8A 4K14A 2K1BA 4UPAA 4B3RL 2R93H 3M85A 3HKZB 1JQYD 4JI5L 1EYAA 3PQIA 2IT1A 5FO9B 1DCZA 1Y8PB 2QKIC 2F3IA 4JV5L 4GNXA 4A3FB 1RF2D 4O0AA 5I9OA 2WIIB 5IGFA 4KY7A 1VQJA 1X6OA 1IKLA 3VR2A 1H95A 3CXCA 4ZYSA 4OX9L 2CWPA 3S1NB 2RQXA 1I4QA 1ENFA 2R7FA 1K9MC 5FO7B 3E5SA 3HRZC 2B63H 1WTXA 3BVGA 2XWBB 4HIOA 1ENCA 1H9SB 2JYOA 1E24A 4GNXB 1S72A 1WD0A 1GD7A 2WACA 3BDCA 1II3A 2JA9A 1LTID 1LO5D 2I46A 4ID6A 1BCPF 1YNJD 2EQSA 1NSNS 1AN8A 1F9QA 2JQOA 1VQGA 2QEJC 3CKIB 3F8TA 4OGQC 4CKEA 4NXML 1HJPA 1LV9A 4N8X1 2CVRA 1KDCA 1VQFA 4DGZA 3GTJH 4GLAC 1A8VA 3BG3A 3HOVB 4NKLA 3NTKA 4JI1Q 5M5XB 5AFWA 4A3MG 1XPRA 3NBHB 5T1GA 1E2ZA 1PZKD 3PF4A 1D5MC 1K28A 1QCBD 1WTHA 3NUCA 4HIDA 1VQ4A 1D6EC 4JI6Q 3KLSX 4LK1C 2NN6H 3MFYA 2B63B 1BO0A 3AFPA 5IODA 3CCQA 3J80i 4QUFA 5J39A 3L2PA 2O5IC 5JPMC 3CPWA 2A68D 4BXXH 1SNDA 3KBGA 2HQLA 4A3BG 4A3DG 4J6HA 4R4CA 2B2WC 3CCJA 1AZPA 1VQHA 4TKOB 4R8NA 2F0HA 4BBRG 3K5OA 1P8LA 3MZ5A 1SNOA 2UUCQ 4DV6Q 2A6HD 1VF5C 3HS0C 5C5MA 2X6GA 4K0KL 1ZKOA 2VB2X 2ZXOA 4OIKA 2JA5G 2KQ3A 3FKIB 2H4OA 1YITA 4DV5Q 1LT6D 2F0GA 2D5DA 3KOJA 1EFID 2JA6H 4NB3A 3GTKH 1D1IA 1PYBA 3HOWG 3DEOA 3WOFA 1M4VA 1N34L 3J7ZC 3C1EA 3K80C 1HFNA 3Q22A 1N32L 3H09A 1XNRQ 2CHBD 4LF6Q 1K0SA 2FHTA 1KLUD 3NEMA 1CKNB 2ZXRA 1HH2P 4FXGC 3TBIB 2F0IA 1Z7TA 2PPBC 3FHWA 3H6MA 4DAYA 2OQ0A 2K5NA 4MHEA 2ZTDA 2PW5A 4R4QA 4CDEC 1PTOC 3RZOB 1CSQA 3W2DA 4ZRZA 5GAHC 3OWEB 4QF4A 3S1RH 4DR3L 1NJIC 2Q8TA 1DGSA 1BCPC 2Q2TA 4DUZQ 1JCKB 1Q12A 5ELNA 1VMCA 1LTTD 1U9RA 2KVMA 5IGGA 4LF4L 4ULLA 1YNNC 5IWAQ 3JAMc 1ZYRD 2ZM6L 3OWFA 3QR8A 4DV7L 1IKMA 4RGTA 3T4AC 5JEAJ 3WDNA 1IW7C 1JMCA 3QOLA 3VR5A 3K7AH 5IT9E 1KDBA 3GTOB 2A19A 2RDFA 1VQ8A 1OXVA 4H44C 3J81L 4IUQA 4XT3B 4LUVA 4F88A 4KMUC 3S14B 4C3JH 2CH4A 3E3XA 1J8IA 1LTRD 1PH4A 2I0QA 4DV0L 1RTNA 2PMZE 5KYLA 3BVZA 3P75A 3K5MA 1K83B 2NN6G 3NWSA 4IPDA 3TP8A 2A73B 5M5WH 3TEHB 2EJFC 1B1ZA 4PMCA 3OMCA 4CJ1B 3GTQB 1FD7D 3DEPA 2F0TA 5FLMG 1VQ9A 2QDLA 3S24A 2IJ0A 2UUAL 1S5BD 1IBLQ 1PMRA 1L1OB 1MJEA 1WTPA 2AMCB 4A3GG 2OTJA 1WTVA 1OXSC 4DNIA 4C3IH 5C0XI 4IJHA 1PRTB 1SBBB 3PUZA 1EEFD 1S5DD 1STBA 2ALYB 3A56A 1O80A 4KHZA 4BY7G 2NVYH 1VQ6A 1S5FD 1LM0A 5FLXE 4DA2A 3MA2B 3T56B 1YJWA 1HZ9A 5JJLA 3MXPA 1HTPA 1PRTC 4JOIA 4OEMB 1TXYA 4I7AA 2KHJA 3K7AB 1V8QA 2B2TA 1H9KA 1YNJC 4P74A 4RHRA 2QF7A 4BBSH 1B3QA 1GUNA 2K14A 1L1OC 5ISRA 4MNOA 4JV5Q 3E6ZX 1NBWA 3RNUA 1TWAB 1TWCB 5M3FG 5I6YA 2UXBQ 5KRUA 2V4DA 2DGYA 4BY1B 1VQEA 1C0AA 3ERQA 4JVZA 3F1ZA 3I4MB 4EX5A 1Q81C 2E2HB 3G7LA 3P7JA 1BBXC 2HHHL 2L0CA 1LT3D 2RHSB 1VQOA 4TSSA 1TS2A 1LUZA 1RODA 1Y1VH 3Q8DA 3VYSA 3U58A 2FJ2A 1AFPA 3CW2C 3A74A 1E2VA 4OHJA 3GD7A 1XPOA 2RHQB 1H9SA 5JOBA 2F0KA 4XXEA 5BN3A 1EZ6A 5C4XH 2A6HC 3FP9A 3L3OC 4A93B 3QWNA 5I2YA 4NXMQ 5ELFA 4ZLTF 2L11A 2R3ZA 4O42A 4UP7A 1EU4A 3CP0A 2L55A 2F0FA 1K8GA 2AWOA 1TY2A 5EBDA 3TMEA 3BJUA 5IYBH 1D5XC 4P71A 3H3VI 1B3AA 3NBHA 3PF5A 1PH1A 1PVOA 4AQYQ 1TWGB 4GN4B 4UAIA 2R92H 5IP9G 3RR5A 5BR8L 5C0XH 4H02A 1RTOA 2ID0A 5JVH3 4QGUA 5C4HA 4I65A 1HQMC 3TP6A 3V2TA 1D1KA 1STAA 3DM1A 4FYDA 3NSWA 2CCZA 4IPHA 5DM73 4XIGS 5M3MG 3CMAA 5IGBA 4C3JB 3D31A 4B3ML 1YHBA 2OEOA 3HOUB 1WCMH 1I4RA 1FJGQ 3VDYA 5FK9C 4DV6L 4K8IA 3H0GB 1RCVD 4K0KQ 1TWHH 4PQXA 3FKIG 2MO0A 4K2KA 3J81i 3QG1A 5HY6A 4X65Q 3OOCA 3C2PA 4GOPB 3M7NA 1GHJA 1VQDA 2FXQA 2N3SA 2K5DA 3L0OA 4C3IG 2Q8IB 3IKJA 1Q3LA 4PZ7A 1Q1EA 4IN3A 1JJ2A 2EPBA 4C3IB 2BA1A 3HP3A 2R7ZG 5J1ZA 2PZUA 3SK5A 3HOYG 4RG1A 2A5HA 1JICA 3J7AF 4DN4M 4LMQD 3CCSA 2CW0D 4RGMA 3HOXG 1CA6A 1G8ZD 3GTLH 3MWYW 1W3SA 1KXLA 3D4WA 3ZJYC 3O13A 3H0GG 3R93A 4FNFA 3CHBD 2PI2A 2BDNA 1D8LA 1LTBD 1WOCA 2MQHA 4DV1Q 3PUXA 1IYJB 2EDGA 1TKWB 3D4RA 1I6HH 1D5ZC 4JI7Q 2KUMA 3NENA 4BBRH 3ULJA 3PUVA 3DUZA 4K5XA 4A3EH 2E2IH 1TS3A 3KF6A 4KTAA 2F0JA 3ERSX 4PG3A 2KJXA 4B08A 5KIXA 4JI5Q 5COYA 1RKNA 1ML0D 1O7LA 1MI2A 3A7AB 1GUSA 2JA6B 1PFSA 2WB1G 2JA8B 3ICEA 3Q0AA 1K3BC 2A1AA 1Q8KA 5IWAL 1SROA 4KD4A 3S1NH 2JA5H 3HOZH 2E5LQ 1A6XA 1FL0A 4NXNL 2AUJD 4IFDH 1C4QA 3DWAA 5M3MB 1YZ6A 1WI5A 3STBC 2VXWA 4BY1H 5CBAE 1AZQA 3FPPA 4A76A 2ZM6Q 2VY3A 3D4DA 4FDBA 3MXNB 3S15H 1K73C 5I6WA 3KLRA 1T5EA 3C46A 1BR9A 4PMBA 4A3MB 1UEAB 3UE1A 3HOXH 2UXDQ 2WKDA 4IPCA 1PYWD 2DY8A 5ELEA 4JI4L 4KHPQ 2F0OA 1X56A 3VYTA 2PO4A 3HOZB 4GKKL 3I3CA 4MTKA 3DMUA 1HFGA 3V96A 4HR7B 3M7GA 2QGQA 2LS01 1C48A 2H5XA 4I7ZC 5IGDA 3K5NA 4FXDA
chains in the Genus database with same CATH topology
1E24A 4GNXB 1S72A 3F2BA 1PV4A 1SFOH 1GD7A 2I5HA 2JA9A 1EQQA 4LNQA 2IX1A 2EQSA 1WCMG 4YCWA 2JQOA 3F8TA 1VQGA 4NXML 3A5ZB 3L7ZC 1HJPA 3I56A 3CCRA 4JI0L 1VQFA 5M5XH 3GTJH 2LXJA 5LMUL 4GLAC 2VUMG 1IBLL 4LF7L 1YHQA 1HNXQ 1A8VA 2MO1A 1GVPA 1VQ5A 4HIKA 1XNQL 3T1YQ 2F52A 2JK8A 4ME3A 2D62A 5IY0A 4JI1Q 5HGQA 1VQIA 3CAMA 4A3MG 1XPRA 3AFQA 3NBHB 4HJ5A 2R93G 4YY3L 4GOPC 2A8VA 5IYCG 3PO2G 1UE5A 1EWIA 3HOWH 3PF4A 4KI0A 4A3IG 1KQSA 1IBMQ 3M4OH 1K83H 4WJ4A 2IHEA 4OO1G 2RCNA 3JC66 4HIDA 2NZOA 2WAQG 1VQ4A 3RLNA 3HFZB 1VQKA 4JI6Q 4LF5L 1JT8A 3OYYA 4POGA 1HNXL 1HZAA 4R4IA 1ASYA 3AFPA 2UXBL 3UDFA 3CCQA 2XGTA 2R7ZH 4YCUA 2PI2E 3J80i 2JA7H 1IBKQ 3L2PA 3M4PA 4DAYB 3J81c 4XTCS 3GO5A 3BU2A 5AJ3Q 2JEBI 2IHFA 1YI2A 1Q7YC 1PH8A 2AWNA 1RL2A 3CPWA 3HOVG 1Y1WH 3PO3H 3CQZH 2IY5B 5GQOA 4BXXH 3G48A 1RIPA 2PQAA 1HZCA 4ALPA 1I5FA 2IX0A 4JI0Q 4JG2A 1BKBA 1CKMA 2HQLA 4A3BG 1UEBA 4A3DG 1UE6A 3H15A 5C0XJ 4QIWE 4DUYQ 2B63G 4R4CA 1AE3A 3I4NG 3CCJA 1K0RA 1VQHA 3G4SA 1YIJA 3T1YL 1XNRL 3H3VH 4LFAL 1VQLA 2BA0A 1X55A 4BBRG 3RZDH 4JYAQ 1P8LA 3S1MH 3I55A 1IBKL 3I7FA 2UUCQ 4DR6Q 3E9IA 2LSSA 1I94L 2HHHQ 1VQ7A 4DR2Q 4DV6Q 4GN5A 4LW1A 4X64Q 1Q82C 4K0KL 5IP7H 1JE5A 1VCIA 4PMWA 2C35B 1N9WA 1M1KC 4KLKA 1K3RA 1I50H 2JA5G 1HNZQ 2Y0SG 3U50C 3CC4A 2ZJRA 1CUKA 2VW9A 1GO3E 1X65A 1NTGA 4B3TQ 2VL6A 1YITA 2ASBA 4YHHQ 1IZ6A 4DV5Q 4DR3Q 4YWMA 3KOJA 4A75A 4JYAL 4JI2L 1WYDA 3PSIA 2JA6H 1D7QA 4NB3A 3U4VA 4IFDG 3GTKH 2D0OA 5FJ8H 1IL2A 3PO2H 1PYBA 3HOWG 1X9NA 4JC0A 4TVAB 4BY1G 1N34L 2VNUD 3J7ZC 4LF8L 3IRBA 3K80C 4GLXA 2F4VQ 1B8AA 1L2FA 1VQAA 3J81j 1N32L 5IT9c 3KFUA 3HKZG 1Z9FA 2AHOB 3LGJA 1XNRQ 1YJ9A 4LF6Q 4DPGA 2CFMA 1HR0L 2JA7G 2ZTCA 1GM5A 3GDEA 3NEMA 2JJQA 1VQNA 1CKNB 2Q2IA 2OTLA 1HH2P 4DR1Q 1KRTA 4X66L 4TQUS 1Y1WG 5M5YH 1U5KA 1KL9A 2KENA 2YYZA 4A3LH 1FVIA 2NVQH 1J5EL 3FHWA 1NMGA 5JEAG 2UU9Q 2OQ0A 4X64L 4A3BH 2F4VL 2K5NA 1IXRA 2ZTDA 2RF4A 4R4QA 2XTIA 1OTCA 4DV0Q 5JJKA 3I2ZA 1CSQA 5C3EH 3E9HA 2JA8G 3I4NH 5GAHC 3KDFA 4LF9Q 4LUOA 1JJGA 3S1RH 3KF6B 5E7NA 4DR3L 1NJIC 5GROA 1C7YA 1DGSA 2Q2TA 2ZTEA 4DUZQ 1Q12A 1N36L 1HR0W 4B3RQ 4QL5A 5ELNA 2QA4A 1MJCA 4DAMA 4DV2L 3OW2A 4IPGA 4IJLA 4LF4L 3ULLA 3PIOA 2R7DA 4WJ3M 5IWAQ 3JAMc 2ZM6L 1UE1A 4J15A 1N32Q 1NMFA 2UUAQ 3CC7A 4DV7L 2VUMH 2UUBL 4IO9A 4A4IA 5JEAJ 1YHAA 1X54A 4JBWA 1JMCA 1AH9A 5FLXc 1KRSA 4LF6L 3K7AH 1QUQA 1HR0Q 4JBKA 2UXCL 4GOPA 4GNXC 2A19A 2JA6G 1Q1BA 2VS1A 3S2DH 1VQ8A 1OXVA 1TWFH 5GADC 3HOUH 3CCMA 1E7ZA 4LUVA 4OX9Q 4C3JH 1WFQA 1NY4A 2I5MX 1BVSA 4DV1L 3S17H 1XJVA 3TREA 3BZKA 4LFBQ 2CQOA 3KJOA 3PGZA 2UU9L 3MEFA 1PH4A 2NVTH 2I0QA 1UWVA 1KHIA 1PH5A 5M3FH 4R1JA 4DV0L 4DR5L 3PV0A 2PMZE 2DUDA 4DV7Q 4L5SA 4QJFA 4O2DA 3CMEA 3UDXA 2NN6G 1B7YB 5LMNQ 4IPDA 4X62Q 1NE3A 4A3CH 1EQRA 3ER0A 5M5WH 3TEHB 1N36Q 4OO1I 1QVFA 2WB1E 1N8RC 2CKZB 3PO3G 3TS2A 3ULPA 3BZCA 2L15A 1Z47A 1VQPA 5JJIA 3K8AA 4BXXG 1JB7A 1C9OA 4A3KH 5FLMG 4LUZA 3S24A 1VQ9A 3CCLA 2UUAL 4A3DH 1IBLQ 3PCOB 4DK6C 1GKHA 2NZHA 3KLWA 5C3EG 1Q86C 4JBMA 1L1OB 1MJEA 2AMCB 3GTGH 1XTDA 5GAGC 4A3GG 1W2BA 2BH2A 1FGUA 4NXNQ 2OTJA 4JI1L 4X62L 4MTNA 4C3HH 5GAEC 1OXSC 1V1QA 4DNIA 3RN2A 4JBJA 4L5TA 4C3IH 5C0XI 1G291 4IJHA 5IYDH 4A3JG 5H1SE 3J80c 2Q2HA 1HNWL 3PUZA 4LFBL 1PH7A 3K81C 2ALYB 4BY7G 4KHZA 1ASZA 2NVYH 1QVCA 4JI8L 1VQ6A 4X6AH 4GN3B 1LM0A 4PZ6A 3HKSA 4LF5Q 1BBUA 1YJWA 1XMQL 2E5LL 1HZ9A 2E8GA 5JJLA 3T1HL 2LXKA 3AEVA 2YTYA 4OWWB 1HZBA 1X3FA 4JOIA 1Q46A 3GTOH 1TXYA 3W1GA 4IOCA 4QQBX 4EQ5A 2KHJA 2ATWA 1L1OA 5EAYA 3M3YH 5IYBG 3H0GH 1J6QA 5AJ3L 4UP9A 4YWKA 4HJ9A 5LMNW 3HOUG 5FJ8G 1VQBA 4P74A 4PZ8A 4L5RC 4BBSH 2K14A 4KHPL 1M90C 1L1OC 1HNWQ 4OWXB 1OXTA 3PUWA 4GKKQ 2K4KA 4DV4Q 4JCVE 4HIMA 4JOIC 4MNOA 4JV5Q 4MZ9A 1NBWA 3G6EA 3S2HH 3KYHC 4JI3L 3RNUA 5M3FG 4DV3L 5K36G 2UXBQ 3DM3A 2K5VA 1A62A 2DGYA 1XMQQ 3SGIA 4A93G 3CD6A 4A3EG 1VQEA 1SRUA 1C0AA 3K7UC 2B29A 5M3MH 3F1ZA 4EX5A 1Q81C 3PUYA 1A0IA 4POFA 3CCEA 4JI4Q 1I94Q 2HHHL 1PA6A 2GVAA 1PHJA 3RZOH 1SMXA 2KCTA 2RHSB 4DKAC 1VQOA 3RLOA 5BR8Q 1N33L 2ES2A 2Y0SE 3S1QH 4JI8Q 1YBYA 1LUZA 1L0WA 1Y1VH 3D0FA 3Q8DA 3U58A 3OTOL 4DR7L 2B3GA 3TS0A 1B70B 3CW2C 3A74A 2ZJPA 1QVGA 4DV3Q 3A5UA 3K0XA 2YU9H 2JA8H 4A3GH 3GD7A 1XPOA 2AKWB 1EUJA 2RHQB 2CWAA 2UUCL 5ELOA 1QZGA 4OWTB 3GTMH 2NVXH 3I4OA 4YY3Q 1VS0A 5C4XH 5IYDG 1X3EA 1OXUA 3STBD 3W1BA 1YJNA 1PH9A 1G6PA 1OXXK 3FP9A 1FJGL 1N34Q 4NXMQ 1Y14B 4BY7H 4DV4L 1CKOA 3RLFA 3UDGA 1XPUA 3M4QA 4LF7Q 3OTOQ 2KBNA 4UP7A 3CP0A 3F2CA 3CCUA 1XNQQ 3HOYH 4YHHL 4DV5L 5IE8A 1K8GA 3EN2A 2AWOA 3EBEA 2R6GA 2NN6I 2Z6KC 3GTQH 4GLVB 3BJUA 2MFIA 5IYBH 2I5LX 4P71A 2D0PA 2PNHA 3H3VI 3PF5A 1PH1A 2K75A 1PVOA 4YCVA 4AQYQ 4GN4B 2R92H 3UE0A 4GKJL 2Z0SA 3RR5A 5IP9G 1IBML 1SR3A 4AYBG 5BR8L 1PH6A 3S1NH 2YTVA 4H02A 2ID0A 4L5QA 2HT1A 4QGUA 3J7A5 2E2HH 1KIXA 3WWVA 4P75A 1G51A 1CKNA 4X65L 2GN5A 4LF9L 3JAMi 4R4TA 3HKZE 1E22A 4LFAQ 2CCZA 4LFCQ 4IPHA 4A3CG 4XIGS 3CC2A 5M3MG 3CMAA 2BH8A 3D31A 4B3ML 1YHBA 1KC8C 4Y7NH 4DR6L 2YV5A 3UDIA 1WCMH 4DV2Q 4P72A 2N8NA 1A63A 1FJGQ 4GKJQ 2WAQE 3VDYA 1U0LA 4DV6L 1LTLA 3TQYA 2PQAB 4A3KG 5FLMH 5C44G 3HOZG 4BA1I 4K0KQ 1TWHH 2JEAI 5J3BA 3FKIG 2MO0A 3E0EA 4DUYL 1EFWA 3J81i 1XMOL 3M9BA 2N49A 1MIUA 3PIPA 1KD1C 5HY6A 1E1TA 4X65Q 4HJ7A 2GVBA 1BBWA 4GOPB 3M7NA 2JE6I 4DK3C 4DUZL 1VQDA 2FXQA 2N3SA 3I4MG 5IYCH 3RN5A 2YTXA 3AYHB 2Q2UA 3L0OA 4B3MQ 5C4XG 1E1OA 4LF4Q 2EIFA 4AIMA 4AQYL 4A3FG 4A3JH 1R9TH 4DR2L 4PZ7A 1Q1EA 1JJ2A 1KAWA 1JJCB 4LF8Q 2KHIA 2BA1A 3GTPH 1YEZA 4JI7L 2UUBQ 4AH6A 1QUQB 1HNZL 2VZAA 3U4ZA 2V1CC 1QZHA 2R7ZG 1V43A 3HOYG 4B3TL 4OXPA 4RG1A 1SLJA 1TWGH 3CCVA 2OWOA 1P16A 4LFCL 3CCSA 2EXDA 2UXCQ 4JI2Q 3HOXG 1LYLA 4C2MH 3AQQA 3GTLH 4BA2I 1W3SA 2K5HA 1KXLA 1T9HA 2OQKA 3ZJYC 3CF5A 3H0GG 1PH3A 1X3GA 1EIYB 3G71A 2ZJQA 4UY8C 2HIXA 3HOVH 2PI2A 2R92G 1D8LA 1WOCA 2MQHA 1CSPA 5IP9H 3PUXA 4GS3A 1IYJB 4DV1Q 4BBSG 5C0XG 2WP8J 3B6YA 3F2DA 4P73A 2MNAA 3CPFA 1I6HH 3KF8B 1VQMA 4JI7Q 1XMOQ 3NENA 4AYBE 1S40A 1PYSB 1SN8A 4A93H 4BBRH 4R4OA 3ULJA 3PUVA 3A0JA 3DLLA 4HJAA 4A3EH 2E2IH 2K52A 2VQFQ 1K8AC 3NELA 3KF6A 1YVCA 3ERSX 4PG3A 4DR1L 4JI5Q 1O7IA 4X66Q 1WJJA 1YNXA 1VQCA 3S14H 1PFSA 2WB1G 2Z6KA 4NPSA 3ICEA 1SE8A 1J5EQ 5IP7G 2QEXA 1S3OA 2A1AA 1E3PA 2WFWA 1EOVA 1Q8KA 1SROA 2N78A 5IWAL 5C44H 1EYGA 2VQEQ 1Y1VG 2JA5H 3HOZH 3FKIH 4DR4L 2E5LQ 4IFDI 4APVA 1FL0A 4B3SQ 3S16H 4NXNL 4UP8A 4IFDJ 3KDFB 2UXDL 4A3MH 4Y52H 4UPAA 3I4MH 4B3RL 2R93H 3W5OA 2E2JH 3M85A 1YZ6A 1WI5A 4JI5L 3STBC 4A3FH 4BY1H 2IT1A 4A3IH 3KJPA 5DLQE 2F3IA 1TWCH 2ZM6Q 4A76A 1TWAH 2VY3A 5LMUQ 4HJ8A 4JV5L 4GNXA 4FDBA 3MXNB 2VQEL 1K73C 3S15H 3T1HQ 1I3QH 4DR5Q 4RMFA 4O0AA 5LMNL 2HIVA 2K50A 4OONA 1AE2A 3UE1A 1UE7A 3HOXH 2VQFL 2UXDQ 1VQJA 4IPCA 1EIFA 1MKHA 1X6OA 4JI4L 1PH2A 1H95A 5C4JH 3CXCA 4A3LG 4KHPQ 1X56A 4OX9L 2KCMA 3EIVA 2CWPA 4GKKL 1N33Q 4QY7A 2R7FA 1K9MC 4JI3Q 2QGQA 4DR7Q 1V9PA 4JI6L 2H5XA 2OCEA 4LWCA 2B63H 3TRZA 4DR4Q 4B3SL 4IOAA 4YWLA 4HIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E24 A;  4GNX B;  1S72 A;  3F2B A;  1PV4 A;  1SFO H;  1GD7 A;  2I5H A;  2JA9 A;  1EQQ A;  4LNQ A;  2IX1 A;  2EQS A;  1WCM G;  4YCW A;  2JQO A;  3F8T A;  1VQG A;  4NXM L;  3A5Z B;  3L7Z C;  1HJP A;  3I56 A;  3CCR A;  4JI0 L;  1VQF A;  5M5X H;  3GTJ H;  2LXJ A;  5LMU L;  4GLA C;  2VUM G;  1IBL L;  4LF7 L;  1YHQ A;  1HNX Q;  1A8V A;  2MO1 A;  1GVP A;  1VQ5 A;  4HIK A;  1XNQ L;  3T1Y Q;  2F52 A;  2JK8 A;  4ME3 A;  2D62 A;  5IY0 A;  4JI1 Q;  5HGQ A;  1VQI A;  3CAM A;  4A3M G;  1XPR A;  3AFQ A;  3NBH B;  4HJ5 A;  2R93 G;  4YY3 L;  4GOP C;  2A8V A;  5IYC G;  3PO2 G;  1UE5 A;  1EWI A;  3HOW H;  3PF4 A;  4KI0 A;  4A3I G;  1KQS A;  1IBM Q;  3M4O H;  1K83 H;  4WJ4 A;  2IHE A;  4OO1 G;  2RCN A;  3JC6 6;  4HID A;  2NZO A;  2WAQ G;  1VQ4 A;  3RLN A;  3HFZ B;  1VQK A;  4JI6 Q;  4LF5 L;  1JT8 A;  3OYY A;  4POG A;  1HNX L;  1HZA A;  4R4I A;  1ASY A;  3AFP A;  2UXB L;  3UDF A;  3CCQ A;  2XGT A;  2R7Z H;  4YCU A;  2PI2 E;  3J80 i;  2JA7 H;  1IBK Q;  3L2P A;  3M4P A;  4DAY B;  3J81 c;  4XTC S;  3GO5 A;  3BU2 A;  5AJ3 Q;  2JEB I;  2IHF A;  1YI2 A;  1Q7Y C;  1PH8 A;  2AWN A;  1RL2 A;  3CPW A;  3HOV G;  1Y1W H;  3PO3 H;  3CQZ H;  2IY5 B;  5GQO A;  4BXX H;  3G48 A;  1RIP A;  2PQA A;  1HZC A;  4ALP A;  1I5F A;  2IX0 A;  4JI0 Q;  4JG2 A;  1BKB A;  1CKM A;  2HQL A;  4A3B G;  1UEB A;  4A3D G;  1UE6 A;  3H15 A;  5C0X J;  4QIW E;  4DUY Q;  2B63 G;  4R4C A;  1AE3 A;  3I4N G;  3CCJ A;  1K0R A;  1VQH A;  3G4S A;  1YIJ A;  3T1Y L;  1XNR L;  3H3V H;  4LFA L;  1VQL A;  2BA0 A;  1X55 A;  4BBR G;  3RZD H;  4JYA Q;  1P8L A;  3S1M H;  3I55 A;  1IBK L;  3I7F A;  2UUC Q;  4DR6 Q;  3E9I A;  2LSS A;  1I94 L;  2HHH Q;  1VQ7 A;  4DR2 Q;  4DV6 Q;  4GN5 A;  4LW1 A;  4X64 Q;  1Q82 C;  4K0K L;  5IP7 H;  1JE5 A;  1VCI A;  4PMW A;  2C35 B;  1N9W A;  1M1K C;  4KLK A;  1K3R A;  1I50 H;  2JA5 G;  1HNZ Q;  2Y0S G;  3U50 C;  3CC4 A;  2ZJR A;  1CUK A;  2VW9 A;  1GO3 E;  1X65 A;  1NTG A;  4B3T Q;  2VL6 A;  1YIT A;  2ASB A;  4YHH Q;  1IZ6 A;  4DV5 Q;  4DR3 Q;  4YWM A;  3KOJ A;  4A75 A;  4JYA L;  4JI2 L;  1WYD A;  3PSI A;  2JA6 H;  1D7Q A;  4NB3 A;  3U4V A;  4IFD G;  3GTK H;  2D0O A;  5FJ8 H;  1IL2 A;  3PO2 H;  1PYB A;  3HOW G;  1X9N A;  4JC0 A;  4TVA B;  4BY1 G;  1N34 L;  2VNU D;  3J7Z C;  4LF8 L;  3IRB A;  3K80 C;  4GLX A;  2F4V Q;  1B8A A;  1L2F A;  1VQA A;  3J81 j;  1N32 L;  5IT9 c;  3KFU A;  3HKZ G;  1Z9F A;  2AHO B;  3LGJ A;  1XNR Q;  1YJ9 A;  4LF6 Q;  4DPG A;  2CFM A;  1HR0 L;  2JA7 G;  2ZTC A;  1GM5 A;  3GDE A;  3NEM A;  2JJQ A;  1VQN A;  1CKN B;  2Q2I A;  2OTL A;  1HH2 P;  4DR1 Q;  1KRT A;  4X66 L;  4TQU S;  1Y1W G;  5M5Y H;  1U5K A;  1KL9 A;  2KEN A;  2YYZ A;  4A3L H;  1FVI A;  2NVQ H;  1J5E L;  3FHW A;  1NMG A;  5JEA G;  2UU9 Q;  2OQ0 A;  4X64 L;  4A3B H;  2F4V L;  2K5N A;  1IXR A;  2ZTD A;  2RF4 A;  4R4Q A;  2XTI A;  1OTC A;  4DV0 Q;  5JJK A;  3I2Z A;  1CSQ A;  5C3E H;  3E9H A;  2JA8 G;  3I4N H;  5GAH C;  3KDF A;  4LF9 Q;  4LUO A;  1JJG A;  3S1R H;  3KF6 B;  5E7N A;  4DR3 L;  1NJI C;  5GRO A;  1C7Y A;  1DGS A;  2Q2T A;  2ZTE A;  4DUZ Q;  1Q12 A;  1N36 L;  1HR0 W;  4B3R Q;  4QL5 A;  5ELN A;  2QA4 A;  1MJC A;  4DAM A;  4DV2 L;  3OW2 A;  4IPG A;  4IJL A;  4LF4 L;  3ULL A;  3PIO A;  2R7D A;  4WJ3 M;  5IWA Q;  3JAM c;  2ZM6 L;  1UE1 A;  4J15 A;  1N32 Q;  1NMF A;  2UUA Q;  3CC7 A;  4DV7 L;  2VUM H;  2UUB L;  4IO9 A;  4A4I A;  5JEA J;  1YHA A;  1X54 A;  4JBW A;  1JMC A;  1AH9 A;  5FLX c;  1KRS A;  4LF6 L;  3K7A H;  1QUQ A;  1HR0 Q;  4JBK A;  2UXC L;  4GOP A;  4GNX C;  2A19 A;  2JA6 G;  1Q1B A;  2VS1 A;  3S2D H;  1VQ8 A;  1OXV A;  1TWF H;  5GAD C;  3HOU H;  3CCM A;  1E7Z A;  4LUV A;  4OX9 Q;  4C3J H;  1WFQ A;  1NY4 A;  2I5M X;  1BVS A;  4DV1 L;  3S17 H;  1XJV A;  3TRE A;  3BZK A;  4LFB Q;  2CQO A;  3KJO A;  3PGZ A;  2UU9 L;  3MEF A;  1PH4 A;  2NVT H;  2I0Q A;  1UWV A;  1KHI A;  1PH5 A;  5M3F H;  4R1J A;  4DV0 L;  4DR5 L;  3PV0 A;  2PMZ E;  2DUD A;  4DV7 Q;  4L5S A;  4QJF A;  4O2D A;  3CME A;  3UDX A;  2NN6 G;  1B7Y B;  5LMN Q;  4IPD A;  4X62 Q;  1NE3 A;  4A3C H;  1EQR A;  3ER0 A;  5M5W H;  3TEH B;  1N36 Q;  4OO1 I;  1QVF A;  2WB1 E;  1N8R C;  2CKZ B;  3PO3 G;  3TS2 A;  3ULP A;  3BZC A;  2L15 A;  1Z47 A;  1VQP A;  5JJI A;  3K8A A;  4BXX G;  1JB7 A;  1C9O A;  4A3K H;  5FLM G;  4LUZ A;  3S24 A;  1VQ9 A;  3CCL A;  2UUA L;  4A3D H;  1IBL Q;  3PCO B;  4DK6 C;  1GKH A;  2NZH A;  3KLW A;  5C3E G;  1Q86 C;  4JBM A;  1L1O B;  1MJE A;  2AMC B;  3GTG H;  1XTD A;  5GAG C;  4A3G G;  1W2B A;  2BH2 A;  1FGU A;  4NXN Q;  2OTJ A;  4JI1 L;  4X62 L;  4MTN A;  4C3H H;  5GAE C;  1OXS C;  1V1Q A;  4DNI A;  3RN2 A;  4JBJ A;  4L5T A;  4C3I H;  5C0X I;  1G29 1;  4IJH A;  5IYD H;  4A3J G;  5H1S E;  3J80 c;  2Q2H A;  1HNW L;  3PUZ A;  4LFB L;  1PH7 A;  3K81 C;  2ALY B;  4BY7 G;  4KHZ A;  1ASZ A;  2NVY H;  1QVC A;  4JI8 L;  1VQ6 A;  4X6A H;  4GN3 B;  1LM0 A;  4PZ6 A;  3HKS A;  4LF5 Q;  1BBU A;  1YJW A;  1XMQ L;  2E5L L;  1HZ9 A;  2E8G A;  5JJL A;  3T1H L;  2LXK A;  3AEV A;  2YTY A;  4OWW B;  1HZB A;  1X3F A;  4JOI A;  1Q46 A;  3GTO H;  1TXY A;  3W1G A;  4IOC A;  4QQB X;  4EQ5 A;  2KHJ A;  2ATW A;  1L1O A;  5EAY A;  3M3Y H;  5IYB G;  3H0G H;  1J6Q A;  5AJ3 L;  4UP9 A;  4YWK A;  4HJ9 A;  5LMN W;  3HOU G;  5FJ8 G;  1VQB A;  4P74 A;  4PZ8 A;  4L5R C;  4BBS H;  2K14 A;  4KHP L;  1M90 C;  1L1O C;  1HNW Q;  4OWX B;  1OXT A;  3PUW A;  4GKK Q;  2K4K A;  4DV4 Q;  4JCV E;  4HIM A;  4JOI C;  4MNO A;  4JV5 Q;  4MZ9 A;  1NBW A;  3G6E A;  3S2H H;  3KYH C;  4JI3 L;  3RNU A;  5M3F G;  4DV3 L;  5K36 G;  2UXB Q;  3DM3 A;  2K5V A;  1A62 A;  2DGY A;  1XMQ Q;  3SGI A;  4A93 G;  3CD6 A;  4A3E G;  1VQE A;  1SRU A;  1C0A A;  3K7U C;  2B29 A;  5M3M H;  3F1Z A;  4EX5 A;  1Q81 C;  3PUY A;  1A0I A;  4POF A;  3CCE A;  4JI4 Q;  1I94 Q;  2HHH L;  1PA6 A;  2GVA A;  1PHJ A;  3RZO H;  1SMX A;  2KCT A;  2RHS B;  4DKA C;  1VQO A;  3RLO A;  5BR8 Q;  1N33 L;  2ES2 A;  2Y0S E;  3S1Q H;  4JI8 Q;  1YBY A;  1LUZ A;  1L0W A;  1Y1V H;  3D0F A;  3Q8D A;  3U58 A;  3OTO L;  4DR7 L;  2B3G A;  3TS0 A;  1B70 B;  3CW2 C;  3A74 A;  2ZJP A;  1QVG A;  4DV3 Q;  3A5U A;  3K0X A;  2YU9 H;  2JA8 H;  4A3G H;  3GD7 A;  1XPO A;  2AKW B;  1EUJ A;  2RHQ B;  2CWA A;  2UUC L;  5ELO A;  1QZG A;  4OWT B;  3GTM H;  2NVX H;  3I4O A;  4YY3 Q;  1VS0 A;  5C4X H;  5IYD G;  1X3E A;  1OXU A;  3STB D;  3W1B A;  1YJN A;  1PH9 A;  1G6P A;  1OXX K;  3FP9 A;  1FJG L;  1N34 Q;  4NXM Q;  1Y14 B;  4BY7 H;  4DV4 L;  1CKO A;  3RLF A;  3UDG A;  1XPU A;  3M4Q A;  4LF7 Q;  3OTO Q;  2KBN A;  4UP7 A;  3CP0 A;  3F2C A;  3CCU A;  1XNQ Q;  3HOY H;  4YHH L;  4DV5 L;  5IE8 A;  1K8G A;  3EN2 A;  2AWO A;  3EBE A;  2R6G A;  2NN6 I;  2Z6K C;  3GTQ H;  4GLV B;  3BJU A;  2MFI A;  5IYB H;  2I5L X;  4P71 A;  2D0P A;  2PNH A;  3H3V I;  3PF5 A;  1PH1 A;  2K75 A;  1PVO A;  4YCV A;  4AQY Q;  4GN4 B;  2R92 H;  3UE0 A;  4GKJ L;  2Z0S A;  3RR5 A;  5IP9 G;  1IBM L;  1SR3 A;  4AYB G;  5BR8 L;  1PH6 A;  3S1N H;  2YTV A;  4H02 A;  2ID0 A;  4L5Q A;  2HT1 A;  4QGU A;  3J7A 5;  2E2H H;  1KIX A;  3WWV A;  4P75 A;  1G51 A;  1CKN A;  4X65 L;  2GN5 A;  4LF9 L;  3JAM i;  4R4T A;  3HKZ E;  1E22 A;  4LFA Q;  2CCZ A;  4LFC Q;  4IPH A;  4A3C G;  4XIG S;  3CC2 A;  5M3M G;  3CMA A;  2BH8 A;  3D31 A;  4B3M L;  1YHB A;  1KC8 C;  4Y7N H;  4DR6 L;  2YV5 A;  3UDI A;  1WCM H;  4DV2 Q;  4P72 A;  2N8N A;  1A63 A;  1FJG Q;  4GKJ Q;  2WAQ E;  3VDY A;  1U0L A;  4DV6 L;  1LTL A;  3TQY A;  2PQA B;  4A3K G;  5FLM H;  5C44 G;  3HOZ G;  4BA1 I;  4K0K Q;  1TWH H;  2JEA I;  5J3B A;  3FKI G;  2MO0 A;  3E0E A;  4DUY L;  1EFW A;  3J81 i;  1XMO L;  3M9B A;  2N49 A;  1MIU A;  3PIP A;  1KD1 C;  5HY6 A;  1E1T A;  4X65 Q;  4HJ7 A;  2GVB A;  1BBW A;  4GOP B;  3M7N A;  2JE6 I;  4DK3 C;  4DUZ L;  1VQD A;  2FXQ A;  2N3S A;  3I4M G;  5IYC H;  3RN5 A;  2YTX A;  3AYH B;  2Q2U A;  3L0O A;  4B3M Q;  5C4X G;  1E1O A;  4LF4 Q;  2EIF A;  4AIM A;  4AQY L;  4A3F G;  4A3J H;  1R9T H;  4DR2 L;  4PZ7 A;  1Q1E A;  1JJ2 A;  1KAW A;  1JJC B;  4LF8 Q;  2KHI A;  2BA1 A;  3GTP H;  1YEZ A;  4JI7 L;  2UUB Q;  4AH6 A;  1QUQ B;  1HNZ L;  2VZA A;  3U4Z A;  2V1C C;  1QZH A;  2R7Z G;  1V43 A;  3HOY G;  4B3T L;  4OXP A;  4RG1 A;  1SLJ A;  1TWG H;  3CCV A;  2OWO A;  1P16 A;  4LFC L;  3CCS A;  2EXD A;  2UXC Q;  4JI2 Q;  3HOX G;  1LYL A;  4C2M H;  3AQQ A;  3GTL H;  4BA2 I;  1W3S A;  2K5H A;  1KXL A;  1T9H A;  2OQK A;  3ZJY C;  3CF5 A;  3H0G G;  1PH3 A;  1X3G A;  1EIY B;  3G71 A;  2ZJQ A;  4UY8 C;  2HIX A;  3HOV H;  2PI2 A;  2R92 G;  1D8L A;  1WOC A;  2MQH A;  1CSP A;  5IP9 H;  3PUX A;  4GS3 A;  1IYJ B;  4DV1 Q;  4BBS G;  5C0X G;  2WP8 J;  3B6Y A;  3F2D A;  4P73 A;  2MNA A;  3CPF A;  1I6H H;  3KF8 B;  1VQM A;  4JI7 Q;  1XMO Q;  3NEN A;  4AYB E;  1S40 A;  1PYS B;  1SN8 A;  4A93 H;  4BBR H;  4R4O A;  3ULJ A;  3PUV A;  3A0J A;  3DLL A;  4HJA A;  4A3E H;  2E2I H;  2K52 A;  2VQF Q;  1K8A C;  3NEL A;  3KF6 A;  1YVC A;  3ERS X;  4PG3 A;  4DR1 L;  4JI5 Q;  1O7I A;  4X66 Q;  1WJJ A;  1YNX A;  1VQC A;  3S14 H;  1PFS A;  2WB1 G;  2Z6K A;  4NPS A;  3ICE A;  1SE8 A;  1J5E Q;  5IP7 G;  2QEX A;  1S3O A;  2A1A A;  1E3P A;  2WFW A;  1EOV A;  1Q8K A;  1SRO A;  2N78 A;  5IWA L;  5C44 H;  1EYG A;  2VQE Q;  1Y1V G;  2JA5 H;  3HOZ H;  3FKI H;  4DR4 L;  2E5L Q;  4IFD I;  4APV A;  1FL0 A;  4B3S Q;  3S16 H;  4NXN L;  4UP8 A;  4IFD J;  3KDF B;  2UXD L;  4A3M H;  4Y52 H;  4UPA A;  3I4M H;  4B3R L;  2R93 H;  3W5O A;  2E2J H;  3M85 A;  1YZ6 A;  1WI5 A;  4JI5 L;  3STB C;  4A3F H;  4BY1 H;  2IT1 A;  4A3I H;  3KJP A;  5DLQ E;  2F3I A;  1TWC H;  2ZM6 Q;  4A76 A;  1TWA H;  2VY3 A;  5LMU Q;  4HJ8 A;  4JV5 L;  4GNX A;  4FDB A;  3MXN B;  2VQE L;  1K73 C;  3S15 H;  3T1H Q;  1I3Q H;  4DR5 Q;  4RMF A;  4O0A A;  5LMN L;  2HIV A;  2K50 A;  4OON A;  1AE2 A;  3UE1 A;  1UE7 A;  3HOX H;  2VQF L;  2UXD Q;  1VQJ A;  4IPC A;  1EIF A;  1MKH A;  1X6O A;  4JI4 L;  1PH2 A;  1H95 A;  5C4J H;  3CXC A;  4A3L G;  4KHP Q;  1X56 A;  4OX9 L;  2KCM A;  3EIV A;  2CWP A;  4GKK L;  1N33 Q;  4QY7 A;  2R7F A;  1K9M C;  4JI3 Q;  2QGQ A;  4DR7 Q;  1V9P A;  4JI6 L;  2H5X A;  2OCE A;  4LWC A;  2B63 H;  3TRZ A;  4DR4 Q;  4B3S L;  4IOA A;  4YWL A;  4HIO A; 
#chains in the Genus database with same CATH topology
 2EOT A;  5LL6 X;  4CGY B;  2JSO A;  4ZK9 B;  1SFO H;  1EIH A;  5LL6 S;  3CRK C;  1TR5 A;  1CFM A;  4LNQ A;  3EFX D;  1TY0 A;  3I56 A;  2B2V C;  2HCC A;  3VYR A;  5LMU L;  2VUM G;  4YIJ A;  4PV1 C;  1IBL L;  1EWH A;  2MO1 A;  1GVP A;  1SE3 A;  2D62 A;  1LT5 D;  5T1I A;  3D8G A;  1NNX A;  1VQI A;  3AFQ A;  4IUN A;  2A8V A;  4IQZ A;  2EYH A;  3U9S A;  5M5W B;  3PO2 G;  3H91 A;  1EWI A;  1ILP A;  2F0M A;  4KI0 A;  1KQS A;  1IBM Q;  4WJ4 A;  4F8M A;  4OO1 G;  5M3F B;  1EQT A;  3PIO 3;  2WAQ G;  1WTQ A;  3HFZ B;  5BN5 A;  3N52 A;  3OYY A;  4Z9C B;  1HNX L;  4R4I A;  3EJI A;  2UXB L;  5CR3 A;  2XGT A;  4YCU A;  2PI2 E;  2JA7 H;  1ET9 A;  1ESR A;  3GO5 A;  1PH8 A;  2JEB I;  4HCE A;  3PO3 H;  2IY5 B;  1M8A A;  2KEC A;  3CQZ H;  1DJR D;  1RIP A;  4IUT A;  1HZC A;  4ALP A;  4JI0 Q;  2FMC A;  2KCC A;  2IX3 A;  1UEB A;  3CU7 A;  3MAQ A;  1EYD A;  3I4N G;  4NDX A;  4MN3 A;  3T1Y L;  4DFA A;  1VQL A;  2BA0 A;  2MGS A;  3RZD H;  3HEJ A;  1U4R A;  5FOB B;  3I55 A;  1NUC A;  4DXG A;  4DR6 Q;  3A8J E;  2EY2 A;  2HHH Q;  1CTM A;  4CJ2 C;  4DR2 Q;  3M4O B;  3J81 E;  2F0D A;  4GN5 A;  1H9J A;  4X64 Q;  4KKU A;  1A2U A;  1JE5 A;  4PMW A;  2C35 B;  1M1K C;  1DZ1 A;  1K3R A;  2AQ3 B;  3GV6 A;  2Y0S G;  3S9W A;  2ZJR A;  4ABN A;  2VW9 A;  1X65 A;  4BS9 A;  2C5C A;  4L6T B;  3OIQ A;  4A75 A;  1KAB A;  1MGS A;  3T51 B;  4JI2 L;  1HRJ A;  1GUT A;  1CM9 A;  3GTJ B;  3PSI A;  4IFD G;  2D0O A;  1AEX A;  5FJ8 H;  3DWQ A;  3AB9 A;  1SYE A;  1R4Q B;  4KY5 A;  1X9N A;  5CV9 A;  2VNU D;  2EYM A;  1V1P B;  4LF8 L;  1B8A A;  1EY4 A;  1VQA A;  2EYO A;  4G4K A;  1X3P A;  4FO2 A;  1HXY D;  2AHO B;  2NVX B;  2PZT A;  1HR0 L;  1RDP D;  3KLS A;  3LX0 A;  2JA7 G;  2ZTC A;  1JOO A;  3R2I A;  2Q2I A;  1C8C A;  2G9D A;  3I72 A;  2MP1 A;  2OTL A;  4DR1 Q;  4TQU S;  1KL9 A;  2KEN A;  3NQI A;  1FVI A;  3AMU A;  2B2U A;  1PFM A;  2F4V L;  1IXR A;  4FXK C;  1JWM D;  3E9H A;  1G6Z A;  3LNN A;  3Q24 A;  3KF6 B;  5E7N A;  2EXZ A;  1K8O A;  1HR0 W;  5C4Z A;  1O78 A;  5KNC A;  2QA4 A;  3OW2 A;  4IJL A;  3S2H B;  1EL0 A;  2R7D A;  4WJ3 M;  4FF3 A;  2EJM A;  1CQF A;  2VUM H;  1YHA A;  4R8I A;  1X54 A;  1AH9 A;  5CYU A;  1GUG A;  2NWG A;  2B8G A;  2F0V A;  4GOP A;  4GNX C;  2AUK A;  2JA5 B;  3SK6 A;  2JA6 G;  3MHB A;  1Q1B A;  3S2D H;  2K01 A;  5GAD C;  4Q0F A;  3CCM A;  1F77 A;  2K32 A;  4DV1 L;  1WFQ A;  1NY4 A;  2I5M X;  4KJN A;  4LFB Q;  4L8J A;  2CQO A;  2UU9 L;  3J80 L;  2NVT H;  1UWV A;  5M3F H;  4QJF A;  2ZXP A;  2K03 A;  3UDX A;  4HSP A;  1HTL D;  5LMN Q;  1BUV T;  2AQ2 B;  3ER0 A;  3SEB A;  4ZKC B;  5HUR A;  2IL8 A;  1N36 Q;  3VYU A;  4C56 C;  1D2B A;  3BZC A;  1VQP A;  4NP5 A;  4BXX G;  2XN9 C;  4A3K H;  3U9O A;  1Y69 U;  4A3D H;  5E4W C;  4DK6 C;  1Q86 C;  2G5D A;  3KLW A;  4JBM A;  4N8F A;  5ELB A;  2Z4H A;  5BN4 A;  3N6R A;  4NXN Q;  1CT1 D;  2O2L D;  3C3L A;  5GAE C;  1EIG A;  4KKS A;  1PFN A;  1V1Q A;  2NUC A;  3GTP B;  2K5Q A;  4JBJ A;  3RN2 A;  3J80 c;  4ZKB B;  2L4N A;  2NVT B;  1KNA A;  1U4P A;  2XWJ B;  4JI8 L;  5E3F A;  4GN3 B;  4LF5 Q;  4PZ6 A;  4MIU A;  1F9P A;  2E5L L;  1DOM A;  2E8G A;  1CZW A;  4IUU A;  4TRD A;  2NTT A;  3AEV A;  4OWW B;  3ONA B;  1HZB A;  1Q46 A;  5C5L A;  4IOC A;  1STE A;  3MXN A;  4N9T A;  5KYI A;  5CMD A;  3UI2 A;  4HJ9 A;  5LMN W;  3HOU G;  1VQB A;  2VUM B;  1JOK A;  4L5R C;  3OMG A;  4KHP L;  4C1N K;  1S4Z A;  1HNW Q;  2L9H A;  4GKK Q;  2K4K A;  4DV4 Q;  4HIM A;  3S15 B;  1J9O A;  3G6E A;  3KYH C;  5I9P A;  4XQN A;  4LAA A;  5K36 G;  2A6E D;  1A62 A;  2RSO A;  3SGI A;  3VA7 A;  1W6J A;  2F0Q A;  1RHP A;  1SRU A;  2E2J B;  3PUY A;  4POF A;  1MHW C;  3CCE A;  3D6W A;  4JI4 Q;  1XYI A;  2GVA A;  1PA6 A;  1PHJ A;  3RZO H;  5D3I B;  4DKA C;  4NMZ A;  2ES2 A;  2OXP A;  1L0W A;  2ZJP A;  1QVG A;  4DV3 Q;  2SNS A;  2BE5 D;  2NVY B;  5ELO A;  4OWT B;  2EZV A;  3GTM H;  2SNM A;  2E75 C;  3W1B A;  1YJN A;  5EKL A;  1G6P A;  5G3L D;  3NQT A;  4X3T A;  5C4X B;  1CKO A;  1QG7 A;  3RLF A;  3GTM B;  1XPU A;  3OTO Q;  1Y8O B;  3D6C A;  2R6G A;  2Z6K C;  1H9R A;  3GTQ H;  2R61 A;  4C2M B;  2ICE C;  2D0P A;  3IFT A;  1PXU A;  2HCI A;  2K75 A;  3GQB A;  2Z0S A;  1IBM L;  1ONL A;  4AYB G;  1A3U A;  1Q90 A;  4L5Q A;  4U68 A;  2HT1 A;  3J7A 5;  1LAB A;  1STN A;  2E2H H;  2P5Z X;  4P75 A;  3GP7 A;  1G51 A;  5CGK A;  1KDA A;  4X65 L;  4LF9 L;  3JAM i;  4R4T A;  4LFC Q;  2BE5 C;  5CV6 A;  2BH8 A;  2J4X A;  4ODG A;  2F0E A;  3M4Y A;  3V05 A;  1KC8 C;  4DR6 L;  4DV2 Q;  4P72 A;  5D65 A;  4GKJ Q;  2F3W A;  1PTO D;  2B8F A;  1SNM A;  4A3K G;  4WFN 3;  2MPM A;  1CK1 A;  5FLM H;  5C44 G;  4BA1 I;  5J22 A;  1E2W A;  5J3B A;  3E0E A;  1PLF A;  3DWP A;  2N49 A;  4HJ7 A;  1BBW A;  4B9X A;  2LFN A;  1QNU A;  3H94 A;  4KN4 C;  1STH A;  1GJX A;  2SEB D;  2Q2U A;  2A6E C;  1E1O A;  2KA7 A;  1WTR A;  3Q23 A;  4DR2 L;  3NE5 B;  4V0B A;  1JJC B;  4LF8 Q;  4RCO A;  3GTP H;  1YEZ A;  2DY7 A;  4JI7 L;  1O7Z A;  4AH6 A;  2VZA A;  3U4Z A;  3T16 A;  1TU2 B;  1V43 A;  1K8M A;  1SLJ A;  4K5W A;  1TWG H;  3A8I E;  2H1E A;  3F2U A;  2OWO A;  2R92 B;  2NVQ B;  4JI2 Q;  4A3D B;  1IW7 D;  1T9H A;  3HGB A;  1PH3 A;  1X3G A;  3BDO A;  3G71 A;  3HOV H;  2ENB A;  5IP9 H;  4GS3 A;  4UHV A;  1ZXT A;  2WP8 J;  3B6Y A;  4KJO A;  3F2D A;  2MNA A;  2M00 A;  3CPF A;  2PQE A;  1SYB A;  2K5W A;  4DXF A;  4ZCK A;  1WVL A;  5G3L F;  2JN4 A;  1SYG A;  1QWY A;  1XMO Q;  1QJO A;  1PYS B;  1SN8 A;  1BCP D;  3MXU A;  4R4O A;  3DLL A;  4HJA A;  5D3D A;  2C9O A;  1TII D;  1I4G A;  1Y8N B;  4DR1 L;  2IWH A;  1VQC A;  3J7A V;  3S14 H;  1SE8 A;  1TWF B;  2QEX A;  1S3O A;  1GXD C;  2N78 A;  1HUN A;  5C44 H;  4RFB A;  3VR6 A;  1EYG A;  1ET6 A;  1VDZ A;  4CKC A;  3MXG A;  5M9O A;  1MBY A;  3S16 H;  2A68 C;  1SDF A;  4IFD J;  2UXD L;  4A3M H;  1QOH A;  3I4M H;  1GHK A;  5CV8 A;  2E2J H;  2RDH A;  4X3S A;  2DNE A;  3SXH A;  2FFK B;  4A3F H;  2F3V A;  4A3I H;  4OO1 H;  5DLQ E;  1HHV A;  3J7Y W;  1TWA H;  4HJ8 A;  2VQE L;  3T1H Q;  4XQQ A;  4RMF A;  1EU3 A;  2D2C C;  3I4L A;  5IGE A;  5LMN L;  2EE1 A;  4OON A;  1AE2 A;  3NTH A;  4XYQ A;  1UE7 A;  2XSC A;  2VQF L;  3LWE A;  4V19 0;  1B44 D;  1MKH A;  3S16 B;  3TP7 A;  4S3S A;  3KK7 A;  1PH2 A;  1E0B A;  5C44 B;  3EIV A;  1I6V C;  2PNR C;  3QO2 A;  2RVL A;  4HCS A;  1ZEQ X;  4QY7 A;  4JI3 Q;  3OSO A;  4JI6 L;  4DR4 Q;  2MUY A;  2OF1 A;  1FNW A;  4B3S L;  1F2Y A;  4K5V A;  4FF4 A;  4DNT B;  2B2Y A;  3MVV A;  2I5H A;  1PRT F;  2EYL A;  1EQQ A;  3HOW B;  1FYC A;  5KGU A;  3L7Z C;  3CCR A;  5M5X H;  1ICF B;  3SK8 A;  1YHQ A;  1HNX Q;  4EQN A;  4ME3 A;  2JK8 A;  3CAM A;  1G2S A;  4HJ5 A;  4GOP C;  3EQL C;  3K58 A;  5EKK A;  1UE5 A;  4U67 3;  2TMP A;  4HMI A;  4G7H C;  4RCN A;  4A3I G;  1SFO B;  3DHQ A;  2RCN A;  5EQ0 A;  3KUP A;  2NZO A;  4LF5 L;  3L9A X;  4K6D A;  1BF4 A;  1VQK A;  3S1M B;  1PZJ D;  1HZA A;  2QIL A;  1ASY A;  1DD2 A;  4E6I A;  3I8Z A;  4KV6 A;  1SYC A;  3J81 c;  4XTC S;  2IHF A;  2AWN A;  1RL2 A;  3HOV G;  4ME5 A;  5GQO A;  2F0N A;  2PYK A;  1Y1W B;  2IX0 A;  2BCO A;  4JG2 A;  1SNP A;  1BKB A;  4B9W A;  1UE6 A;  5C0X J;  4QIW E;  2B63 G;  4Y7N B;  2HDL A;  2MHV A;  3VA5 A;  1F9R A;  3JAM L;  1K0R A;  1PZI D;  4CKB A;  1XNR L;  3H3V H;  4LFA L;  1XXG A;  3S1M H;  1IBK L;  3I7F A;  1V1P A;  4JK1 C;  3E9I A;  5FKA C;  4RHS A;  3BS1 A;  4KN7 C;  5C3E B;  4LW1 A;  1Q82 C;  5IP7 H;  3NBI A;  1VCI A;  1N9W A;  4PNY A;  3MC0 B;  1I50 H;  1HNZ Q;  3H3V C;  1CUK A;  1DM0 B;  1PRT D;  1GO3 E;  1NTG A;  1I4X A;  3HG9 A;  2ASB A;  1IZ6 A;  4DR3 Q;  4JYA L;  5JPN C;  1EOT A;  1WYD A;  4DF7 A;  3U4V A;  4JPB W;  4N9P A;  1IL2 A;  3PO2 H;  4FP5 D;  4JC0 A;  4TVA B;  4BY1 G;  1B2T A;  1QIL A;  2RCF A;  2RDG A;  2F4V Q;  1L2F A;  3J81 j;  1L0Y B;  1LTA D;  5IT9 c;  2E76 C;  4RAU C;  2Z4I A;  3HKZ G;  1Z9F A;  1MD2 D;  4CHT B;  1YJ9 A;  4DPG A;  2L12 A;  1GM5 A;  3GDE A;  4HAE A;  2JJQ A;  3C1F A;  3SR1 A;  5EPK A;  5C6A A;  1Y1W G;  2YYZ A;  4CJ0 B;  3FRP B;  5C4J B;  3S1Q B;  2NVQ H;  1J5E L;  4A3B H;  4QCL A;  5JJK A;  3HOX B;  4DV0 Q;  2WB1 B;  2JA8 G;  1SMY C;  3I4N H;  5EJW A;  4LF9 Q;  3KDF A;  1IHZ A;  3K6O A;  5GRO A;  2EVB A;  1R9T B;  1MJC A;  4DAM A;  4DV2 L;  2X69 A;  4IPG A;  4ZUI A;  3PIO A;  2KHS A;  2RBM A;  1PTO H;  4J15 A;  1N32 Q;  1NMF A;  2UUA Q;  3CC7 A;  4BBS B;  1T5X D;  3VR3 A;  4IO9 A;  4X3U A;  5FLX c;  1KRS A;  2K7V A;  4LF6 L;  1CHQ D;  3CQZ B;  4JBK A;  4DAP A;  2J7Z A;  2VS1 A;  1RD9 D;  2JP1 A;  3FDT A;  3I90 A;  1BQQ T;  1SJH D;  1E7Z A;  3URY A;  2R7Z B;  1JC7 A;  2F0U A;  3S17 H;  1BVS A;  3TN2 A;  3TRE A;  3P20 A;  5A2Q L;  4QUC A;  1GUO A;  3MEF A;  1KHI A;  1PTO F;  1PH5 A;  4L5S A;  4DR5 L;  5K36 H;  4O2D A;  3G6J B;  4A3C H;  2PCF B;  2NTS A;  1IYU A;  3GV3 A;  1F2Z A;  1F9S A;  2F0W A;  4UDU C;  1QVF A;  3MEH A;  3RMH A;  1EY8 A;  2CKZ B;  2PMZ B;  3ULP A;  3PO3 G;  3TS2 A;  2L15 A;  5JJI A;  1XTC D;  4XYO A;  3CCL A;  4XQJ A;  1ZYR C;  1IL8 A;  1SEB D;  2K04 A;  3PCO B;  1GOZ A;  3GTG H;  5GAG C;  2BH2 A;  1XX8 A;  4RGO S;  4X62 L;  3TP5 A;  2KOL A;  4C3H H;  3K57 A;  2IPK D;  4L5T A;  5JVG 3;  1G29 1;  1HNW L;  5F2D A;  4FF1 A;  2KCN A;  3SE0 A;  2PZW A;  2O5J C;  3K81 C;  2JXM B;  1ASZ A;  5KND A;  3S17 B;  5EPL A;  3HKS A;  1BBU A;  3S2D B;  1H9M A;  3T1H L;  2LXK A;  2TSS A;  3GTO H;  3DXJ C;  1BCP B;  2WIN B;  1G91 A;  2ATW A;  1J6Q A;  1CQV A;  1ENA A;  5AJ3 L;  4UP9 A;  4YWK A;  2Y0S B;  5FJ8 G;  4PZ8 A;  1NAP A;  3A54 A;  1STG A;  1I3Q B;  2N55 A;  4JCV E;  3S2H H;  4JI3 L;  4DV3 L;  1LAC A;  3DM3 A;  1XMQ Q;  1A2T A;  4A93 G;  2FIN B;  3CD6 A;  3R3O A;  3K7U C;  1ILQ A;  2B29 A;  3S1R B;  5M3M H;  1SSO A;  4GZY C;  1A0I A;  3I4N B;  1I94 Q;  1SMX A;  2FMM A;  2A69 C;  3RLO A;  5BR8 Q;  1MSG A;  3BVM A;  1YBY A;  5JEA H;  3OTO L;  5M5Y B;  3TS0 A;  3FEW X;  3A5U A;  3K0X A;  2YU9 H;  4A3G H;  5DAU A;  4Q5V A;  2Q8R E;  5D14 A;  4M1U B;  4WJW A;  4DNR B;  2NVX H;  2K05 A;  3I4O A;  1VS0 A;  1IYV A;  3SDZ A;  5IYD G;  1A3T A;  1Q8I A;  1OXX K;  1FJG L;  3MTS A;  4C3H B;  2EY5 A;  4BY7 H;  3JAM E;  3IFD A;  2F1M A;  3M4Q A;  2SDF A;  3PO2 B;  3BYT B;  1JOQ A;  3F2C A;  3GTK B;  1QE6 A;  3E0J A;  4A3G B;  4YHH L;  5IE8 A;  3SHL A;  2O4X A;  2XIW A;  3EBE A;  2K6A A;  1S5E D;  2NN6 I;  2MFI A;  2I5L X;  4IZ8 A;  4YCV A;  4GKJ L;  5DNF A;  3BZD B;  2EJG C;  1KIX A;  3WWV A;  5I2X A;  5TSS A;  1HPC A;  1S5C D;  2M2L A;  4LFA Q;  4A3C G;  2Z8L A;  3SK4 A;  1PFB A;  4Y7N H;  2CQA A;  3UDI A;  1GUW A;  4AYB B;  2EY1 A;  2X6L A;  2XVS A;  1A63 A;  2WAQ E;  1HQR D;  1LTL A;  3I70 A;  3TQY A;  3NWT A;  5FO8 B;  3HOZ G;  3NK9 A;  2JEA I;  2XRQ D;  1EFW A;  1MIU A;  2F0L A;  4R9W A;  2GVB A;  4CBV A;  5L37 A;  2JE6 I;  1A15 A;  4DK3 C;  2B2U C;  5I4D A;  3PIP 3;  1EQV A;  5IYC H;  2YTX A;  5C4X G;  1OO9 B;  2EIF A;  4AIM A;  4AQY L;  4A3J H;  1MSH A;  1KAW A;  1CZG A;  2KHI A;  1SYD A;  2DJF C;  2UUB Q;  2HDM A;  1QUQ B;  1HNZ L;  1FGB D;  3A8K E;  4OXP A;  4OEL B;  4H13 C;  3CCV A;  4QB4 A;  2UXC Q;  5C3W A;  1EWC A;  1KNE A;  4BA2 I;  2K5H A;  3R2T A;  5IIF A;  2ZJQ A;  3CF5 A;  5C0X G;  4P73 A;  1EZ8 A;  1VQM A;  2EYJ A;  4A93 H;  4RA8 A;  2RA4 A;  1K8A C;  5ELC A;  5EKI A;  4QMG A;  1O7I A;  1WJJ A;  5A35 A;  4IAL A;  2GA4 B;  4NW2 A;  4NPS A;  1J5E Q;  1UUP A;  5NUC A;  1E3P A;  1EOV A;  4WOR A;  2VQE Q;  4APV A;  5JAV A;  2AQ1 B;  3NTI A;  1SE2 A;  3KDF B;  4Y52 H;  3TZU A;  1NR2 A;  3W5O A;  5CV7 A;  1EY6 A;  2EYP A;  4ZAI A;  4FF2 A;  2N88 A;  3KJP A;  1TWC H;  1HA5 A;  5EPJ A;  5LMU Q;  4A3I B;  2LMC B;  4RKL A;  4IUV A;  1I3Q H;  4DR5 Q;  1HUM A;  3BDL A;  2HIV A;  2K50 A;  1KTK A;  5EBC A;  1CI3 M;  1EIF A;  4A3B B;  1TS4 A;  5C4J H;  4A3L G;  3BYY B;  2F4I A;  2KCM A;  4H7B A;  4DK0 A;  4EVO A;  5CC4 A;  1N33 Q;  2CW0 C;  4DR7 Q;  1I4P A;  1V9P A;  2OCE A;  4LWC A;  3TRZ A;  1NR4 A;  3PMF A;  2LY7 A;  4IOA A;  4YWL A;  2B2V A;  4A3E B;  2E2I B;  4G7Z C;  3F2B A;  1PV4 A;  4QIW B;  1ICW A;  4DK1 A;  3NHH A;  4F87 A;  2IX1 A;  1WCM G;  4YCW A;  5LHY 1;  3A5Z B;  3R8B A;  3IL8 A;  4JI0 L;  1EY0 A;  1EEI D;  2LXJ A;  1O7Y A;  3FPU B;  4LF7 L;  1EY7 A;  4EGV A;  4HIK A;  1VQ5 A;  1XNQ L;  3GTL B;  3T1Y Q;  2F52 A;  5COR A;  4ZUJ A;  5IY0 A;  1QB5 D;  2IW3 A;  4H0L C;  5HGQ A;  1B50 A;  3MFG A;  1B9N A;  2R93 G;  4YY3 L;  1DOK A;  2D9U A;  2E2D C;  5IYC G;  3K59 A;  3HOW H;  4C3J G;  3M4O H;  1K83 H;  2IHE A;  3X3M A;  3JC6 6;  1JB3 A;  3RLN A;  4HED A;  1JT8 A;  4KD3 A;  4POG A;  2HQE A;  3UDF A;  2R7Z H;  1IBK Q;  1X32 A;  3M4P A;  4DAY B;  1AW7 A;  1SMY D;  3BU2 A;  5AJ3 Q;  1Q7Y C;  1YI2 A;  1XWE A;  1Y1W H;  3IAY A;  3NPP A;  3HZX A;  3G48 A;  2PQA A;  3PO3 B;  1I5F A;  3K0Y A;  1CKM A;  4CDC C;  4X3K A;  3H15 A;  4DUY Q;  2JA7 B;  1AE3 A;  3G4S A;  2B39 A;  5KEE A;  1YIJ A;  1LTG D;  1X55 A;  4JYA Q;  1FNV A;  1SNQ A;  1UAP A;  4G7O C;  2LSS A;  1I94 L;  1TQO A;  1VQ7 A;  3D3R A;  4K8J A;  3A55 A;  2R93 B;  2DN8 A;  3WOE A;  4K6L A;  1PDQ A;  4G57 A;  4KLK A;  1SE4 A;  3CC4 A;  3U50 C;  3ERO A;  4B3T Q;  1FR3 A;  3P1H A;  2PW7 A;  2VL6 A;  4YHH Q;  4YWM A;  3VR4 A;  1KAA A;  5C3X A;  1B4O A;  1TT2 A;  3ZYY X;  1RJT A;  4IUR A;  2BOS A;  1LT4 D;  3IRB A;  4GLX A;  3KF8 A;  4BBR B;  5IOC A;  1SAP A;  1U4L A;  4WRD A;  2NYZ D;  3KFU A;  1V1O A;  1I4H A;  3CRL C;  3LGJ A;  4KKT A;  1I6H B;  2CFM A;  1VQN A;  1L0X B;  3I73 A;  1KRT A;  4X66 L;  5M5Y H;  1U5K A;  4A3L H;  1UNS A;  1NMG A;  2EY6 A;  5JEA G;  2UU9 Q;  4X64 L;  3AU7 A;  3FMC A;  2RF4 A;  4DAV A;  2XTI A;  1OTC A;  2MJ8 A;  3I2Z A;  2DJG C;  5C3E H;  2XRS D;  1WD1 A;  4LUO A;  1JJG A;  2HD3 A;  1C7Y A;  1VMP A;  2Z9H A;  2ZTE A;  1N36 L;  4B3R Q;  4QL5 A;  1BXT A;  1JWU D;  3ULL A;  4HSV A;  4DU9 A;  1SYF A;  1UE1 A;  3OPO A;  4ZQ3 A;  2UUB L;  1LTS D;  4A4I A;  4JBW A;  3RUZ A;  3M3Y B;  1QUQ A;  1HR0 Q;  4O1N A;  2WV6 D;  1JR0 D;  2UXC L;  1VF7 A;  2QDB A;  1TWF H;  3HOU H;  4OX9 Q;  1WTO A;  1XJV A;  3BZK A;  3KJO A;  3PGZ A;  1KLG D;  1F2L A;  1TVX A;  4R1J A;  3PV0 A;  4DV7 Q;  2DUD A;  3CME A;  1B7Y B;  1DXM A;  4X62 Q;  1NE3 A;  4CDF C;  1SXT A;  1EQR A;  3QIA A;  1BNZ A;  3GTG B;  4OO1 I;  3Q6S A;  1SNC A;  2ICI A;  2WB1 E;  1N8R C;  2J0T D;  1DON A;  1JE4 A;  1Z47 A;  3K8A A;  4KY6 A;  1JB7 A;  1C9O A;  4P2C B;  4LUZ A;  1CA5 A;  4KHV A;  4RGN A;  1GKH A;  2NZH A;  5C3E G;  2A69 D;  2G9H D;  1DOL A;  1XTD A;  1B9M A;  4RH6 A;  1W2B A;  1FGU A;  2A74 C;  4JI1 L;  4MTN A;  4K2L A;  2I07 B;  1YNN D;  3TSS A;  5IYD H;  4A3J G;  3OHX C;  5H1S E;  2Q2H A;  3K5L A;  1NCV A;  4IUP A;  1EY5 A;  1PH7 A;  4LFB L;  4X6A H;  1QVC A;  2K28 A;  3X3N A;  1XMQ L;  4ILW A;  1R4P B;  4J8Q A;  1U4M A;  3OW7 A;  1Y1V B;  2M9V A;  2YTY A;  1X3F A;  2DNC A;  4M8A A;  4QQB X;  3W1G A;  2ZT9 C;  4EQ5 A;  3M3Y H;  1L1O A;  5EAY A;  1ESF A;  3H0G H;  5IYB G;  3A7L A;  4F7X A;  2KED A;  5JJZ A;  5A2Q E;  2B2T C;  1M90 C;  1PTO B;  2B2Y C;  1OXT A;  3PUW A;  4OWX B;  4JOI C;  2EYF A;  4EQP A;  4MZ9 A;  1Z6H A;  2K5V A;  2KEE A;  4A3E G;  1LLR D;  3ITP A;  2KCT A;  4KK7 A;  1N33 L;  2Y0S E;  3S1Q H;  4JI8 Q;  4L63 B;  3D0F A;  1FNU A;  4DR7 L;  2NZ1 D;  2B3G A;  2QCP X;  1B70 B;  2Z1C A;  2XNA C;  2JA8 H;  3HOY B;  4OIJ A;  1EY9 A;  1JWS D;  2AKW B;  1EUJ A;  2CWA A;  5ELD A;  4C3H G;  2UUC L;  1QZG A;  5CV4 A;  4YY3 Q;  1X3E A;  1OXU A;  1QNK A;  3I91 A;  3STB D;  1PH9 A;  2K33 A;  1N34 Q;  1Y14 B;  1HCZ A;  4DV4 L;  5DEH A;  2QW7 A;  3UDG A;  3T13 A;  4LF7 Q;  2KBN A;  5EGT A;  3CCU A;  2L5T A;  1XNQ Q;  3HOY H;  4DV5 L;  4J1M A;  3EN2 A;  2WKC A;  4GLV B;  3QB3 A;  1AP0 A;  2PNH A;  2F03 A;  1I50 B;  1CHP D;  3UE0 A;  2Z6B A;  3J80 E;  2RKS A;  1D7Q A;  1SR3 A;  3RD4 A;  1PH6 A;  2YTV A;  5E4X A;  3W3A A;  2F0P A;  3T53 B;  3EA6 A;  5K5P A;  1WTW A;  1CKN A;  3SVM A;  2GN5 A;  4A3J B;  3HKZ E;  1E22 A;  3EVQ A;  3RZD B;  5IGC A;  3CC2 A;  3LWU A;  4JW0 A;  2RSN A;  2YV5 A;  5DM6 3;  2LKV A;  3KBX A;  3FVQ A;  1A3V A;  3ND8 A;  2N8N A;  2L1B A;  4LJZ C;  1U0L A;  3TDQ A;  1SJE D;  2PQA B;  1X3Q A;  1TWH B;  3ND9 A;  5KNB A;  4DUY L;  1XMO L;  3M9B A;  4EQO A;  3PIP A;  4XT1 B;  5E1F A;  1KD1 C;  1E1T A;  3QOJ A;  1WCM B;  5FLX L;  4DUZ L;  4RKB A;  3I4M G;  3TZD A;  3RN5 A;  3AYH B;  4B3M Q;  4LF4 Q;  4A3F G;  1R9T H;  4RWS C;  2CH4 W;  1B53 A;  2F0S A;  2VB3 X;  2SOB A;  4FVM A;  2V1C C;  4XDX A;  1BOS A;  1QZH A;  4B3T L;  1P16 A;  4LFC L;  2EXD A;  2OT2 A;  5CV5 A;  4C1N I;  1LYL A;  4C2M H;  3AQQ A;  4HMJ A;  2OQK A;  4A3K B;  1EIY B;  4UY8 C;  2E74 C;  2HIX A;  1G2T A;  2R92 G;  4BWG B;  1CSP A;  4BBS G;  2BDO A;  2HUG A;  1F2M A;  1W6K A;  5CBE E;  3QJY A;  3KF8 B;  3NXW A;  1JOR A;  4BY7 B;  4AYB E;  1DYQ A;  1S40 A;  2NBF A;  2WAQ B;  4OL7 A;  3A0J A;  2K52 A;  2VQF Q;  1TS5 A;  3NEL A;  4CDD C;  1STY A;  5IT9 L;  1YVC A;  4HTH A;  4X66 Q;  1YNX A;  2YU9 B;  2Z6K A;  1EYC A;  5IP7 G;  2WFW A;  4HN7 A;  5HGT A;  1Y1V G;  3FKI H;  2NB0 A;  4DR4 L;  1BDO A;  2B2W A;  4IFD I;  4B3S Q;  4UP8 A;  3OIP A;  1HA6 A;  3NP8 A;  4K14 A;  2K1B A;  4UPA A;  4B3R L;  2R93 H;  3M85 A;  3HKZ B;  1JQY D;  4JI5 L;  1EYA A;  3PQI A;  2IT1 A;  5FO9 B;  1DCZ A;  1Y8P B;  2QKI C;  2F3I A;  4JV5 L;  4GNX A;  4A3F B;  1RF2 D;  4O0A A;  5I9O A;  2WII B;  5IGF A;  4KY7 A;  1VQJ A;  1X6O A;  1IKL A;  3VR2 A;  1H95 A;  3CXC A;  4ZYS A;  4OX9 L;  2CWP A;  3S1N B;  2RQX A;  1I4Q A;  1ENF A;  2R7F A;  1K9M C;  5FO7 B;  3E5S A;  3HRZ C;  2B63 H;  1WTX A;  3BVG A;  2XWB B;  4HIO A;  1ENC A;  1H9S B;  2JYO A;  1E24 A;  4GNX B;  1S72 A;  1WD0 A;  1GD7 A;  2WAC A;  3BDC A;  1II3 A;  2JA9 A;  1LTI D;  1LO5 D;  2I46 A;  4ID6 A;  1BCP F;  1YNJ D;  2EQS A;  1NSN S;  1AN8 A;  1F9Q A;  2JQO A;  1VQG A;  2QEJ C;  3CKI B;  3F8T A;  4OGQ C;  4CKE A;  4NXM L;  1HJP A;  1LV9 A;  4N8X 1;  2CVR A;  1KDC A;  1VQF A;  4DGZ A;  3GTJ H;  4GLA C;  1A8V A;  3BG3 A;  3HOV B;  4NKL A;  3NTK A;  4JI1 Q;  5M5X B;  5AFW A;  4A3M G;  1XPR A;  3NBH B;  5T1G A;  1E2Z A;  1PZK D;  3PF4 A;  1D5M C;  1K28 A;  1QCB D;  1WTH A;  3NUC A;  4HID A;  1VQ4 A;  1D6E C;  4JI6 Q;  3KLS X;  4LK1 C;  2NN6 H;  3MFY A;  2B63 B;  1BO0 A;  3AFP A;  5IOD A;  3CCQ A;  3J80 i;  4QUF A;  5J39 A;  3L2P A;  2O5I C;  5JPM C;  3CPW A;  2A68 D;  4BXX H;  1SND A;  3KBG A;  2HQL A;  4A3B G;  4A3D G;  4J6H A;  4R4C A;  2B2W C;  3CCJ A;  1AZP A;  1VQH A;  4TKO B;  4R8N A;  2F0H A;  4BBR G;  3K5O A;  1P8L A;  3MZ5 A;  1SNO A;  2UUC Q;  4DV6 Q;  2A6H D;  1VF5 C;  3HS0 C;  5C5M A;  2X6G A;  4K0K L;  1ZKO A;  2VB2 X;  2ZXO A;  4OIK A;  2JA5 G;  2KQ3 A;  3FKI B;  2H4O A;  1YIT A;  4DV5 Q;  1LT6 D;  2F0G A;  2D5D A;  3KOJ A;  1EFI D;  2JA6 H;  4NB3 A;  3GTK H;  1D1I A;  1PYB A;  3HOW G;  3DEO A;  3WOF A;  1M4V A;  1N34 L;  3J7Z C;  3C1E A;  3K80 C;  1HFN A;  3Q22 A;  1N32 L;  3H09 A;  1XNR Q;  2CHB D;  4LF6 Q;  1K0S A;  2FHT A;  1KLU D;  3NEM A;  1CKN B;  2ZXR A;  1HH2 P;  4FXG C;  3TBI B;  2F0I A;  1Z7T A;  2PPB C;  3FHW A;  3H6M A;  4DAY A;  2OQ0 A;  2K5N A;  4MHE A;  2ZTD A;  2PW5 A;  4R4Q A;  4CDE C;  1PTO C;  3RZO B;  1CSQ A;  3W2D A;  4ZRZ A;  5GAH C;  3OWE B;  4QF4 A;  3S1R H;  4DR3 L;  1NJI C;  2Q8T A;  1DGS A;  1BCP C;  2Q2T A;  4DUZ Q;  1JCK B;  1Q12 A;  5ELN A;  1VMC A;  1LTT D;  1U9R A;  2KVM A;  5IGG A;  4LF4 L;  4ULL A;  1YNN C;  5IWA Q;  3JAM c;  1ZYR D;  2ZM6 L;  3OWF A;  3QR8 A;  4DV7 L;  1IKM A;  4RGT A;  3T4A C;  5JEA J;  3WDN A;  1IW7 C;  1JMC A;  3QOL A;  3VR5 A;  3K7A H;  5IT9 E;  1KDB A;  3GTO B;  2A19 A;  2RDF A;  1VQ8 A;  1OXV A;  4H44 C;  3J81 L;  4IUQ A;  4XT3 B;  4LUV A;  4F88 A;  4KMU C;  3S14 B;  4C3J H;  2CH4 A;  3E3X A;  1J8I A;  1LTR D;  1PH4 A;  2I0Q A;  4DV0 L;  1RTN A;  2PMZ E;  5KYL A;  3BVZ A;  3P75 A;  3K5M A;  1K83 B;  2NN6 G;  3NWS A;  4IPD A;  3TP8 A;  2A73 B;  5M5W H;  3TEH B;  2EJF C;  1B1Z A;  4PMC A;  3OMC A;  4CJ1 B;  3GTQ B;  1FD7 D;  3DEP A;  2F0T A;  5FLM G;  1VQ9 A;  2QDL A;  3S24 A;  2IJ0 A;  2UUA L;  1S5B D;  1IBL Q;  1PMR A;  1L1O B;  1MJE A;  1WTP A;  2AMC B;  4A3G G;  2OTJ A;  1WTV A;  1OXS C;  4DNI A;  4C3I H;  5C0X I;  4IJH A;  1PRT B;  1SBB B;  3PUZ A;  1EEF D;  1S5D D;  1STB A;  2ALY B;  3A56 A;  1O80 A;  4KHZ A;  4BY7 G;  2NVY H;  1VQ6 A;  1S5F D;  1LM0 A;  5FLX E;  4DA2 A;  3MA2 B;  3T56 B;  1YJW A;  1HZ9 A;  5JJL A;  3MXP A;  1HTP A;  1PRT C;  4JOI A;  4OEM B;  1TXY A;  4I7A A;  2KHJ A;  3K7A B;  1V8Q A;  2B2T A;  1H9K A;  1YNJ C;  4P74 A;  4RHR A;  2QF7 A;  4BBS H;  1B3Q A;  1GUN A;  2K14 A;  1L1O C;  5ISR A;  4MNO A;  4JV5 Q;  3E6Z X;  1NBW A;  3RNU A;  1TWA B;  1TWC B;  5M3F G;  5I6Y A;  2UXB Q;  5KRU A;  2V4D A;  2DGY A;  4BY1 B;  1VQE A;  1C0A A;  3ERQ A;  4JVZ A;  3F1Z A;  3I4M B;  4EX5 A;  1Q81 C;  2E2H B;  3G7L A;  3P7J A;  1BBX C;  2HHH L;  2L0C A;  1LT3 D;  2RHS B;  1VQO A;  4TSS A;  1TS2 A;  1LUZ A;  1ROD A;  1Y1V H;  3Q8D A;  3VYS A;  3U58 A;  2FJ2 A;  1AFP A;  3CW2 C;  3A74 A;  1E2V A;  4OHJ A;  3GD7 A;  1XPO A;  2RHQ B;  1H9S A;  5JOB A;  2F0K A;  4XXE A;  5BN3 A;  1EZ6 A;  5C4X H;  2A6H C;  3FP9 A;  3L3O C;  4A93 B;  3QWN A;  5I2Y A;  4NXM Q;  5ELF A;  4ZLT F;  2L11 A;  2R3Z A;  4O42 A;  4UP7 A;  1EU4 A;  3CP0 A;  2L55 A;  2F0F A;  1K8G A;  2AWO A;  1TY2 A;  5EBD A;  3TME A;  3BJU A;  5IYB H;  1D5X C;  4P71 A;  3H3V I;  1B3A A;  3NBH A;  3PF5 A;  1PH1 A;  1PVO A;  4AQY Q;  1TWG B;  4GN4 B;  4UAI A;  2R92 H;  5IP9 G;  3RR5 A;  5BR8 L;  5C0X H;  4H02 A;  1RTO A;  2ID0 A;  5JVH 3;  4QGU A;  5C4H A;  4I65 A;  1HQM C;  3TP6 A;  3V2T A;  1D1K A;  1STA A;  3DM1 A;  4FYD A;  3NSW A;  2CCZ A;  4IPH A;  5DM7 3;  4XIG S;  5M3M G;  3CMA A;  5IGB A;  4C3J B;  3D31 A;  4B3M L;  1YHB A;  2OEO A;  3HOU B;  1WCM H;  1I4R A;  1FJG Q;  3VDY A;  5FK9 C;  4DV6 L;  4K8I A;  3H0G B;  1RCV D;  4K0K Q;  1TWH H;  4PQX A;  3FKI G;  2MO0 A;  4K2K A;  3J81 i;  3QG1 A;  5HY6 A;  4X65 Q;  3OOC A;  3C2P A;  4GOP B;  3M7N A;  1GHJ A;  1VQD A;  2FXQ A;  2N3S A;  2K5D A;  3L0O A;  4C3I G;  2Q8I B;  3IKJ A;  1Q3L A;  4PZ7 A;  1Q1E A;  4IN3 A;  1JJ2 A;  2EPB A;  4C3I B;  2BA1 A;  3HP3 A;  2R7Z G;  5J1Z A;  2PZU A;  3SK5 A;  3HOY G;  4RG1 A;  2A5H A;  1JIC A;  3J7A F;  4DN4 M;  4LMQ D;  3CCS A;  2CW0 D;  4RGM A;  3HOX G;  1CA6 A;  1G8Z D;  3GTL H;  3MWY W;  1W3S A;  1KXL A;  3D4W A;  3ZJY C;  3O13 A;  3H0G G;  3R93 A;  4FNF A;  3CHB D;  2PI2 A;  2BDN A;  1D8L A;  1LTB D;  1WOC A;  2MQH A;  4DV1 Q;  3PUX A;  1IYJ B;  2EDG A;  1TKW B;  3D4R A;  1I6H H;  1D5Z C;  4JI7 Q;  2KUM A;  3NEN A;  4BBR H;  3ULJ A;  3PUV A;  3DUZ A;  4K5X A;  4A3E H;  2E2I H;  1TS3 A;  3KF6 A;  4KTA A;  2F0J A;  3ERS X;  4PG3 A;  2KJX A;  4B08 A;  5KIX A;  4JI5 Q;  5COY A;  1RKN A;  1ML0 D;  1O7L A;  1MI2 A;  3A7A B;  1GUS A;  2JA6 B;  1PFS A;  2WB1 G;  2JA8 B;  3ICE A;  3Q0A A;  1K3B C;  2A1A A;  1Q8K A;  5IWA L;  1SRO A;  4KD4 A;  3S1N H;  2JA5 H;  3HOZ H;  2E5L Q;  1A6X A;  1FL0 A;  4NXN L;  2AUJ D;  4IFD H;  1C4Q A;  3DWA A;  5M3M B;  1YZ6 A;  1WI5 A;  3STB C;  2VXW A;  4BY1 H;  5CBA E;  1AZQ A;  3FPP A;  4A76 A;  2ZM6 Q;  2VY3 A;  3D4D A;  4FDB A;  3MXN B;  3S15 H;  1K73 C;  5I6W A;  3KLR A;  1T5E A;  3C46 A;  1BR9 A;  4PMB A;  4A3M B;  1UEA B;  3UE1 A;  3HOX H;  2UXD Q;  2WKD A;  4IPC A;  1PYW D;  2DY8 A;  5ELE A;  4JI4 L;  4KHP Q;  2F0O A;  1X56 A;  3VYT A;  2PO4 A;  3HOZ B;  4GKK L;  3I3C A;  4MTK A;  3DMU A;  1HFG A;  3V96 A;  4HR7 B;  3M7G A;  2QGQ A;  2LS0 1;  1C48 A;  2H5X A;  4I7Z C;  5IGD A;  3K5N A;  4FXD A; 
#chains in the Genus database with same CATH homology
 1E24 A;  4GNX B;  1S72 A;  3F2B A;  1PV4 A;  1SFO H;  1GD7 A;  2I5H A;  2JA9 A;  1EQQ A;  4LNQ A;  2IX1 A;  2EQS A;  1WCM G;  4YCW A;  2JQO A;  3F8T A;  1VQG A;  4NXM L;  3A5Z B;  3L7Z C;  1HJP A;  3I56 A;  3CCR A;  4JI0 L;  1VQF A;  5M5X H;  3GTJ H;  2LXJ A;  5LMU L;  4GLA C;  2VUM G;  1IBL L;  4LF7 L;  1YHQ A;  1HNX Q;  1A8V A;  2MO1 A;  1GVP A;  1VQ5 A;  4HIK A;  1XNQ L;  3T1Y Q;  2F52 A;  2JK8 A;  4ME3 A;  2D62 A;  5IY0 A;  4JI1 Q;  5HGQ A;  1VQI A;  3CAM A;  4A3M G;  1XPR A;  3AFQ A;  3NBH B;  4HJ5 A;  2R93 G;  4YY3 L;  4GOP C;  2A8V A;  5IYC G;  3PO2 G;  1UE5 A;  1EWI A;  3HOW H;  3PF4 A;  4KI0 A;  4A3I G;  1KQS A;  1IBM Q;  3M4O H;  1K83 H;  4WJ4 A;  2IHE A;  4OO1 G;  2RCN A;  3JC6 6;  4HID A;  2NZO A;  2WAQ G;  1VQ4 A;  3RLN A;  3HFZ B;  1VQK A;  4JI6 Q;  4LF5 L;  1JT8 A;  3OYY A;  4POG A;  1HNX L;  1HZA A;  4R4I A;  1ASY A;  3AFP A;  2UXB L;  3UDF A;  3CCQ A;  2XGT A;  2R7Z H;  4YCU A;  2PI2 E;  3J80 i;  2JA7 H;  1IBK Q;  3L2P A;  3M4P A;  4DAY B;  3J81 c;  4XTC S;  3GO5 A;  3BU2 A;  5AJ3 Q;  2JEB I;  2IHF A;  1YI2 A;  1Q7Y C;  1PH8 A;  2AWN A;  1RL2 A;  3CPW A;  3HOV G;  1Y1W H;  3PO3 H;  3CQZ H;  2IY5 B;  5GQO A;  4BXX H;  3G48 A;  1RIP A;  2PQA A;  1HZC A;  4ALP A;  1I5F A;  2IX0 A;  4JI0 Q;  4JG2 A;  1BKB A;  1CKM A;  2HQL A;  4A3B G;  1UEB A;  4A3D G;  1UE6 A;  3H15 A;  5C0X J;  4QIW E;  4DUY Q;  2B63 G;  4R4C A;  1AE3 A;  3I4N G;  3CCJ A;  1K0R A;  1VQH A;  3G4S A;  1YIJ A;  3T1Y L;  1XNR L;  3H3V H;  4LFA L;  1VQL A;  2BA0 A;  1X55 A;  4BBR G;  3RZD H;  4JYA Q;  1P8L A;  3S1M H;  3I55 A;  1IBK L;  3I7F A;  2UUC Q;  4DR6 Q;  3E9I A;  2LSS A;  1I94 L;  2HHH Q;  1VQ7 A;  4DR2 Q;  4DV6 Q;  4GN5 A;  4LW1 A;  4X64 Q;  1Q82 C;  4K0K L;  5IP7 H;  1JE5 A;  1VCI A;  4PMW A;  2C35 B;  1N9W A;  1M1K C;  4KLK A;  1K3R A;  1I50 H;  2JA5 G;  1HNZ Q;  2Y0S G;  3U50 C;  3CC4 A;  2ZJR A;  1CUK A;  2VW9 A;  1GO3 E;  1X65 A;  1NTG A;  4B3T Q;  2VL6 A;  1YIT A;  2ASB A;  4YHH Q;  1IZ6 A;  4DV5 Q;  4DR3 Q;  4YWM A;  3KOJ A;  4A75 A;  4JYA L;  4JI2 L;  1WYD A;  3PSI A;  2JA6 H;  1D7Q A;  4NB3 A;  3U4V A;  4IFD G;  3GTK H;  2D0O A;  5FJ8 H;  1IL2 A;  3PO2 H;  1PYB A;  3HOW G;  1X9N A;  4JC0 A;  4TVA B;  4BY1 G;  1N34 L;  2VNU D;  3J7Z C;  4LF8 L;  3IRB A;  3K80 C;  4GLX A;  2F4V Q;  1B8A A;  1L2F A;  1VQA A;  3J81 j;  1N32 L;  5IT9 c;  3KFU A;  3HKZ G;  1Z9F A;  2AHO B;  3LGJ A;  1XNR Q;  1YJ9 A;  4LF6 Q;  4DPG A;  2CFM A;  1HR0 L;  2JA7 G;  2ZTC A;  1GM5 A;  3GDE A;  3NEM A;  2JJQ A;  1VQN A;  1CKN B;  2Q2I A;  2OTL A;  1HH2 P;  4DR1 Q;  1KRT A;  4X66 L;  4TQU S;  1Y1W G;  5M5Y H;  1U5K A;  1KL9 A;  2KEN A;  2YYZ A;  4A3L H;  1FVI A;  2NVQ H;  1J5E L;  3FHW A;  1NMG A;  5JEA G;  2UU9 Q;  2OQ0 A;  4X64 L;  4A3B H;  2F4V L;  2K5N A;  1IXR A;  2ZTD A;  2RF4 A;  4R4Q A;  2XTI A;  1OTC A;  4DV0 Q;  5JJK A;  3I2Z A;  1CSQ A;  5C3E H;  3E9H A;  2JA8 G;  3I4N H;  5GAH C;  3KDF A;  4LF9 Q;  4LUO A;  1JJG A;  3S1R H;  3KF6 B;  5E7N A;  4DR3 L;  1NJI C;  5GRO A;  1C7Y A;  1DGS A;  2Q2T A;  2ZTE A;  4DUZ Q;  1Q12 A;  1N36 L;  1HR0 W;  4B3R Q;  4QL5 A;  5ELN A;  2QA4 A;  1MJC A;  4DAM A;  4DV2 L;  3OW2 A;  4IPG A;  4IJL A;  4LF4 L;  3ULL A;  3PIO A;  2R7D A;  4WJ3 M;  5IWA Q;  3JAM c;  2ZM6 L;  1UE1 A;  4J15 A;  1N32 Q;  1NMF A;  2UUA Q;  3CC7 A;  4DV7 L;  2VUM H;  2UUB L;  4IO9 A;  4A4I A;  5JEA J;  1YHA A;  1X54 A;  4JBW A;  1JMC A;  1AH9 A;  5FLX c;  1KRS A;  4LF6 L;  3K7A H;  1QUQ A;  1HR0 Q;  4JBK A;  2UXC L;  4GOP A;  4GNX C;  2A19 A;  2JA6 G;  1Q1B A;  2VS1 A;  3S2D H;  1VQ8 A;  1OXV A;  1TWF H;  5GAD C;  3HOU H;  3CCM A;  1E7Z A;  4LUV A;  4OX9 Q;  4C3J H;  1WFQ A;  1NY4 A;  2I5M X;  1BVS A;  4DV1 L;  3S17 H;  1XJV A;  3TRE A;  3BZK A;  4LFB Q;  2CQO A;  3KJO A;  3PGZ A;  2UU9 L;  3MEF A;  1PH4 A;  2NVT H;  2I0Q A;  1UWV A;  1KHI A;  1PH5 A;  5M3F H;  4R1J A;  4DV0 L;  4DR5 L;  3PV0 A;  2PMZ E;  2DUD A;  4DV7 Q;  4L5S A;  4QJF A;  4O2D A;  3CME A;  3UDX A;  2NN6 G;  1B7Y B;  5LMN Q;  4IPD A;  4X62 Q;  1NE3 A;  4A3C H;  1EQR A;  3ER0 A;  5M5W H;  3TEH B;  1N36 Q;  4OO1 I;  1QVF A;  2WB1 E;  1N8R C;  2CKZ B;  3PO3 G;  3TS2 A;  3ULP A;  3BZC A;  2L15 A;  1Z47 A;  1VQP A;  5JJI A;  3K8A A;  4BXX G;  1JB7 A;  1C9O A;  4A3K H;  5FLM G;  4LUZ A;  3S24 A;  1VQ9 A;  3CCL A;  2UUA L;  4A3D H;  1IBL Q;  3PCO B;  4DK6 C;  1GKH A;  2NZH A;  3KLW A;  5C3E G;  1Q86 C;  4JBM A;  1L1O B;  1MJE A;  2AMC B;  3GTG H;  1XTD A;  5GAG C;  4A3G G;  1W2B A;  2BH2 A;  1FGU A;  4NXN Q;  2OTJ A;  4JI1 L;  4X62 L;  4MTN A;  4C3H H;  5GAE C;  1OXS C;  1V1Q A;  4DNI A;  3RN2 A;  4JBJ A;  4L5T A;  4C3I H;  5C0X I;  1G29 1;  4IJH A;  5IYD H;  4A3J G;  5H1S E;  3J80 c;  2Q2H A;  1HNW L;  3PUZ A;  4LFB L;  1PH7 A;  3K81 C;  2ALY B;  4BY7 G;  4KHZ A;  1ASZ A;  2NVY H;  1QVC A;  4JI8 L;  1VQ6 A;  4X6A H;  4GN3 B;  1LM0 A;  4PZ6 A;  3HKS A;  4LF5 Q;  1BBU A;  1YJW A;  1XMQ L;  2E5L L;  1HZ9 A;  2E8G A;  5JJL A;  3T1H L;  2LXK A;  3AEV A;  2YTY A;  4OWW B;  1HZB A;  1X3F A;  4JOI A;  1Q46 A;  3GTO H;  1TXY A;  3W1G A;  4IOC A;  4QQB X;  4EQ5 A;  2KHJ A;  2ATW A;  1L1O A;  5EAY A;  3M3Y H;  5IYB G;  3H0G H;  1J6Q A;  5AJ3 L;  4UP9 A;  4YWK A;  4HJ9 A;  5LMN W;  3HOU G;  5FJ8 G;  1VQB A;  4P74 A;  4PZ8 A;  4L5R C;  4BBS H;  2K14 A;  4KHP L;  1M90 C;  1L1O C;  1HNW Q;  4OWX B;  1OXT A;  3PUW A;  4GKK Q;  2K4K A;  4DV4 Q;  4JCV E;  4HIM A;  4JOI C;  4MNO A;  4JV5 Q;  4MZ9 A;  1NBW A;  3G6E A;  3S2H H;  3KYH C;  4JI3 L;  3RNU A;  5M3F G;  4DV3 L;  5K36 G;  2UXB Q;  3DM3 A;  2K5V A;  1A62 A;  2DGY A;  1XMQ Q;  3SGI A;  4A93 G;  3CD6 A;  4A3E G;  1VQE A;  1SRU A;  1C0A A;  3K7U C;  2B29 A;  5M3M H;  3F1Z A;  4EX5 A;  1Q81 C;  3PUY A;  1A0I A;  4POF A;  3CCE A;  4JI4 Q;  1I94 Q;  2HHH L;  1PA6 A;  2GVA A;  1PHJ A;  3RZO H;  1SMX A;  2KCT A;  2RHS B;  4DKA C;  1VQO A;  3RLO A;  5BR8 Q;  1N33 L;  2ES2 A;  2Y0S E;  3S1Q H;  4JI8 Q;  1YBY A;  1LUZ A;  1L0W A;  1Y1V H;  3D0F A;  3Q8D A;  3U58 A;  3OTO L;  4DR7 L;  2B3G A;  3TS0 A;  1B70 B;  3CW2 C;  3A74 A;  2ZJP A;  1QVG A;  4DV3 Q;  3A5U A;  3K0X A;  2YU9 H;  2JA8 H;  4A3G H;  3GD7 A;  1XPO A;  2AKW B;  1EUJ A;  2RHQ B;  2CWA A;  2UUC L;  5ELO A;  1QZG A;  4OWT B;  3GTM H;  2NVX H;  3I4O A;  4YY3 Q;  1VS0 A;  5C4X H;  5IYD G;  1X3E A;  1OXU A;  3STB D;  3W1B A;  1YJN A;  1PH9 A;  1G6P A;  1OXX K;  3FP9 A;  1FJG L;  1N34 Q;  4NXM Q;  1Y14 B;  4BY7 H;  4DV4 L;  1CKO A;  3RLF A;  3UDG A;  1XPU A;  3M4Q A;  4LF7 Q;  3OTO Q;  2KBN A;  4UP7 A;  3CP0 A;  3F2C A;  3CCU A;  1XNQ Q;  3HOY H;  4YHH L;  4DV5 L;  5IE8 A;  1K8G A;  3EN2 A;  2AWO A;  3EBE A;  2R6G A;  2NN6 I;  2Z6K C;  3GTQ H;  4GLV B;  3BJU A;  2MFI A;  5IYB H;  2I5L X;  4P71 A;  2D0P A;  2PNH A;  3H3V I;  3PF5 A;  1PH1 A;  2K75 A;  1PVO A;  4YCV A;  4AQY Q;  4GN4 B;  2R92 H;  3UE0 A;  4GKJ L;  2Z0S A;  3RR5 A;  5IP9 G;  1IBM L;  1SR3 A;  4AYB G;  5BR8 L;  1PH6 A;  3S1N H;  2YTV A;  4H02 A;  2ID0 A;  4L5Q A;  2HT1 A;  4QGU A;  3J7A 5;  2E2H H;  1KIX A;  3WWV A;  4P75 A;  1G51 A;  1CKN A;  4X65 L;  2GN5 A;  4LF9 L;  3JAM i;  4R4T A;  3HKZ E;  1E22 A;  4LFA Q;  2CCZ A;  4LFC Q;  4IPH A;  4A3C G;  4XIG S;  3CC2 A;  5M3M G;  3CMA A;  2BH8 A;  3D31 A;  4B3M L;  1YHB A;  1KC8 C;  4Y7N H;  4DR6 L;  2YV5 A;  3UDI A;  1WCM H;  4DV2 Q;  4P72 A;  2N8N A;  1A63 A;  1FJG Q;  4GKJ Q;  2WAQ E;  3VDY A;  1U0L A;  4DV6 L;  1LTL A;  3TQY A;  2PQA B;  4A3K G;  5FLM H;  5C44 G;  3HOZ G;  4BA1 I;  4K0K Q;  1TWH H;  2JEA I;  5J3B A;  3FKI G;  2MO0 A;  3E0E A;  4DUY L;  1EFW A;  3J81 i;  1XMO L;  3M9B A;  2N49 A;  1MIU A;  3PIP A;  1KD1 C;  5HY6 A;  1E1T A;  4X65 Q;  4HJ7 A;  2GVB A;  1BBW A;  4GOP B;  3M7N A;  2JE6 I;  4DK3 C;  4DUZ L;  1VQD A;  2FXQ A;  2N3S A;  3I4M G;  5IYC H;  3RN5 A;  2YTX A;  3AYH B;  2Q2U A;  3L0O A;  4B3M Q;  5C4X G;  1E1O A;  4LF4 Q;  2EIF A;  4AIM A;  4AQY L;  4A3F G;  4A3J H;  1R9T H;  4DR2 L;  4PZ7 A;  1Q1E A;  1JJ2 A;  1KAW A;  1JJC B;  4LF8 Q;  2KHI A;  2BA1 A;  3GTP H;  1YEZ A;  4JI7 L;  2UUB Q;  4AH6 A;  1QUQ B;  1HNZ L;  2VZA A;  3U4Z A;  2V1C C;  1QZH A;  2R7Z G;  1V43 A;  3HOY G;  4B3T L;  4OXP A;  4RG1 A;  1SLJ A;  1TWG H;  3CCV A;  2OWO A;  1P16 A;  4LFC L;  3CCS A;  2EXD A;  2UXC Q;  4JI2 Q;  3HOX G;  1LYL A;  4C2M H;  3AQQ A;  3GTL H;  4BA2 I;  1W3S A;  2K5H A;  1KXL A;  1T9H A;  2OQK A;  3ZJY C;  3CF5 A;  3H0G G;  1PH3 A;  1X3G A;  1EIY B;  3G71 A;  2ZJQ A;  4UY8 C;  2HIX A;  3HOV H;  2PI2 A;  2R92 G;  1D8L A;  1WOC A;  2MQH A;  1CSP A;  5IP9 H;  3PUX A;  4GS3 A;  1IYJ B;  4DV1 Q;  4BBS G;  5C0X G;  2WP8 J;  3B6Y A;  3F2D A;  4P73 A;  2MNA A;  3CPF A;  1I6H H;  3KF8 B;  1VQM A;  4JI7 Q;  1XMO Q;  3NEN A;  4AYB E;  1S40 A;  1PYS B;  1SN8 A;  4A93 H;  4BBR H;  4R4O A;  3ULJ A;  3PUV A;  3A0J A;  3DLL A;  4HJA A;  4A3E H;  2E2I H;  2K52 A;  2VQF Q;  1K8A C;  3NEL A;  3KF6 A;  1YVC A;  3ERS X;  4PG3 A;  4DR1 L;  4JI5 Q;  1O7I A;  4X66 Q;  1WJJ A;  1YNX A;  1VQC A;  3S14 H;  1PFS A;  2WB1 G;  2Z6K A;  4NPS A;  3ICE A;  1SE8 A;  1J5E Q;  5IP7 G;  2QEX A;  1S3O A;  2A1A A;  1E3P A;  2WFW A;  1EOV A;  1Q8K A;  1SRO A;  2N78 A;  5IWA L;  5C44 H;  1EYG A;  2VQE Q;  1Y1V G;  2JA5 H;  3HOZ H;  3FKI H;  4DR4 L;  2E5L Q;  4IFD I;  4APV A;  1FL0 A;  4B3S Q;  3S16 H;  4NXN L;  4UP8 A;  4IFD J;  3KDF B;  2UXD L;  4A3M H;  4Y52 H;  4UPA A;  3I4M H;  4B3R L;  2R93 H;  3W5O A;  2E2J H;  3M85 A;  1YZ6 A;  1WI5 A;  4JI5 L;  3STB C;  4A3F H;  4BY1 H;  2IT1 A;  4A3I H;  3KJP A;  5DLQ E;  2F3I A;  1TWC H;  2ZM6 Q;  4A76 A;  1TWA H;  2VY3 A;  5LMU Q;  4HJ8 A;  4JV5 L;  4GNX A;  4FDB A;  3MXN B;  2VQE L;  1K73 C;  3S15 H;  3T1H Q;  1I3Q H;  4DR5 Q;  4RMF A;  4O0A A;  5LMN L;  2HIV A;  2K50 A;  4OON A;  1AE2 A;  3UE1 A;  1UE7 A;  3HOX H;  2VQF L;  2UXD Q;  1VQJ A;  4IPC A;  1EIF A;  1MKH A;  1X6O A;  4JI4 L;  1PH2 A;  1H95 A;  5C4J H;  3CXC A;  4A3L G;  4KHP Q;  1X56 A;  4OX9 L;  2KCM A;  3EIV A;  2CWP A;  4GKK L;  1N33 Q;  4QY7 A;  2R7F A;  1K9M C;  4JI3 Q;  2QGQ A;  4DR7 Q;  1V9P A;  4JI6 L;  2H5X A;  2OCE A;  4LWC A;  2B63 H;  3TRZ A;  4DR4 Q;  4B3S L;  4IOA A;  4YWL A;  4HIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...