2ES2A

Crystal structure analysis of the bacillus subtilis cold shock protein bs-cspb in complex with hexathymidine
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-rich DNA single strands bind to a preformed site on the bacterial cold shock protein Bs-CspB.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation
molecule keywords 5'-D(*TP*TP*TP*TP*TP*T)-3'
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2es2A00
2JA7H 3F2BA 1N34L 1PYBA 5J3BA 1J5EQ 3I55A 1T9HA 4JI2L 1UE1A 1VQBA 1WJJA 2GVAA 4JBWA 3U58A 2YTXA 2R7ZH 3KF6A 1X54A 2NVYH 4AQYL 5GAEC 1LM0A 1K73C 3U50C 4JI0Q 1IBKL 1UE5A 1Q8KA 3D31A 3M7NA 3TRZA 1Y14B 4JI4L 5E7NA 2I5MX 2F3IA 1A0IA 3RLOA 4H02A 5FLMH 1I5FA 2BH8A 4MTNA 4B3TQ 2IY5B 1JMCA 1DGSA 1SLJA 1NMGA 4LF8L 2WB1E 4IPDA 2JA7G 4YWLA 3CCUA 4LFBL 1KQSA 5JJIA 5C0XI 3U4VA 4NPSA 2RHQB 3PSIA 3RN2A 3FP9A 3G4SA 4NXML 4A3BG 4YHHL 1CUKA 2C35B 4JBKA 2F4VQ 3CQZH 3J81i 1VQKA 4YCUA 4L5QA 2Q2TA 1HNWQ 1WFQA 5LMUQ 2ZJQA 1JJ2A 4DR7L 2UU9L 2Y0SE 3S1QH 1IBMQ 4DKAC 3CCLA 4C3HH 2R92H 3UDFA 4BBRH 4JG2A 1ASYA 1E3PA 2N3SA 2E2JH 1VQNA 2UXBQ 3CCRA 2UXCQ 4BY7G 1E1OA 1V9PA 3PF5A 5JEAJ 5ELOA 4BXXH 1EFWA 2JK8A 5LMNQ 2MO1A 3CC4A 1HZCA 1QUQA 4A3MG 3HOZH 4PZ8A 2CWAA 4DV0L 1CKNA 4DR1L 4FDBA 4DV5Q 3U4ZA 1EOVA 4A3IH 1XMOL 3E9IA 3HFZB 3ULLA 4A3FH 1VQ5A 2IHFA 1L1OC 3HKZE 5IYCG 1LUZA 1XNRQ 5M5YH 4A3MH 5IYBH 1TWFH 5C44G 4JI3Q 2E5LQ 1NTGA 2VQFL 2YTVA 4QY7A 4NB3A 4DAYB 2OWOA 5JJKA 2CKZB 4X66L 5IWAQ 3F2DA 4JV5Q 2JA9A 3F1ZA 1HH2P 3I7FA 2WP8J 5M3FH 5IY0A 4C2MH 4JYAL 1KXLA 2RCNA 3CP0A 4P71A 4LFCL 4JI2Q 1VQ6A 3GTMH 5BR8Q 1TWHH 2Y0SG 4BY1G 4X62Q 1IYJB 3ULPA 4JI8L 2EIFA 1G291 2VZAA 3S1MH 4JI0L 1IBKQ 4LUVA 1X56A 3FKIH 1QUQB 2IX0A 1VQ7A 2HQLA 1XNQQ 4JI1Q 1CKOA 3A0JA 1YNXA 1KRTA 4B3TL 2K4KA 4J15A 4O0AA 4YWKA 3W1GA 4HJ5A 2WB1G 4JC0A 3PIOA 2LXJA 1HNXQ 1PHJA 1SN8A 3CCSA 2EXDA 2R7DA 5JJLA 4NXMQ 4YHHQ 4GNXB 1WOCA 1C0AA 3RLFA 1Q1BA 2PI2A 1YI2A 1AE3A 1V43A 2NVTH 4BY7H 2MFIA 3K80C 4LF4L 1HZAA 1Z47A 4JBJA 3OTOL 2HIXA 2GN5A 4L5RC 1GVPA 2I5HA 2VNUD 2UU9Q 3M9BA 1K83H 1TWCH 2UUAL 1YJ9A 1CSQA 4BBRG 4HJ7A 2UXBL 1N36L 1IBLQ 1GKHA 1FJGL 4HIOA 5IP7G 3J81c 4JBMA 3B6YA 3UE0A 3UDXA 4GN3B 5LMNW 2NVXH 4B3MQ 4DR5Q 4GLXA 1V1QA 4O2DA 5FLXc 4AYBE 4ALPA 1XJVA 4HIDA 1UEBA 2CCZA 2B3GA 3AEVA 4OO1G 4DV5L 2MO0A 3W1BA 1XTDA 4GNXC 2JEAI 1XNRL 3K7AH 4A4IA 1TXYA 1N32Q 2N49A 1XPUA 5FJ8G 3RNUA 1VQLA 1FGUA 2MQHA 1BVSA 4QIWE 3STBC 2JA6G 1X3GA 2IT1A 5IWAL 1GD7A 5M3MH 1YITA 4JV5L 2JA8G 1XPRA 3K8AA 3D0FA 1C7YA 3S15H 4LF5Q 3TEHB 2PMZE 1YZ6A 3W5OA 3PF4A 4OO1I 3TS0A 1I6HH 2KENA 1NJIC 2R93G 4A3JH 3NEMA 3S24A 1Q7YC 3FHWA 4DR4L 3H0GH 1KC8C 3E9HA 1I94Q 4A93G 1J6QA 3K81C 1PYSB 3I56A 4B3RQ 3HOVG 2JA5H 3L2PA 1UE6A 4HIKA 2H5XA 1OXXK 2PI2E 3GTJH 4PZ6A 2FXQA 2N78A 4A3FG 3KDFA 1S3OA 2K50A 2NZHA 5M3MG 2KCTA 4GKKQ 3BU2A 1QVFA 5C3EG 2YYZA 4DNIA 3RR5A 2AMCB 4A75A 3T1YQ 2YTYA 4X65L 4JI7Q 3HOZG 1X3EA 2DGYA 2IHEA 2R6GA 2NN6G 4JOIA 4RMFA 1SROA 3I4MG 3S16H 2V1CC 3T1HL 3ZJYC 1Y1VG 3OTOQ 2A1AA 2K75A 1LTLA 2Z0SA 2UUAQ 3HKSA 3CCJA 3L7ZC 1HR0W 3HOWH 3DLLA 1K9MC 2R7FA 2ES2A 3I4NG 1SFOH 4P73A 5ELNA 1J5EL 2ZJRA 1D8LA 4KHPQ 1OXUA 2CWPA 3H0GG 3CC7A 2Q2IA 4A3LG 2AWNA 1VQFA 1N8RC 3I4NH 2BA0A 3CXCA 1MJEA 3IRBA 5C0XG 3CMAA 5HY6A 4RG1A 4AYBG 4OX9Q 1YHQA 4HJAA 3CPWA 4DR2Q 4GKJL 1P8LA 2QGQA 4BBSH 2JA6H 4LF8Q 1SR3A 3AFPA 3CD6A 4IFDI 3BZCA 2N8NA 5IYDG 3G6EA 2QEXA 1RIPA 1FVIA 1VQEA 1HR0Q 2E2HH 4JI6Q 2JQOA 2LSSA 3F8TA 2BA1A 4DK6C 3CMEA 3KDFB 4LF5L 2OCEA 2F4VL 3PIPA 3A5ZB 1W2BA 4DUYQ 2OTLA 3PGZA 5LMUL 4DR7Q 1WCMG 1MJCA 3A74A 3RLNA 1BBUA 3I2ZA 1I94L 1N33Q 2ATWA 2HHHQ 1IBML 4A93H 4B3RL 3CF5A 3HOVH 5DLQE 3ERSX 3PUZA 2AWOA 3CCVA 2ZM6Q 1PH3A 4DV6L 4A3KG 4P75A 3G71A 4DV2L 4IOCA 4GKKL 2OTJA 4KI0A 3CW2C 4A3GG 4DR1Q 2A19A 4IPCA 1YIJA 3L0OA 4JI7L 1PVOA 4IFDJ 3VDYA 1B8AA 2GVBA 1VQ8A 1UWVA 2XGTA 2K5NA 4YY3L 4GS3A 4K0KQ 1NMFA 4POGA 5C44H 1I50H 2UUCQ 2VQFQ 1OTCA 2A8VA 2L15A 1VQIA 2K14A 3WWVA 4LFAQ 2VW9A 2UUBQ 3TS2A 4C3JH 5C4XG 1W3SA 4GOPB 1PH6A 3MXNB 1Z9FA 5GQOA 1JJGA 4OWXB 4GNXA 3F2CA 4A3CH 4LFCQ 4LF6L 4Y52H 3GTPH 4X62L 4A3GH 4R4OA 4DR3L 3SGIA 4JI5Q 1E24A 3GD7A 4JI8Q 1WYDA 3UE1A 1GM5A 1Q1EA 3GTLH 4OX9L 3K7UC 2VQEQ 5IP7H 4KHZA 5GROA 1IL2A 3KLWA 3HOXG 3EN2A 1XNQL 3CAMA 4DR2L 4LF9L 3S14H 4A3DG 4DR6Q 4A3BH 2VY3A 4IPGA 4IJHA 3CC2A 1E1TA 4GLAC 1A62A 2PNHA 4IO9A 5C4JH 1X9NA 4C3IH 1HNXL 1WCMH 3KJOA 1X3FA 1HR0L 1A8VA 1VQGA 3RN5A 4A3CG 2Q2HA 1ASZA 1X55A 4R4QA 4UPAA 3KF8B 5HGQA 1B70B 1X65A 2KHIA 2WAQE 3CPFA 4LF4Q 1A63A 1JJCB 1Q12A 5C0XJ 4DUZL 3TREA 4LF7Q 2D0OA 4BBSG 2NN6I 1IBLL 5M5XH 1CKMA 1YVCA 2JE6I 1HZBA 4DV3Q 4OXPA 2ZM6L 3PV0A 1HJPA 5IP9G 1EUJA 1Q82C 5AJ3Q 4B3ML 4NXNQ 3AYHB 3AQQA 3ER0A 2E2IH 1M90C 1VS0A 2KBNA 5EAYA 1IZ6A 3RZDH 1XMQL 1PH2A 1KIXA 1HNZL 1JB7A 4BA2I 3GO5A 3CCEA 4QQBX 4K0KL 2UUCL 3JC66 3HOWG 3NENA 1QZGA 3PO2H 2ALYB 5C4XH 1CKNB 2RHSB 5IYCH 3DM3A 2JA8H 3S2DH 4DPGA 3RZOH 1N34Q 2B29A 1L1OA 1PH4A 1TWGH 4LF6Q 2CQOA 3KYHC 3HOUH 1MIUA 5IT9c 4DR3Q 4JI5L 2OQ0A 2DUDA 2VL6A 5C3EH 1GO3E 2F52A 4YWMA 1PA6A 1BBWA 1Y1WH 2ZTEA 3J81j 4A3EG 1E7ZA 2VQEL 1MKHA 1QZHA 1SE8A 1VQJA 2ZTCA 4ME3A 4LF9Q 2JA5G 5GAGC 1D7QA 2KCMA 1EIYB 1YBYA 3GDEA 2AHOB 4LFBQ 4LW1A 4POFA 4WJ3M 4XIGS 3J7ZC 3ICEA 4TVAB 1OXTA 1SRUA 3STBD 1OXSC 4X65Q 4DV1L 3JAMi 1VQPA 1VQAA 3HKZG 4LWCA 4MZ9A 3H15A 1Y1WG 4HIMA 1Y1VH 1HNWL 2AKWB 1YHBA 4PMWA 4APVA 5IP9H 5FLMG 4EX5A 2NVQH 3ULJA 3NBHB 4JCVE 1PH7A 1S40A 1BKBA 1L1OB 1YJWA 2UXCL 4LUOA 5H1SE 4DV3L 2R7ZG 1L0WA 3TQYA 4TQUS 3M3YH 4GLVB 1YHAA 5AJ3L 4IFDG 5LMNL 4KHPL 4IJLA 5GAHC 3PUWA 4AH6A 4DAMA 4DV0Q 2RF4A 3S1NH 1XMOQ 2LXKA 4OWTB 2ZJPA 3KFUA 3S17H 2ASBA 1Q86C 1VQDA 1KL9A 2IX1A 3PUVA 4GKJQ 4BY1H 4UP8A 1U0LA 3A5UA 3M4OH 2VUMG 1Q81C 5K36G 3H3VH 4JYAQ 3K0XA 1N9WA 4OONA 4X64L 4JI6L 4DV4Q 3M4PA 5IE8A 1VQMA 5FJ8H 2NZOA 3UDIA 5BR8L 4DV7Q 3GTKH 3HOYH 1P16A 4DUYL 1PH8A 1RL2A 2OQKA 3I4MH 5IYBG 4MNOA 3BJUA 2BH2A 2D62A 4LUZA 1C9OA 1WI5A 1N33L 2HHHL 1S72A 1UE7A 3PO2G 3PUYA 4JI1L 1K8AC 2XTIA 2YV5A 4PZ7A 1EWIA 1JT8A 2JJQA 2I0QA 4UP7A 1YJNA 1Q46A 4DV6Q 2Q2UA 4BXXG 3KOJA 2CFMA 2WFWA 4DV2Q 4B3SQ 1E22A 1O7IA 4A3DH 3EBEA 1U5KA 2UXDL 2Z6KC 1K0RA 2PQAA 4DV1Q 3AFQA 3HOXH 4DK3C 2MNAA 1I3QH 4QL5A 2B63G 4Y7NH 1K8GA 4R4CA 4AIMA 4HJ9A 3MEFA 5M3FG 2KHJA 1KRSA 4R4TA 4YY3Q 1KD1C 3CCQA 3H3VI 3J80i 4QJFA 4IOAA 2UUBL 4LFAL 1N36Q 2YU9H 1XPOA 1FJGQ 1EYGA 3LGJA 4R4IA 2E8GA 3CCMA 1PV4A 1EIFA 1LYLA 3I4OA 4DR5L 1IXRA 3NELA 4QGUA 3OYYA 4KLKA 3Q8DA 1VQCA 2ID0A 3KF6B 4IPHA 4A76A 3KJPA 1EQRA 1OXVA 4AQYQ 1PH5A 2K5HA 3S1RH 1FL0A 4P74A 1NBWA 1VQ9A 3GTGH 3G48A 1JE5A 3EIVA 4BA1I 2K52A 1VQ4A 1EQQA 1G51A 3PCOB 4GOPC 3FKIG 4JI4Q 1R9TH 3GTQH 1N32L 3OW2A 4UY8C 4WJ4A 4DR6L 5GADC 4YCWA 4R1JA 2VUMH 1NE3A 2PQAB 4X6AH 4X64Q 2B63H 4DV4L 1TWAH 2JEBI 2VS1A 4GN5A 1QVCA 1M1KC 3GTOH 4GOPA 5M5WH 4DV7L 2EQSA 2K5VA 3UDGA 4L5SA 1G6PA 5JEAG 4OWWB 1H95A 4L5TA 3M4QA 4DUZQ 4A3EH 1VCIA 3PO3G 4GN4B 4DR4Q 4P72A 4A3IG 4XTCS 3M85A 1YEZA 4LF7L 1KAWA 4HJ8A 2QA4A 3HOUG 1L2FA 1PH1A 5IYDH 4UP9A 4JOIC 2ZTDA 3BZKA 1PH9A 1QVGA 3J7A5 4B3SL 4NXNL 3HOYG 2WAQG 4PG3A 1B7YB 1K3RA 3JAMc 3PUXA 2R92G 1PFSA 2UXDQ 1CSPA 1KHIA 1SMXA 3T1YL 4YCVA 1X6OA 3T1HQ 4A3KH 1XMQQ 3S2HH 1HNZQ 2I5LX 3PO3H 2HIVA 2Z6KA 4JI3L 4EQ5A 3J80c 2E5LL 4LNQA 1NY4A 4A3LH 1VQHA 1AE2A 3E0EA 2HT1A 1HZ9A 4X66Q 4A3JG 2R93H 1AH9A 1VQOA 2D0PA
chains in the Genus database with same CATH superfamily
2JA7H 3F2BA 1PFMA 5J3BA 3I55A 1T9HA 3R8BA 2TMPA 1WJJA 3N6RA 2F0JA 2YTXA 3KF6A 1K73C 3U50C 2B8GA 3D31A 3TRZA 1Y14B 3KF8A 5E7NA 2I5MX 3MHBA 1QCBD 1BR9A 5FLMH 1I5FA 2IY5B 1PTOD 1DGSA 2DN8A 2M9VA 2JA5B 1EU3A 1NMGA 4LF8L 4IPDA 4YWLA 4XYOA 5E4XA 5JJIA 1XX8A 3FP9A 3G4SA 3GTKB 1Q90A 4MTKA 1RJTA 1STNA 3CQZH 2ZJQA 3VR3A 1AP0A 1A3TA 4KN7C 4DKAC 3CCLA 2L55A 1EIHA 2R92H 3UDFA 4BBRH 4JG2A 2E2JH 2N3SA 2EDGA 2UXBQ 5CORA 1A2UA 2O5IC 2SEBD 3PIO3 4K6LA 2EVBA 1SYBA 1SE4A 3CC4A 4K5VA 1LT3D 3HOXB 2CWAA 4DR1L 4FDBA 4DV5Q 3HFZB 1VQ5A 2IHFA 4IUTA 3HKZE 5IYCG 3J80L 5M5YH 4A3MH 2CW0C 3VA5A 2CQAA 4DAYB 2QF7A 1BCPD 2QW7A 3F2DA 4JYAL 1HH2P 2RCNA 2I46A 1VQ6A 3GTMH 5BR8Q 1TWHH 4X62Q 4MHEA 5DEHA 2VZAA 3S1MH 1LACA 2B2UA 3KK7A 4JI0L 3GTGB 1WD0A 1X56A 1SYDA 1QUQB 2IX0A 3NUCA 1R9TB 4R8NA 1CKOA 1O7LA 1YNXA 2K4KA 4YWKA 2WB1G 3PIOA 2O4XA 2EXDA 2R7DA 4NXMQ 4C3HB 4YHHQ 4GNXB 4R9WA 3VR6A 4FF3A 1YI2A 2PI2A 2NVTH 3K80C 4LF4L 1HZAA 1Z47A 2GN5A 3MXPA 3NE5B 3M9BA 1K83H 1TWCH 3LX0A 2UUAL 1CSQA 2ENBA 3MXGA 3OSOA 3B6YA 4DR5Q 5FLXc 2CCZA 3HOWB 2B3GA 2LY7A 3S2HB 1JOKA 4XT1B 1XNRL 3K7AH 1HTLD 1E0BA 2NN6H 3PMFA 1WTHA 1VQLA 1FGUA 5IWAL 4JV5L 2JA7B 2JA8G 2F3WA 3BYYB 3GV6A 4LF5Q 3TEHB 5IIFA 3EROA 2RQXA 3FHWA 1H9JA 3E9HA 4A93G 1J6QA 1PYSB 1PFBA 2JA5H 2OF1A 1CI3M 3NXWA 3L2PA 1U4LA 2H5XA 1OXXK 3WOEA 5M5XB 5KRUA 5M3MG 2K50A 1HCZA 1QVFA 3BDCA 2AMCB 4X3TA 2YTYA 2CH4A 2N88A 1HHVA 3SK6A 3EFXD 3OTOQ 2A1AA 5FKAC 2AQ2B 1F9RA 3CCJA 3L7ZC 1FNVA 1K9MC 1Z6HA 2R7FA 2ES2A 3I4NG 2F4IA 5ELNA 4EVOA 4CJ0B 2EY1A 2K05A 1TWGB 5CV6A 4A3LG 1VQFA 5E3FA 1N8RC 1WTXA 3IRBA 5C0XG 3CMAA 1XWEA 1YHQA 2AUJD 3CPWA 3IFTA 3V05A 1EZ6A 4U673 1K28A 3Q22A 4RGTA 3H6MA 3OW7A 3CRKC 3CMEA 3VYUA 3KDFB 3VR4A 2OCEA 4ME5A 4DUYQ 3PGZA 4RWSC 3SDZA 1WCMB 1G2TA 1YNND 3I2ZA 1I94L 1RD9D 2GA4B 4X3SA 4CBVA 4HAEA 3HOVH 1RTNA 1I4PA 4CDCC 4DV6L 4P75A 2LMCB 4DV2L 4GKKL 5A35A 1TY0A 3FMCA 4DR1Q 1YIJA 4DNRB 1PVOA 1SYFA 1B8AA 2FHTA 4J1MA 1SE3A 2K5NA 4FXDA 4GS3A 1K83B 1M4VA 5FOBB 5C44H 1STGA 3W2DA 1VQIA 2UUBQ 4RH6A 5BN3A 4GOPB 3MTSA 3I91A 1PH6A 1Z9FA 4CDEC 4LFCQ 2B2VA 1ZYRC 3ND8A 4Y52H 4X62L 1VF7A 1E24A 5C4XB 5JJZA 2JA6B 2WKDA 3GP7A 4OX9L 3K7UC 1S5DD 1IL2A 3KLWA 3CAMA 4ZCKA 4IPGA 1I4RA 2RCFA 3CC2A 1E1TA 4GLAC 4IO9A 1HNXL 1GUTA 2R61A 1VQGA 3KF8B 2F0QA 5HGQA 1GHJA 1X65A 4I7ZC 1PFNA 4RKLA 4LF4Q 2V4DA 2RSNA 2EYMA 4ZKBB 3A56A 1L0XB 2F0PA 5M5XH 3NK9A 3E5SA 3PV0A 1HJPA 3FRPB 2NVQB 4B3ML 4B9WA 5TSSA 3GV3A 2L1BA 2XVSA 1NR4A 1I50B 1M90C 1PZID 3P1HA 1JB7A 4BA2I 3L9AX 2UUCL 2WACA 1KNAA 3GTQB 5CV4A 1MBYA 2VUMB 3DM3A 2JA8H 1WTPA 1N34Q 1ZEQX 1TWGH 2CQOA 3KYHC 3FEWX 3HOUH 5IT9c 2PZUA 2DUDA 5C3EH 3S14B 2K7VA 1EY9A 2F52A 3MC0B 2RVLA 4YWMA 3Q23A 2XNAC 1VQJA 2ZTCA 4H7BA 2VB2X 4HMIA 2WV6D 3HOYB 5C0XH 4LFBQ 4POFA 4WJ3M 3J7ZC 3IL8A 3BVZA 1FD7D 1Q8IA 2E76C 3CHBD 1OXSC 4G7HC 1VQPA 4KY6A 1VQAA 3HKZB 3DXJC 3H15A 4QF4A 4HIMA 2AKWB 3MA2B 3R3OA 1D5ZC 3E6ZX 5COYA 3NBHB 4JCVE 1V1PB 4LUOA 4IURA 3TP8A 3KUPA 4WFN3 4GLVB 5AJ3L 3RD4A 4IJLA 5GAHC 4DV0Q 3BYTB 2K32A 4RCNA 1X32A 3S17H 2Z8LA 3IFDA 4WJWA 1U9RA 2G9DA 1ML0D 1EYCA 3M4OH 5K36G 3H3VH 5D14A 4X64L 1Y1WB 4DV4Q 2KCNA 5IE8A 4HCSA 3UDIA 4DV7Q 1P16A 2HDMA 5DNFA 4DUYL 1PH8A 1TS5A 5CR3A 2F0UA 1LT5D 1N33L 1PTOC 3NQIA 2DY8A 5T1GA 2XTIA 3SK8A 4XYQA 1HPCA 2JJQA 1CM9A 2PMZB 2OXPA 4B3SQ 5G3LF 1EWHA 2UXDL 5I4DA 2Z6KC 4DV1Q 3FPUB 2B63G 1K8GA 4R4CA 4HJ9A 4H44C 3MEFA 5M3FG 4A3FB 1GUGA 3VYRA 3CCQA 3KBGA 3H3VI 3J80i 3F2UA 2UUBL 4ABNA 1QG7A 4R4IA 1O78A 3QO2A 1KDCA 2KJXA 4QGUA 4PNYA 2ID0A 4A76A 5DM73 1EQRA 3J81E 2A73B 1VMCA 1JE5A 1EEID 1NSNS 2X69A 4BA1I 4FXKC 1VQ4A 3PCOB 3GTQH 5J22A 4Q5VA 1BXTA 4MIUA 1MI2A 4WJ4A 2VUMH 2B2UC 2O5JC 2JA8B 3HRZC 4E6IA 2B63H 2JEBI 4K5XA 3SE0A 1QVCA 1SEBD 4GOPA 1JWSD 2K5VA 3UDGA 4L5SA 1G6PA 3K58A 4HTHA 4A3EH 1VCIA 5E1FA 4DR4Q 4XTCS 1YEZA 1Z7TA 4A3DB 3CQZB 2K33A 1UUPA 1L2FA 1TIID 4JOIC 5EGTA 1SJED 4N9PA 1TS3A 2NUCA 5C3WA 1K3RA 3JAMc 1RHPA 1ENFA 2YU9B 1F2ZA 4IUUA 4A3KH 2I5LX 2Z6KA 4JI3L 3J80c 2EYOA 2L11A 3P75A 1B9NA 1AE2A 2K5QA 4A3JG 5CV5A 1GUNA 2IWHA 3K59A 1VQOA 5M5YB 2WB1B 1WTVA 1PYBA 1J5EQ 3C1EA 3T4AC 1WD1A 4FVMA 1UE1A 3U58A 1ESRA 3J81L 5GAEC 1LM0A 4JI0Q 3NTHA 1IBKL 1A15A 4ZLTF 1TWHB 2F3IA 2BH8A 1PMRA 3M4OB 2JA7G 3EJIA 4LFBL 1KQSA 1DONA 4OELB 5D65A 2EY6A 2Q8IB 4YHHL 1CUKA 1PRTB 3D3RA 2A69C 3PQIA 3J81i 2Q2TA 1HNWQ 5LMUQ 4DR7L 1JJ2A 1EQTA 1JOQA 3S1QH 2Y0SE 1IBMQ 3OIQA 4C3HH 2QKIC 3CCRA 4HN7A 4K2KA 1EEFD 5JEAJ 1G6ZA 4BXXH 2R3ZA 2CW0D 1EFWA 2JK8A 2MO1A 1QUQA 1CKNA 2F3VA 3U4ZA 4NDXA 4A3FH 1L1OC 1LUZA 3R2TA 5IYBH 1NTGA 3J7AF 2VQFL 1BNZA 4V190 4M1UB 4QY7A 4NB3A 2OWOA 5JJKA 1LO5D 2R7ZB 4X66L 4O42A 2NVYB 2WP8J 5IY0A 5M3FH 1Y8OB 3BS1A 5IT9L 3I73A 4P71A 3ULPA 3MVVA 1DOLA 3LNNA 4JI8L 3VYSA 1XXGA 1EY0A 3FDTA 4LUVA 5KGUA 2HQLA 4RGOS 2HCCA 1XNQQ 1KRTA 5KNBA 4J15A 4O0AA 2K5WA 4RCOA 4IFDH 3C3LA 5EKLA 1LABA 1WOCA 2E75C 4OEMB 4A3EB 3URYA 3OTOL 4JBJA 2HIXA 2UU9Q 4NMZA 3ERQA 1YJ9A 2UXBL 1T5XD 1GKHA 4HIOA 1F9PA 3UDXA 4GN3B 1CHPD 4O2DA 1U4MA 4AYBE 3HG9A 4OO1G 3NTIA 4DV5L 2MO0A 4YIJA 2MUYA 1XTDA 5I6YA 4XDXA 2J7ZA 1S5BD 3FPPA 1BVSA 3STBC 1EY7A 1FYCA 1PRTC 4C3IB 3D0FA 1FNWA 2PMZE 3G7LA 4OO1I 5C6AA 3TS0A 4C3HG 1I6HH 2KENA 1NJIC 4PQXA 1PTOF 4DR4L 2DNEA 1I94Q 4CGYB 4TSSA 3K5NA 1TQOA 5EPKA 3HOVG 4HIKA 2Z4IA 1KTKA 1H9MA 1PRTD 4PZ6A 2FXQA 3VYTA 3Q6SA 3KDFA 1S3OA 5J39A 3BU2A 5C3EG 3HOVB 3T1YQ 3HOZG 2MJ8A 4JOIA 3N52A 3ZJYC 1Y1VG 3IAYA 1EY4A 2NVXB 1LTLA 2CVRA 2Z0SA 3J7YW 2UUAQ 3HKSA 5IGBA 3DLLA 5ISRA 4ZRZA 3K5OA 4P73A 5C44B 4DN4M 4ZQ3A 3H0GG 4K5WA 5ELDA 3CXCA 4KV6A 5HY6A 5M3MB 3TZUA 1L0YB 3S15B 4DF7A 4CJ1B 2JA6H 3NP8A 3MEHA 3BZCA 1A6XA 2QEXA 3G6JB 3TP7A 3I90A 2JQOA 4DK6C 3F8TA 2BA1A 4LF5L 1YNJC 2F4VL 2QDBA 5LMUL 4DR7Q 1MJCA 2ATWA 4XQQA 2HHHQ 1IBML 4KKTA 1S5CD 3ERSX 2AWOA 4ZKCB 2ZM6Q 1ZXTA 1PH3A 4UAIA 1IW7C 5CMDA 1HA5A 5I6WA 4RFBA 3CW2C 4A3GG 3VDYA 4AYBB 4CKEA 1VQ8A 2XGTA 1FR3A 3ONAB 4KD3A 3O13A 4TKOB 5I9OA 4POGA 2UUCQ 1I50H 2VQFQ 2A8VA 2L15A 3A8IE 3WWVA 2FMMA 1SNOA 1KNEA 2VW9A 3TS2A 4C3JH 5EBCA 5I2XA 5M9OA 2G9HD 2L9HA 2F0EA 1X3QA 2WINB 3D6CA 4OWXB 4GNXA 3F2CA 1ICWA 1JB3A 3GTPH 2F0MA 4A3GH 4R4OA 4JI5Q 4C1NK 2AQ3B 5GROA 2J0TD 2E2HB 1XNQL 5C3EB 3S14H 4DR6Q 4A3DG 2VY3A 1SBBB 1X9NA 2PNHA 4C3IH 2IJ0A 1X3FA 1RODA 1STBA 2ICIA 1BF4A 1X55A 5FLXL 5IGCA 1CHQD 2KHIA 2WAQE 4IN3A 3BDLA 1JJCB 4DUZL 4LF7Q 3NWTA 3TZDA 2SOBA 2OEOA 1IBLL 1CKMA 1YVCA 3JAML 1HZBA 1II3A 4OXPA 2O2LD 5IP9G 1MSGA 5AJ3Q 1R4PB 3A8JE 2D5DA 4NXNQ 4F8MA 3AYHB 3AQQA 2XIWA 3KLSX 1HUNA 5JPMC 1V1OA 1XYIA 5IGDA 3RZDH 2BOSA 3NHHA 1PH2A 3CCEA 1BCPF 2RBMA 5CV9A 1IKLA 4I65A 1PYWD 1CT1D 2RHSB 5IYCH 3S2DH 2B29A 1F2LA 5C4HA 1L1OA 3H3VC 3CRLC 4LF6Q 2HCIA 3PIP3 4DR3Q 5EPJA 2OQ0A 3SR1A 1VMPA 2E2DC 3VR2A 1Y1WH 5C4JB 4A3EG 1B9MA 1QJOA 2PQEA 1ICFB 1O7ZA 1JORA 1J8IA 5KIXA 2F03A 2I07B 1C4QA 3ICEA 2PW5A 1OXTA 1SRUA 3STBD 3V96A 1SSOA 4U68A 1ZKOA 4DAYA 1IL8A 1Y1WG 2PCFB 1BKBA 1L1OB 1YJWA 2CH4W 2UXCL 2R7ZG 2F0TA 5C3XA 4DV3L 3TQYA 4TQUS 5HGTA 1YHAA 1DD2A 3PUWA 4AH6A 2K5DA 5IGEA 4C1NI 4LMQD 4G7OC 5I9PA 4HEDA 2QILA 1VQDA 1Q86C 4C3IG 1QOHA 1I4XA 1LTBD 3NPPA 3PUVA 4BY1H 4C3JB 4UP8A 2B2YC 3K0XA 1N9WA 1F77A 4OONA 3LWEA 4JI6L 3M4PA 3K6OA 3U9SA 2EYPA 2NZOA 5BR8L 3OIPA 4KD4A 4L6TB 5IGGA 2OQKA 1TT2A 4MNOA 2BH2A 2B2VC 2B63B 2EY5A 2HHHL 3PO2G 1UE7A 2EE1A 2F0DA 3ND9A 3NBHA 4PZ7A 5LL6S 4PMBA 5IODA 3TN2A 1DCZA 3QG1A 4UP7A 4PMCA 2CFMA 2WFWA 4IUQA 3HP3A 1O7IA 4A3DH 1K0RA 3AFQA 2B39A 5JPNC 1I3QH 4QL5A 2CHBD 4ILWA 1TU2B 4R4TA 4RGNA 2F0VA 4P2CB 4LFAL 4DU9A 2YU9H 2DJGC 1FJGQ 3TSSA 4A3KB 1EYGA 2E8GA 1LYLA 2RA4A 4DR5L 1IXRA 3NELA 1SNPA 3Q8DA 2KHSA 3RZDB 1RDPD 2XSCA 3S1RH 1FL0A 4P74A 1VQ9A 4FNFA 3G48A 2NTSA 2K52A 3FKIB 1G51A 3FKIG 1N32L 3OW2A 5GADC 1SNCA 4YCWA 2PQAB 3S2DB 1H9KA 4DV4L 1TWAH 2K04A 2VS1A 1M1KC 3MZ5A 3DUZA 1EYDA 3M4QA 1ET6A 1B3QA 4A3IG 2C5CA 4LF7L 1KAWA 1QNUA 4KJNA 4HJ8A 2QA4A 1EL0A 1A2TA 4XXEA 1BO0A 4LAAA 2ZTDA 3S1QB 3BDOA 4NXNL 2WAQG 2QDLA 1YNJD 3PUXA 2B2TC 2R92G 1CSPA 1SMXA 3SK4A 2DY7A 4ZK9B 2F0SA 2F0LA 1XMQQ 3MFYA 4NP5A 4EQ5A 4LNQA 1NY4A 3DMUA 2E74C 3D6WA 4X66Q 2R93H 3PO3G 1HQRD 1SDFA 2A68C 4EQNA 4JI2L 3A54A 3MXNA 2R7ZH 1X54A 2NVYH 4AQYL 5M3FB 2BDNA 1UE5A 2B2WA 3IKJA 5NUCA 3RLOA 4JI4L 4BS9A 1ILQA 4H02A 2OT2A 4BY1B 4B3TQ 1JMCA 1SLJA 1KLUD 2WB1E 1LT4D 3CCUA 1DXMA 1UAPA 3U4VA 4NPSA 3PSIA 3RN2A 1PRTF 2C35B 4JBKA 1HXYD 4XQNA 4IQZA 2LKVA 3WDNA 5J1ZA 1WFQA 5D3DA 4J6HA 3VA7A 3BG3A 2UU9L 3BVGA 1ZYRD 1BCPC 1CK1A 2Q8TA 1VQNA 3NQTA 2UXCQ 3DWPA 1E1OA 2A5HA 1Y8NB 1SFOB 1E2WA 1HZCA 3OPOA 2IW3A 1I3QB 1EOVA 3ULLA 3I70A 1BUVT 2B8FA 4FF4A 3QR8A 4EQOA 5C44G 4JI3Q 2FFKB 2E5LQ 3OWEB 1ET9A 1E2ZA 1CQFA 3JAME 2CKZB 4QUFA 3F1ZA 3I7FA 4M8AA 1KXLA 1STAA 5ELCA 3NWSA 2PZWA 4LFCL 3DWQA 2RKSA 4DK1A 1IYJB 1DOKA 2EIFA 1G291 1EWCA 1LTTD 1QNKA 1IBKQ 3FKIH 1VQ7A 1TR5A 5FLXE 3A0JA 1I6HB 1BBXC 4DGZA 3W1GA 3DM1A 1HNXQ 1TWAB 1SN8A 2FMCA 3CCSA 2HUGA 5JJLA 1GUWA 3RLFA 1Q1BA 3K5MA 4BY7H 1A63A 2MFIA 4ZUJA 2I5HA 1EQVA 5E4WC 3AU7A 1HFGA 4HJ7A 5JVG3 1FJGL 5IP7G 4JBMA 1TS2A 4A3IB 2F0NA 3A7AB 5LMNW 2NVXH 4B3MQ 1V1QA 4ALPA 1XJVA 1HQMC 4HIDA 1UEBA 3A55A 3AEVA 2JYOA 1TKWB 2MHVA 4RA8A 1GJXA 4CKCA 4A4IA 1TXYA 5KEEA 1N32Q 2N49A 3RNUA 2L12A 4JPBW 1V1PA 2KEEA 2R93B 1SE2A 2IT1A 2Z4HA 1YITA 5M3MH 1JR0D 2K01A 1XPRA 1C7YA 3S15H 3W5OA 1ILPA 2NZ1D 2RDHA 2R93G 2KUMA 3NEMA 1Q7YC 1KC8C 3T53B 3K81C 5D3IB 3E0JA 3I56A 3J7AV 5C5MA 4DFAA 2L0CA 3GTJH 3QOJA 2A69D 1YNNC 2YYZA 4A75A 3L3OC 4JI7Q 2DGYA 2NN6G 3S16H 2R6GA 1LLRD 1SROA 3T1HL 2BDOA 1IYVA 3P20A 4I7AA 2KQ3A 1SFOH 3TMEA 3RZOB 1D8LA 3ITPA 1OXUA 3CC7A 2Q2IA 2AWNA 1W6JA 1PLFA 2BA0A 1NUCA 5F2DA 4NKLA 2MPMA 4AYBG 2XRQD 1S5FD 5EQ0A 4IUPA 4HJAA 1EU4A 3GTPB 4A3GB 4KY7A 4DR2Q 4CJ2C 1P8LA 4NW2A 3SHLA 2QGQA 4BBSH 4LF8Q 1SR3A 3CD6A 1O7YA 2N8NA 3G6EA 2E2HH 1FVIA 1AN8A 5CBAE 3H0GB 2LSSA 4G7ZC 1ESFA 3J80E 1B4OA 2KCCA 2VB3X 1MSHA 1W2BA 2EY2A 2OTLA 1IKMA 1WCMG 3FVQA 3QIAA 1N33Q 3CKIB 4B3RL 3CF5A 5DLQE 4JVZA 3CCVA 1LTGD 3R93A 2PO4A 3AB9A 3G71A 3M3YB 4IOCA 2OTJA 4KI0A 2H4OA 2PZTA 4BY7B 1PTOH 1QWYA 2RSOA 2GVBA 1UWVA 3NTKA 2XWJB 4YY3L 4DA2A 4K0KQ 3D4RA 3T13A 2EZVA 1S5ED 3U9OA 5C4XG 3I4NB 1KAAA 3MXNB 5GQOA 5BN4A 1JJGA 5KNDA 4A3CH 4LF6L 4DR3L 3SGIA 3GD7A 1WYDA 3UE1A 2BE5C 1Q1EA 1F9SA 2VQEQ 4KHZA 2JN4A 3HOXG 3EN2A 2F0WA 4MN3A 1JOOA 3H09A 5C4JH 3KJOA 1HR0L 1A8VA 3RN5A 4A3CG 1ASZA 4R4QA 3RMHA 4UPAA 1B70B 1RCVD 3CPFA 3D4DA 2EYJA 4F88A 2BCOA 1AZPA 3UI2A 2JE6I 4DV3Q 2ZM6L 1Q82C 1JCKB 1RTOA 5I2YA 1BOSA 3ER0A 4KK7A 2RDGA 4DNTB 2KECA 1VS0A 4DXFA 1IZ6A 2ZXOA 1HNZL 4QQBX 4DK0A 3NENA 1QZGA 1Q3LA 3PO2H 2ALYB 4JW0A 3C46A 4PV1C 4Z9CB 3RZOH 1D1IA 1PH4A 5ELBA 1STYA 3SK5A 2RDFA 4JI5L 3ZYYX 3EVQA 3OOCA 2NWGA 1MKHA 3HS0C 1HFNA 1JE4A 4KHVA 4B08A 1H9RA 4HSVA 4LF9Q 2JA5G 1B50A 4IZ8A 3DHQA 2KCMA 2Z9HA 4X3UA 1EIYB 1YBYA 1K0SA 4EGVA 2KOLA 2M00A 4RHRA 2KVMA 2NYZD 3OHXC 3H91A 5JAVA 3DEPA 3HKZG 4LWCA 4MZ9A 1D5XC 1HNWL 5IP9H 1YHBA 1A3UA 4PMWA 4APVA 5FLMG 4HCEA 4ZUIA 4EX5A 5IOCA 3ULJA 1S40A 3I3CA 3OWFA 1L0WA 5ELEA 3M3YH 2KA7A 1NNXA 5LMNL 2P5ZX 1PZJD 4XT3B 2RF4A 1KDBA 2F0OA 3S1NH 1PTOB 1CA6A 1XMOQ 2LXKA 4OWTB 2ZJPA 1PDQA 2ASBA 1AW7A 1SXTA 3QWNA 4TRDA 2DNCA 2VUMG 3S1RB 5FJ8H 1B3AA 1D1KA 1TVXA 1K8OA 2Z1CA 3I4MH 2D62A 1C9OA 1WI5A 4S3SA 3PUYA 4JI1L 5C4ZA 1K8AC 1PZKD 2YV5A 2EJGC 1JT8A 2I0QA 1DOMA 1QE6A 1YJNA 1Q46A 4DV6Q 2Q2UA 5K36H 4DV2Q 1E22A 3EBEA 4FF2A 3HOZB 3CU7A 3SXHA 2KHJA 4YY3Q 1KD1C 1TWFB 1JQYD 4QJFA 1H9SB 1N36Q 1XPOA 1G2SA 1PV4A 2ZXRA 1U4PA 4C2MB 3I4OA 2A6EC 3OYYA 3KF6B 4JK1C 3KJPA 4AQYQ 2WKCA 4UHVA 1I4QA 3EIVA 1K8MA 1HRJA 4JI4Q 4GOPC 2G5DA 3I8ZA 3KLSA 5BN5A 2HD3A 4R1JA 4IUNA 2F0IA 1NE3A 4X6AH 1EYAA 4CHTB 2EQSA 1AEXA 4L5TA 1EIGA 2QCPX 3EA6A 5EPLA 4GN4B 4P72A 3R2IA 2SDFA 3HOUG 4ID6A 4KKUA 1UNSA 2DJFC 4OGQC 5IYDH 4UP9A 1PH9A 1AZQA 1QVGA 3M7GA 3J7A5 3HOYG 4PG3A 3TBIB 1PFSA 3T1YL 3W3AA 1W6KA 2VXWA 3P7JA 1B2TA 1HNZQ 2E5LL 4F7XA 4A3LH 2HT1A 1CZGA 1LTID 1AH9A 1N34L 3MXUA 2GVAA 1VQBA 4JBWA 4F87A 2F0FA 3X3NA 3SVMA 3M7NA 1Q8KA 4ZAIA 2TSSA 1A0IA 4MTNA 1E2VA 1EFID 2EYLA 3RUZA 1NAPA 2HQEA 5C0XI 2NTTA 2JSOA 1JWUD 2RHQB 4OL7A 4NXML 4A3BG 2ICEC 4IUVA 2F4VQ 4ULLA 1VQKA 2LS01 4YCUA 4L5QA 5A2QE 1LTSD 1WTRA 3NBIA 1ASYA 1E3PA 4R8IA 3TP6A 4BY7G 4KJOA 1V9PA 3PF5A 1SYCA 4FF1A 5ELOA 1VF5C 1UEAB 2NBFA 5LMNQ 3QOLA 2N55A 4A3MG 1SNMA 3HOZH 4IALA 3MAQA 4PZ8A 4DV0L 4EQPA 4ODGA 1XMOL 4A3IH 3E9IA 2C9OA 1FNUA 1X3PA 1XNRQ 1TWFH 4DXGA 2YTVA 4HR7B 5CGKA 2X6LA 1KLGD 3D8GA 5IWAQ 4JV5Q 5C5LA 2JA9A 4L63B 4C2MH 2QEJC 2XWBB 3CP0A 4JI2Q 2Y0SG 5EKIA 4BY1G 1ENAA 1SYEA 3TP5A 1HUMA 1QB5D 4JI1Q 4DAPA 3WOFA 1D5MC 4B3TL 1GUOA 4FO2A 4JC0A 4HJ5A 3MFGA 2LXJA 1PHJA 4OO1H 1F2MA 4H13C 5ELFA 2R92B 1C0AA 3GTJB 1AE3A 1V43A 4GZYC 1MHWC 4L5RC 2VNUD 1GVPA 1FGBD 3T16A 3X3MA 2F0GA 5IT9E 4BBRG 3S16B 1N36L 1IBLQ 4QB4A 5IGFA 3J81c 5T1IA 1D2BA 1SNDA 2EYHA 2EYFA 3UE0A 1SNQA 1SAPA 5KYIA 4GLXA 3MWYW 4A3MB 2J4XA 1MGSA 4HMJA 1CZWA 4G57A 3W1BA 4B9XA 3HGBA 4GNXC 2JEAI 3GTLB 3TDQA 5HURA 2A6HD 3OMCA 2MP1A 1XPUA 2AUKA 1R4QB 1EY6A 5FJ8G 3GTMB 2MQHA 4QIWE 2JA6G 1X3GA 1GD7A 5JOBA 3K8AA 3VR5A 5JVH3 1YZ6A 4O1NA 3PF4A 5DM63 4BBSB 5JEAH 4A3JH 3S24A 2IX3A 4K14A 1VDZA 3H0GH 4FXGC 4QUCA 4B3RQ 2PYKA 1Y69U 1UE6A 5G3LD 2PI2E 2BE5D 2N78A 4A3FG 1I4HA 2NZHA 2KCTA 2F1MA 1A3VA 4GKKQ 2A6HC 4DNIA 3RR5A 3QJYA 4X65L 5CBEE 2Y0SB 3I4MG 1X3EA 4G4KA 2IHEA 2D2CC 4RMFA 2V1CC 1CFMA 2K75A 4H0LC 1BDOA 1HR0W 3HOWH 2JXMB 1EZ8A 1CA5A 3KBXA 4XQJA 1J5EL 2ZJRA 3K7AB 4KHPQ 2WAQB 1SYGA 2CWPA 4K8JA 4K2LA 1D6EC 1IW7D 3I4NH 5CV7A 3H94A 1MJEA 3BVMA 4RG1A 4OX9Q 1EOTA 2M2LA 2NB0A 4GKJL 1GUSA 3AFPA 3GQBA 4IFDI 5IYDG 1RIPA 1HR0Q 1VQEA 4JI6Q 1SMYD 4C3JG 4K8IA 3PIPA 3A5ZB 2K1BA 1WVLA 3HEJA 3RLNA 1JC7A 3A74A 1BBUA 4LK1C 1U4RA 3S9WA 4A93H 2K28A 1WTWA 1QILA 4QIWB 5FO8B 1MD2D 2D9UA 3PUZA 4A3KG 1GOZA 1TS4A 1LTRD 3DEOA 2A19A 4IPCA 4JI7L 3L0OA 4IFDJ 4KY5A 2EXZA 4N8X1 1NMFA 2MGSA 1OTCA 1O80A 2K14A 4LFAQ 1W3SA 4WRDA 4QCLA 3NSWA 2L5TA 2AQ1B 1HA6A 1RF2D 4C56C 1CQVA 4CKBA 3PO2B 3LWUA 2EOTA 4JI8Q 1GXDC 1GM5A 3M4YA 3GTLH 4CDFC 2EJMA 3C2PA 4RHSA 1KABA 5IP7H 3V2TA 4DR2L 4LF9L 4A3BH 4IJHA 5KYLA 1STEA 3DWAA 1A62A 3EQLC 1WCMH 2XN9C 1RKNA 1G8ZD 2Q2HA 5DAUA 4A3JB 3K5LA 1DZ1A 1J9OA 1Q12A 5C0XJ 4Y7NB 3C1FA 1S4ZA 3TREA 4OHJA 3A8KE 2D0OA 4BBSG 2NN6I 2ZXPA 1STHA 2JP1A 2A68D 4OIKA 1JICA 1EUJA 2Z6BA 3I72A 3OMGA 2E2IH 4KKSA 2KBNA 5EAYA 1I6VC 5LL6X 1C8CA 4KTAA 1XMQL 1KIXA 1B44D 3GO5A 3E3XA 4K0KL 3JC66 5CC4A 3HOWG 3S1NB 2EJFC 5C4XH 4J8QA 1CKNB 1EY5A 3D4WA 1F9QA 2KEDA 5EBDA 4DPGA 1ONLA 1LV9A 1MIUA 3GTOB 5M5WB 1CTMA 1LT6D 2VL6A 5FK9C 1GO3E 1PA6A 1BBWA 2ZTEA 5CYUA 3J81j 1E7ZA 1F2YA 2VQEL 1QZHA 1SE8A 4ME3A 5GAGC 5KNCA 1D7QA 4N9TA 3I4MB 5CV8A 3GDEA 1BCPB 2AHOB 2H1EA 4LW1A 4XIGS 4TVAB 3I4LA 4X65Q 1DYQA 4DV1L 3JAMi 4X3KA 2Q8RE 1Y1VH 2SNSA 3PO3B 4A93B 2NVQH 1SJHD 1PH7A 3BZDB 1KDAA 2SNMA 1AFPA 5H1SE 1HTPA 2A74C 2PNRC 5LHY1 4IFDG 2IPKD 4KHPL 4DAMA 4RKBA 2B2YA 5A2QL 3KFUA 1NR2A 4CDDC 1KL9A 2HDLA 2IX1A 1G91A 5K5PA 4BWGB 4GKJQ 4LJZC 3HOUB 1U0LA 3A5UA 2PW7A 1Q81C 2FINB 1EY8A 4JYAQ 1IYUA 1VQMA 1PXUA 2B2WC 3GTKH 2XRSD 3HOYH 1WTQA 1RL2A 5IYBG 3BJUA 1B1ZA 1V8QA 4LUZA 4N8FA 5L37A 4RGMA 1S72A 2ZT9C 1JWMD 4A3BB 4BBRB 2E2JB 1EWIA 4HSPA 4WORA 4BXXG 3KOJA 5EKKA 3QB3A 1U5KA 2PQAA 3HOXH 4KMUC 4DK3C 2MNAA 1Y8PB 4Y7NH 4AIMA 3K57A 2PPBC 1KRSA 2B2TA 1DJRD 4IOAA 3T51B 1I4GA 4DAVA 3SEBA 3LGJA 2K03A 3CCMA 3AMUA 1OO9B 5AFWA 1EIFA 3S17B 2E2IB 4KLKA 1XTCD 1VQCA 4IPHA 4UDUC 3Q0AA 2EPBA 1OXVA 1PH5A 2K5HA 2A6ED 4L8JA 1NBWA 4KN4C 3GTGH 3S1MB 4FP5D 2K6AA 2LFNA 1EQQA 3HZXA 1R9TH 1WTOA 4UY8C 1M8AA 4DR6L 2F0KA 4FYDA 5EJWA 5FO9B 4X64Q 4GN5A 4OIJA 3GTOH 5M5WH 4DV7L 3A7LA 5JEAG 4OWWB 1DM0B 1C48A 1H95A 2NVTB 4DUZQ 1NCVA 2FJ2A 4K6DA 3T56B 3M85A 3Q24A 1ENCA 1TWCB 5FO7B 1GHKA 2IL8A 3K0YA 1T5EA 1PH1A 4ZYSA 1LTAD 3BZKA 4B3SL 4Q0FA 2F0HA 3KLRA 1B7YB 1SMYC 2UXDQ 1BQQT 1KHIA 4YCVA 1X6OA 2L4NA 1Y1VB 3T1HQ 3S2HH 3PO3H 1K3BC 1TY2A 2HIVA 4V0BA 4QMGA 1B53A 2WIIB 4RAUC 1VQHA 1IHZA 3E0EA 1HZ9A 2X6GA 1H9SA 2D0PA
chains in the Genus database with same CATH topology
2JA7H 3F2BA 1N34L 1PYBA 5J3BA 1J5EQ 3I55A 1T9HA 4JI2L 1UE1A 1VQBA 1WJJA 2GVAA 4JBWA 3U58A 2YTXA 2R7ZH 3KF6A 1X54A 2NVYH 4AQYL 5GAEC 1LM0A 1K73C 3U50C 4JI0Q 1IBKL 1UE5A 1Q8KA 3D31A 3M7NA 3TRZA 1Y14B 4JI4L 5E7NA 2I5MX 2F3IA 1A0IA 3RLOA 4H02A 5FLMH 1I5FA 2BH8A 4MTNA 4B3TQ 2IY5B 1JMCA 1DGSA 1SLJA 1NMGA 4LF8L 2WB1E 4IPDA 2JA7G 4YWLA 3CCUA 4LFBL 1KQSA 5JJIA 5C0XI 3U4VA 4NPSA 2RHQB 3PSIA 3RN2A 3FP9A 3G4SA 4NXML 4A3BG 4YHHL 1CUKA 2C35B 4JBKA 2F4VQ 3CQZH 3J81i 1VQKA 4YCUA 4L5QA 2Q2TA 1HNWQ 1WFQA 5LMUQ 2ZJQA 1JJ2A 4DR7L 2UU9L 2Y0SE 3S1QH 1IBMQ 4DKAC 3CCLA 4C3HH 2R92H 3UDFA 4BBRH 4JG2A 1ASYA 1E3PA 2N3SA 2E2JH 1VQNA 2UXBQ 3CCRA 2UXCQ 4BY7G 1E1OA 1V9PA 3PF5A 5JEAJ 5ELOA 4BXXH 1EFWA 2JK8A 5LMNQ 2MO1A 3CC4A 1HZCA 1QUQA 4A3MG 3HOZH 4PZ8A 2CWAA 4DV0L 1CKNA 4DR1L 4FDBA 4DV5Q 3U4ZA 1EOVA 4A3IH 1XMOL 3E9IA 3HFZB 3ULLA 4A3FH 1VQ5A 2IHFA 1L1OC 3HKZE 5IYCG 1LUZA 1XNRQ 5M5YH 4A3MH 5IYBH 1TWFH 5C44G 4JI3Q 2E5LQ 1NTGA 2VQFL 2YTVA 4QY7A 4NB3A 4DAYB 2OWOA 5JJKA 2CKZB 4X66L 5IWAQ 3F2DA 4JV5Q 2JA9A 3F1ZA 1HH2P 3I7FA 2WP8J 5M3FH 5IY0A 4C2MH 4JYAL 1KXLA 2RCNA 3CP0A 4P71A 4LFCL 4JI2Q 1VQ6A 3GTMH 5BR8Q 1TWHH 2Y0SG 4BY1G 4X62Q 1IYJB 3ULPA 4JI8L 2EIFA 1G291 2VZAA 3S1MH 4JI0L 1IBKQ 4LUVA 1X56A 3FKIH 1QUQB 2IX0A 1VQ7A 2HQLA 1XNQQ 4JI1Q 1CKOA 3A0JA 1YNXA 1KRTA 4B3TL 2K4KA 4J15A 4O0AA 4YWKA 3W1GA 4HJ5A 2WB1G 4JC0A 3PIOA 2LXJA 1HNXQ 1PHJA 1SN8A 3CCSA 2EXDA 2R7DA 5JJLA 4NXMQ 4YHHQ 4GNXB 1WOCA 1C0AA 3RLFA 1Q1BA 2PI2A 1YI2A 1AE3A 1V43A 2NVTH 4BY7H 2MFIA 3K80C 4LF4L 1HZAA 1Z47A 4JBJA 3OTOL 2HIXA 2GN5A 4L5RC 1GVPA 2I5HA 2VNUD 2UU9Q 3M9BA 1K83H 1TWCH 2UUAL 1YJ9A 1CSQA 4BBRG 4HJ7A 2UXBL 1N36L 1IBLQ 1GKHA 1FJGL 4HIOA 5IP7G 3J81c 4JBMA 3B6YA 3UE0A 3UDXA 4GN3B 5LMNW 2NVXH 4B3MQ 4DR5Q 4GLXA 1V1QA 4O2DA 5FLXc 4AYBE 4ALPA 1XJVA 4HIDA 1UEBA 2CCZA 2B3GA 3AEVA 4OO1G 4DV5L 2MO0A 3W1BA 1XTDA 4GNXC 2JEAI 1XNRL 3K7AH 4A4IA 1TXYA 1N32Q 2N49A 1XPUA 5FJ8G 3RNUA 1VQLA 1FGUA 2MQHA 1BVSA 4QIWE 3STBC 2JA6G 1X3GA 2IT1A 5IWAL 1GD7A 5M3MH 1YITA 4JV5L 2JA8G 1XPRA 3K8AA 3D0FA 1C7YA 3S15H 4LF5Q 3TEHB 2PMZE 1YZ6A 3W5OA 3PF4A 4OO1I 3TS0A 1I6HH 2KENA 1NJIC 2R93G 4A3JH 3NEMA 3S24A 1Q7YC 3FHWA 4DR4L 3H0GH 1KC8C 3E9HA 1I94Q 4A93G 1J6QA 3K81C 1PYSB 3I56A 4B3RQ 3HOVG 2JA5H 3L2PA 1UE6A 4HIKA 2H5XA 1OXXK 2PI2E 3GTJH 4PZ6A 2FXQA 2N78A 4A3FG 3KDFA 1S3OA 2K50A 2NZHA 5M3MG 2KCTA 4GKKQ 3BU2A 1QVFA 5C3EG 2YYZA 4DNIA 3RR5A 2AMCB 4A75A 3T1YQ 2YTYA 4X65L 4JI7Q 3HOZG 1X3EA 2DGYA 2IHEA 2R6GA 2NN6G 4JOIA 4RMFA 1SROA 3I4MG 3S16H 2V1CC 3T1HL 3ZJYC 1Y1VG 3OTOQ 2A1AA 2K75A 1LTLA 2Z0SA 2UUAQ 3HKSA 3CCJA 3L7ZC 1HR0W 3HOWH 3DLLA 1K9MC 2R7FA 2ES2A 3I4NG 1SFOH 4P73A 5ELNA 1J5EL 2ZJRA 1D8LA 4KHPQ 1OXUA 2CWPA 3H0GG 3CC7A 2Q2IA 4A3LG 2AWNA 1VQFA 1N8RC 3I4NH 2BA0A 3CXCA 1MJEA 3IRBA 5C0XG 3CMAA 5HY6A 4RG1A 4AYBG 4OX9Q 1YHQA 4HJAA 3CPWA 4DR2Q 4GKJL 1P8LA 2QGQA 4BBSH 2JA6H 4LF8Q 1SR3A 3AFPA 3CD6A 4IFDI 3BZCA 2N8NA 5IYDG 3G6EA 2QEXA 1RIPA 1FVIA 1VQEA 1HR0Q 2E2HH 4JI6Q 2JQOA 2LSSA 3F8TA 2BA1A 4DK6C 3CMEA 3KDFB 4LF5L 2OCEA 2F4VL 3PIPA 3A5ZB 1W2BA 4DUYQ 2OTLA 3PGZA 5LMUL 4DR7Q 1WCMG 1MJCA 3A74A 3RLNA 1BBUA 3I2ZA 1I94L 1N33Q 2ATWA 2HHHQ 1IBML 4A93H 4B3RL 3CF5A 3HOVH 5DLQE 3ERSX 3PUZA 2AWOA 3CCVA 2ZM6Q 1PH3A 4DV6L 4A3KG 4P75A 3G71A 4DV2L 4IOCA 4GKKL 2OTJA 4KI0A 3CW2C 4A3GG 4DR1Q 2A19A 4IPCA 1YIJA 3L0OA 4JI7L 1PVOA 4IFDJ 3VDYA 1B8AA 2GVBA 1VQ8A 1UWVA 2XGTA 2K5NA 4YY3L 4GS3A 4K0KQ 1NMFA 4POGA 5C44H 1I50H 2UUCQ 2VQFQ 1OTCA 2A8VA 2L15A 1VQIA 2K14A 3WWVA 4LFAQ 2VW9A 2UUBQ 3TS2A 4C3JH 5C4XG 1W3SA 4GOPB 1PH6A 3MXNB 1Z9FA 5GQOA 1JJGA 4OWXB 4GNXA 3F2CA 4A3CH 4LFCQ 4LF6L 4Y52H 3GTPH 4X62L 4A3GH 4R4OA 4DR3L 3SGIA 4JI5Q 1E24A 3GD7A 4JI8Q 1WYDA 3UE1A 1GM5A 1Q1EA 3GTLH 4OX9L 3K7UC 2VQEQ 5IP7H 4KHZA 5GROA 1IL2A 3KLWA 3HOXG 3EN2A 1XNQL 3CAMA 4DR2L 4LF9L 3S14H 4A3DG 4DR6Q 4A3BH 2VY3A 4IPGA 4IJHA 3CC2A 1E1TA 4GLAC 1A62A 2PNHA 4IO9A 5C4JH 1X9NA 4C3IH 1HNXL 1WCMH 3KJOA 1X3FA 1HR0L 1A8VA 1VQGA 3RN5A 4A3CG 2Q2HA 1ASZA 1X55A 4R4QA 4UPAA 3KF8B 5HGQA 1B70B 1X65A 2KHIA 2WAQE 3CPFA 4LF4Q 1A63A 1JJCB 1Q12A 5C0XJ 4DUZL 3TREA 4LF7Q 2D0OA 4BBSG 2NN6I 1IBLL 5M5XH 1CKMA 1YVCA 2JE6I 1HZBA 4DV3Q 4OXPA 2ZM6L 3PV0A 1HJPA 5IP9G 1EUJA 1Q82C 5AJ3Q 4B3ML 4NXNQ 3AYHB 3AQQA 3ER0A 2E2IH 1M90C 1VS0A 2KBNA 5EAYA 1IZ6A 3RZDH 1XMQL 1PH2A 1KIXA 1HNZL 1JB7A 4BA2I 3GO5A 3CCEA 4QQBX 4K0KL 2UUCL 3JC66 3HOWG 3NENA 1QZGA 3PO2H 2ALYB 5C4XH 1CKNB 2RHSB 5IYCH 3DM3A 2JA8H 3S2DH 4DPGA 3RZOH 1N34Q 2B29A 1L1OA 1PH4A 1TWGH 4LF6Q 2CQOA 3KYHC 3HOUH 1MIUA 5IT9c 4DR3Q 4JI5L 2OQ0A 2DUDA 2VL6A 5C3EH 1GO3E 2F52A 4YWMA 1PA6A 1BBWA 1Y1WH 2ZTEA 3J81j 4A3EG 1E7ZA 2VQEL 1MKHA 1QZHA 1SE8A 1VQJA 2ZTCA 4ME3A 4LF9Q 2JA5G 5GAGC 1D7QA 2KCMA 1EIYB 1YBYA 3GDEA 2AHOB 4LFBQ 4LW1A 4POFA 4WJ3M 4XIGS 3J7ZC 3ICEA 4TVAB 1OXTA 1SRUA 3STBD 1OXSC 4X65Q 4DV1L 3JAMi 1VQPA 1VQAA 3HKZG 4LWCA 4MZ9A 3H15A 1Y1WG 4HIMA 1Y1VH 1HNWL 2AKWB 1YHBA 4PMWA 4APVA 5IP9H 5FLMG 4EX5A 2NVQH 3ULJA 3NBHB 4JCVE 1PH7A 1S40A 1BKBA 1L1OB 1YJWA 2UXCL 4LUOA 5H1SE 4DV3L 2R7ZG 1L0WA 3TQYA 4TQUS 3M3YH 4GLVB 1YHAA 5AJ3L 4IFDG 5LMNL 4KHPL 4IJLA 5GAHC 3PUWA 4AH6A 4DAMA 4DV0Q 2RF4A 3S1NH 1XMOQ 2LXKA 4OWTB 2ZJPA 3KFUA 3S17H 2ASBA 1Q86C 1VQDA 1KL9A 2IX1A 3PUVA 4GKJQ 4BY1H 4UP8A 1U0LA 3A5UA 3M4OH 2VUMG 1Q81C 5K36G 3H3VH 4JYAQ 3K0XA 1N9WA 4OONA 4X64L 4JI6L 4DV4Q 3M4PA 5IE8A 1VQMA 5FJ8H 2NZOA 3UDIA 5BR8L 4DV7Q 3GTKH 3HOYH 1P16A 4DUYL 1PH8A 1RL2A 2OQKA 3I4MH 5IYBG 4MNOA 3BJUA 2BH2A 2D62A 4LUZA 1C9OA 1WI5A 1N33L 2HHHL 1S72A 1UE7A 3PO2G 3PUYA 4JI1L 1K8AC 2XTIA 2YV5A 4PZ7A 1EWIA 1JT8A 2JJQA 2I0QA 4UP7A 1YJNA 1Q46A 4DV6Q 2Q2UA 4BXXG 3KOJA 2CFMA 2WFWA 4DV2Q 4B3SQ 1E22A 1O7IA 4A3DH 3EBEA 1U5KA 2UXDL 2Z6KC 1K0RA 2PQAA 4DV1Q 3AFQA 3HOXH 4DK3C 2MNAA 1I3QH 4QL5A 2B63G 4Y7NH 1K8GA 4R4CA 4AIMA 4HJ9A 3MEFA 5M3FG 2KHJA 1KRSA 4R4TA 4YY3Q 1KD1C 3CCQA 3H3VI 3J80i 4QJFA 4IOAA 2UUBL 4LFAL 1N36Q 2YU9H 1XPOA 1FJGQ 1EYGA 3LGJA 4R4IA 2E8GA 3CCMA 1PV4A 1EIFA 1LYLA 3I4OA 4DR5L 1IXRA 3NELA 4QGUA 3OYYA 4KLKA 3Q8DA 1VQCA 2ID0A 3KF6B 4IPHA 4A76A 3KJPA 1EQRA 1OXVA 4AQYQ 1PH5A 2K5HA 3S1RH 1FL0A 4P74A 1NBWA 1VQ9A 3GTGH 3G48A 1JE5A 3EIVA 4BA1I 2K52A 1VQ4A 1EQQA 1G51A 3PCOB 4GOPC 3FKIG 4JI4Q 1R9TH 3GTQH 1N32L 3OW2A 4UY8C 4WJ4A 4DR6L 5GADC 4YCWA 4R1JA 2VUMH 1NE3A 2PQAB 4X6AH 4X64Q 2B63H 4DV4L 1TWAH 2JEBI 2VS1A 4GN5A 1QVCA 1M1KC 3GTOH 4GOPA 5M5WH 4DV7L 2EQSA 2K5VA 3UDGA 4L5SA 1G6PA 5JEAG 4OWWB 1H95A 4L5TA 3M4QA 4DUZQ 4A3EH 1VCIA 3PO3G 4GN4B 4DR4Q 4P72A 4A3IG 4XTCS 3M85A 1YEZA 4LF7L 1KAWA 4HJ8A 2QA4A 3HOUG 1L2FA 1PH1A 5IYDH 4UP9A 4JOIC 2ZTDA 3BZKA 1PH9A 1QVGA 3J7A5 4B3SL 4NXNL 3HOYG 2WAQG 4PG3A 1B7YB 1K3RA 3JAMc 3PUXA 2R92G 1PFSA 2UXDQ 1CSPA 1KHIA 1SMXA 3T1YL 4YCVA 1X6OA 3T1HQ 4A3KH 1XMQQ 3S2HH 1HNZQ 2I5LX 3PO3H 2HIVA 2Z6KA 4JI3L 4EQ5A 3J80c 2E5LL 4LNQA 1NY4A 4A3LH 1VQHA 1AE2A 3E0EA 2HT1A 1HZ9A 4X66Q 4A3JG 2R93H 1AH9A 1VQOA 2D0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA7 H;  3F2B A;  1N34 L;  1PYB A;  5J3B A;  1J5E Q;  3I55 A;  1T9H A;  4JI2 L;  1UE1 A;  1VQB A;  1WJJ A;  2GVA A;  4JBW A;  3U58 A;  2YTX A;  2R7Z H;  3KF6 A;  1X54 A;  2NVY H;  4AQY L;  5GAE C;  1LM0 A;  1K73 C;  3U50 C;  4JI0 Q;  1IBK L;  1UE5 A;  1Q8K A;  3D31 A;  3M7N A;  3TRZ A;  1Y14 B;  4JI4 L;  5E7N A;  2I5M X;  2F3I A;  1A0I A;  3RLO A;  4H02 A;  5FLM H;  1I5F A;  2BH8 A;  4MTN A;  4B3T Q;  2IY5 B;  1JMC A;  1DGS A;  1SLJ A;  1NMG A;  4LF8 L;  2WB1 E;  4IPD A;  2JA7 G;  4YWL A;  3CCU A;  4LFB L;  1KQS A;  5JJI A;  5C0X I;  3U4V A;  4NPS A;  2RHQ B;  3PSI A;  3RN2 A;  3FP9 A;  3G4S A;  4NXM L;  4A3B G;  4YHH L;  1CUK A;  2C35 B;  4JBK A;  2F4V Q;  3CQZ H;  3J81 i;  1VQK A;  4YCU A;  4L5Q A;  2Q2T A;  1HNW Q;  1WFQ A;  5LMU Q;  2ZJQ A;  1JJ2 A;  4DR7 L;  2UU9 L;  2Y0S E;  3S1Q H;  1IBM Q;  4DKA C;  3CCL A;  4C3H H;  2R92 H;  3UDF A;  4BBR H;  4JG2 A;  1ASY A;  1E3P A;  2N3S A;  2E2J H;  1VQN A;  2UXB Q;  3CCR A;  2UXC Q;  4BY7 G;  1E1O A;  1V9P A;  3PF5 A;  5JEA J;  5ELO A;  4BXX H;  1EFW A;  2JK8 A;  5LMN Q;  2MO1 A;  3CC4 A;  1HZC A;  1QUQ A;  4A3M G;  3HOZ H;  4PZ8 A;  2CWA A;  4DV0 L;  1CKN A;  4DR1 L;  4FDB A;  4DV5 Q;  3U4Z A;  1EOV A;  4A3I H;  1XMO L;  3E9I A;  3HFZ B;  3ULL A;  4A3F H;  1VQ5 A;  2IHF A;  1L1O C;  3HKZ E;  5IYC G;  1LUZ A;  1XNR Q;  5M5Y H;  4A3M H;  5IYB H;  1TWF H;  5C44 G;  4JI3 Q;  2E5L Q;  1NTG A;  2VQF L;  2YTV A;  4QY7 A;  4NB3 A;  4DAY B;  2OWO A;  5JJK A;  2CKZ B;  4X66 L;  5IWA Q;  3F2D A;  4JV5 Q;  2JA9 A;  3F1Z A;  1HH2 P;  3I7F A;  2WP8 J;  5M3F H;  5IY0 A;  4C2M H;  4JYA L;  1KXL A;  2RCN A;  3CP0 A;  4P71 A;  4LFC L;  4JI2 Q;  1VQ6 A;  3GTM H;  5BR8 Q;  1TWH H;  2Y0S G;  4BY1 G;  4X62 Q;  1IYJ B;  3ULP A;  4JI8 L;  2EIF A;  1G29 1;  2VZA A;  3S1M H;  4JI0 L;  1IBK Q;  4LUV A;  1X56 A;  3FKI H;  1QUQ B;  2IX0 A;  1VQ7 A;  2HQL A;  1XNQ Q;  4JI1 Q;  1CKO A;  3A0J A;  1YNX A;  1KRT A;  4B3T L;  2K4K A;  4J15 A;  4O0A A;  4YWK A;  3W1G A;  4HJ5 A;  2WB1 G;  4JC0 A;  3PIO A;  2LXJ A;  1HNX Q;  1PHJ A;  1SN8 A;  3CCS A;  2EXD A;  2R7D A;  5JJL A;  4NXM Q;  4YHH Q;  4GNX B;  1WOC A;  1C0A A;  3RLF A;  1Q1B A;  2PI2 A;  1YI2 A;  1AE3 A;  1V43 A;  2NVT H;  4BY7 H;  2MFI A;  3K80 C;  4LF4 L;  1HZA A;  1Z47 A;  4JBJ A;  3OTO L;  2HIX A;  2GN5 A;  4L5R C;  1GVP A;  2I5H A;  2VNU D;  2UU9 Q;  3M9B A;  1K83 H;  1TWC H;  2UUA L;  1YJ9 A;  1CSQ A;  4BBR G;  4HJ7 A;  2UXB L;  1N36 L;  1IBL Q;  1GKH A;  1FJG L;  4HIO A;  5IP7 G;  3J81 c;  4JBM A;  3B6Y A;  3UE0 A;  3UDX A;  4GN3 B;  5LMN W;  2NVX H;  4B3M Q;  4DR5 Q;  4GLX A;  1V1Q A;  4O2D A;  5FLX c;  4AYB E;  4ALP A;  1XJV A;  4HID A;  1UEB A;  2CCZ A;  2B3G A;  3AEV A;  4OO1 G;  4DV5 L;  2MO0 A;  3W1B A;  1XTD A;  4GNX C;  2JEA I;  1XNR L;  3K7A H;  4A4I A;  1TXY A;  1N32 Q;  2N49 A;  1XPU A;  5FJ8 G;  3RNU A;  1VQL A;  1FGU A;  2MQH A;  1BVS A;  4QIW E;  3STB C;  2JA6 G;  1X3G A;  2IT1 A;  5IWA L;  1GD7 A;  5M3M H;  1YIT A;  4JV5 L;  2JA8 G;  1XPR A;  3K8A A;  3D0F A;  1C7Y A;  3S15 H;  4LF5 Q;  3TEH B;  2PMZ E;  1YZ6 A;  3W5O A;  3PF4 A;  4OO1 I;  3TS0 A;  1I6H H;  2KEN A;  1NJI C;  2R93 G;  4A3J H;  3NEM A;  3S24 A;  1Q7Y C;  3FHW A;  4DR4 L;  3H0G H;  1KC8 C;  3E9H A;  1I94 Q;  4A93 G;  1J6Q A;  3K81 C;  1PYS B;  3I56 A;  4B3R Q;  3HOV G;  2JA5 H;  3L2P A;  1UE6 A;  4HIK A;  2H5X A;  1OXX K;  2PI2 E;  3GTJ H;  4PZ6 A;  2FXQ A;  2N78 A;  4A3F G;  3KDF A;  1S3O A;  2K50 A;  2NZH A;  5M3M G;  2KCT A;  4GKK Q;  3BU2 A;  1QVF A;  5C3E G;  2YYZ A;  4DNI A;  3RR5 A;  2AMC B;  4A75 A;  3T1Y Q;  2YTY A;  4X65 L;  4JI7 Q;  3HOZ G;  1X3E A;  2DGY A;  2IHE A;  2R6G A;  2NN6 G;  4JOI A;  4RMF A;  1SRO A;  3I4M G;  3S16 H;  2V1C C;  3T1H L;  3ZJY C;  1Y1V G;  3OTO Q;  2A1A A;  2K75 A;  1LTL A;  2Z0S A;  2UUA Q;  3HKS A;  3CCJ A;  3L7Z C;  1HR0 W;  3HOW H;  3DLL A;  1K9M C;  2R7F A;  2ES2 A;  3I4N G;  1SFO H;  4P73 A;  5ELN A;  1J5E L;  2ZJR A;  1D8L A;  4KHP Q;  1OXU A;  2CWP A;  3H0G G;  3CC7 A;  2Q2I A;  4A3L G;  2AWN A;  1VQF A;  1N8R C;  3I4N H;  2BA0 A;  3CXC A;  1MJE A;  3IRB A;  5C0X G;  3CMA A;  5HY6 A;  4RG1 A;  4AYB G;  4OX9 Q;  1YHQ A;  4HJA A;  3CPW A;  4DR2 Q;  4GKJ L;  1P8L A;  2QGQ A;  4BBS H;  2JA6 H;  4LF8 Q;  1SR3 A;  3AFP A;  3CD6 A;  4IFD I;  3BZC A;  2N8N A;  5IYD G;  3G6E A;  2QEX A;  1RIP A;  1FVI A;  1VQE A;  1HR0 Q;  2E2H H;  4JI6 Q;  2JQO A;  2LSS A;  3F8T A;  2BA1 A;  4DK6 C;  3CME A;  3KDF B;  4LF5 L;  2OCE A;  2F4V L;  3PIP A;  3A5Z B;  1W2B A;  4DUY Q;  2OTL A;  3PGZ A;  5LMU L;  4DR7 Q;  1WCM G;  1MJC A;  3A74 A;  3RLN A;  1BBU A;  3I2Z A;  1I94 L;  1N33 Q;  2ATW A;  2HHH Q;  1IBM L;  4A93 H;  4B3R L;  3CF5 A;  3HOV H;  5DLQ E;  3ERS X;  3PUZ A;  2AWO A;  3CCV A;  2ZM6 Q;  1PH3 A;  4DV6 L;  4A3K G;  4P75 A;  3G71 A;  4DV2 L;  4IOC A;  4GKK L;  2OTJ A;  4KI0 A;  3CW2 C;  4A3G G;  4DR1 Q;  2A19 A;  4IPC A;  1YIJ A;  3L0O A;  4JI7 L;  1PVO A;  4IFD J;  3VDY A;  1B8A A;  2GVB A;  1VQ8 A;  1UWV A;  2XGT A;  2K5N A;  4YY3 L;  4GS3 A;  4K0K Q;  1NMF A;  4POG A;  5C44 H;  1I50 H;  2UUC Q;  2VQF Q;  1OTC A;  2A8V A;  2L15 A;  1VQI A;  2K14 A;  3WWV A;  4LFA Q;  2VW9 A;  2UUB Q;  3TS2 A;  4C3J H;  5C4X G;  1W3S A;  4GOP B;  1PH6 A;  3MXN B;  1Z9F A;  5GQO A;  1JJG A;  4OWX B;  4GNX A;  3F2C A;  4A3C H;  4LFC Q;  4LF6 L;  4Y52 H;  3GTP H;  4X62 L;  4A3G H;  4R4O A;  4DR3 L;  3SGI A;  4JI5 Q;  1E24 A;  3GD7 A;  4JI8 Q;  1WYD A;  3UE1 A;  1GM5 A;  1Q1E A;  3GTL H;  4OX9 L;  3K7U C;  2VQE Q;  5IP7 H;  4KHZ A;  5GRO A;  1IL2 A;  3KLW A;  3HOX G;  3EN2 A;  1XNQ L;  3CAM A;  4DR2 L;  4LF9 L;  3S14 H;  4A3D G;  4DR6 Q;  4A3B H;  2VY3 A;  4IPG A;  4IJH A;  3CC2 A;  1E1T A;  4GLA C;  1A62 A;  2PNH A;  4IO9 A;  5C4J H;  1X9N A;  4C3I H;  1HNX L;  1WCM H;  3KJO A;  1X3F A;  1HR0 L;  1A8V A;  1VQG A;  3RN5 A;  4A3C G;  2Q2H A;  1ASZ A;  1X55 A;  4R4Q A;  4UPA A;  3KF8 B;  5HGQ A;  1B70 B;  1X65 A;  2KHI A;  2WAQ E;  3CPF A;  4LF4 Q;  1A63 A;  1JJC B;  1Q12 A;  5C0X J;  4DUZ L;  3TRE A;  4LF7 Q;  2D0O A;  4BBS G;  2NN6 I;  1IBL L;  5M5X H;  1CKM A;  1YVC A;  2JE6 I;  1HZB A;  4DV3 Q;  4OXP A;  2ZM6 L;  3PV0 A;  1HJP A;  5IP9 G;  1EUJ A;  1Q82 C;  5AJ3 Q;  4B3M L;  4NXN Q;  3AYH B;  3AQQ A;  3ER0 A;  2E2I H;  1M90 C;  1VS0 A;  2KBN A;  5EAY A;  1IZ6 A;  3RZD H;  1XMQ L;  1PH2 A;  1KIX A;  1HNZ L;  1JB7 A;  4BA2 I;  3GO5 A;  3CCE A;  4QQB X;  4K0K L;  2UUC L;  3JC6 6;  3HOW G;  3NEN A;  1QZG A;  3PO2 H;  2ALY B;  5C4X H;  1CKN B;  2RHS B;  5IYC H;  3DM3 A;  2JA8 H;  3S2D H;  4DPG A;  3RZO H;  1N34 Q;  2B29 A;  1L1O A;  1PH4 A;  1TWG H;  4LF6 Q;  2CQO A;  3KYH C;  3HOU H;  1MIU A;  5IT9 c;  4DR3 Q;  4JI5 L;  2OQ0 A;  2DUD A;  2VL6 A;  5C3E H;  1GO3 E;  2F52 A;  4YWM A;  1PA6 A;  1BBW A;  1Y1W H;  2ZTE A;  3J81 j;  4A3E G;  1E7Z A;  2VQE L;  1MKH A;  1QZH A;  1SE8 A;  1VQJ A;  2ZTC A;  4ME3 A;  4LF9 Q;  2JA5 G;  5GAG C;  1D7Q A;  2KCM A;  1EIY B;  1YBY A;  3GDE A;  2AHO B;  4LFB Q;  4LW1 A;  4POF A;  4WJ3 M;  4XIG S;  3J7Z C;  3ICE A;  4TVA B;  1OXT A;  1SRU A;  3STB D;  1OXS C;  4X65 Q;  4DV1 L;  3JAM i;  1VQP A;  1VQA A;  3HKZ G;  4LWC A;  4MZ9 A;  3H15 A;  1Y1W G;  4HIM A;  1Y1V H;  1HNW L;  2AKW B;  1YHB A;  4PMW A;  4APV A;  5IP9 H;  5FLM G;  4EX5 A;  2NVQ H;  3ULJ A;  3NBH B;  4JCV E;  1PH7 A;  1S40 A;  1BKB A;  1L1O B;  1YJW A;  2UXC L;  4LUO A;  5H1S E;  4DV3 L;  2R7Z G;  1L0W A;  3TQY A;  4TQU S;  3M3Y H;  4GLV B;  1YHA A;  5AJ3 L;  4IFD G;  5LMN L;  4KHP L;  4IJL A;  5GAH C;  3PUW A;  4AH6 A;  4DAM A;  4DV0 Q;  2RF4 A;  3S1N H;  1XMO Q;  2LXK A;  4OWT B;  2ZJP A;  3KFU A;  3S17 H;  2ASB A;  1Q86 C;  1VQD A;  1KL9 A;  2IX1 A;  3PUV A;  4GKJ Q;  4BY1 H;  4UP8 A;  1U0L A;  3A5U A;  3M4O H;  2VUM G;  1Q81 C;  5K36 G;  3H3V H;  4JYA Q;  3K0X A;  1N9W A;  4OON A;  4X64 L;  4JI6 L;  4DV4 Q;  3M4P A;  5IE8 A;  1VQM A;  5FJ8 H;  2NZO A;  3UDI A;  5BR8 L;  4DV7 Q;  3GTK H;  3HOY H;  1P16 A;  4DUY L;  1PH8 A;  1RL2 A;  2OQK A;  3I4M H;  5IYB G;  4MNO A;  3BJU A;  2BH2 A;  2D62 A;  4LUZ A;  1C9O A;  1WI5 A;  1N33 L;  2HHH L;  1S72 A;  1UE7 A;  3PO2 G;  3PUY A;  4JI1 L;  1K8A C;  2XTI A;  2YV5 A;  4PZ7 A;  1EWI A;  1JT8 A;  2JJQ A;  2I0Q A;  4UP7 A;  1YJN A;  1Q46 A;  4DV6 Q;  2Q2U A;  4BXX G;  3KOJ A;  2CFM A;  2WFW A;  4DV2 Q;  4B3S Q;  1E22 A;  1O7I A;  4A3D H;  3EBE A;  1U5K A;  2UXD L;  2Z6K C;  1K0R A;  2PQA A;  4DV1 Q;  3AFQ A;  3HOX H;  4DK3 C;  2MNA A;  1I3Q H;  4QL5 A;  2B63 G;  4Y7N H;  1K8G A;  4R4C A;  4AIM A;  4HJ9 A;  3MEF A;  5M3F G;  2KHJ A;  1KRS A;  4R4T A;  4YY3 Q;  1KD1 C;  3CCQ A;  3H3V I;  3J80 i;  4QJF A;  4IOA A;  2UUB L;  4LFA L;  1N36 Q;  2YU9 H;  1XPO A;  1FJG Q;  1EYG A;  3LGJ A;  4R4I A;  2E8G A;  3CCM A;  1PV4 A;  1EIF A;  1LYL A;  3I4O A;  4DR5 L;  1IXR A;  3NEL A;  4QGU A;  3OYY A;  4KLK A;  3Q8D A;  1VQC A;  2ID0 A;  3KF6 B;  4IPH A;  4A76 A;  3KJP A;  1EQR A;  1OXV A;  4AQY Q;  1PH5 A;  2K5H A;  3S1R H;  1FL0 A;  4P74 A;  1NBW A;  1VQ9 A;  3GTG H;  3G48 A;  1JE5 A;  3EIV A;  4BA1 I;  2K52 A;  1VQ4 A;  1EQQ A;  1G51 A;  3PCO B;  4GOP C;  3FKI G;  4JI4 Q;  1R9T H;  3GTQ H;  1N32 L;  3OW2 A;  4UY8 C;  4WJ4 A;  4DR6 L;  5GAD C;  4YCW A;  4R1J A;  2VUM H;  1NE3 A;  2PQA B;  4X6A H;  4X64 Q;  2B63 H;  4DV4 L;  1TWA H;  2JEB I;  2VS1 A;  4GN5 A;  1QVC A;  1M1K C;  3GTO H;  4GOP A;  5M5W H;  4DV7 L;  2EQS A;  2K5V A;  3UDG A;  4L5S A;  1G6P A;  5JEA G;  4OWW B;  1H95 A;  4L5T A;  3M4Q A;  4DUZ Q;  4A3E H;  1VCI A;  3PO3 G;  4GN4 B;  4DR4 Q;  4P72 A;  4A3I G;  4XTC S;  3M85 A;  1YEZ A;  4LF7 L;  1KAW A;  4HJ8 A;  2QA4 A;  3HOU G;  1L2F A;  1PH1 A;  5IYD H;  4UP9 A;  4JOI C;  2ZTD A;  3BZK A;  1PH9 A;  1QVG A;  3J7A 5;  4B3S L;  4NXN L;  3HOY G;  2WAQ G;  4PG3 A;  1B7Y B;  1K3R A;  3JAM c;  3PUX A;  2R92 G;  1PFS A;  2UXD Q;  1CSP A;  1KHI A;  1SMX A;  3T1Y L;  4YCV A;  1X6O A;  3T1H Q;  4A3K H;  1XMQ Q;  3S2H H;  1HNZ Q;  2I5L X;  3PO3 H;  2HIV A;  2Z6K A;  4JI3 L;  4EQ5 A;  3J80 c;  2E5L L;  4LNQ A;  1NY4 A;  4A3L H;  1VQH A;  1AE2 A;  3E0E A;  2HT1 A;  1HZ9 A;  4X66 Q;  4A3J G;  2R93 H;  1AH9 A;  1VQO A;  2D0P A; 
#chains in the Genus database with same CATH topology
 2JA7 H;  3F2B A;  1PFM A;  5J3B A;  3I55 A;  1T9H A;  3R8B A;  2TMP A;  1WJJ A;  3N6R A;  2F0J A;  2YTX A;  3KF6 A;  1K73 C;  3U50 C;  2B8G A;  3D31 A;  3TRZ A;  1Y14 B;  3KF8 A;  5E7N A;  2I5M X;  3MHB A;  1QCB D;  1BR9 A;  5FLM H;  1I5F A;  2IY5 B;  1PTO D;  1DGS A;  2DN8 A;  2M9V A;  2JA5 B;  1EU3 A;  1NMG A;  4LF8 L;  4IPD A;  4YWL A;  4XYO A;  5E4X A;  5JJI A;  1XX8 A;  3FP9 A;  3G4S A;  3GTK B;  1Q90 A;  4MTK A;  1RJT A;  1STN A;  3CQZ H;  2ZJQ A;  3VR3 A;  1AP0 A;  1A3T A;  4KN7 C;  4DKA C;  3CCL A;  2L55 A;  1EIH A;  2R92 H;  3UDF A;  4BBR H;  4JG2 A;  2E2J H;  2N3S A;  2EDG A;  2UXB Q;  5COR A;  1A2U A;  2O5I C;  2SEB D;  3PIO 3;  4K6L A;  2EVB A;  1SYB A;  1SE4 A;  3CC4 A;  4K5V A;  1LT3 D;  3HOX B;  2CWA A;  4DR1 L;  4FDB A;  4DV5 Q;  3HFZ B;  1VQ5 A;  2IHF A;  4IUT A;  3HKZ E;  5IYC G;  3J80 L;  5M5Y H;  4A3M H;  2CW0 C;  3VA5 A;  2CQA A;  4DAY B;  2QF7 A;  1BCP D;  2QW7 A;  3F2D A;  4JYA L;  1HH2 P;  2RCN A;  2I46 A;  1VQ6 A;  3GTM H;  5BR8 Q;  1TWH H;  4X62 Q;  4MHE A;  5DEH A;  2VZA A;  3S1M H;  1LAC A;  2B2U A;  3KK7 A;  4JI0 L;  3GTG B;  1WD0 A;  1X56 A;  1SYD A;  1QUQ B;  2IX0 A;  3NUC A;  1R9T B;  4R8N A;  1CKO A;  1O7L A;  1YNX A;  2K4K A;  4YWK A;  2WB1 G;  3PIO A;  2O4X A;  2EXD A;  2R7D A;  4NXM Q;  4C3H B;  4YHH Q;  4GNX B;  4R9W A;  3VR6 A;  4FF3 A;  1YI2 A;  2PI2 A;  2NVT H;  3K80 C;  4LF4 L;  1HZA A;  1Z47 A;  2GN5 A;  3MXP A;  3NE5 B;  3M9B A;  1K83 H;  1TWC H;  3LX0 A;  2UUA L;  1CSQ A;  2ENB A;  3MXG A;  3OSO A;  3B6Y A;  4DR5 Q;  5FLX c;  2CCZ A;  3HOW B;  2B3G A;  2LY7 A;  3S2H B;  1JOK A;  4XT1 B;  1XNR L;  3K7A H;  1HTL D;  1E0B A;  2NN6 H;  3PMF A;  1WTH A;  1VQL A;  1FGU A;  5IWA L;  4JV5 L;  2JA7 B;  2JA8 G;  2F3W A;  3BYY B;  3GV6 A;  4LF5 Q;  3TEH B;  5IIF A;  3ERO A;  2RQX A;  3FHW A;  1H9J A;  3E9H A;  4A93 G;  1J6Q A;  1PYS B;  1PFB A;  2JA5 H;  2OF1 A;  1CI3 M;  3NXW A;  3L2P A;  1U4L A;  2H5X A;  1OXX K;  3WOE A;  5M5X B;  5KRU A;  5M3M G;  2K50 A;  1HCZ A;  1QVF A;  3BDC A;  2AMC B;  4X3T A;  2YTY A;  2CH4 A;  2N88 A;  1HHV A;  3SK6 A;  3EFX D;  3OTO Q;  2A1A A;  5FKA C;  2AQ2 B;  1F9R A;  3CCJ A;  3L7Z C;  1FNV A;  1K9M C;  1Z6H A;  2R7F A;  2ES2 A;  3I4N G;  2F4I A;  5ELN A;  4EVO A;  4CJ0 B;  2EY1 A;  2K05 A;  1TWG B;  5CV6 A;  4A3L G;  1VQF A;  5E3F A;  1N8R C;  1WTX A;  3IRB A;  5C0X G;  3CMA A;  1XWE A;  1YHQ A;  2AUJ D;  3CPW A;  3IFT A;  3V05 A;  1EZ6 A;  4U67 3;  1K28 A;  3Q22 A;  4RGT A;  3H6M A;  3OW7 A;  3CRK C;  3CME A;  3VYU A;  3KDF B;  3VR4 A;  2OCE A;  4ME5 A;  4DUY Q;  3PGZ A;  4RWS C;  3SDZ A;  1WCM B;  1G2T A;  1YNN D;  3I2Z A;  1I94 L;  1RD9 D;  2GA4 B;  4X3S A;  4CBV A;  4HAE A;  3HOV H;  1RTN A;  1I4P A;  4CDC C;  4DV6 L;  4P75 A;  2LMC B;  4DV2 L;  4GKK L;  5A35 A;  1TY0 A;  3FMC A;  4DR1 Q;  1YIJ A;  4DNR B;  1PVO A;  1SYF A;  1B8A A;  2FHT A;  4J1M A;  1SE3 A;  2K5N A;  4FXD A;  4GS3 A;  1K83 B;  1M4V A;  5FOB B;  5C44 H;  1STG A;  3W2D A;  1VQI A;  2UUB Q;  4RH6 A;  5BN3 A;  4GOP B;  3MTS A;  3I91 A;  1PH6 A;  1Z9F A;  4CDE C;  4LFC Q;  2B2V A;  1ZYR C;  3ND8 A;  4Y52 H;  4X62 L;  1VF7 A;  1E24 A;  5C4X B;  5JJZ A;  2JA6 B;  2WKD A;  3GP7 A;  4OX9 L;  3K7U C;  1S5D D;  1IL2 A;  3KLW A;  3CAM A;  4ZCK A;  4IPG A;  1I4R A;  2RCF A;  3CC2 A;  1E1T A;  4GLA C;  4IO9 A;  1HNX L;  1GUT A;  2R61 A;  1VQG A;  3KF8 B;  2F0Q A;  5HGQ A;  1GHJ A;  1X65 A;  4I7Z C;  1PFN A;  4RKL A;  4LF4 Q;  2V4D A;  2RSN A;  2EYM A;  4ZKB B;  3A56 A;  1L0X B;  2F0P A;  5M5X H;  3NK9 A;  3E5S A;  3PV0 A;  1HJP A;  3FRP B;  2NVQ B;  4B3M L;  4B9W A;  5TSS A;  3GV3 A;  2L1B A;  2XVS A;  1NR4 A;  1I50 B;  1M90 C;  1PZI D;  3P1H A;  1JB7 A;  4BA2 I;  3L9A X;  2UUC L;  2WAC A;  1KNA A;  3GTQ B;  5CV4 A;  1MBY A;  2VUM B;  3DM3 A;  2JA8 H;  1WTP A;  1N34 Q;  1ZEQ X;  1TWG H;  2CQO A;  3KYH C;  3FEW X;  3HOU H;  5IT9 c;  2PZU A;  2DUD A;  5C3E H;  3S14 B;  2K7V A;  1EY9 A;  2F52 A;  3MC0 B;  2RVL A;  4YWM A;  3Q23 A;  2XNA C;  1VQJ A;  2ZTC A;  4H7B A;  2VB2 X;  4HMI A;  2WV6 D;  3HOY B;  5C0X H;  4LFB Q;  4POF A;  4WJ3 M;  3J7Z C;  3IL8 A;  3BVZ A;  1FD7 D;  1Q8I A;  2E76 C;  3CHB D;  1OXS C;  4G7H C;  1VQP A;  4KY6 A;  1VQA A;  3HKZ B;  3DXJ C;  3H15 A;  4QF4 A;  4HIM A;  2AKW B;  3MA2 B;  3R3O A;  1D5Z C;  3E6Z X;  5COY A;  3NBH B;  4JCV E;  1V1P B;  4LUO A;  4IUR A;  3TP8 A;  3KUP A;  4WFN 3;  4GLV B;  5AJ3 L;  3RD4 A;  4IJL A;  5GAH C;  4DV0 Q;  3BYT B;  2K32 A;  4RCN A;  1X32 A;  3S17 H;  2Z8L A;  3IFD A;  4WJW A;  1U9R A;  2G9D A;  1ML0 D;  1EYC A;  3M4O H;  5K36 G;  3H3V H;  5D14 A;  4X64 L;  1Y1W B;  4DV4 Q;  2KCN A;  5IE8 A;  4HCS A;  3UDI A;  4DV7 Q;  1P16 A;  2HDM A;  5DNF A;  4DUY L;  1PH8 A;  1TS5 A;  5CR3 A;  2F0U A;  1LT5 D;  1N33 L;  1PTO C;  3NQI A;  2DY8 A;  5T1G A;  2XTI A;  3SK8 A;  4XYQ A;  1HPC A;  2JJQ A;  1CM9 A;  2PMZ B;  2OXP A;  4B3S Q;  5G3L F;  1EWH A;  2UXD L;  5I4D A;  2Z6K C;  4DV1 Q;  3FPU B;  2B63 G;  1K8G A;  4R4C A;  4HJ9 A;  4H44 C;  3MEF A;  5M3F G;  4A3F B;  1GUG A;  3VYR A;  3CCQ A;  3KBG A;  3H3V I;  3J80 i;  3F2U A;  2UUB L;  4ABN A;  1QG7 A;  4R4I A;  1O78 A;  3QO2 A;  1KDC A;  2KJX A;  4QGU A;  4PNY A;  2ID0 A;  4A76 A;  5DM7 3;  1EQR A;  3J81 E;  2A73 B;  1VMC A;  1JE5 A;  1EEI D;  1NSN S;  2X69 A;  4BA1 I;  4FXK C;  1VQ4 A;  3PCO B;  3GTQ H;  5J22 A;  4Q5V A;  1BXT A;  4MIU A;  1MI2 A;  4WJ4 A;  2VUM H;  2B2U C;  2O5J C;  2JA8 B;  3HRZ C;  4E6I A;  2B63 H;  2JEB I;  4K5X A;  3SE0 A;  1QVC A;  1SEB D;  4GOP A;  1JWS D;  2K5V A;  3UDG A;  4L5S A;  1G6P A;  3K58 A;  4HTH A;  4A3E H;  1VCI A;  5E1F A;  4DR4 Q;  4XTC S;  1YEZ A;  1Z7T A;  4A3D B;  3CQZ B;  2K33 A;  1UUP A;  1L2F A;  1TII D;  4JOI C;  5EGT A;  1SJE D;  4N9P A;  1TS3 A;  2NUC A;  5C3W A;  1K3R A;  3JAM c;  1RHP A;  1ENF A;  2YU9 B;  1F2Z A;  4IUU A;  4A3K H;  2I5L X;  2Z6K A;  4JI3 L;  3J80 c;  2EYO A;  2L11 A;  3P75 A;  1B9N A;  1AE2 A;  2K5Q A;  4A3J G;  5CV5 A;  1GUN A;  2IWH A;  3K59 A;  1VQO A;  5M5Y B;  2WB1 B;  1WTV A;  1PYB A;  1J5E Q;  3C1E A;  3T4A C;  1WD1 A;  4FVM A;  1UE1 A;  3U58 A;  1ESR A;  3J81 L;  5GAE C;  1LM0 A;  4JI0 Q;  3NTH A;  1IBK L;  1A15 A;  4ZLT F;  1TWH B;  2F3I A;  2BH8 A;  1PMR A;  3M4O B;  2JA7 G;  3EJI A;  4LFB L;  1KQS A;  1DON A;  4OEL B;  5D65 A;  2EY6 A;  2Q8I B;  4YHH L;  1CUK A;  1PRT B;  3D3R A;  2A69 C;  3PQI A;  3J81 i;  2Q2T A;  1HNW Q;  5LMU Q;  4DR7 L;  1JJ2 A;  1EQT A;  1JOQ A;  3S1Q H;  2Y0S E;  1IBM Q;  3OIQ A;  4C3H H;  2QKI C;  3CCR A;  4HN7 A;  4K2K A;  1EEF D;  5JEA J;  1G6Z A;  4BXX H;  2R3Z A;  2CW0 D;  1EFW A;  2JK8 A;  2MO1 A;  1QUQ A;  1CKN A;  2F3V A;  3U4Z A;  4NDX A;  4A3F H;  1L1O C;  1LUZ A;  3R2T A;  5IYB H;  1NTG A;  3J7A F;  2VQF L;  1BNZ A;  4V19 0;  4M1U B;  4QY7 A;  4NB3 A;  2OWO A;  5JJK A;  1LO5 D;  2R7Z B;  4X66 L;  4O42 A;  2NVY B;  2WP8 J;  5IY0 A;  5M3F H;  1Y8O B;  3BS1 A;  5IT9 L;  3I73 A;  4P71 A;  3ULP A;  3MVV A;  1DOL A;  3LNN A;  4JI8 L;  3VYS A;  1XXG A;  1EY0 A;  3FDT A;  4LUV A;  5KGU A;  2HQL A;  4RGO S;  2HCC A;  1XNQ Q;  1KRT A;  5KNB A;  4J15 A;  4O0A A;  2K5W A;  4RCO A;  4IFD H;  3C3L A;  5EKL A;  1LAB A;  1WOC A;  2E75 C;  4OEM B;  4A3E B;  3URY A;  3OTO L;  4JBJ A;  2HIX A;  2UU9 Q;  4NMZ A;  3ERQ A;  1YJ9 A;  2UXB L;  1T5X D;  1GKH A;  4HIO A;  1F9P A;  3UDX A;  4GN3 B;  1CHP D;  4O2D A;  1U4M A;  4AYB E;  3HG9 A;  4OO1 G;  3NTI A;  4DV5 L;  2MO0 A;  4YIJ A;  2MUY A;  1XTD A;  5I6Y A;  4XDX A;  2J7Z A;  1S5B D;  3FPP A;  1BVS A;  3STB C;  1EY7 A;  1FYC A;  1PRT C;  4C3I B;  3D0F A;  1FNW A;  2PMZ E;  3G7L A;  4OO1 I;  5C6A A;  3TS0 A;  4C3H G;  1I6H H;  2KEN A;  1NJI C;  4PQX A;  1PTO F;  4DR4 L;  2DNE A;  1I94 Q;  4CGY B;  4TSS A;  3K5N A;  1TQO A;  5EPK A;  3HOV G;  4HIK A;  2Z4I A;  1KTK A;  1H9M A;  1PRT D;  4PZ6 A;  2FXQ A;  3VYT A;  3Q6S A;  3KDF A;  1S3O A;  5J39 A;  3BU2 A;  5C3E G;  3HOV B;  3T1Y Q;  3HOZ G;  2MJ8 A;  4JOI A;  3N52 A;  3ZJY C;  1Y1V G;  3IAY A;  1EY4 A;  2NVX B;  1LTL A;  2CVR A;  2Z0S A;  3J7Y W;  2UUA Q;  3HKS A;  5IGB A;  3DLL A;  5ISR A;  4ZRZ A;  3K5O A;  4P73 A;  5C44 B;  4DN4 M;  4ZQ3 A;  3H0G G;  4K5W A;  5ELD A;  3CXC A;  4KV6 A;  5HY6 A;  5M3M B;  3TZU A;  1L0Y B;  3S15 B;  4DF7 A;  4CJ1 B;  2JA6 H;  3NP8 A;  3MEH A;  3BZC A;  1A6X A;  2QEX A;  3G6J B;  3TP7 A;  3I90 A;  2JQO A;  4DK6 C;  3F8T A;  2BA1 A;  4LF5 L;  1YNJ C;  2F4V L;  2QDB A;  5LMU L;  4DR7 Q;  1MJC A;  2ATW A;  4XQQ A;  2HHH Q;  1IBM L;  4KKT A;  1S5C D;  3ERS X;  2AWO A;  4ZKC B;  2ZM6 Q;  1ZXT A;  1PH3 A;  4UAI A;  1IW7 C;  5CMD A;  1HA5 A;  5I6W A;  4RFB A;  3CW2 C;  4A3G G;  3VDY A;  4AYB B;  4CKE A;  1VQ8 A;  2XGT A;  1FR3 A;  3ONA B;  4KD3 A;  3O13 A;  4TKO B;  5I9O A;  4POG A;  2UUC Q;  1I50 H;  2VQF Q;  2A8V A;  2L15 A;  3A8I E;  3WWV A;  2FMM A;  1SNO A;  1KNE A;  2VW9 A;  3TS2 A;  4C3J H;  5EBC A;  5I2X A;  5M9O A;  2G9H D;  2L9H A;  2F0E A;  1X3Q A;  2WIN B;  3D6C A;  4OWX B;  4GNX A;  3F2C A;  1ICW A;  1JB3 A;  3GTP H;  2F0M A;  4A3G H;  4R4O A;  4JI5 Q;  4C1N K;  2AQ3 B;  5GRO A;  2J0T D;  2E2H B;  1XNQ L;  5C3E B;  3S14 H;  4DR6 Q;  4A3D G;  2VY3 A;  1SBB B;  1X9N A;  2PNH A;  4C3I H;  2IJ0 A;  1X3F A;  1ROD A;  1STB A;  2ICI A;  1BF4 A;  1X55 A;  5FLX L;  5IGC A;  1CHQ D;  2KHI A;  2WAQ E;  4IN3 A;  3BDL A;  1JJC B;  4DUZ L;  4LF7 Q;  3NWT A;  3TZD A;  2SOB A;  2OEO A;  1IBL L;  1CKM A;  1YVC A;  3JAM L;  1HZB A;  1II3 A;  4OXP A;  2O2L D;  5IP9 G;  1MSG A;  5AJ3 Q;  1R4P B;  3A8J E;  2D5D A;  4NXN Q;  4F8M A;  3AYH B;  3AQQ A;  2XIW A;  3KLS X;  1HUN A;  5JPM C;  1V1O A;  1XYI A;  5IGD A;  3RZD H;  2BOS A;  3NHH A;  1PH2 A;  3CCE A;  1BCP F;  2RBM A;  5CV9 A;  1IKL A;  4I65 A;  1PYW D;  1CT1 D;  2RHS B;  5IYC H;  3S2D H;  2B29 A;  1F2L A;  5C4H A;  1L1O A;  3H3V C;  3CRL C;  4LF6 Q;  2HCI A;  3PIP 3;  4DR3 Q;  5EPJ A;  2OQ0 A;  3SR1 A;  1VMP A;  2E2D C;  3VR2 A;  1Y1W H;  5C4J B;  4A3E G;  1B9M A;  1QJO A;  2PQE A;  1ICF B;  1O7Z A;  1JOR A;  1J8I A;  5KIX A;  2F03 A;  2I07 B;  1C4Q A;  3ICE A;  2PW5 A;  1OXT A;  1SRU A;  3STB D;  3V96 A;  1SSO A;  4U68 A;  1ZKO A;  4DAY A;  1IL8 A;  1Y1W G;  2PCF B;  1BKB A;  1L1O B;  1YJW A;  2CH4 W;  2UXC L;  2R7Z G;  2F0T A;  5C3X A;  4DV3 L;  3TQY A;  4TQU S;  5HGT A;  1YHA A;  1DD2 A;  3PUW A;  4AH6 A;  2K5D A;  5IGE A;  4C1N I;  4LMQ D;  4G7O C;  5I9P A;  4HED A;  2QIL A;  1VQD A;  1Q86 C;  4C3I G;  1QOH A;  1I4X A;  1LTB D;  3NPP A;  3PUV A;  4BY1 H;  4C3J B;  4UP8 A;  2B2Y C;  3K0X A;  1N9W A;  1F77 A;  4OON A;  3LWE A;  4JI6 L;  3M4P A;  3K6O A;  3U9S A;  2EYP A;  2NZO A;  5BR8 L;  3OIP A;  4KD4 A;  4L6T B;  5IGG A;  2OQK A;  1TT2 A;  4MNO A;  2BH2 A;  2B2V C;  2B63 B;  2EY5 A;  2HHH L;  3PO2 G;  1UE7 A;  2EE1 A;  2F0D A;  3ND9 A;  3NBH A;  4PZ7 A;  5LL6 S;  4PMB A;  5IOD A;  3TN2 A;  1DCZ A;  3QG1 A;  4UP7 A;  4PMC A;  2CFM A;  2WFW A;  4IUQ A;  3HP3 A;  1O7I A;  4A3D H;  1K0R A;  3AFQ A;  2B39 A;  5JPN C;  1I3Q H;  4QL5 A;  2CHB D;  4ILW A;  1TU2 B;  4R4T A;  4RGN A;  2F0V A;  4P2C B;  4LFA L;  4DU9 A;  2YU9 H;  2DJG C;  1FJG Q;  3TSS A;  4A3K B;  1EYG A;  2E8G A;  1LYL A;  2RA4 A;  4DR5 L;  1IXR A;  3NEL A;  1SNP A;  3Q8D A;  2KHS A;  3RZD B;  1RDP D;  2XSC A;  3S1R H;  1FL0 A;  4P74 A;  1VQ9 A;  4FNF A;  3G48 A;  2NTS A;  2K52 A;  3FKI B;  1G51 A;  3FKI G;  1N32 L;  3OW2 A;  5GAD C;  1SNC A;  4YCW A;  2PQA B;  3S2D B;  1H9K A;  4DV4 L;  1TWA H;  2K04 A;  2VS1 A;  1M1K C;  3MZ5 A;  3DUZ A;  1EYD A;  3M4Q A;  1ET6 A;  1B3Q A;  4A3I G;  2C5C A;  4LF7 L;  1KAW A;  1QNU A;  4KJN A;  4HJ8 A;  2QA4 A;  1EL0 A;  1A2T A;  4XXE A;  1BO0 A;  4LAA A;  2ZTD A;  3S1Q B;  3BDO A;  4NXN L;  2WAQ G;  2QDL A;  1YNJ D;  3PUX A;  2B2T C;  2R92 G;  1CSP A;  1SMX A;  3SK4 A;  2DY7 A;  4ZK9 B;  2F0S A;  2F0L A;  1XMQ Q;  3MFY A;  4NP5 A;  4EQ5 A;  4LNQ A;  1NY4 A;  3DMU A;  2E74 C;  3D6W A;  4X66 Q;  2R93 H;  3PO3 G;  1HQR D;  1SDF A;  2A68 C;  4EQN A;  4JI2 L;  3A54 A;  3MXN A;  2R7Z H;  1X54 A;  2NVY H;  4AQY L;  5M3F B;  2BDN A;  1UE5 A;  2B2W A;  3IKJ A;  5NUC A;  3RLO A;  4JI4 L;  4BS9 A;  1ILQ A;  4H02 A;  2OT2 A;  4BY1 B;  4B3T Q;  1JMC A;  1SLJ A;  1KLU D;  2WB1 E;  1LT4 D;  3CCU A;  1DXM A;  1UAP A;  3U4V A;  4NPS A;  3PSI A;  3RN2 A;  1PRT F;  2C35 B;  4JBK A;  1HXY D;  4XQN A;  4IQZ A;  2LKV A;  3WDN A;  5J1Z A;  1WFQ A;  5D3D A;  4J6H A;  3VA7 A;  3BG3 A;  2UU9 L;  3BVG A;  1ZYR D;  1BCP C;  1CK1 A;  2Q8T A;  1VQN A;  3NQT A;  2UXC Q;  3DWP A;  1E1O A;  2A5H A;  1Y8N B;  1SFO B;  1E2W A;  1HZC A;  3OPO A;  2IW3 A;  1I3Q B;  1EOV A;  3ULL A;  3I70 A;  1BUV T;  2B8F A;  4FF4 A;  3QR8 A;  4EQO A;  5C44 G;  4JI3 Q;  2FFK B;  2E5L Q;  3OWE B;  1ET9 A;  1E2Z A;  1CQF A;  3JAM E;  2CKZ B;  4QUF A;  3F1Z A;  3I7F A;  4M8A A;  1KXL A;  1STA A;  5ELC A;  3NWS A;  2PZW A;  4LFC L;  3DWQ A;  2RKS A;  4DK1 A;  1IYJ B;  1DOK A;  2EIF A;  1G29 1;  1EWC A;  1LTT D;  1QNK A;  1IBK Q;  3FKI H;  1VQ7 A;  1TR5 A;  5FLX E;  3A0J A;  1I6H B;  1BBX C;  4DGZ A;  3W1G A;  3DM1 A;  1HNX Q;  1TWA B;  1SN8 A;  2FMC A;  3CCS A;  2HUG A;  5JJL A;  1GUW A;  3RLF A;  1Q1B A;  3K5M A;  4BY7 H;  1A63 A;  2MFI A;  4ZUJ A;  2I5H A;  1EQV A;  5E4W C;  3AU7 A;  1HFG A;  4HJ7 A;  5JVG 3;  1FJG L;  5IP7 G;  4JBM A;  1TS2 A;  4A3I B;  2F0N A;  3A7A B;  5LMN W;  2NVX H;  4B3M Q;  1V1Q A;  4ALP A;  1XJV A;  1HQM C;  4HID A;  1UEB A;  3A55 A;  3AEV A;  2JYO A;  1TKW B;  2MHV A;  4RA8 A;  1GJX A;  4CKC A;  4A4I A;  1TXY A;  5KEE A;  1N32 Q;  2N49 A;  3RNU A;  2L12 A;  4JPB W;  1V1P A;  2KEE A;  2R93 B;  1SE2 A;  2IT1 A;  2Z4H A;  1YIT A;  5M3M H;  1JR0 D;  2K01 A;  1XPR A;  1C7Y A;  3S15 H;  3W5O A;  1ILP A;  2NZ1 D;  2RDH A;  2R93 G;  2KUM A;  3NEM A;  1Q7Y C;  1KC8 C;  3T53 B;  3K81 C;  5D3I B;  3E0J A;  3I56 A;  3J7A V;  5C5M A;  4DFA A;  2L0C A;  3GTJ H;  3QOJ A;  2A69 D;  1YNN C;  2YYZ A;  4A75 A;  3L3O C;  4JI7 Q;  2DGY A;  2NN6 G;  3S16 H;  2R6G A;  1LLR D;  1SRO A;  3T1H L;  2BDO A;  1IYV A;  3P20 A;  4I7A A;  2KQ3 A;  1SFO H;  3TME A;  3RZO B;  1D8L A;  3ITP A;  1OXU A;  3CC7 A;  2Q2I A;  2AWN A;  1W6J A;  1PLF A;  2BA0 A;  1NUC A;  5F2D A;  4NKL A;  2MPM A;  4AYB G;  2XRQ D;  1S5F D;  5EQ0 A;  4IUP A;  4HJA A;  1EU4 A;  3GTP B;  4A3G B;  4KY7 A;  4DR2 Q;  4CJ2 C;  1P8L A;  4NW2 A;  3SHL A;  2QGQ A;  4BBS H;  4LF8 Q;  1SR3 A;  3CD6 A;  1O7Y A;  2N8N A;  3G6E A;  2E2H H;  1FVI A;  1AN8 A;  5CBA E;  3H0G B;  2LSS A;  4G7Z C;  1ESF A;  3J80 E;  1B4O A;  2KCC A;  2VB3 X;  1MSH A;  1W2B A;  2EY2 A;  2OTL A;  1IKM A;  1WCM G;  3FVQ A;  3QIA A;  1N33 Q;  3CKI B;  4B3R L;  3CF5 A;  5DLQ E;  4JVZ A;  3CCV A;  1LTG D;  3R93 A;  2PO4 A;  3AB9 A;  3G71 A;  3M3Y B;  4IOC A;  2OTJ A;  4KI0 A;  2H4O A;  2PZT A;  4BY7 B;  1PTO H;  1QWY A;  2RSO A;  2GVB A;  1UWV A;  3NTK A;  2XWJ B;  4YY3 L;  4DA2 A;  4K0K Q;  3D4R A;  3T13 A;  2EZV A;  1S5E D;  3U9O A;  5C4X G;  3I4N B;  1KAA A;  3MXN B;  5GQO A;  5BN4 A;  1JJG A;  5KND A;  4A3C H;  4LF6 L;  4DR3 L;  3SGI A;  3GD7 A;  1WYD A;  3UE1 A;  2BE5 C;  1Q1E A;  1F9S A;  2VQE Q;  4KHZ A;  2JN4 A;  3HOX G;  3EN2 A;  2F0W A;  4MN3 A;  1JOO A;  3H09 A;  5C4J H;  3KJO A;  1HR0 L;  1A8V A;  3RN5 A;  4A3C G;  1ASZ A;  4R4Q A;  3RMH A;  4UPA A;  1B70 B;  1RCV D;  3CPF A;  3D4D A;  2EYJ A;  4F88 A;  2BCO A;  1AZP A;  3UI2 A;  2JE6 I;  4DV3 Q;  2ZM6 L;  1Q82 C;  1JCK B;  1RTO A;  5I2Y A;  1BOS A;  3ER0 A;  4KK7 A;  2RDG A;  4DNT B;  2KEC A;  1VS0 A;  4DXF A;  1IZ6 A;  2ZXO A;  1HNZ L;  4QQB X;  4DK0 A;  3NEN A;  1QZG A;  1Q3L A;  3PO2 H;  2ALY B;  4JW0 A;  3C46 A;  4PV1 C;  4Z9C B;  3RZO H;  1D1I A;  1PH4 A;  5ELB A;  1STY A;  3SK5 A;  2RDF A;  4JI5 L;  3ZYY X;  3EVQ A;  3OOC A;  2NWG A;  1MKH A;  3HS0 C;  1HFN A;  1JE4 A;  4KHV A;  4B08 A;  1H9R A;  4HSV A;  4LF9 Q;  2JA5 G;  1B50 A;  4IZ8 A;  3DHQ A;  2KCM A;  2Z9H A;  4X3U A;  1EIY B;  1YBY A;  1K0S A;  4EGV A;  2KOL A;  2M00 A;  4RHR A;  2KVM A;  2NYZ D;  3OHX C;  3H91 A;  5JAV A;  3DEP A;  3HKZ G;  4LWC A;  4MZ9 A;  1D5X C;  1HNW L;  5IP9 H;  1YHB A;  1A3U A;  4PMW A;  4APV A;  5FLM G;  4HCE A;  4ZUI A;  4EX5 A;  5IOC A;  3ULJ A;  1S40 A;  3I3C A;  3OWF A;  1L0W A;  5ELE A;  3M3Y H;  2KA7 A;  1NNX A;  5LMN L;  2P5Z X;  1PZJ D;  4XT3 B;  2RF4 A;  1KDB A;  2F0O A;  3S1N H;  1PTO B;  1CA6 A;  1XMO Q;  2LXK A;  4OWT B;  2ZJP A;  1PDQ A;  2ASB A;  1AW7 A;  1SXT A;  3QWN A;  4TRD A;  2DNC A;  2VUM G;  3S1R B;  5FJ8 H;  1B3A A;  1D1K A;  1TVX A;  1K8O A;  2Z1C A;  3I4M H;  2D62 A;  1C9O A;  1WI5 A;  4S3S A;  3PUY A;  4JI1 L;  5C4Z A;  1K8A C;  1PZK D;  2YV5 A;  2EJG C;  1JT8 A;  2I0Q A;  1DOM A;  1QE6 A;  1YJN A;  1Q46 A;  4DV6 Q;  2Q2U A;  5K36 H;  4DV2 Q;  1E22 A;  3EBE A;  4FF2 A;  3HOZ B;  3CU7 A;  3SXH A;  2KHJ A;  4YY3 Q;  1KD1 C;  1TWF B;  1JQY D;  4QJF A;  1H9S B;  1N36 Q;  1XPO A;  1G2S A;  1PV4 A;  2ZXR A;  1U4P A;  4C2M B;  3I4O A;  2A6E C;  3OYY A;  3KF6 B;  4JK1 C;  3KJP A;  4AQY Q;  2WKC A;  4UHV A;  1I4Q A;  3EIV A;  1K8M A;  1HRJ A;  4JI4 Q;  4GOP C;  2G5D A;  3I8Z A;  3KLS A;  5BN5 A;  2HD3 A;  4R1J A;  4IUN A;  2F0I A;  1NE3 A;  4X6A H;  1EYA A;  4CHT B;  2EQS A;  1AEX A;  4L5T A;  1EIG A;  2QCP X;  3EA6 A;  5EPL A;  4GN4 B;  4P72 A;  3R2I A;  2SDF A;  3HOU G;  4ID6 A;  4KKU A;  1UNS A;  2DJF C;  4OGQ C;  5IYD H;  4UP9 A;  1PH9 A;  1AZQ A;  1QVG A;  3M7G A;  3J7A 5;  3HOY G;  4PG3 A;  3TBI B;  1PFS A;  3T1Y L;  3W3A A;  1W6K A;  2VXW A;  3P7J A;  1B2T A;  1HNZ Q;  2E5L L;  4F7X A;  4A3L H;  2HT1 A;  1CZG A;  1LTI D;  1AH9 A;  1N34 L;  3MXU A;  2GVA A;  1VQB A;  4JBW A;  4F87 A;  2F0F A;  3X3N A;  3SVM A;  3M7N A;  1Q8K A;  4ZAI A;  2TSS A;  1A0I A;  4MTN A;  1E2V A;  1EFI D;  2EYL A;  3RUZ A;  1NAP A;  2HQE A;  5C0X I;  2NTT A;  2JSO A;  1JWU D;  2RHQ B;  4OL7 A;  4NXM L;  4A3B G;  2ICE C;  4IUV A;  2F4V Q;  4ULL A;  1VQK A;  2LS0 1;  4YCU A;  4L5Q A;  5A2Q E;  1LTS D;  1WTR A;  3NBI A;  1ASY A;  1E3P A;  4R8I A;  3TP6 A;  4BY7 G;  4KJO A;  1V9P A;  3PF5 A;  1SYC A;  4FF1 A;  5ELO A;  1VF5 C;  1UEA B;  2NBF A;  5LMN Q;  3QOL A;  2N55 A;  4A3M G;  1SNM A;  3HOZ H;  4IAL A;  3MAQ A;  4PZ8 A;  4DV0 L;  4EQP A;  4ODG A;  1XMO L;  4A3I H;  3E9I A;  2C9O A;  1FNU A;  1X3P A;  1XNR Q;  1TWF H;  4DXG A;  2YTV A;  4HR7 B;  5CGK A;  2X6L A;  1KLG D;  3D8G A;  5IWA Q;  4JV5 Q;  5C5L A;  2JA9 A;  4L63 B;  4C2M H;  2QEJ C;  2XWB B;  3CP0 A;  4JI2 Q;  2Y0S G;  5EKI A;  4BY1 G;  1ENA A;  1SYE A;  3TP5 A;  1HUM A;  1QB5 D;  4JI1 Q;  4DAP A;  3WOF A;  1D5M C;  4B3T L;  1GUO A;  4FO2 A;  4JC0 A;  4HJ5 A;  3MFG A;  2LXJ A;  1PHJ A;  4OO1 H;  1F2M A;  4H13 C;  5ELF A;  2R92 B;  1C0A A;  3GTJ B;  1AE3 A;  1V43 A;  4GZY C;  1MHW C;  4L5R C;  2VNU D;  1GVP A;  1FGB D;  3T16 A;  3X3M A;  2F0G A;  5IT9 E;  4BBR G;  3S16 B;  1N36 L;  1IBL Q;  4QB4 A;  5IGF A;  3J81 c;  5T1I A;  1D2B A;  1SND A;  2EYH A;  2EYF A;  3UE0 A;  1SNQ A;  1SAP A;  5KYI A;  4GLX A;  3MWY W;  4A3M B;  2J4X A;  1MGS A;  4HMJ A;  1CZW A;  4G57 A;  3W1B A;  4B9X A;  3HGB A;  4GNX C;  2JEA I;  3GTL B;  3TDQ A;  5HUR A;  2A6H D;  3OMC A;  2MP1 A;  1XPU A;  2AUK A;  1R4Q B;  1EY6 A;  5FJ8 G;  3GTM B;  2MQH A;  4QIW E;  2JA6 G;  1X3G A;  1GD7 A;  5JOB A;  3K8A A;  3VR5 A;  5JVH 3;  1YZ6 A;  4O1N A;  3PF4 A;  5DM6 3;  4BBS B;  5JEA H;  4A3J H;  3S24 A;  2IX3 A;  4K14 A;  1VDZ A;  3H0G H;  4FXG C;  4QUC A;  4B3R Q;  2PYK A;  1Y69 U;  1UE6 A;  5G3L D;  2PI2 E;  2BE5 D;  2N78 A;  4A3F G;  1I4H A;  2NZH A;  2KCT A;  2F1M A;  1A3V A;  4GKK Q;  2A6H C;  4DNI A;  3RR5 A;  3QJY A;  4X65 L;  5CBE E;  2Y0S B;  3I4M G;  1X3E A;  4G4K A;  2IHE A;  2D2C C;  4RMF A;  2V1C C;  1CFM A;  2K75 A;  4H0L C;  1BDO A;  1HR0 W;  3HOW H;  2JXM B;  1EZ8 A;  1CA5 A;  3KBX A;  4XQJ A;  1J5E L;  2ZJR A;  3K7A B;  4KHP Q;  2WAQ B;  1SYG A;  2CWP A;  4K8J A;  4K2L A;  1D6E C;  1IW7 D;  3I4N H;  5CV7 A;  3H94 A;  1MJE A;  3BVM A;  4RG1 A;  4OX9 Q;  1EOT A;  2M2L A;  2NB0 A;  4GKJ L;  1GUS A;  3AFP A;  3GQB A;  4IFD I;  5IYD G;  1RIP A;  1HR0 Q;  1VQE A;  4JI6 Q;  1SMY D;  4C3J G;  4K8I A;  3PIP A;  3A5Z B;  2K1B A;  1WVL A;  3HEJ A;  3RLN A;  1JC7 A;  3A74 A;  1BBU A;  4LK1 C;  1U4R A;  3S9W A;  4A93 H;  2K28 A;  1WTW A;  1QIL A;  4QIW B;  5FO8 B;  1MD2 D;  2D9U A;  3PUZ A;  4A3K G;  1GOZ A;  1TS4 A;  1LTR D;  3DEO A;  2A19 A;  4IPC A;  4JI7 L;  3L0O A;  4IFD J;  4KY5 A;  2EXZ A;  4N8X 1;  1NMF A;  2MGS A;  1OTC A;  1O80 A;  2K14 A;  4LFA Q;  1W3S A;  4WRD A;  4QCL A;  3NSW A;  2L5T A;  2AQ1 B;  1HA6 A;  1RF2 D;  4C56 C;  1CQV A;  4CKB A;  3PO2 B;  3LWU A;  2EOT A;  4JI8 Q;  1GXD C;  1GM5 A;  3M4Y A;  3GTL H;  4CDF C;  2EJM A;  3C2P A;  4RHS A;  1KAB A;  5IP7 H;  3V2T A;  4DR2 L;  4LF9 L;  4A3B H;  4IJH A;  5KYL A;  1STE A;  3DWA A;  1A62 A;  3EQL C;  1WCM H;  2XN9 C;  1RKN A;  1G8Z D;  2Q2H A;  5DAU A;  4A3J B;  3K5L A;  1DZ1 A;  1J9O A;  1Q12 A;  5C0X J;  4Y7N B;  3C1F A;  1S4Z A;  3TRE A;  4OHJ A;  3A8K E;  2D0O A;  4BBS G;  2NN6 I;  2ZXP A;  1STH A;  2JP1 A;  2A68 D;  4OIK A;  1JIC A;  1EUJ A;  2Z6B A;  3I72 A;  3OMG A;  2E2I H;  4KKS A;  2KBN A;  5EAY A;  1I6V C;  5LL6 X;  1C8C A;  4KTA A;  1XMQ L;  1KIX A;  1B44 D;  3GO5 A;  3E3X A;  4K0K L;  3JC6 6;  5CC4 A;  3HOW G;  3S1N B;  2EJF C;  5C4X H;  4J8Q A;  1CKN B;  1EY5 A;  3D4W A;  1F9Q A;  2KED A;  5EBD A;  4DPG A;  1ONL A;  1LV9 A;  1MIU A;  3GTO B;  5M5W B;  1CTM A;  1LT6 D;  2VL6 A;  5FK9 C;  1GO3 E;  1PA6 A;  1BBW A;  2ZTE A;  5CYU A;  3J81 j;  1E7Z A;  1F2Y A;  2VQE L;  1QZH A;  1SE8 A;  4ME3 A;  5GAG C;  5KNC A;  1D7Q A;  4N9T A;  3I4M B;  5CV8 A;  3GDE A;  1BCP B;  2AHO B;  2H1E A;  4LW1 A;  4XIG S;  4TVA B;  3I4L A;  4X65 Q;  1DYQ A;  4DV1 L;  3JAM i;  4X3K A;  2Q8R E;  1Y1V H;  2SNS A;  3PO3 B;  4A93 B;  2NVQ H;  1SJH D;  1PH7 A;  3BZD B;  1KDA A;  2SNM A;  1AFP A;  5H1S E;  1HTP A;  2A74 C;  2PNR C;  5LHY 1;  4IFD G;  2IPK D;  4KHP L;  4DAM A;  4RKB A;  2B2Y A;  5A2Q L;  3KFU A;  1NR2 A;  4CDD C;  1KL9 A;  2HDL A;  2IX1 A;  1G91 A;  5K5P A;  4BWG B;  4GKJ Q;  4LJZ C;  3HOU B;  1U0L A;  3A5U A;  2PW7 A;  1Q81 C;  2FIN B;  1EY8 A;  4JYA Q;  1IYU A;  1VQM A;  1PXU A;  2B2W C;  3GTK H;  2XRS D;  3HOY H;  1WTQ A;  1RL2 A;  5IYB G;  3BJU A;  1B1Z A;  1V8Q A;  4LUZ A;  4N8F A;  5L37 A;  4RGM A;  1S72 A;  2ZT9 C;  1JWM D;  4A3B B;  4BBR B;  2E2J B;  1EWI A;  4HSP A;  4WOR A;  4BXX G;  3KOJ A;  5EKK A;  3QB3 A;  1U5K A;  2PQA A;  3HOX H;  4KMU C;  4DK3 C;  2MNA A;  1Y8P B;  4Y7N H;  4AIM A;  3K57 A;  2PPB C;  1KRS A;  2B2T A;  1DJR D;  4IOA A;  3T51 B;  1I4G A;  4DAV A;  3SEB A;  3LGJ A;  2K03 A;  3CCM A;  3AMU A;  1OO9 B;  5AFW A;  1EIF A;  3S17 B;  2E2I B;  4KLK A;  1XTC D;  1VQC A;  4IPH A;  4UDU C;  3Q0A A;  2EPB A;  1OXV A;  1PH5 A;  2K5H A;  2A6E D;  4L8J A;  1NBW A;  4KN4 C;  3GTG H;  3S1M B;  4FP5 D;  2K6A A;  2LFN A;  1EQQ A;  3HZX A;  1R9T H;  1WTO A;  4UY8 C;  1M8A A;  4DR6 L;  2F0K A;  4FYD A;  5EJW A;  5FO9 B;  4X64 Q;  4GN5 A;  4OIJ A;  3GTO H;  5M5W H;  4DV7 L;  3A7L A;  5JEA G;  4OWW B;  1DM0 B;  1C48 A;  1H95 A;  2NVT B;  4DUZ Q;  1NCV A;  2FJ2 A;  4K6D A;  3T56 B;  3M85 A;  3Q24 A;  1ENC A;  1TWC B;  5FO7 B;  1GHK A;  2IL8 A;  3K0Y A;  1T5E A;  1PH1 A;  4ZYS A;  1LTA D;  3BZK A;  4B3S L;  4Q0F A;  2F0H A;  3KLR A;  1B7Y B;  1SMY C;  2UXD Q;  1BQQ T;  1KHI A;  4YCV A;  1X6O A;  2L4N A;  1Y1V B;  3T1H Q;  3S2H H;  3PO3 H;  1K3B C;  1TY2 A;  2HIV A;  4V0B A;  4QMG A;  1B53 A;  2WII B;  4RAU C;  1VQH A;  1IHZ A;  3E0E A;  1HZ9 A;  2X6G A;  1H9S A;  2D0P A; 
#chains in the Genus database with same CATH homology
 2JA7 H;  3F2B A;  1N34 L;  1PYB A;  5J3B A;  1J5E Q;  3I55 A;  1T9H A;  4JI2 L;  1UE1 A;  1VQB A;  1WJJ A;  2GVA A;  4JBW A;  3U58 A;  2YTX A;  2R7Z H;  3KF6 A;  1X54 A;  2NVY H;  4AQY L;  5GAE C;  1LM0 A;  1K73 C;  3U50 C;  4JI0 Q;  1IBK L;  1UE5 A;  1Q8K A;  3D31 A;  3M7N A;  3TRZ A;  1Y14 B;  4JI4 L;  5E7N A;  2I5M X;  2F3I A;  1A0I A;  3RLO A;  4H02 A;  5FLM H;  1I5F A;  2BH8 A;  4MTN A;  4B3T Q;  2IY5 B;  1JMC A;  1DGS A;  1SLJ A;  1NMG A;  4LF8 L;  2WB1 E;  4IPD A;  2JA7 G;  4YWL A;  3CCU A;  4LFB L;  1KQS A;  5JJI A;  5C0X I;  3U4V A;  4NPS A;  2RHQ B;  3PSI A;  3RN2 A;  3FP9 A;  3G4S A;  4NXM L;  4A3B G;  4YHH L;  1CUK A;  2C35 B;  4JBK A;  2F4V Q;  3CQZ H;  3J81 i;  1VQK A;  4YCU A;  4L5Q A;  2Q2T A;  1HNW Q;  1WFQ A;  5LMU Q;  2ZJQ A;  1JJ2 A;  4DR7 L;  2UU9 L;  2Y0S E;  3S1Q H;  1IBM Q;  4DKA C;  3CCL A;  4C3H H;  2R92 H;  3UDF A;  4BBR H;  4JG2 A;  1ASY A;  1E3P A;  2N3S A;  2E2J H;  1VQN A;  2UXB Q;  3CCR A;  2UXC Q;  4BY7 G;  1E1O A;  1V9P A;  3PF5 A;  5JEA J;  5ELO A;  4BXX H;  1EFW A;  2JK8 A;  5LMN Q;  2MO1 A;  3CC4 A;  1HZC A;  1QUQ A;  4A3M G;  3HOZ H;  4PZ8 A;  2CWA A;  4DV0 L;  1CKN A;  4DR1 L;  4FDB A;  4DV5 Q;  3U4Z A;  1EOV A;  4A3I H;  1XMO L;  3E9I A;  3HFZ B;  3ULL A;  4A3F H;  1VQ5 A;  2IHF A;  1L1O C;  3HKZ E;  5IYC G;  1LUZ A;  1XNR Q;  5M5Y H;  4A3M H;  5IYB H;  1TWF H;  5C44 G;  4JI3 Q;  2E5L Q;  1NTG A;  2VQF L;  2YTV A;  4QY7 A;  4NB3 A;  4DAY B;  2OWO A;  5JJK A;  2CKZ B;  4X66 L;  5IWA Q;  3F2D A;  4JV5 Q;  2JA9 A;  3F1Z A;  1HH2 P;  3I7F A;  2WP8 J;  5M3F H;  5IY0 A;  4C2M H;  4JYA L;  1KXL A;  2RCN A;  3CP0 A;  4P71 A;  4LFC L;  4JI2 Q;  1VQ6 A;  3GTM H;  5BR8 Q;  1TWH H;  2Y0S G;  4BY1 G;  4X62 Q;  1IYJ B;  3ULP A;  4JI8 L;  2EIF A;  1G29 1;  2VZA A;  3S1M H;  4JI0 L;  1IBK Q;  4LUV A;  1X56 A;  3FKI H;  1QUQ B;  2IX0 A;  1VQ7 A;  2HQL A;  1XNQ Q;  4JI1 Q;  1CKO A;  3A0J A;  1YNX A;  1KRT A;  4B3T L;  2K4K A;  4J15 A;  4O0A A;  4YWK A;  3W1G A;  4HJ5 A;  2WB1 G;  4JC0 A;  3PIO A;  2LXJ A;  1HNX Q;  1PHJ A;  1SN8 A;  3CCS A;  2EXD A;  2R7D A;  5JJL A;  4NXM Q;  4YHH Q;  4GNX B;  1WOC A;  1C0A A;  3RLF A;  1Q1B A;  2PI2 A;  1YI2 A;  1AE3 A;  1V43 A;  2NVT H;  4BY7 H;  2MFI A;  3K80 C;  4LF4 L;  1HZA A;  1Z47 A;  4JBJ A;  3OTO L;  2HIX A;  2GN5 A;  4L5R C;  1GVP A;  2I5H A;  2VNU D;  2UU9 Q;  3M9B A;  1K83 H;  1TWC H;  2UUA L;  1YJ9 A;  1CSQ A;  4BBR G;  4HJ7 A;  2UXB L;  1N36 L;  1IBL Q;  1GKH A;  1FJG L;  4HIO A;  5IP7 G;  3J81 c;  4JBM A;  3B6Y A;  3UE0 A;  3UDX A;  4GN3 B;  5LMN W;  2NVX H;  4B3M Q;  4DR5 Q;  4GLX A;  1V1Q A;  4O2D A;  5FLX c;  4AYB E;  4ALP A;  1XJV A;  4HID A;  1UEB A;  2CCZ A;  2B3G A;  3AEV A;  4OO1 G;  4DV5 L;  2MO0 A;  3W1B A;  1XTD A;  4GNX C;  2JEA I;  1XNR L;  3K7A H;  4A4I A;  1TXY A;  1N32 Q;  2N49 A;  1XPU A;  5FJ8 G;  3RNU A;  1VQL A;  1FGU A;  2MQH A;  1BVS A;  4QIW E;  3STB C;  2JA6 G;  1X3G A;  2IT1 A;  5IWA L;  1GD7 A;  5M3M H;  1YIT A;  4JV5 L;  2JA8 G;  1XPR A;  3K8A A;  3D0F A;  1C7Y A;  3S15 H;  4LF5 Q;  3TEH B;  2PMZ E;  1YZ6 A;  3W5O A;  3PF4 A;  4OO1 I;  3TS0 A;  1I6H H;  2KEN A;  1NJI C;  2R93 G;  4A3J H;  3NEM A;  3S24 A;  1Q7Y C;  3FHW A;  4DR4 L;  3H0G H;  1KC8 C;  3E9H A;  1I94 Q;  4A93 G;  1J6Q A;  3K81 C;  1PYS B;  3I56 A;  4B3R Q;  3HOV G;  2JA5 H;  3L2P A;  1UE6 A;  4HIK A;  2H5X A;  1OXX K;  2PI2 E;  3GTJ H;  4PZ6 A;  2FXQ A;  2N78 A;  4A3F G;  3KDF A;  1S3O A;  2K50 A;  2NZH A;  5M3M G;  2KCT A;  4GKK Q;  3BU2 A;  1QVF A;  5C3E G;  2YYZ A;  4DNI A;  3RR5 A;  2AMC B;  4A75 A;  3T1Y Q;  2YTY A;  4X65 L;  4JI7 Q;  3HOZ G;  1X3E A;  2DGY A;  2IHE A;  2R6G A;  2NN6 G;  4JOI A;  4RMF A;  1SRO A;  3I4M G;  3S16 H;  2V1C C;  3T1H L;  3ZJY C;  1Y1V G;  3OTO Q;  2A1A A;  2K75 A;  1LTL A;  2Z0S A;  2UUA Q;  3HKS A;  3CCJ A;  3L7Z C;  1HR0 W;  3HOW H;  3DLL A;  1K9M C;  2R7F A;  2ES2 A;  3I4N G;  1SFO H;  4P73 A;  5ELN A;  1J5E L;  2ZJR A;  1D8L A;  4KHP Q;  1OXU A;  2CWP A;  3H0G G;  3CC7 A;  2Q2I A;  4A3L G;  2AWN A;  1VQF A;  1N8R C;  3I4N H;  2BA0 A;  3CXC A;  1MJE A;  3IRB A;  5C0X G;  3CMA A;  5HY6 A;  4RG1 A;  4AYB G;  4OX9 Q;  1YHQ A;  4HJA A;  3CPW A;  4DR2 Q;  4GKJ L;  1P8L A;  2QGQ A;  4BBS H;  2JA6 H;  4LF8 Q;  1SR3 A;  3AFP A;  3CD6 A;  4IFD I;  3BZC A;  2N8N A;  5IYD G;  3G6E A;  2QEX A;  1RIP A;  1FVI A;  1VQE A;  1HR0 Q;  2E2H H;  4JI6 Q;  2JQO A;  2LSS A;  3F8T A;  2BA1 A;  4DK6 C;  3CME A;  3KDF B;  4LF5 L;  2OCE A;  2F4V L;  3PIP A;  3A5Z B;  1W2B A;  4DUY Q;  2OTL A;  3PGZ A;  5LMU L;  4DR7 Q;  1WCM G;  1MJC A;  3A74 A;  3RLN A;  1BBU A;  3I2Z A;  1I94 L;  1N33 Q;  2ATW A;  2HHH Q;  1IBM L;  4A93 H;  4B3R L;  3CF5 A;  3HOV H;  5DLQ E;  3ERS X;  3PUZ A;  2AWO A;  3CCV A;  2ZM6 Q;  1PH3 A;  4DV6 L;  4A3K G;  4P75 A;  3G71 A;  4DV2 L;  4IOC A;  4GKK L;  2OTJ A;  4KI0 A;  3CW2 C;  4A3G G;  4DR1 Q;  2A19 A;  4IPC A;  1YIJ A;  3L0O A;  4JI7 L;  1PVO A;  4IFD J;  3VDY A;  1B8A A;  2GVB A;  1VQ8 A;  1UWV A;  2XGT A;  2K5N A;  4YY3 L;  4GS3 A;  4K0K Q;  1NMF A;  4POG A;  5C44 H;  1I50 H;  2UUC Q;  2VQF Q;  1OTC A;  2A8V A;  2L15 A;  1VQI A;  2K14 A;  3WWV A;  4LFA Q;  2VW9 A;  2UUB Q;  3TS2 A;  4C3J H;  5C4X G;  1W3S A;  4GOP B;  1PH6 A;  3MXN B;  1Z9F A;  5GQO A;  1JJG A;  4OWX B;  4GNX A;  3F2C A;  4A3C H;  4LFC Q;  4LF6 L;  4Y52 H;  3GTP H;  4X62 L;  4A3G H;  4R4O A;  4DR3 L;  3SGI A;  4JI5 Q;  1E24 A;  3GD7 A;  4JI8 Q;  1WYD A;  3UE1 A;  1GM5 A;  1Q1E A;  3GTL H;  4OX9 L;  3K7U C;  2VQE Q;  5IP7 H;  4KHZ A;  5GRO A;  1IL2 A;  3KLW A;  3HOX G;  3EN2 A;  1XNQ L;  3CAM A;  4DR2 L;  4LF9 L;  3S14 H;  4A3D G;  4DR6 Q;  4A3B H;  2VY3 A;  4IPG A;  4IJH A;  3CC2 A;  1E1T A;  4GLA C;  1A62 A;  2PNH A;  4IO9 A;  5C4J H;  1X9N A;  4C3I H;  1HNX L;  1WCM H;  3KJO A;  1X3F A;  1HR0 L;  1A8V A;  1VQG A;  3RN5 A;  4A3C G;  2Q2H A;  1ASZ A;  1X55 A;  4R4Q A;  4UPA A;  3KF8 B;  5HGQ A;  1B70 B;  1X65 A;  2KHI A;  2WAQ E;  3CPF A;  4LF4 Q;  1A63 A;  1JJC B;  1Q12 A;  5C0X J;  4DUZ L;  3TRE A;  4LF7 Q;  2D0O A;  4BBS G;  2NN6 I;  1IBL L;  5M5X H;  1CKM A;  1YVC A;  2JE6 I;  1HZB A;  4DV3 Q;  4OXP A;  2ZM6 L;  3PV0 A;  1HJP A;  5IP9 G;  1EUJ A;  1Q82 C;  5AJ3 Q;  4B3M L;  4NXN Q;  3AYH B;  3AQQ A;  3ER0 A;  2E2I H;  1M90 C;  1VS0 A;  2KBN A;  5EAY A;  1IZ6 A;  3RZD H;  1XMQ L;  1PH2 A;  1KIX A;  1HNZ L;  1JB7 A;  4BA2 I;  3GO5 A;  3CCE A;  4QQB X;  4K0K L;  2UUC L;  3JC6 6;  3HOW G;  3NEN A;  1QZG A;  3PO2 H;  2ALY B;  5C4X H;  1CKN B;  2RHS B;  5IYC H;  3DM3 A;  2JA8 H;  3S2D H;  4DPG A;  3RZO H;  1N34 Q;  2B29 A;  1L1O A;  1PH4 A;  1TWG H;  4LF6 Q;  2CQO A;  3KYH C;  3HOU H;  1MIU A;  5IT9 c;  4DR3 Q;  4JI5 L;  2OQ0 A;  2DUD A;  2VL6 A;  5C3E H;  1GO3 E;  2F52 A;  4YWM A;  1PA6 A;  1BBW A;  1Y1W H;  2ZTE A;  3J81 j;  4A3E G;  1E7Z A;  2VQE L;  1MKH A;  1QZH A;  1SE8 A;  1VQJ A;  2ZTC A;  4ME3 A;  4LF9 Q;  2JA5 G;  5GAG C;  1D7Q A;  2KCM A;  1EIY B;  1YBY A;  3GDE A;  2AHO B;  4LFB Q;  4LW1 A;  4POF A;  4WJ3 M;  4XIG S;  3J7Z C;  3ICE A;  4TVA B;  1OXT A;  1SRU A;  3STB D;  1OXS C;  4X65 Q;  4DV1 L;  3JAM i;  1VQP A;  1VQA A;  3HKZ G;  4LWC A;  4MZ9 A;  3H15 A;  1Y1W G;  4HIM A;  1Y1V H;  1HNW L;  2AKW B;  1YHB A;  4PMW A;  4APV A;  5IP9 H;  5FLM G;  4EX5 A;  2NVQ H;  3ULJ A;  3NBH B;  4JCV E;  1PH7 A;  1S40 A;  1BKB A;  1L1O B;  1YJW A;  2UXC L;  4LUO A;  5H1S E;  4DV3 L;  2R7Z G;  1L0W A;  3TQY A;  4TQU S;  3M3Y H;  4GLV B;  1YHA A;  5AJ3 L;  4IFD G;  5LMN L;  4KHP L;  4IJL A;  5GAH C;  3PUW A;  4AH6 A;  4DAM A;  4DV0 Q;  2RF4 A;  3S1N H;  1XMO Q;  2LXK A;  4OWT B;  2ZJP A;  3KFU A;  3S17 H;  2ASB A;  1Q86 C;  1VQD A;  1KL9 A;  2IX1 A;  3PUV A;  4GKJ Q;  4BY1 H;  4UP8 A;  1U0L A;  3A5U A;  3M4O H;  2VUM G;  1Q81 C;  5K36 G;  3H3V H;  4JYA Q;  3K0X A;  1N9W A;  4OON A;  4X64 L;  4JI6 L;  4DV4 Q;  3M4P A;  5IE8 A;  1VQM A;  5FJ8 H;  2NZO A;  3UDI A;  5BR8 L;  4DV7 Q;  3GTK H;  3HOY H;  1P16 A;  4DUY L;  1PH8 A;  1RL2 A;  2OQK A;  3I4M H;  5IYB G;  4MNO A;  3BJU A;  2BH2 A;  2D62 A;  4LUZ A;  1C9O A;  1WI5 A;  1N33 L;  2HHH L;  1S72 A;  1UE7 A;  3PO2 G;  3PUY A;  4JI1 L;  1K8A C;  2XTI A;  2YV5 A;  4PZ7 A;  1EWI A;  1JT8 A;  2JJQ A;  2I0Q A;  4UP7 A;  1YJN A;  1Q46 A;  4DV6 Q;  2Q2U A;  4BXX G;  3KOJ A;  2CFM A;  2WFW A;  4DV2 Q;  4B3S Q;  1E22 A;  1O7I A;  4A3D H;  3EBE A;  1U5K A;  2UXD L;  2Z6K C;  1K0R A;  2PQA A;  4DV1 Q;  3AFQ A;  3HOX H;  4DK3 C;  2MNA A;  1I3Q H;  4QL5 A;  2B63 G;  4Y7N H;  1K8G A;  4R4C A;  4AIM A;  4HJ9 A;  3MEF A;  5M3F G;  2KHJ A;  1KRS A;  4R4T A;  4YY3 Q;  1KD1 C;  3CCQ A;  3H3V I;  3J80 i;  4QJF A;  4IOA A;  2UUB L;  4LFA L;  1N36 Q;  2YU9 H;  1XPO A;  1FJG Q;  1EYG A;  3LGJ A;  4R4I A;  2E8G A;  3CCM A;  1PV4 A;  1EIF A;  1LYL A;  3I4O A;  4DR5 L;  1IXR A;  3NEL A;  4QGU A;  3OYY A;  4KLK A;  3Q8D A;  1VQC A;  2ID0 A;  3KF6 B;  4IPH A;  4A76 A;  3KJP A;  1EQR A;  1OXV A;  4AQY Q;  1PH5 A;  2K5H A;  3S1R H;  1FL0 A;  4P74 A;  1NBW A;  1VQ9 A;  3GTG H;  3G48 A;  1JE5 A;  3EIV A;  4BA1 I;  2K52 A;  1VQ4 A;  1EQQ A;  1G51 A;  3PCO B;  4GOP C;  3FKI G;  4JI4 Q;  1R9T H;  3GTQ H;  1N32 L;  3OW2 A;  4UY8 C;  4WJ4 A;  4DR6 L;  5GAD C;  4YCW A;  4R1J A;  2VUM H;  1NE3 A;  2PQA B;  4X6A H;  4X64 Q;  2B63 H;  4DV4 L;  1TWA H;  2JEB I;  2VS1 A;  4GN5 A;  1QVC A;  1M1K C;  3GTO H;  4GOP A;  5M5W H;  4DV7 L;  2EQS A;  2K5V A;  3UDG A;  4L5S A;  1G6P A;  5JEA G;  4OWW B;  1H95 A;  4L5T A;  3M4Q A;  4DUZ Q;  4A3E H;  1VCI A;  3PO3 G;  4GN4 B;  4DR4 Q;  4P72 A;  4A3I G;  4XTC S;  3M85 A;  1YEZ A;  4LF7 L;  1KAW A;  4HJ8 A;  2QA4 A;  3HOU G;  1L2F A;  1PH1 A;  5IYD H;  4UP9 A;  4JOI C;  2ZTD A;  3BZK A;  1PH9 A;  1QVG A;  3J7A 5;  4B3S L;  4NXN L;  3HOY G;  2WAQ G;  4PG3 A;  1B7Y B;  1K3R A;  3JAM c;  3PUX A;  2R92 G;  1PFS A;  2UXD Q;  1CSP A;  1KHI A;  1SMX A;  3T1Y L;  4YCV A;  1X6O A;  3T1H Q;  4A3K H;  1XMQ Q;  3S2H H;  1HNZ Q;  2I5L X;  3PO3 H;  2HIV A;  2Z6K A;  4JI3 L;  4EQ5 A;  3J80 c;  2E5L L;  4LNQ A;  1NY4 A;  4A3L H;  1VQH A;  1AE2 A;  3E0E A;  2HT1 A;  1HZ9 A;  4X66 Q;  4A3J G;  2R93 H;  1AH9 A;  1VQO A;  2D0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...