2ES2A

Crystal structure analysis of the bacillus subtilis cold shock protein bs-cspb in complex with hexathymidine
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*TP*TP*TP*T)-3'
publication title T-rich DNA single strands bind to a preformed site on the bacterial cold shock protein Bs-CspB.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation
total genus 12
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2es2A00
1Y1VH 5DLQE 4DR1L 1XNQQ 3TS2A 1N9WA 4TQUS 2PNHA 4DR1Q 1E7ZA 3U58A 3EN2A 4H02A 4LFBL 4UP7A 1PH1A 3AFQA 2VQFL 1K9MC 3J80c 2NVTH 4IOAA 4LFBQ 1HZ9A 3DLLA 1J6QA 3B6YA 2KBNA 4JBJA 2VQFQ 3GO5A 5HY6A 5IP7G 4A76A 2VS1A 3VDYA 2K5VA 2K52A 1VQDA 2L15A 3RN5A 1EIYB 1PH9A 4B3MQ 1N34L 2AWOA 1JJGA 1X55A 4GNXA 5C0XJ 4DUYL 4XIGS 4QL5A 4XTCS 1N34Q 4R4QA 4DR3L 4DUYQ 1CSQA 4LF4L 4HIOA 2NVXH 1J5EL 4FDBA 4IFDJ 2R7FA 4BBSH 2RHSB 1J5EQ 1N32Q 1M90C 4HIKA 4LFCL 1Y1WH 2HHHQ 3H15A 1Y1VG 4A3IH 2KCMA 3CC7A 3L2PA 1K83H 1KXLA 4R4TA 4JBMA 4A75A 2K4KA 2WB1G 3PCOB 3JC66 3UDXA 1OXSC 4UY8C 3HOVH 2D62A 1A8VA 1Q1EA 2C35B 4JOIA 1Q46A 4YHHL 2H5XA 4L5SA 2HIXA 1C0AA 1U0LA 1HNXL 4NXMQ 2K75A 3OTOL 1XMOQ 4A3MG 1GM5A 5E7NA 4BY7G 4GN4B 1HNXQ 3OTOQ 1KD1C 3G4SA 3KFUA 2I5LX 3T1YQ 4P71A 4IPCA 1VQJA 1C7YA 4QIWE 3HOXH 3M7NA 4A93H 2K50A 5IYCH 4GNXB 2VUMH 3S24A 4YCVA 3GD7A 1YVCA 4APVA 1OXVA 2YTXA 4DV3L 2I5MX 3K0XA 3M85A 4WJ4A 3J81i 2R7DA 1PV4A 2CWPA 4DR4L 4A3GH 4DV3Q 3HOVG 2D0PA 3PUZA 4UP9A 3TEHB 4BA2I 4DR4Q 4NXNL 4BA1I 2YTVA 1ASZA 1D7QA 2IHFA 4MTNA 5GROA 4ME3A 3CCEA 1Q12A 1VQ8A 3AYHB 4A3DH 4LF9L 1EQRA 1TWAH 1VS0A 5M5YH 2MQHA 1D8LA 4BBRH 1Q81C 4LF9Q 2DUDA 3CCMA 1VQCA 1WYDA 1W3SA 2CCZA 2KHIA 2JA5H 2JEAI 2K5NA 5ELNA 5IT9c 5IWAL 2UUBL 3M4OH 2I5HA 1LTLA 4X62L 1V9PA 4PZ7A 4BY1G 2UUBQ 3PF4A 1SN8A 3I4OA 2VUMG 2JA9A 4X62Q 3PO2G 3F2BA 3U50C 2NZHA 4A3JG 2NN6I 3KDFA 1EFWA 1X3GA 1HH2P 1YZ6A 2EQSA 4BXXH 2VW9A 3HKZE 2JQOA 3BZCA 1XJVA 1L1OC 4DV0Q 2ZJPA 3Q8DA 4GLAC 1TXYA 1SMXA 1IYJB 3GTPH 3TRZA 1UE5A 1QZGA 1A62A 2VL6A 1LUZA 1OXUA 5JJKA 4JI0L 1NY4A 2PQAA 3GTOH 1HZCA 4A3EH 2JE6I 1Q8KA 1HZBA 3PUYA 1UWVA 2BH8A 2LSSA 1IBML 3OW2A 1UE6A 5LMUL 4PZ8A 4JI1L 1SE8A 5FJ8G 1QUQA 2ID0A 1KRTA 5LMUQ 4KHPL 2WFWA 4PZ6A 4HJ7A 3I4MG 4KHPQ 2K5HA 1MKHA 1VQGA 3ERSX 3PGZA 3CCSA 2N49A 3ULJA 4YY3Q 4GNXC 1YITA 4JV5Q 4PMWA 3K8AA 4A3FH 4JBWA 3NEMA 1VQNA 2JA6H 3GTGH 5IYBH 4TVAB 1LYLA 1YJ9A 1N33L 4A3LH 2K14A 3TQYA 3W1GA 3FP9A 3RN2A 3S15H 2IHEA 2UUAQ 1XMQL 1N33Q 2OTJA 1ASYA 5LMNQ 4GKJL 3ZJYC 1I50H 1XMQQ 4LF7L 3GTMH 1QZHA 2ALYB 4GKJQ 4A3EG 4LF7Q 4LNQA 1PH7A 4JI8Q 3A5ZB 4L5QA 1PYBA 2AMCB 1KAWA 4JOIC 2WAQE 3ULPA 4POGA 1WCMG 2R92G 1YNXA 2OTLA 3GTLH 2PI2E 2UXCQ 4RG1A 2AWNA 3HOUG 4B3ML 4JCVE 2IT1A 1YHQA 3RNUA 1PH6A 1XNRL 1CSPA 4WJ3M 4UP8A 4C3JH 4DR5Q 1HNWL 1CKOA 1YBYA 2B63H 1QUQB 4X65Q 1XNRQ 3MEFA 1TWFH 3F2CA 2Z6KA 3FKIH 4A3FG 1HNWQ 1X3EA 3ICEA 1H95A 2A1AA 1NMFA 1S72A 1IZ6A 4L5RC 1N32L 2VQEQ 2HHHL 3I4NH 2KENA 1PH2A 2QEXA 1A0IA 3KF6A 5HGQA 1VQIA 5ELOA 1L1OB 4DK3C 3CCLA 2UXCL 2RF4A 5GAEC 1VQFA 3KF8B 4NB3A 5IY0A 4QGUA 2N78A 1M1KC 4DV6L 2ZTCA 3G6EA 3H3VH 1O7IA 4NXML 2EIFA 1XMOL 4DV6Q 5C4XH 2JK8A 3CF5A 1Q1BA 3UDGA 1VQBA 1XPUA 4JG2A 4K0KL 1HJPA 2UXBL 1P16A 3HKZG 4A3BH 4K0KQ 1PH3A 2ZM6L 1XPOA 2UXBQ 3W5OA 2R6GA 3T1YL 2B63G 2ZM6Q 4LFAQ 3H0GH 1SFOH 1HR0L 1IL2A 2OQKA 1YIJA 3GTKH 1AE3A 1HR0Q 3AEVA 4BBSG 4YWLA 4YCUA 1QVCA 3KYHC 3LGJA 4EX5A 1Y1WG 1AE2A 4A3IG 3J7A5 3S16H 3STBC 1KHIA 3GDEA 4OWWB 5C4JH 4IPDA 4B3SL 1X54A 3PV0A 4OWTB 1W2BA 3NELA 1TWGH 4JI7L 4B3SQ 4YWMA 4DAMA 1X9NA 1SLJA 1K8GA 4A3KH 4P72A 1E24A 2WP8J 4JI7Q 2VNUD 1PHJA 4B3RL 1KL9A 4GLXA 4IFDI 2NN6G 1GD7A 1X6OA 2Y0SE 3CPWA 2A8VA 5C4XG 4IJHA 4B3RQ 4AYBE 3CMEA 1NJIC 3D31A 1IBLQ 1K73C 1U5KA 3CP0A 4DR2L 2E5LL 1E22A 1FJGL 4AH6A 1X56A 4P74A 1PFSA 4GN5A 1VQKA 1CKNA 4DR2Q 2E5LQ 3HOZH 1FJGQ 3RZDH 1VQPA 1XPRA 2V1CC 1SRUA 3GTJH 1I6HH 3J80i 3H0GG 3JAMc 4GOPC 5JJLA 2PI2A 3HOXG 2UXDL 2B3GA 2CKZB 4Y52H 2Q2IA 2UU9Q 5IE8A 1Y14B 1EUJA 5C44H 4A93G 2UXDQ 4HIMA 5IYCG 3CD6A 1HR0W 3H3VI 3G48A 3RLFA 3D0FA 2IX0A 1UE1A 4DUZL 2GVAA 3J7ZC 4IJLA 4LF6Q 2E2HH 1GVPA 4DUZQ 1C9OA 3S1NH 4A3GG 4DV4L 3T1HL 4JI6L 2R93H 4DV0L 4IOCA 4A3KG 1JB7A 1PVOA 1B8AA 2BA1A 1FVIA 4UPAA 3W1BA 5AJ3L 4DV4Q 3T1HQ 2E2JH 4JI6Q 1X65A 2CQOA 4JI5L 5AJ3Q 1R9TH 2QGQA 3L7ZC 1AH9A 1YHAA 4JI5Q 4A3DG 4RMFA 2YV5A 3CPFA 2WB1E 4BBRG 2D0OA 3UE1A 1E1OA 4JI4L 4L5TA 4YWKA 3UDIA 2MO1A 2ZJRA 4DKAC 4JI4Q 3S1QH 2JA5G 3FHWA 4GOPA 5J3BA 1UEBA 4C3IH 1OXXK 2JA8H 4O0AA 3HOWH 3STBD 3PO3H 5C44G 1CKNB 4DK6C 1G291 3A74A 3CC4A 4YY3L 1VCIA 3UE0A 4O2DA 3WWVA 1B7YB 3RLNA 3GTQH 4JV5L 1WFQA 1Z47A 4BXXG 1VQHA 3E9IA 1CUKA 2HQLA 5JEAG 2UUCL 2Z6KC 1X3FA 4LUZA 2YU9H 4Y7NH 1MJCA 1VQOA 5K36G 4MNOA 1PH5A 4QQBX 1YJNA 2UUCQ 3KDFB 2UUAL 4LF8L 1QVFA 5LMNL 3S17H 4LF8Q 4GS3A 1XTDA 2JEBI 2OCEA 3ER0A 3PUWA 4JI8L 3PUVA 3PUXA 1VQ9A 2B29A 2Q2TA 4R4IA 4DR6L 2OWOA 2JA8G 4QY7A 5IP7H 3CCRA 1N36Q 1Q82C 3HOWG 1WOCA 3E9HA 1L0WA 1JJCB 1VQ6A 5M3MH 4HJ5A 2PQAB 4LF5L 1WI5A 3J81j 3CMAA 1SR3A 3J81c 3F1ZA 4X64Q 4DR5L 4GOPB 4LF5Q 1L2FA 4P75A 3RLOA 4X65L 4B3TQ 1PH4A 2KCTA 5BR8L 5H1SE 5M5WH 4R1JA 2F4VQ 4OX9L 2JA6G 4AYBG 4AQYL 5IYBG 2OQ0A 3TREA 5BR8Q 4DNIA 2LXKA 2VQEL 4A3LG 4OX9Q 3BZKA 3K81C 4AQYQ 3K7AH 1S40A 1YHBA 4ALPA 1FGUA 1WJJA 3KJPA 1YI2A 3UDFA 1NBWA 3HKSA 1E1TA 4IPHA 5LMNW 2MO0A 1OXTA 3KLWA 4OXPA 1NMGA 4X6AH 1N8RC 1EYGA 1K0RA 4JYAL 1BKBA 1K3RA 4A3MH 3CC2A 5FLMH 4BY7H 4JYAQ 4QJFA 4PG3A 2CWAA 3L0OA 3CCJA 5M3FH 5M3MG 4R4CA 5C0XG 3HFZB 2Z0SA 3RR5A 1CKMA 4JBKA 3I2ZA 1Q86C 2KHJA 2HT1A 2BA0A 4DR3Q 2XGTA 4LFAL 2BH2A 3U4ZA 4IFDG 4C3HH 4LF4Q 3PIPA 3A5UA 2JA7H 1T9HA 1JT8A 3FKIG 3CCUA 4GKKL 1V1QA 1BBUA 1NE3A 1V43A 4J15A 4P73A 2E2IH 4LFCQ 4GKKQ 3AFPA 1Q7YC 3M9BA 3IRBA 4AIMA 3I4NG 4EQ5A 3CAMA 4JI3L 3CCQA 2LXJA 2YTYA 1TWHH 3PF5A 4IPGA 4JI3Q 1VQMA 2E8GA 2Q2HA 5C0XI 2N8NA 4MZ9A 5GADC 2HIVA 4YHHQ 3F8TA 2YYZA 3CW2C 4OWXB 5FLMG 1JMCA 1P8LA 4LUOA 4HIDA 4DR6Q 5M3FG 1JJ2A 3KF6B 1LM0A 2NVYH 4LUVA 4DV1L 1IBLL 1XNQL 3S1MH 2FXQA 1VQ7A 1KRSA 3E0EA 4GLVB 4X66L 4DV1Q 1BBWA 5GQOA 2AKWB 4IO9A 1DGSA 2Q2UA 2GN5A 2GVBA 1EWIA 4X66Q 4A3BG 2AHOB 4DV2L 1BVSA 4YCWA 3F2DA 4KLKA 2I0QA 1EQQA 2CFMA 4BY1H 4DV2Q 2JA7G 1KIXA 4HJ8A 3U4VA 3PO2H 2UU9L 4A3JH 4LWCA 3TS0A 2ES2A 1NTGA 4DV5L 3EBEA 4HJAA 4A3CH 3S14H 3G71A 5IYDH 2XTIA 4DV5Q 1IBKL 3M3YH 4DPGA 3MXNB 4NPSA 1IBKQ 4LF6L 1FL0A 1GKHA 3HOYH 1MJEA 1K8AC 1IXRA 5GAGC 4JI2L 4KI0A 2WAQG 4NXNQ 3S2DH 1G51A 4JI2Q 2NVQH 2ZTDA 2IY5B 3CXCA 2MFIA 3S2HH 5M5XH 3I56A 1VQLA 3DM3A 1PYSB 4A4IA 2ZJQA 1RL2A 3ULLA 1I94L 4KHZA 3PIOA 3BJUA 1I94Q 1B70B 1S3OA 5EAYA 3I55A 2R7ZH 4HJ9A 3HOZG 3S1RH 5IWAQ 2IX1A 2ZTEA 2ASBA 5FJ8H 1I5FA 5JJIA 3RZOH 1PH8A 3SGIA 3I4MH 4A3CG 3KJOA 3AQQA 2RHQB 4POFA 5IYDG 1QVGA 1PA6A 4DR7L 1VQEA 1GO3E 2JJQA 4DR7Q 2VY3A 1A63A 1VQ4A 4DV7L 4LW1A 3HOYG 4GN3B 4DV7Q 5C3EH 2R93G 5JEAJ 1VQ5A 5IP9H 3K7UC 4OO1G 1KC8C 5GAHC 2PMZE 1KQSA 1EOVA 1SROA 4R4OA 4JI0Q 2R7ZG 2DGYA 1OTCA 5FLXc 3EIVA 1IBMQ 1WCMH 3CQZH 2R92H 3OYYA 2MNAA 1TWCH 1EIFA 4C2MH 4JI1Q 1N36L 2RCNA 3I7FA 2EXDA 3HOUH 3PO3G 2F3IA 2VZAA 3KOJA 1YEZA 1RIPA 3M4QA 4DAYB 4X64L 2F52A 1Z9FA 2NZOA 3K80C 3NBHB 2ATWA 3PSIA 4B3TL 1E3PA 3BU2A 1I3QH 2N3SA 4OO1I 1HNZL 3A0JA 1VQAA 1HZAA 1L1OA 1UE7A 3NENA 3JAMi 5C3EG 1MIUA 4OONA 1HNZQ 2F4VL 4JC0A 1JE5A 3CCVA 2Y0SG 3M4PA 1G6PA 1YJWA 2QA4A 2A19A 5IP9G
chains in the Genus database with same CATH superfamily
4DR1L 3OOCA 3D6WA 4C1NI 2PNHA 4EQNA 1PRTF 2F0MA 5KRUA 2Z4HA 4PQXA 5CV8A 1K9MC 3BVMA 2NVTH 4IOAA 3KUPA 1SYFA 2VQFQ 3GO5A 5HY6A 2K5VA 1GUNA 1NCVA 2AWOA 4GNXA 4XIGS 4QL5A 1Q3LA 4HIOA 1DOLA 1TY2A 2R7FA 4BBSH 2EOTA 4HIKA 1Y1WH 5IGBA 4A3IH 3CC7A 3BYTB 3L2PA 1KXLA 2X69A 3SXHA 2O2LD 1A8VA 2EYJA 2H5XA 4L5SA 2JP1A 3DEOA 3J80L 5DM63 1WD0A 4ME5A 1F77A 1FGBD 1KD1C 2IX3A 4FP5D 1U4LA 2WKCA 3MEHA 3KFUA 3FMCA 2P5ZX 1C7YA 4MN3A 4L8JA 3M7NA 4EQPA 4DK1A 5IYCH 4GNXB 4I7AA 2VUMH 1B44D 1YVCA 5DEHA 4MIUA 5FO7B 1LTID 3HGBA 1OXVA 4RKLA 3T51B 3K0XA 3M85A 1PV4A 2VB3X 1PXUA 4A3GH 4U68A 3TEHB 4DU9A 4DR4Q 4BY7B 1ASZA 1D7QA 2K5WA 2IHFA 4J6HA 4A3DH 1WTQA 1DD2A 5M5YH 1Q81C 4BBRH 1STHA 2DUDA 1ICFB 1MSHA 2M9VA 4G7HC 1W3SA 2F0QA 2CCZA 2JA5H 5IT9c 1NAPA 2UUBL 2PMZB 4X62L 1V9PA 4PZ7A 4BY1G 1PZKD 2VUMG 2MPMA 1Q8IA 5COYA 1EFWA 1X3GA 1HH2P 5CV4A 3WDNA 4G7ZC 1O80A 2JQOA 5NUCA 4ZCKA 1BNZA 1L1OC 2EYFA 2K6AA 2NVYB 4PV1C 1A62A 4KD3A 2JN4A 3Q0AA 2SNSA 3GTOH 4A3EH 3SK8A 3PO2B 4PZ8A 4JI1L 3EQLC 2Q8IB 1WTRA 1LLRD 3I4MG 3KBXA 3CCSA 2N49A 3ULJA 4YY3Q 3S2DB 4JV5Q 5ELCA 4EVOA 3K8AA 5CV7A 4QQBX 1IYVA 1TWAB 3AU7A 1N33L 3S2HB 3TQYA 3W1GA 3RN2A 2KVMA 3S15H 1XMQL 3R2IA 1SEBD 4Z9CB 5LMNQ 4GKJL 4LF7L 1V8QA 4HEDA 3FPPA 1HXYD 1U4PA 4A3EG 2R61A 2HQEA 3A5ZB 4JPBW 1EY8A 4L5QA 4CKCA 5K5PA 4DR6Q 1WCMG 3PMFA 1DM0B 2NTSA 2UXCQ 1G8ZD 1SE3A 2RSNA 3VR2A 1EL0A 4H7BA 1C48A 1U4RA 4WJ3M 3RD4A 4C3JH 5C3EB 1HNWL 1YBYA 1ONLA 5T1IA 4FXKC 3MEFA 3F2CA 2XN9C 3ICEA 2B2VC 2QILA 1TR5A 4PNYA 4QIWB 4WRDA 1WD1A 5ELOA 1L1OB 4DK3C 1KNAA 1TWCB 4QGUA 3HRZC 2LS01 3QG1A 1M1KC 3HOUB 4OIJA 1ET9A 1VQBA 2NZ1D 5LHY1 1VDZA 4XQJA 3HKZG 4A3BH 1I3QB 4K2KA 4C3JG 5L37A 1LT5D 2UXBQ 3N52A 3T4AC 3W5OA 2ZM6Q 1DOKA 1IL8A 4LK1C 1ZXTA 1SFOH 2NBFA 1HR0L 1YIJA 1BBXC 2B2VA 3KYHC 4RFBA 1AE2A 2PO4A 2NVTB 3VA5A 2EJGC 4OWTB 3NELA 2FINB 4DAMA 1F2ZA 5CBEE 4P72A 1K8GA 4JI7Q 4GLXA 4IFDI 2NN6G 4J1MA 4KKSA 2A8VA 4KY6A 4CDCC 4AYBE 1IBLQ 2B63B 2EY2A 2E5LL 5I9PA 1X56A 4P74A 5KIXA 1PFSA 3CHBD 3MHBA 4BBSB 3JAMc 1I4RA 2XVSA 3IAYA 1Y1WB 2B3GA 4A3IB 4Y52H 2Q2IA 5C44H 4A93G 2UXDQ 3QOLA 1HR0W 2HD3A 3URYA 3E5SA 2IX0A 3V96A 2L5TA 2R93H 5C4XB 2QKIC 3T1HL 4IOCA 1JB7A 1PVOA 4UPAA 5AJ3L 4DV4Q 2E2JH 1XYIA 2QGQA 3BZDB 1HA6A 4JI5Q 3ZYYX 4RMFA 1FNVA 1JE4A 3DWQA 5E4XA 4JI4L 2ZJRA 2MO1A 1UEBA 2BOSA 1WTVA 4O0AA 3STBD 5C44G 3Q22A 5G3LD 1PTOH 4A3GB 3A74A 2N55A 3CC4A 4YY3L 3WWVA 1B7YB 3GTQH 4JV5L 1WFQA 4M1UB 4BXXG 1VQHA 1CUKA 5JEAG 2J7ZA 3K57A 2Z6KC 2K04A 4LUZA 5K36G 1VQOA 4A3DB 4MNOA 2UUCQ 5M5YB 3FRPB 4BBRB 1STNA 5LMNL 2DNEA 2EYPA 4LF8Q 1XTDA 4DA2A 2JA5B 3TZUA 3ER0A 4HAEA 4DR6L 2DN8A 4KKTA 4PMCA 3CCRA 1WOCA 3FEWX 1QOHA 1L0WA 2NTTA 4KMUC 2FMMA 4RGNA 4HJ5A 1WI5A 4LF5Q 3H6MA 3NHHA 3I91A 1GUGA 1R9TB 2F0HA 2KCTA 5H1SE 2F4VQ 4AQYL 5CV6A 1WTWA 1VF7A 2OQ0A 4CHTB 4DNIA 2LXKA 4OX9Q 3K7AH 1YHBA 4ALPA 1FGUA 1WJJA 3KJPA 2CQAA 3UDFA 1CHQD 1Y8OB 1E1TA 4XT3B 3ITPA 5LMNW 3HOWB 1EY9A 4OXPA 1IKMA 1LTTD 1B2TA 3V05A 5FLMH 3D8GA 5FK9C 2CWAA 4IN3A 1FNUA 4R4CA 3OIQA 3MZ5A 2KECA 3RR5A 1QG7A 4DR3Q 3J81L 2XGTA 4LF4Q 5CR3A 1CQVA 3S15B 4I7ZC 3CCUA 1TS4A 2F0LA 5J39A 2LKVA 1FYCA 2E2IH 5E4WC 2IW3A 3AFPA 3I4NG 4KJOA 2K1BA 3MXUA 2ZXRA 3PF5A 4IPGA 2E8GA 2Q2HA 4MZ9A 4YHHQ 5FLMG 1JMCA 4OWXB 1IBLL 1HPCA 4DV1L 4C3JB 2FXQA 3SHLA 5I4DA 1BBWA 3A8IE 2Q2UA 3F2DA 1EQQA 3C2PA 4DV2Q 1ZYRC 2WACA 5JAVA 4A3JH 3VR6A 4DV5L 3EBEA 1GUSA 2XTIA 3OPOA 4ZLTF 4NPSA 4G4KA 1IBKQ 4MTKA 1G2SA 4PMBA 1FL0A 4RGMA 4NP5A 1KDAA 1FNWA 2FMCA 2KJXA 1IXRA 1SMYD 3HOYH 1DZ1A 4JI2Q 2ZTDA 3I90A 2EY5A 4A3BB 2MFIA 5M5XH 1HA5A 1PTOC 4C3HB 2CHBD 3DXJC 1I94L 1SFOB 5EAYA 1F2YA 1S3OA 3G6JB 3NPPA 3I55A 2ZTEA 2I07B 5FJ8H 5KNCA 1RTNA 1I5FA 5JJIA 3RZOH 3KJOA 3J80E 3J7AV 1SYBA 4TSSA 3NTIA 5IGEA 4DV7L 1Z6HA 2F0GA 3HOYG 1Y69U 2M2LA 1H9MA 2F0FA 1J9OA 1TS5A 1KQSA 1SROA 2EYMA 4JI0Q 1BCPD 4RWSC 2R92H 5EBDA 5IT9L 3TN2A 2F0DA 2RCNA 5CBAE 2EXDA 3TMEA 1XWEA 2F3IA 4OELB 3KOJA 1DONA 1YEZA 3TP7A 1RIPA 2R93B 1H9JA 2XIWA 2NZOA 3DHQA 3PSIA 1E3PA 3BU2A 1AN8A 3A0JA 1VQAA 3MA2B 3JAMi 3NENA 2G9HD 1MIUA 2F4VL 2C9OA 2QA4A 2A19A 4UAIA 1Y1VH 5DLQE 3TDQA 5EPJA 3TS2A 4DR1Q 3U58A 4H02A 4LFBL 1PH1A 3AFQA 2KBNA 4JBJA 1PTOB 3VDYA 2VS1A 3ND8A 1EOTA 4G7OC 3W3AA 1N34L 4DUYL 4XTCS 4DR3L 2Y0SB 4KK7A 4LF4L 2NVXH 4FDBA 4IFDJ 1EWCA 2BE5C 5KNBA 1Y1VG 2G5DA 2NUCA 4R4TA 1AEXA 4A75A 4JBMA 2O5IC 3JC66 4HR7B 4UY8C 2D62A 2EY6A 1NSNS 2O4XA 4JOIA 4YHHL 2KA7A 1O7YA 1C0AA 1C4QA 3OTOL 1GM5A 2A6HD 4BY7G 1ENAA 1D5XC 2L1BA 4RCNA 4ZKBB 2KCNA 3HZXA 2I5LX 3D4WA 1VQJA 3HOXH 1STGA 3UI2A 2K5DA 3K7AB 2WB1B 5EJWA 4APVA 3S9WA 2YTXA 2I5MX 3KLSX 1D5ZC 5FOBB 1UEAB 5EPLA 1KLGD 4UP9A 1GHJA 3FDTA 2D9UA 1M8AA 1QJOA 1TWAH 4DF7A 2MQHA 2F4IA 2ICEC 1VQCA 1IW7C 1HUMA 1WYDA 4RKBA 3M4OH 2F0IA 2UUBQ 3PF4A 1SN8A 3V2TA 3I4OA 4X62Q 3PO2G 3F2BA 3EFXD 2NN6I 3KLRA 3KDFA 2EQSA 1L0YB 5I6YA 3HKZE 1A2TA 1UNSA 1SMXA 1IYJB 3VR3A 3TRZA 4P2CB 3OSOA 2F0TA 1LUZA 1OXUA 3VYRA 2PYKA 4JI0L 2PQAA 5IGCA 1HZCA 2JE6I 1Q8KA 1HZBA 2QW7A 3OW2A 1UE6A 1LT3D 2A5HA 3JAML 4A3JB 4RH6A 1QUQA 2ID0A 4KHPL 1AP0A 1D1IA 1MKHA 3PGZA 4GNXC 4DNTB 1JB3A 2JA6H 3GTGH 5IYBH 4TVAB 2C5CA 5M5XB 2DJFC 1SBBB 1O7ZA 4F7XA 2IHEA 2UUAQ 1N33Q 1UAPA 1CHPD 3ZJYC 4C56C 1XMQQ 2Z1CA 3BDLA 4GKJQ 1SAPA 2ALYB 4LF7Q 5T1GA 5F2DA 4JI8Q 1K0SA 3RZOB 1CTMA 3ULPA 1DCZA 1XTCD 1YNXA 1E0BA 2L9HA 1XXGA 2FJ2A 4QUFA 3HOUG 2WKDA 4JCVE 2IT1A 4JVZA 1EEID 3RNUA 4F87A 4KN4C 1XNRL 1F9QA 2CH4W 4KY7A 4R8IA 2B63H 1QUQB 2MGSA 4X65Q 1HNWQ 1H9RA 1TWFH 4IUTA 4CDEC 2H1EA 2QF7A 2JXMB 4I65A 1S72A 5BN5A 1U9RA 1PH2A 1II3A 4UHVA 3SK5A 1VQIA 3CCLA 2R92B 5GAEC 1CT1D 2D2CC 5IY0A 1PFMA 3T56B 2ZTCA 3H3VH 2F0WA 3J7AF 5C4XH 3CF5A 1Q1BA 3A54A 4K0KL 3AB9A 3DUZA 1STYA 2B63G 2EYLA 1PRTC 4LFAQ 4UDUC 3BVZA 2OQKA 1AE3A 1Y1VB 2PZTA 4CDFC 1HR0Q 1ENCA 4ID6A 3EROA 4YWLA 4U673 4BBSG 3QR8A 1Y1WG 4NMZA 4A3IG 3I8ZA 1Y8NB 1B53A 3NUCA 1CA6A 1HUNA 4YWMA 4NDXA 1SLJA 1X6OA 2Y0SE 3A7AB 5C4XG 1VF5C 3C1EA 1U5KA 3CP0A 1B3QA 4DR2L 1FJGL 4AH6A 4GN5A 1VQKA 2NVXB 2E5LQ 3HOZH 3RZDH 1XPRA 2V1CC 1SSOA 3QJYA 4GOPC 5JJLA 1JWSD 2PI2A 1S5BD 2CW0C 3J7YW 2OEOA 2UU9Q 5IE8A 1Y14B 4HIMA 5IYCG 4IURA 3D0FA 2AQ2B 5JVG3 2GVAA 3J7ZC 4IJLA 3PIP3 1I4QA 4LF6Q 2E2HH 3S1NH 4A3GG 5D3DA 3T1HQ 3J81E 3H91A 5AJ3Q 1R9TH 1AH9A 4IALA 2HDLA 4OEMB 1ICWA 1STAA 4A3DG 3H0GB 2CH4A 2WB1E 4BBRG 2D0OA 1YNNC 4HCEA 3HOXB 4L5TA 4YWKA 3UDIA 4DKAC 4JI4Q 2JA5G 3FHWA 3R2TA 1L0XB 4GOPA 4C3IH 4CBVA 3NTHA 3HOWH 3PO3H 4IUVA 5C4JB 1J8IA 1SJHD 2RDGA 2F0VA 1WTOA 1PRTB 1I4HA 3IL8A 3RLNA 2NB0A 3Q6SA 5M9OA 3KBGA 3E9IA 1PLFA 1JICA 3I4LA 2J0TD 3IFDA 1W6JA 2F0NA 2OXPA 2UUAL 2RQXA 4B08A 2PZWA 1QVFA 4FXDA 1GOZA 1O78A 1FD7D 3M4OB 4JI8L 3PUVA 2B29A 2I46A 5IP7H 3HOWG 4V190 3E9HA 3TP6A 5C0XH 1MSGA 1S5ED 3J81j 2A69C 5KNDA 4X64Q 2BDNA 4XYOA 4GOPB 1L2FA 2IL8A 4X65L 4OIKA 4B3TQ 1HQMC 5LL6X 2ZXPA 4QB4A 2XSCA 5BR8L 3H3VC 4L63B 1RTOA 1PFNA 4AQYQ 3K58A 1S40A 4ZK9B 1JWUD 3S1QB 5D14A 1IKLA 1NBWA 3HKSA 3DWPA 4IPHA 2MO0A 4X6AH 2QDLA 1N8RC 3BYYB 4XXEA 1LTSD 1NNXA 1BKBA 4A3MH 5JJZA 4K5XA 5DNFA 5C0XG 2Z0SA 2E75C 4NW2A 4QCLA 2HT1A 2BA0A 2JA6B 3GTGB 4LFAL 4C3HH 5J1ZA 3MXNA 3S17B 3RUZA 4DAVA 2LMCB 2VB2X 4GKKL 1NE3A 3TP5A 4DNRB 2MJ8A 3M9BA 1O7LA 5I2XA 2F0SA 3CCQA 2LXJA 1EWHA 1VQMA 3T13A 5ELDA 3QOJA 3H09A 1A3UA 4ZRZA 3F8TA 2YYZA 3CW2C 3K0YA 1F2LA 3X3MA 1LM0A 3S1MH 3EJIA 4YIJA 3E0EA 4DV1Q 4IQZA 2AKWB 5GQOA 1DGSA 1TWFB 2GN5A 2KOLA 2M00A 4IO9A 4A3BG 1MBYA 5ELBA 4C3HG 2I0QA 1S5FD 4L6TB 3OIPA 4HJ8A 4N9TA 3U4VA 2UU9L 1ZEQX 4HJAA 5IYDH 3WOEA 4DV5Q 4DPGA 4H0LC 3MXNB 3OHXC 4FF3A 4LF6L 3SK6A 3M7GA 5ISRA 1MJEA 5GAGC 4KI0A 2F0OA 1G51A 5A2QE 2IY5B 3DM3A 4OO1H 1RL2A 1IYUA 2KUMA 4KHZA 2XWJB 1I94Q 4HJ9A 4DAYA 5AFWA 3NWTA 2ASBA 2L4NA 2EJMA 3AQQA 5IYDG 1B50A 1VQEA 1D1KA 1GO3E 2JJQA 2WAQB 1A63A 4DV7Q 2R93G 2XRSD 3NK9A 1F9PA 5JEAJ 4WFN3 3K7UC 2SEBD 4OO1G 3HOZB 3RZDB 2PMZE 2RCFA 1ZYRD 4R4OA 4TRDA 1D6EC 2PW5A 2DGYA 1IBMQ 2MNAA 4C2MH 4EQOA 3M3YB 2VZAA 3A8JE 3P7JA 3OW7A 3S1NB 2E2HB 4X3TA 4DAYB 4X64L 2F52A 3HG9A 2HDMA 4B3TL 2N3SA 1HNZL 3CRKC 1JOQA 1PTOD 3SE0A 2K28A 1JE5A 2X6LA 3IKJA 2Y0SG 4JC0A 1B4OA 1XNQL 2R7ZB 5BN4A 1N9WA 4TQUS 2SNMA 1KLUD 2B2YA 1TY0A 4C3IB 3J80c 3PO3B 4LFBQ 4S3SA 1HZ9A 3DLLA 3B6YA 2Q8RE 5FLXL 4A76A 2K33A 2K52A 4JK1C 1I4GA 1EIYB 3A7LA 1JJGA 4Q5VA 1X55A 5G3LF 1N34Q 1JR0D 2D5DA 4DUYQ 1CSQA 2CVRA 2L55A 1J5EL 2EY1A 3TP8A 3H15A 5FKAC 1NUCA 3U9SA 2WB1G 3CQZB 3PCOB 2NYZD 1DYQA 1B9MA 1OXSC 1SNQA 2PW7A 2HIXA 1HNXL 4NXMQ 1XMOQ 4HMJA 5E7NA 4GN4B 1EY7A 1PZID 3OTOQ 2FFKB 4IUPA 1RD9D 3G4SA 3NQIA 3T1YQ 4P71A 4QIWE 2MP1A 4MHEA 4KN7C 4XYQA 2K50A 3QO2A 3S24A 3GD7A 4DV3L 1JQYD 1SNDA 2R7DA 2CWPA 2F3WA 2B8GA 4EGVA 4A3MB 5BN3A 1LTGD 1RDPD 5GROA 3SDZA 5CORA 4LF9L 1VS0A 3A55A 3CCMA 1A3VA 2BE5D 4OL7A 4XT1B 2KHIA 2JEAI 2K5NA 3KK7A 2I5HA 4HMIA 2DY8A 3GP7A 3I3CA 2JA9A 1EU3A 3U50C 2NZHA 3HOVB 3GQBA 3NTKA 4A3JG 1EY5A 2J4XA 1YZ6A 1S5CD 2MHVA 2VW9A 4RHRA 5D3IB 1EU4A 1SE2A 3D6CA 3BZCA 1RF2D 3NSWA 3Q8DA 1HHVA 1TXYA 3ONAB 3S1MB 4FO2A 3GTPH 3LWUA 2VL6A 4RAUC 2EYHA 5JJKA 3GV6A 3A56A 2LSSA 4H44C 1IBML 5LMUL 1BQQT 1SNPA 1SE8A 1MGSA 5FJ8G 1KRTA 2VXWA 4PZ6A 4HJ7A 4KHPQ 2K5HA 5KYLA 1YITA 5DM73 5FO8B 5HURA 3ND9A 4PMWA 1LT4D 1EYAA 1I4PA 4JBWA 3NEMA 3T16A 1LYLA 4A3LH 4C1NK 2OTJA 1ESFA 1IW7D 1ILQA 1S4ZA 2XRQD 1ASYA 4LMQD 1I50H 2QCPX 3GTMH 3TSSA 1QZHA 1PH7A 1EYCA 1EY4A 1TVXA 2LFNA 4POGA 1PYBA 4JOIC 1KAWA 2WAQE 2R92G 5CV5A 2OTLA 1X3PA 1GHKA 1QNKA 4RG1A 3I73A 2G9DA 2PNRC 4ZKCB 4QF4A 4DR5Q 4IFDH 1XNRQ 2KHSA 4ULLA 3FKIH 5EQ0A 1YNJC 1X3EA 3CU7A 2IPKD 1H95A 2A1AA 4L5RC 2VQEQ 4QMGA 3NXWA 2QEXA 4ZQ3A 3R93A 3KF6A 2RF4A 5E3FA 1VQFA 4ZUIA 4NB3A 4DAPA 1ML0D 4C2MB 5EPKA 1BCPF 2N78A 4M8AA 2E74C 3VA7A 4DV6L 3G6EA 4NXML 2EIFA 1XMOL 3UDGA 1XPUA 2A74C 1TQOA 4JG2A 4N9PA 4K0KQ 4A3FB 2JYOA 1PH3A 4DK0A 3T1YL 1TS2A 3H0GH 2B2WC 1IL2A 3C1FA 3GTKH 3EA6A 1EIHA 3J7A5 2A73B 5C4JH 3GTLB 4B3SL 1A3TA 3N6RA 3PV0A 1RHPA 2K05A 4RCOA 1RJTA 4X3KA 1X9NA 1E24A 2WV6D 1TS3A 4B3RL 1KL9A 2AUKA 2B8FA 3CPWA 4IJHA 1AZQA 3CMEA 3D31A 4K8IA 1E22A 5EKIA 2RVLA 1KDCA 4DR2Q 3A8KE 1FJGQ 1VQPA 1SRUA 2K03A 3J80i 3H0GG 5I2YA 4HCSA 3HOXG 2B2WA 4BS9A 4LJZC 2L0CA 1G6ZA 4X3SA 3RLFA 3L3OC 1UE1A 4DUZL 5EKLA 1JC7A 2PZUA 1T5EA 4XDXA 4JI6L 1PYWD 1B8AA 2BA1A 1FVIA 3QWNA 2CQOA 2PPBC 3L7ZC 3W2DA 1YHAA 1PRTD 3HS0C 3P20A 3CPFA 2F0KA 3C3LA 1BXTA 1E1OA 4B9WA 3IFTA 1GXDC 3S1QH 3LX0A 5CMDA 3VYSA 1MD2D 2L11A 1OXXK 1TWGB 5CYUA 4HSVA 1G2TA 4A3KB 1BUVT 1VCIA 3UE0A 1Z47A 1VMCA 4GZYC 1EEFD 2HQLA 1X3FA 3HEJA 5JOBA 4Y7NH 1PH5A 4CDDC 3KDFB 5C4ZA 1S5DD 2RA4A 3S17H 1A15A 2XNAC 3TBIB 4GS3A 1SDFA 2JEBI 5IODA 2CW0D 3PUWA 4K5VA 1K8OA 2Q2TA 2OWOA 3OWEB 2RKSA 1ZKOA 1EFID 3VR4A 3X3NA 3C46A 1JJCB 1VQ6A 1LO5D 3PIO3 5M3MH 2PQAB 3NWSA 2F0UA 3CMAA 4RGOS 1LTRD 1V1PA 3J81c 4DR5L 4QUCA 1PMRA 4P75A 3RLOA 3MXGA 4XQQA 3GTPB 1OO9B 5M5WH 4R1JA 4DXFA 2JA6G 2F0EA 1LTBD 5IYBG 5BR8Q 2SOBA 2VQEL 4RGTA 1YNND 4K6DA 3R3OA 2JA8B 3KLWA 1CFMA 3MWYW 4IUUA 1EYGA 3DMUA 4HSPA 4JYAL 1K3RA 3OMCA 2A68C 4PG3A 2EVBA 3CCJA 1QNUA 3O13A 5M3MG 2YU9B 1CKMA 3I2ZA 1Q86C 2KHJA 1CK1A 4AYBB 3U4ZA 3PIPA 3A5UA 1T9HA 5D65A 3SR1A 1V43A 1V1PB 1I50B 4LFCQ 3CRLC 3GTMB 4GKKQ 1Q7YC 3QIAA 4AIMA 3CAMA 4JI3L 4IZ8A 2E76C 4X3UA 2N8NA 1PZJD 4BWGB 2HIVA 4FVMA 4DGZA 3KLSA 2A69D 3NQTA 4XQNA 4LUOA 4HIDA 1JJ2A 1HTPA 1VQ7A 2RBMA 1KRSA 4GLVB 4X66L 1VMPA 3AMUA 1JCKB 1STEA 2GVBA 1EWIA 3FKIB 4FF2A 1BVSA 4YCWA 2IWHA 2Z8LA 4BY1H 1NTGA 2B39A 1XX8A 1AW7A 5FLXE 3RMHA 3M3YH 2WIIB 1F2MA 1GKHA 1K8AC 4NXNQ 5M3FB 2WAQG 1WVLA 2NVQH 4ZYSA 5IIFA 3CXCA 2A6EC 1PFBA 2Q8TA 2Z4IA 2PQEA 3ULLA 2JA7B 1D5MC 2DY7A 2KCCA 1B70B 2R7ZH 3GTKB 1K8MA 3HOZG 3S1RH 5IWAQ 3SVMA 2IX1A 4V0BA 1PH8A 3I4MH 1TWHB 1QVGA 4DR7L 4POFA 1KNEA 4J8QA 4B9XA 1VQ4A 1AZPA 4LW1A 4GN3B 1LABA 3U9OA 5LL6S 1SNCA 2QDBA 5IP9H 5GAHC 1EY0A 5C5LA 1EOVA 2R7ZG 1OTCA 3EIVA 1WCMH 3CQZH 2K5QA 3OYYA 2L12A 3S14B 1SNOA 3I7FA 4C3IG 3CKIB 3PO3G 1TIID 1JOKA 3VR5A 2DJGC 5CV9A 1K3BC 2K32A 3M4QA 2MUYA 1Z9FA 3K80C 3Q23A 5KGUA 2OF1A 1HZAA 1L1OA 1HNZQ 3CCVA 3M4PA 1G6PA 1A6XA 1K0RA 5IP9G 1G91A 1XNQQ 4N8X1 1E2WA 1E7ZA 1GUOA 3EN2A 3NE5B 5J22A 4UP7A 2VQFL 4KD4A 2GA4B 1QILA 1J6QA 1TT2A 1BDOA 5IP7G 3BS1A 5C6AA 2AQ3B 5CC4A 2F03A 1VQDA 2L15A 3RN5A 1PH9A 4B3MQ 1B9NA 2F0PA 5C0XJ 4R4QA 1EQTA 4Y7NB 3M4YA 1F9SA 3VYTA 3P75A 3H94A 2RHSB 1J5EQ 1N32Q 1M90C 4LFCL 2HHHQ 2KCMA 3BDCA 1K83H 2BCOA 5IT9E 3MFYA 2K4KA 3UDXA 3HOVH 1Q1EA 2C35B 1Q46A 2NN6H 3K5OA 1KAAA 1U0LA 1SJED 5M3MB 2K75A 5KEEA 4A3MG 1HNXQ 3I70A 3E6ZX 2H4OA 4ZAIA 1I6VC 1LT6D 4IPCA 5M5WB 1AFPA 2F1MA 4A93H 4YCVA 2EXZA 4FF1A 4NKLA 2IJ0A 1EZ6A 4WJ4A 3J81i 4DR4L 4E6IA 4DV3Q 3HOVG 2D0PA 4DN4M 3PUZA 3T53B 4BA2I 4NXNL 4BA1I 3PQIA 4K2LA 2YTVA 2DNCA 4MTNA 4ME3A 1I4XA 3CCEA 1Q12A 1VQ8A 3AYHB 1EQRA 1SE4A 1D8LA 1LACA 4KTAA 4LF9Q 1LTAD 3K59A 2E2DC 4F88A 1D2BA 2B2TC 2OT2A 1WTXA 1RKNA 5ELNA 1E2VA 5IWAL 4OHJA 1SYDA 1LTLA 3LNNA 1Z7TA 2HUGA 4N8FA 1X3QA 4BXXH 5C5MA 5JEAH 5K36H 1XJVA 2TSSA 4DV0Q 1BOSA 2ZJPA 4K5WA 4GLAC 1MI2A 1A2UA 1UE5A 1QZGA 1MHWC 5IGDA 1E2ZA 2B2YC 1NY4A 1KDBA 3D4RA 4KKUA 2KQ3A 4BY1B 3PUYA 1UWVA 2B2TA 2BH8A 5ELFA 2VUMB 1GJXA 4K6LA 2B2UC 4ILWA 5LMUQ 1GUTA 4ODGA 2WFWA 1VQGA 3ERSX 5JPMC 3EVQA 2NVQB 4A3FH 3R8BA 1VQNA 1YJ9A 3BDOA 2X6GA 2K14A 3KF8A 3FP9A 5A35A 4JW0A 1EQVA 2AQ1B 1U4MA 3S1RB 4LNQA 2BDOA 2ENBA 3K5MA 4O42A 4H13C 2AMCB 2UXCL 3GTLH 1CA5A 3I4MB 3OWFA 2PI2E 2B2UA 1RCVD 1H9KA 4KV6A 2AWNA 4B3ML 1YHQA 2N88A 1PH6A 1CSPA 2XWBB 4ZUJA 4UP8A 2K7VA 1CKOA 1X32A 5C3XA 4A3FG 2Z6KA 2EJFC 5TSSA 1N32L 1NMFA 1IZ6A 2HHHL 5IGFA 3GTOB 3I4NH 4A3EB 1BO0A 1TKWB 2KENA 2Z6BA 4K14A 3JAME 1A0IA 5HGQA 1QE6A 3D3RA 4R9WA 1WCMB 3KF8B 2JSOA 1SYEA 1O7IA 4DV6Q 5C3WA 2JK8A 2EE1A 5I6WA 3E0JA 1HJPA 1TU2B 2RSOA 2UXBL 1P16A 5EKKA 3MXPA 2ZM6L 1XPOA 2R6GA 1NR4A 3G7LA 2RDHA 3AEVA 1PTOF 4YCUA 1QVCA 1C8CA 3LGJA 4EX5A 3S16H 3STBC 1KHIA 3GDEA 4OWWB 4IPDA 1X54A 1W2BA 4JI7L 1TWGH 4CJ0B 4B3SQ 4DXGA 4A3KH 2WP8J 2VNUD 2QEJC 1PHJA 1EIGA 3HKZB 1GD7A 4B3RQ 3FPUB 1NJIC 1K73C 4G57A 3TZDA 1YNJD 1CKNA 1I6HH 3GTJH 2NWGA 4KY5A 4KJNA 2UXDL 4LAAA 2CKZB 1EUJA 1K83B 3GV3A 4O1NA 3CD6A 3VYUA 3H3VI 3G48A 1M4VA 5ELEA 1GVPA 4DUZQ 1C9OA 4DV4L 1Q90A 4DV0L 4A3KG 4HN7A 5EGTA 3W1BA 4JI6Q 1X65A 4JI5L 3SK4A 3DM1A 5KYIA 2YV5A 4Q0FA 3UE1A 4TKOB 4A93B 2LY7A 3F2UA 5J3BA 2JA8H 4IUQA 1CKNB 1ESRA 4DK6C 1CQFA 5C4HA 4CGYB 1T5XD 1G291 1JORA 5FO9B 5HGTA 4O2DA 3NBIA 2PCFB 5DAUA 1QCBD 3P1HA 4DFAA 1EZ8A 5E1FA 2YU9H 2UUCL 1MJCA 2HCIA 3MFGA 1YJNA 3MTSA 4LF8L 3Q24A 2WINB 4HTHA 4RA8A 3LWEA 2OCEA 3DEPA 3PUXA 5C44B 1VQ9A 4R4IA 2JA8G 4QY7A 3ERQA 1N36Q 1Q82C 1UUPA 5JVH3 4LF5L 1SR3A 3F1ZA 2E2JB 2K01A 1V1OA 2SDFA 1CZGA 1PH4A 4F8MA 4OX9L 1HQRD 4AYBG 4CJ2C 3TREA 4A3LG 2EYOA 1DXMA 3BZKA 3K81C 1YI2A 1FR3A 1OXTA 1NMGA 1W6KA 3CC2A 1DOMA 4BY7H 4JYAQ 2ZXOA 4QJFA 2HCCA 3L0OA 1SMYC 5M3FH 3GTQB 5IGGA 3HFZB 5A2QL 4JBKA 2BH2A 4IFDG 2V4DA 2O5JC 2JA7H 3NP8A 1JT8A 3FKIG 2RDFA 1V1QA 1BBUA 1KABA 4J15A 1SYCA 4P73A 2FHTA 3IRBA 1EYDA 1ET6A 4EQ5A 5I9OA 2YTYA 2F0JA 1RODA 1TWHH 4JI3Q 4FNFA 5C0XI 2EPBA 5GADC 1HFNA 3QB3A 1P8LA 1WTPA 1ILPA 5IOCA 5M3FG 3KF6B 2NVYH 1CI3M 1IHZA 4LUVA 3WOFA 4X66Q 3BG3A 2AHOB 4DV2L 4CKEA 2EDGA 4KLKA 4WJWA 2CFMA 3MAQA 2JA7G 3MVVA 1ENFA 1KIXA 3I4NB 3PO2H 1BCPC 1EY6A 1CM9A 1GUWA 4LWCA 3TS0A 2ES2A 4A3CH 1BF4A 1PDQA 3G71A 3S14H 3FVQA 1IBKL 1KTKA 5JPNC 1STBA 1DJRD 2A68D 3BVGA 1HCZA 1HTLD 3K5NA 4JI2L 3S2DH 4CJ1B 1NR2A 4FXGC 1F9RA 3K5LA 3S2HH 1B1ZA 3I56A 1PYSB 1LV9A 3DWAA 4A4IA 2ZJQA 4RHSA 3HP3A 3PIOA 3BJUA 1SXTA 4ABNA 2E2IB 1H9SA 5EBCA 2KEEA 3NBHA 3S16B 3SGIA 5CGKA 4A3CG 1HFGA 2RHQB 1PA6A 1JWMD 1QB5D 2R3ZA 4DR7Q 4K8JA 4R8NA 2VY3A 2Z9HA 3K6OA 5C3EH 3D4DA 2AUJD 1VQ5A 4FYDA 2TMPA 4CKBA 1SNMA 4KHVA 1KC8C 3E3XA 1B3AA 4OGQC 4IUNA 3GTJB 1I6HB 2ICIA 1CZWA 1SYGA 4WORA 1K28A 4FF4A 1R4PB 5FLXc 3OMGA 1TWCH 1EIFA 1QWYA 4JI1Q 1N36L 3MC0B 3HOUH 3SEBA 1R4QB 2KEDA 1Y8PB 3HOYB 1JOOA 1H9SB 1HRJA 2A6HC 3NBHB 2ATWA 1I3QH 1BR9A 2ZT9C 4OO1I 1BCPB 2F3VA 1UE7A 5C3EG 2EZVA 2A6ED 3L9AX 4OONA 3I72A 1YJWA 1WTHA 1VQLA
chains in the Genus database with same CATH topology
1Y1VH 5DLQE 4DR1L 1XNQQ 3TS2A 1N9WA 4TQUS 2PNHA 4DR1Q 1E7ZA 3U58A 3EN2A 4H02A 4LFBL 4UP7A 1PH1A 3AFQA 2VQFL 1K9MC 3J80c 2NVTH 4IOAA 4LFBQ 1HZ9A 3DLLA 1J6QA 3B6YA 2KBNA 4JBJA 2VQFQ 3GO5A 5HY6A 5IP7G 4A76A 2VS1A 3VDYA 2K5VA 2K52A 1VQDA 2L15A 3RN5A 1EIYB 1PH9A 4B3MQ 1N34L 2AWOA 1JJGA 1X55A 4GNXA 5C0XJ 4DUYL 4XIGS 4QL5A 4XTCS 1N34Q 4R4QA 4DR3L 4DUYQ 1CSQA 4LF4L 4HIOA 2NVXH 1J5EL 4FDBA 4IFDJ 2R7FA 4BBSH 2RHSB 1J5EQ 1N32Q 1M90C 4HIKA 4LFCL 1Y1WH 2HHHQ 3H15A 1Y1VG 4A3IH 2KCMA 3CC7A 3L2PA 1K83H 1KXLA 4R4TA 4JBMA 4A75A 2K4KA 2WB1G 3PCOB 3JC66 3UDXA 1OXSC 4UY8C 3HOVH 2D62A 1A8VA 1Q1EA 2C35B 4JOIA 1Q46A 4YHHL 2H5XA 4L5SA 2HIXA 1C0AA 1U0LA 1HNXL 4NXMQ 2K75A 3OTOL 1XMOQ 4A3MG 1GM5A 5E7NA 4BY7G 4GN4B 1HNXQ 3OTOQ 1KD1C 3G4SA 3KFUA 2I5LX 3T1YQ 4P71A 4IPCA 1VQJA 1C7YA 4QIWE 3HOXH 3M7NA 4A93H 2K50A 5IYCH 4GNXB 2VUMH 3S24A 4YCVA 3GD7A 1YVCA 4APVA 1OXVA 2YTXA 4DV3L 2I5MX 3K0XA 3M85A 4WJ4A 3J81i 2R7DA 1PV4A 2CWPA 4DR4L 4A3GH 4DV3Q 3HOVG 2D0PA 3PUZA 4UP9A 3TEHB 4BA2I 4DR4Q 4NXNL 4BA1I 2YTVA 1ASZA 1D7QA 2IHFA 4MTNA 5GROA 4ME3A 3CCEA 1Q12A 1VQ8A 3AYHB 4A3DH 4LF9L 1EQRA 1TWAH 1VS0A 5M5YH 2MQHA 1D8LA 4BBRH 1Q81C 4LF9Q 2DUDA 3CCMA 1VQCA 1WYDA 1W3SA 2CCZA 2KHIA 2JA5H 2JEAI 2K5NA 5ELNA 5IT9c 5IWAL 2UUBL 3M4OH 2I5HA 1LTLA 4X62L 1V9PA 4PZ7A 4BY1G 2UUBQ 3PF4A 1SN8A 3I4OA 2VUMG 2JA9A 4X62Q 3PO2G 3F2BA 3U50C 2NZHA 4A3JG 2NN6I 3KDFA 1EFWA 1X3GA 1HH2P 1YZ6A 2EQSA 4BXXH 2VW9A 3HKZE 2JQOA 3BZCA 1XJVA 1L1OC 4DV0Q 2ZJPA 3Q8DA 4GLAC 1TXYA 1SMXA 1IYJB 3GTPH 3TRZA 1UE5A 1QZGA 1A62A 2VL6A 1LUZA 1OXUA 5JJKA 4JI0L 1NY4A 2PQAA 3GTOH 1HZCA 4A3EH 2JE6I 1Q8KA 1HZBA 3PUYA 1UWVA 2BH8A 2LSSA 1IBML 3OW2A 1UE6A 5LMUL 4PZ8A 4JI1L 1SE8A 5FJ8G 1QUQA 2ID0A 1KRTA 5LMUQ 4KHPL 2WFWA 4PZ6A 4HJ7A 3I4MG 4KHPQ 2K5HA 1MKHA 1VQGA 3ERSX 3PGZA 3CCSA 2N49A 3ULJA 4YY3Q 4GNXC 1YITA 4JV5Q 4PMWA 3K8AA 4A3FH 4JBWA 3NEMA 1VQNA 2JA6H 3GTGH 5IYBH 4TVAB 1LYLA 1YJ9A 1N33L 4A3LH 2K14A 3TQYA 3W1GA 3FP9A 3RN2A 3S15H 2IHEA 2UUAQ 1XMQL 1N33Q 2OTJA 1ASYA 5LMNQ 4GKJL 3ZJYC 1I50H 1XMQQ 4LF7L 3GTMH 1QZHA 2ALYB 4GKJQ 4A3EG 4LF7Q 4LNQA 1PH7A 4JI8Q 3A5ZB 4L5QA 1PYBA 2AMCB 1KAWA 4JOIC 2WAQE 3ULPA 4POGA 1WCMG 2R92G 1YNXA 2OTLA 3GTLH 2PI2E 2UXCQ 4RG1A 2AWNA 3HOUG 4B3ML 4JCVE 2IT1A 1YHQA 3RNUA 1PH6A 1XNRL 1CSPA 4WJ3M 4UP8A 4C3JH 4DR5Q 1HNWL 1CKOA 1YBYA 2B63H 1QUQB 4X65Q 1XNRQ 3MEFA 1TWFH 3F2CA 2Z6KA 3FKIH 4A3FG 1HNWQ 1X3EA 3ICEA 1H95A 2A1AA 1NMFA 1S72A 1IZ6A 4L5RC 1N32L 2VQEQ 2HHHL 3I4NH 2KENA 1PH2A 2QEXA 1A0IA 3KF6A 5HGQA 1VQIA 5ELOA 1L1OB 4DK3C 3CCLA 2UXCL 2RF4A 5GAEC 1VQFA 3KF8B 4NB3A 5IY0A 4QGUA 2N78A 1M1KC 4DV6L 2ZTCA 3G6EA 3H3VH 1O7IA 4NXML 2EIFA 1XMOL 4DV6Q 5C4XH 2JK8A 3CF5A 1Q1BA 3UDGA 1VQBA 1XPUA 4JG2A 4K0KL 1HJPA 2UXBL 1P16A 3HKZG 4A3BH 4K0KQ 1PH3A 2ZM6L 1XPOA 2UXBQ 3W5OA 2R6GA 3T1YL 2B63G 2ZM6Q 4LFAQ 3H0GH 1SFOH 1HR0L 1IL2A 2OQKA 1YIJA 3GTKH 1AE3A 1HR0Q 3AEVA 4BBSG 4YWLA 4YCUA 1QVCA 3KYHC 3LGJA 4EX5A 1Y1WG 1AE2A 4A3IG 3J7A5 3S16H 3STBC 1KHIA 3GDEA 4OWWB 5C4JH 4IPDA 4B3SL 1X54A 3PV0A 4OWTB 1W2BA 3NELA 1TWGH 4JI7L 4B3SQ 4YWMA 4DAMA 1X9NA 1SLJA 1K8GA 4A3KH 4P72A 1E24A 2WP8J 4JI7Q 2VNUD 1PHJA 4B3RL 1KL9A 4GLXA 4IFDI 2NN6G 1GD7A 1X6OA 2Y0SE 3CPWA 2A8VA 5C4XG 4IJHA 4B3RQ 4AYBE 3CMEA 1NJIC 3D31A 1IBLQ 1K73C 1U5KA 3CP0A 4DR2L 2E5LL 1E22A 1FJGL 4AH6A 1X56A 4P74A 1PFSA 4GN5A 1VQKA 1CKNA 4DR2Q 2E5LQ 3HOZH 1FJGQ 3RZDH 1VQPA 1XPRA 2V1CC 1SRUA 3GTJH 1I6HH 3J80i 3H0GG 3JAMc 4GOPC 5JJLA 2PI2A 3HOXG 2UXDL 2B3GA 2CKZB 4Y52H 2Q2IA 2UU9Q 5IE8A 1Y14B 1EUJA 5C44H 4A93G 2UXDQ 4HIMA 5IYCG 3CD6A 1HR0W 3H3VI 3G48A 3RLFA 3D0FA 2IX0A 1UE1A 4DUZL 2GVAA 3J7ZC 4IJLA 4LF6Q 2E2HH 1GVPA 4DUZQ 1C9OA 3S1NH 4A3GG 4DV4L 3T1HL 4JI6L 2R93H 4DV0L 4IOCA 4A3KG 1JB7A 1PVOA 1B8AA 2BA1A 1FVIA 4UPAA 3W1BA 5AJ3L 4DV4Q 3T1HQ 2E2JH 4JI6Q 1X65A 2CQOA 4JI5L 5AJ3Q 1R9TH 2QGQA 3L7ZC 1AH9A 1YHAA 4JI5Q 4A3DG 4RMFA 2YV5A 3CPFA 2WB1E 4BBRG 2D0OA 3UE1A 1E1OA 4JI4L 4L5TA 4YWKA 3UDIA 2MO1A 2ZJRA 4DKAC 4JI4Q 3S1QH 2JA5G 3FHWA 4GOPA 5J3BA 1UEBA 4C3IH 1OXXK 2JA8H 4O0AA 3HOWH 3STBD 3PO3H 5C44G 1CKNB 4DK6C 1G291 3A74A 3CC4A 4YY3L 1VCIA 3UE0A 4O2DA 3WWVA 1B7YB 3RLNA 3GTQH 4JV5L 1WFQA 1Z47A 4BXXG 1VQHA 3E9IA 1CUKA 2HQLA 5JEAG 2UUCL 2Z6KC 1X3FA 4LUZA 2YU9H 4Y7NH 1MJCA 1VQOA 5K36G 4MNOA 1PH5A 4QQBX 1YJNA 2UUCQ 3KDFB 2UUAL 4LF8L 1QVFA 5LMNL 3S17H 4LF8Q 4GS3A 1XTDA 2JEBI 2OCEA 3ER0A 3PUWA 4JI8L 3PUVA 3PUXA 1VQ9A 2B29A 2Q2TA 4R4IA 4DR6L 2OWOA 2JA8G 4QY7A 5IP7H 3CCRA 1N36Q 1Q82C 3HOWG 1WOCA 3E9HA 1L0WA 1JJCB 1VQ6A 5M3MH 4HJ5A 2PQAB 4LF5L 1WI5A 3J81j 3CMAA 1SR3A 3J81c 3F1ZA 4X64Q 4DR5L 4GOPB 4LF5Q 1L2FA 4P75A 3RLOA 4X65L 4B3TQ 1PH4A 2KCTA 5BR8L 5H1SE 5M5WH 4R1JA 2F4VQ 4OX9L 2JA6G 4AYBG 4AQYL 5IYBG 2OQ0A 3TREA 5BR8Q 4DNIA 2LXKA 2VQEL 4A3LG 4OX9Q 3BZKA 3K81C 4AQYQ 3K7AH 1S40A 1YHBA 4ALPA 1FGUA 1WJJA 3KJPA 1YI2A 3UDFA 1NBWA 3HKSA 1E1TA 4IPHA 5LMNW 2MO0A 1OXTA 3KLWA 4OXPA 1NMGA 4X6AH 1N8RC 1EYGA 1K0RA 4JYAL 1BKBA 1K3RA 4A3MH 3CC2A 5FLMH 4BY7H 4JYAQ 4QJFA 4PG3A 2CWAA 3L0OA 3CCJA 5M3FH 5M3MG 4R4CA 5C0XG 3HFZB 2Z0SA 3RR5A 1CKMA 4JBKA 3I2ZA 1Q86C 2KHJA 2HT1A 2BA0A 4DR3Q 2XGTA 4LFAL 2BH2A 3U4ZA 4IFDG 4C3HH 4LF4Q 3PIPA 3A5UA 2JA7H 1T9HA 1JT8A 3FKIG 3CCUA 4GKKL 1V1QA 1BBUA 1NE3A 1V43A 4J15A 4P73A 2E2IH 4LFCQ 4GKKQ 3AFPA 1Q7YC 3M9BA 3IRBA 4AIMA 3I4NG 4EQ5A 3CAMA 4JI3L 3CCQA 2LXJA 2YTYA 1TWHH 3PF5A 4IPGA 4JI3Q 1VQMA 2E8GA 2Q2HA 5C0XI 2N8NA 4MZ9A 5GADC 2HIVA 4YHHQ 3F8TA 2YYZA 3CW2C 4OWXB 5FLMG 1JMCA 1P8LA 4LUOA 4HIDA 4DR6Q 5M3FG 1JJ2A 3KF6B 1LM0A 2NVYH 4LUVA 4DV1L 1IBLL 1XNQL 3S1MH 2FXQA 1VQ7A 1KRSA 3E0EA 4GLVB 4X66L 4DV1Q 1BBWA 5GQOA 2AKWB 4IO9A 1DGSA 2Q2UA 2GN5A 2GVBA 1EWIA 4X66Q 4A3BG 2AHOB 4DV2L 1BVSA 4YCWA 3F2DA 4KLKA 2I0QA 1EQQA 2CFMA 4BY1H 4DV2Q 2JA7G 1KIXA 4HJ8A 3U4VA 3PO2H 2UU9L 4A3JH 4LWCA 3TS0A 2ES2A 1NTGA 4DV5L 3EBEA 4HJAA 4A3CH 3S14H 3G71A 5IYDH 2XTIA 4DV5Q 1IBKL 3M3YH 4DPGA 3MXNB 4NPSA 1IBKQ 4LF6L 1FL0A 1GKHA 3HOYH 1MJEA 1K8AC 1IXRA 5GAGC 4JI2L 4KI0A 2WAQG 4NXNQ 3S2DH 1G51A 4JI2Q 2NVQH 2ZTDA 2IY5B 3CXCA 2MFIA 3S2HH 5M5XH 3I56A 1VQLA 3DM3A 1PYSB 4A4IA 2ZJQA 1RL2A 3ULLA 1I94L 4KHZA 3PIOA 3BJUA 1I94Q 1B70B 1S3OA 5EAYA 3I55A 2R7ZH 4HJ9A 3HOZG 3S1RH 5IWAQ 2IX1A 2ZTEA 2ASBA 5FJ8H 1I5FA 5JJIA 3RZOH 1PH8A 3SGIA 3I4MH 4A3CG 3KJOA 3AQQA 2RHQB 4POFA 5IYDG 1QVGA 1PA6A 4DR7L 1VQEA 1GO3E 2JJQA 4DR7Q 2VY3A 1A63A 1VQ4A 4DV7L 4LW1A 3HOYG 4GN3B 4DV7Q 5C3EH 2R93G 5JEAJ 1VQ5A 5IP9H 3K7UC 4OO1G 1KC8C 5GAHC 2PMZE 1KQSA 1EOVA 1SROA 4R4OA 4JI0Q 2R7ZG 2DGYA 1OTCA 5FLXc 3EIVA 1IBMQ 1WCMH 3CQZH 2R92H 3OYYA 2MNAA 1TWCH 1EIFA 4C2MH 4JI1Q 1N36L 2RCNA 3I7FA 2EXDA 3HOUH 3PO3G 2F3IA 2VZAA 3KOJA 1YEZA 1RIPA 3M4QA 4DAYB 4X64L 2F52A 1Z9FA 2NZOA 3K80C 3NBHB 2ATWA 3PSIA 4B3TL 1E3PA 3BU2A 1I3QH 2N3SA 4OO1I 1HNZL 3A0JA 1VQAA 1HZAA 1L1OA 1UE7A 3NENA 3JAMi 5C3EG 1MIUA 4OONA 1HNZQ 2F4VL 4JC0A 1JE5A 3CCVA 2Y0SG 3M4PA 1G6PA 1YJWA 2QA4A 2A19A 5IP9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V H;  5DLQ E;  4DR1 L;  1XNQ Q;  3TS2 A;  1N9W A;  4TQU S;  2PNH A;  4DR1 Q;  1E7Z A;  3U58 A;  3EN2 A;  4H02 A;  4LFB L;  4UP7 A;  1PH1 A;  3AFQ A;  2VQF L;  1K9M C;  3J80 c;  2NVT H;  4IOA A;  4LFB Q;  1HZ9 A;  3DLL A;  1J6Q A;  3B6Y A;  2KBN A;  4JBJ A;  2VQF Q;  3GO5 A;  5HY6 A;  5IP7 G;  4A76 A;  2VS1 A;  3VDY A;  2K5V A;  2K52 A;  1VQD A;  2L15 A;  3RN5 A;  1EIY B;  1PH9 A;  4B3M Q;  1N34 L;  2AWO A;  1JJG A;  1X55 A;  4GNX A;  5C0X J;  4DUY L;  4XIG S;  4QL5 A;  4XTC S;  1N34 Q;  4R4Q A;  4DR3 L;  4DUY Q;  1CSQ A;  4LF4 L;  4HIO A;  2NVX H;  1J5E L;  4FDB A;  4IFD J;  2R7F A;  4BBS H;  2RHS B;  1J5E Q;  1N32 Q;  1M90 C;  4HIK A;  4LFC L;  1Y1W H;  2HHH Q;  3H15 A;  1Y1V G;  4A3I H;  2KCM A;  3CC7 A;  3L2P A;  1K83 H;  1KXL A;  4R4T A;  4JBM A;  4A75 A;  2K4K A;  2WB1 G;  3PCO B;  3JC6 6;  3UDX A;  1OXS C;  4UY8 C;  3HOV H;  2D62 A;  1A8V A;  1Q1E A;  2C35 B;  4JOI A;  1Q46 A;  4YHH L;  2H5X A;  4L5S A;  2HIX A;  1C0A A;  1U0L A;  1HNX L;  4NXM Q;  2K75 A;  3OTO L;  1XMO Q;  4A3M G;  1GM5 A;  5E7N A;  4BY7 G;  4GN4 B;  1HNX Q;  3OTO Q;  1KD1 C;  3G4S A;  3KFU A;  2I5L X;  3T1Y Q;  4P71 A;  4IPC A;  1VQJ A;  1C7Y A;  4QIW E;  3HOX H;  3M7N A;  4A93 H;  2K50 A;  5IYC H;  4GNX B;  2VUM H;  3S24 A;  4YCV A;  3GD7 A;  1YVC A;  4APV A;  1OXV A;  2YTX A;  4DV3 L;  2I5M X;  3K0X A;  3M85 A;  4WJ4 A;  3J81 i;  2R7D A;  1PV4 A;  2CWP A;  4DR4 L;  4A3G H;  4DV3 Q;  3HOV G;  2D0P A;  3PUZ A;  4UP9 A;  3TEH B;  4BA2 I;  4DR4 Q;  4NXN L;  4BA1 I;  2YTV A;  1ASZ A;  1D7Q A;  2IHF A;  4MTN A;  5GRO A;  4ME3 A;  3CCE A;  1Q12 A;  1VQ8 A;  3AYH B;  4A3D H;  4LF9 L;  1EQR A;  1TWA H;  1VS0 A;  5M5Y H;  2MQH A;  1D8L A;  4BBR H;  1Q81 C;  4LF9 Q;  2DUD A;  3CCM A;  1VQC A;  1WYD A;  1W3S A;  2CCZ A;  2KHI A;  2JA5 H;  2JEA I;  2K5N A;  5ELN A;  5IT9 c;  5IWA L;  2UUB L;  3M4O H;  2I5H A;  1LTL A;  4X62 L;  1V9P A;  4PZ7 A;  4BY1 G;  2UUB Q;  3PF4 A;  1SN8 A;  3I4O A;  2VUM G;  2JA9 A;  4X62 Q;  3PO2 G;  3F2B A;  3U50 C;  2NZH A;  4A3J G;  2NN6 I;  3KDF A;  1EFW A;  1X3G A;  1HH2 P;  1YZ6 A;  2EQS A;  4BXX H;  2VW9 A;  3HKZ E;  2JQO A;  3BZC A;  1XJV A;  1L1O C;  4DV0 Q;  2ZJP A;  3Q8D A;  4GLA C;  1TXY A;  1SMX A;  1IYJ B;  3GTP H;  3TRZ A;  1UE5 A;  1QZG A;  1A62 A;  2VL6 A;  1LUZ A;  1OXU A;  5JJK A;  4JI0 L;  1NY4 A;  2PQA A;  3GTO H;  1HZC A;  4A3E H;  2JE6 I;  1Q8K A;  1HZB A;  3PUY A;  1UWV A;  2BH8 A;  2LSS A;  1IBM L;  3OW2 A;  1UE6 A;  5LMU L;  4PZ8 A;  4JI1 L;  1SE8 A;  5FJ8 G;  1QUQ A;  2ID0 A;  1KRT A;  5LMU Q;  4KHP L;  2WFW A;  4PZ6 A;  4HJ7 A;  3I4M G;  4KHP Q;  2K5H A;  1MKH A;  1VQG A;  3ERS X;  3PGZ A;  3CCS A;  2N49 A;  3ULJ A;  4YY3 Q;  4GNX C;  1YIT A;  4JV5 Q;  4PMW A;  3K8A A;  4A3F H;  4JBW A;  3NEM A;  1VQN A;  2JA6 H;  3GTG H;  5IYB H;  4TVA B;  1LYL A;  1YJ9 A;  1N33 L;  4A3L H;  2K14 A;  3TQY A;  3W1G A;  3FP9 A;  3RN2 A;  3S15 H;  2IHE A;  2UUA Q;  1XMQ L;  1N33 Q;  2OTJ A;  1ASY A;  5LMN Q;  4GKJ L;  3ZJY C;  1I50 H;  1XMQ Q;  4LF7 L;  3GTM H;  1QZH A;  2ALY B;  4GKJ Q;  4A3E G;  4LF7 Q;  4LNQ A;  1PH7 A;  4JI8 Q;  3A5Z B;  4L5Q A;  1PYB A;  2AMC B;  1KAW A;  4JOI C;  2WAQ E;  3ULP A;  4POG A;  1WCM G;  2R92 G;  1YNX A;  2OTL A;  3GTL H;  2PI2 E;  2UXC Q;  4RG1 A;  2AWN A;  3HOU G;  4B3M L;  4JCV E;  2IT1 A;  1YHQ A;  3RNU A;  1PH6 A;  1XNR L;  1CSP A;  4WJ3 M;  4UP8 A;  4C3J H;  4DR5 Q;  1HNW L;  1CKO A;  1YBY A;  2B63 H;  1QUQ B;  4X65 Q;  1XNR Q;  3MEF A;  1TWF H;  3F2C A;  2Z6K A;  3FKI H;  4A3F G;  1HNW Q;  1X3E A;  3ICE A;  1H95 A;  2A1A A;  1NMF A;  1S72 A;  1IZ6 A;  4L5R C;  1N32 L;  2VQE Q;  2HHH L;  3I4N H;  2KEN A;  1PH2 A;  2QEX A;  1A0I A;  3KF6 A;  5HGQ A;  1VQI A;  5ELO A;  1L1O B;  4DK3 C;  3CCL A;  2UXC L;  2RF4 A;  5GAE C;  1VQF A;  3KF8 B;  4NB3 A;  5IY0 A;  4QGU A;  2N78 A;  1M1K C;  4DV6 L;  2ZTC A;  3G6E A;  3H3V H;  1O7I A;  4NXM L;  2EIF A;  1XMO L;  4DV6 Q;  5C4X H;  2JK8 A;  3CF5 A;  1Q1B A;  3UDG A;  1VQB A;  1XPU A;  4JG2 A;  4K0K L;  1HJP A;  2UXB L;  1P16 A;  3HKZ G;  4A3B H;  4K0K Q;  1PH3 A;  2ZM6 L;  1XPO A;  2UXB Q;  3W5O A;  2R6G A;  3T1Y L;  2B63 G;  2ZM6 Q;  4LFA Q;  3H0G H;  1SFO H;  1HR0 L;  1IL2 A;  2OQK A;  1YIJ A;  3GTK H;  1AE3 A;  1HR0 Q;  3AEV A;  4BBS G;  4YWL A;  4YCU A;  1QVC A;  3KYH C;  3LGJ A;  4EX5 A;  1Y1W G;  1AE2 A;  4A3I G;  3J7A 5;  3S16 H;  3STB C;  1KHI A;  3GDE A;  4OWW B;  5C4J H;  4IPD A;  4B3S L;  1X54 A;  3PV0 A;  4OWT B;  1W2B A;  3NEL A;  1TWG H;  4JI7 L;  4B3S Q;  4YWM A;  4DAM A;  1X9N A;  1SLJ A;  1K8G A;  4A3K H;  4P72 A;  1E24 A;  2WP8 J;  4JI7 Q;  2VNU D;  1PHJ A;  4B3R L;  1KL9 A;  4GLX A;  4IFD I;  2NN6 G;  1GD7 A;  1X6O A;  2Y0S E;  3CPW A;  2A8V A;  5C4X G;  4IJH A;  4B3R Q;  4AYB E;  3CME A;  1NJI C;  3D31 A;  1IBL Q;  1K73 C;  1U5K A;  3CP0 A;  4DR2 L;  2E5L L;  1E22 A;  1FJG L;  4AH6 A;  1X56 A;  4P74 A;  1PFS A;  4GN5 A;  1VQK A;  1CKN A;  4DR2 Q;  2E5L Q;  3HOZ H;  1FJG Q;  3RZD H;  1VQP A;  1XPR A;  2V1C C;  1SRU A;  3GTJ H;  1I6H H;  3J80 i;  3H0G G;  3JAM c;  4GOP C;  5JJL A;  2PI2 A;  3HOX G;  2UXD L;  2B3G A;  2CKZ B;  4Y52 H;  2Q2I A;  2UU9 Q;  5IE8 A;  1Y14 B;  1EUJ A;  5C44 H;  4A93 G;  2UXD Q;  4HIM A;  5IYC G;  3CD6 A;  1HR0 W;  3H3V I;  3G48 A;  3RLF A;  3D0F A;  2IX0 A;  1UE1 A;  4DUZ L;  2GVA A;  3J7Z C;  4IJL A;  4LF6 Q;  2E2H H;  1GVP A;  4DUZ Q;  1C9O A;  3S1N H;  4A3G G;  4DV4 L;  3T1H L;  4JI6 L;  2R93 H;  4DV0 L;  4IOC A;  4A3K G;  1JB7 A;  1PVO A;  1B8A A;  2BA1 A;  1FVI A;  4UPA A;  3W1B A;  5AJ3 L;  4DV4 Q;  3T1H Q;  2E2J H;  4JI6 Q;  1X65 A;  2CQO A;  4JI5 L;  5AJ3 Q;  1R9T H;  2QGQ A;  3L7Z C;  1AH9 A;  1YHA A;  4JI5 Q;  4A3D G;  4RMF A;  2YV5 A;  3CPF A;  2WB1 E;  4BBR G;  2D0O A;  3UE1 A;  1E1O A;  4JI4 L;  4L5T A;  4YWK A;  3UDI A;  2MO1 A;  2ZJR A;  4DKA C;  4JI4 Q;  3S1Q H;  2JA5 G;  3FHW A;  4GOP A;  5J3B A;  1UEB A;  4C3I H;  1OXX K;  2JA8 H;  4O0A A;  3HOW H;  3STB D;  3PO3 H;  5C44 G;  1CKN B;  4DK6 C;  1G29 1;  3A74 A;  3CC4 A;  4YY3 L;  1VCI A;  3UE0 A;  4O2D A;  3WWV A;  1B7Y B;  3RLN A;  3GTQ H;  4JV5 L;  1WFQ A;  1Z47 A;  4BXX G;  1VQH A;  3E9I A;  1CUK A;  2HQL A;  5JEA G;  2UUC L;  2Z6K C;  1X3F A;  4LUZ A;  2YU9 H;  4Y7N H;  1MJC A;  1VQO A;  5K36 G;  4MNO A;  1PH5 A;  4QQB X;  1YJN A;  2UUC Q;  3KDF B;  2UUA L;  4LF8 L;  1QVF A;  5LMN L;  3S17 H;  4LF8 Q;  4GS3 A;  1XTD A;  2JEB I;  2OCE A;  3ER0 A;  3PUW A;  4JI8 L;  3PUV A;  3PUX A;  1VQ9 A;  2B29 A;  2Q2T A;  4R4I A;  4DR6 L;  2OWO A;  2JA8 G;  4QY7 A;  5IP7 H;  3CCR A;  1N36 Q;  1Q82 C;  3HOW G;  1WOC A;  3E9H A;  1L0W A;  1JJC B;  1VQ6 A;  5M3M H;  4HJ5 A;  2PQA B;  4LF5 L;  1WI5 A;  3J81 j;  3CMA A;  1SR3 A;  3J81 c;  3F1Z A;  4X64 Q;  4DR5 L;  4GOP B;  4LF5 Q;  1L2F A;  4P75 A;  3RLO A;  4X65 L;  4B3T Q;  1PH4 A;  2KCT A;  5BR8 L;  5H1S E;  5M5W H;  4R1J A;  2F4V Q;  4OX9 L;  2JA6 G;  4AYB G;  4AQY L;  5IYB G;  2OQ0 A;  3TRE A;  5BR8 Q;  4DNI A;  2LXK A;  2VQE L;  4A3L G;  4OX9 Q;  3BZK A;  3K81 C;  4AQY Q;  3K7A H;  1S40 A;  1YHB A;  4ALP A;  1FGU A;  1WJJ A;  3KJP A;  1YI2 A;  3UDF A;  1NBW A;  3HKS A;  1E1T A;  4IPH A;  5LMN W;  2MO0 A;  1OXT A;  3KLW A;  4OXP A;  1NMG A;  4X6A H;  1N8R C;  1EYG A;  1K0R A;  4JYA L;  1BKB A;  1K3R A;  4A3M H;  3CC2 A;  5FLM H;  4BY7 H;  4JYA Q;  4QJF A;  4PG3 A;  2CWA A;  3L0O A;  3CCJ A;  5M3F H;  5M3M G;  4R4C A;  5C0X G;  3HFZ B;  2Z0S A;  3RR5 A;  1CKM A;  4JBK A;  3I2Z A;  1Q86 C;  2KHJ A;  2HT1 A;  2BA0 A;  4DR3 Q;  2XGT A;  4LFA L;  2BH2 A;  3U4Z A;  4IFD G;  4C3H H;  4LF4 Q;  3PIP A;  3A5U A;  2JA7 H;  1T9H A;  1JT8 A;  3FKI G;  3CCU A;  4GKK L;  1V1Q A;  1BBU A;  1NE3 A;  1V43 A;  4J15 A;  4P73 A;  2E2I H;  4LFC Q;  4GKK Q;  3AFP A;  1Q7Y C;  3M9B A;  3IRB A;  4AIM A;  3I4N G;  4EQ5 A;  3CAM A;  4JI3 L;  3CCQ A;  2LXJ A;  2YTY A;  1TWH H;  3PF5 A;  4IPG A;  4JI3 Q;  1VQM A;  2E8G A;  2Q2H A;  5C0X I;  2N8N A;  4MZ9 A;  5GAD C;  2HIV A;  4YHH Q;  3F8T A;  2YYZ A;  3CW2 C;  4OWX B;  5FLM G;  1JMC A;  1P8L A;  4LUO A;  4HID A;  4DR6 Q;  5M3F G;  1JJ2 A;  3KF6 B;  1LM0 A;  2NVY H;  4LUV A;  4DV1 L;  1IBL L;  1XNQ L;  3S1M H;  2FXQ A;  1VQ7 A;  1KRS A;  3E0E A;  4GLV B;  4X66 L;  4DV1 Q;  1BBW A;  5GQO A;  2AKW B;  4IO9 A;  1DGS A;  2Q2U A;  2GN5 A;  2GVB A;  1EWI A;  4X66 Q;  4A3B G;  2AHO B;  4DV2 L;  1BVS A;  4YCW A;  3F2D A;  4KLK A;  2I0Q A;  1EQQ A;  2CFM A;  4BY1 H;  4DV2 Q;  2JA7 G;  1KIX A;  4HJ8 A;  3U4V A;  3PO2 H;  2UU9 L;  4A3J H;  4LWC A;  3TS0 A;  2ES2 A;  1NTG A;  4DV5 L;  3EBE A;  4HJA A;  4A3C H;  3S14 H;  3G71 A;  5IYD H;  2XTI A;  4DV5 Q;  1IBK L;  3M3Y H;  4DPG A;  3MXN B;  4NPS A;  1IBK Q;  4LF6 L;  1FL0 A;  1GKH A;  3HOY H;  1MJE A;  1K8A C;  1IXR A;  5GAG C;  4JI2 L;  4KI0 A;  2WAQ G;  4NXN Q;  3S2D H;  1G51 A;  4JI2 Q;  2NVQ H;  2ZTD A;  2IY5 B;  3CXC A;  2MFI A;  3S2H H;  5M5X H;  3I56 A;  1VQL A;  3DM3 A;  1PYS B;  4A4I A;  2ZJQ A;  1RL2 A;  3ULL A;  1I94 L;  4KHZ A;  3PIO A;  3BJU A;  1I94 Q;  1B70 B;  1S3O A;  5EAY A;  3I55 A;  2R7Z H;  4HJ9 A;  3HOZ G;  3S1R H;  5IWA Q;  2IX1 A;  2ZTE A;  2ASB A;  5FJ8 H;  1I5F A;  5JJI A;  3RZO H;  1PH8 A;  3SGI A;  3I4M H;  4A3C G;  3KJO A;  3AQQ A;  2RHQ B;  4POF A;  5IYD G;  1QVG A;  1PA6 A;  4DR7 L;  1VQE A;  1GO3 E;  2JJQ A;  4DR7 Q;  2VY3 A;  1A63 A;  1VQ4 A;  4DV7 L;  4LW1 A;  3HOY G;  4GN3 B;  4DV7 Q;  5C3E H;  2R93 G;  5JEA J;  1VQ5 A;  5IP9 H;  3K7U C;  4OO1 G;  1KC8 C;  5GAH C;  2PMZ E;  1KQS A;  1EOV A;  1SRO A;  4R4O A;  4JI0 Q;  2R7Z G;  2DGY A;  1OTC A;  5FLX c;  3EIV A;  1IBM Q;  1WCM H;  3CQZ H;  2R92 H;  3OYY A;  2MNA A;  1TWC H;  1EIF A;  4C2M H;  4JI1 Q;  1N36 L;  2RCN A;  3I7F A;  2EXD A;  3HOU H;  3PO3 G;  2F3I A;  2VZA A;  3KOJ A;  1YEZ A;  1RIP A;  3M4Q A;  4DAY B;  4X64 L;  2F52 A;  1Z9F A;  2NZO A;  3K80 C;  3NBH B;  2ATW A;  3PSI A;  4B3T L;  1E3P A;  3BU2 A;  1I3Q H;  2N3S A;  4OO1 I;  1HNZ L;  3A0J A;  1VQA A;  1HZA A;  1L1O A;  1UE7 A;  3NEN A;  3JAM i;  5C3E G;  1MIU A;  4OON A;  1HNZ Q;  2F4V L;  4JC0 A;  1JE5 A;  3CCV A;  2Y0S G;  3M4P A;  1G6P A;  1YJW A;  2QA4 A;  2A19 A;  5IP9 G; 
#chains in the Genus database with same CATH topology
 4DR1 L;  3OOC A;  3D6W A;  4C1N I;  2PNH A;  4EQN A;  1PRT F;  2F0M A;  5KRU A;  2Z4H A;  4PQX A;  5CV8 A;  1K9M C;  3BVM A;  2NVT H;  4IOA A;  3KUP A;  1SYF A;  2VQF Q;  3GO5 A;  5HY6 A;  2K5V A;  1GUN A;  1NCV A;  2AWO A;  4GNX A;  4XIG S;  4QL5 A;  1Q3L A;  4HIO A;  1DOL A;  1TY2 A;  2R7F A;  4BBS H;  2EOT A;  4HIK A;  1Y1W H;  5IGB A;  4A3I H;  3CC7 A;  3BYT B;  3L2P A;  1KXL A;  2X69 A;  3SXH A;  2O2L D;  1A8V A;  2EYJ A;  2H5X A;  4L5S A;  2JP1 A;  3DEO A;  3J80 L;  5DM6 3;  1WD0 A;  4ME5 A;  1F77 A;  1FGB D;  1KD1 C;  2IX3 A;  4FP5 D;  1U4L A;  2WKC A;  3MEH A;  3KFU A;  3FMC A;  2P5Z X;  1C7Y A;  4MN3 A;  4L8J A;  3M7N A;  4EQP A;  4DK1 A;  5IYC H;  4GNX B;  4I7A A;  2VUM H;  1B44 D;  1YVC A;  5DEH A;  4MIU A;  5FO7 B;  1LTI D;  3HGB A;  1OXV A;  4RKL A;  3T51 B;  3K0X A;  3M85 A;  1PV4 A;  2VB3 X;  1PXU A;  4A3G H;  4U68 A;  3TEH B;  4DU9 A;  4DR4 Q;  4BY7 B;  1ASZ A;  1D7Q A;  2K5W A;  2IHF A;  4J6H A;  4A3D H;  1WTQ A;  1DD2 A;  5M5Y H;  1Q81 C;  4BBR H;  1STH A;  2DUD A;  1ICF B;  1MSH A;  2M9V A;  4G7H C;  1W3S A;  2F0Q A;  2CCZ A;  2JA5 H;  5IT9 c;  1NAP A;  2UUB L;  2PMZ B;  4X62 L;  1V9P A;  4PZ7 A;  4BY1 G;  1PZK D;  2VUM G;  2MPM A;  1Q8I A;  5COY A;  1EFW A;  1X3G A;  1HH2 P;  5CV4 A;  3WDN A;  4G7Z C;  1O80 A;  2JQO A;  5NUC A;  4ZCK A;  1BNZ A;  1L1O C;  2EYF A;  2K6A A;  2NVY B;  4PV1 C;  1A62 A;  4KD3 A;  2JN4 A;  3Q0A A;  2SNS A;  3GTO H;  4A3E H;  3SK8 A;  3PO2 B;  4PZ8 A;  4JI1 L;  3EQL C;  2Q8I B;  1WTR A;  1LLR D;  3I4M G;  3KBX A;  3CCS A;  2N49 A;  3ULJ A;  4YY3 Q;  3S2D B;  4JV5 Q;  5ELC A;  4EVO A;  3K8A A;  5CV7 A;  4QQB X;  1IYV A;  1TWA B;  3AU7 A;  1N33 L;  3S2H B;  3TQY A;  3W1G A;  3RN2 A;  2KVM A;  3S15 H;  1XMQ L;  3R2I A;  1SEB D;  4Z9C B;  5LMN Q;  4GKJ L;  4LF7 L;  1V8Q A;  4HED A;  3FPP A;  1HXY D;  1U4P A;  4A3E G;  2R61 A;  2HQE A;  3A5Z B;  4JPB W;  1EY8 A;  4L5Q A;  4CKC A;  5K5P A;  4DR6 Q;  1WCM G;  3PMF A;  1DM0 B;  2NTS A;  2UXC Q;  1G8Z D;  1SE3 A;  2RSN A;  3VR2 A;  1EL0 A;  4H7B A;  1C48 A;  1U4R A;  4WJ3 M;  3RD4 A;  4C3J H;  5C3E B;  1HNW L;  1YBY A;  1ONL A;  5T1I A;  4FXK C;  3MEF A;  3F2C A;  2XN9 C;  3ICE A;  2B2V C;  2QIL A;  1TR5 A;  4PNY A;  4QIW B;  4WRD A;  1WD1 A;  5ELO A;  1L1O B;  4DK3 C;  1KNA A;  1TWC B;  4QGU A;  3HRZ C;  2LS0 1;  3QG1 A;  1M1K C;  3HOU B;  4OIJ A;  1ET9 A;  1VQB A;  2NZ1 D;  5LHY 1;  1VDZ A;  4XQJ A;  3HKZ G;  4A3B H;  1I3Q B;  4K2K A;  4C3J G;  5L37 A;  1LT5 D;  2UXB Q;  3N52 A;  3T4A C;  3W5O A;  2ZM6 Q;  1DOK A;  1IL8 A;  4LK1 C;  1ZXT A;  1SFO H;  2NBF A;  1HR0 L;  1YIJ A;  1BBX C;  2B2V A;  3KYH C;  4RFB A;  1AE2 A;  2PO4 A;  2NVT B;  3VA5 A;  2EJG C;  4OWT B;  3NEL A;  2FIN B;  4DAM A;  1F2Z A;  5CBE E;  4P72 A;  1K8G A;  4JI7 Q;  4GLX A;  4IFD I;  2NN6 G;  4J1M A;  4KKS A;  2A8V A;  4KY6 A;  4CDC C;  4AYB E;  1IBL Q;  2B63 B;  2EY2 A;  2E5L L;  5I9P A;  1X56 A;  4P74 A;  5KIX A;  1PFS A;  3CHB D;  3MHB A;  4BBS B;  3JAM c;  1I4R A;  2XVS A;  3IAY A;  1Y1W B;  2B3G A;  4A3I B;  4Y52 H;  2Q2I A;  5C44 H;  4A93 G;  2UXD Q;  3QOL A;  1HR0 W;  2HD3 A;  3URY A;  3E5S A;  2IX0 A;  3V96 A;  2L5T A;  2R93 H;  5C4X B;  2QKI C;  3T1H L;  4IOC A;  1JB7 A;  1PVO A;  4UPA A;  5AJ3 L;  4DV4 Q;  2E2J H;  1XYI A;  2QGQ A;  3BZD B;  1HA6 A;  4JI5 Q;  3ZYY X;  4RMF A;  1FNV A;  1JE4 A;  3DWQ A;  5E4X A;  4JI4 L;  2ZJR A;  2MO1 A;  1UEB A;  2BOS A;  1WTV A;  4O0A A;  3STB D;  5C44 G;  3Q22 A;  5G3L D;  1PTO H;  4A3G B;  3A74 A;  2N55 A;  3CC4 A;  4YY3 L;  3WWV A;  1B7Y B;  3GTQ H;  4JV5 L;  1WFQ A;  4M1U B;  4BXX G;  1VQH A;  1CUK A;  5JEA G;  2J7Z A;  3K57 A;  2Z6K C;  2K04 A;  4LUZ A;  5K36 G;  1VQO A;  4A3D B;  4MNO A;  2UUC Q;  5M5Y B;  3FRP B;  4BBR B;  1STN A;  5LMN L;  2DNE A;  2EYP A;  4LF8 Q;  1XTD A;  4DA2 A;  2JA5 B;  3TZU A;  3ER0 A;  4HAE A;  4DR6 L;  2DN8 A;  4KKT A;  4PMC A;  3CCR A;  1WOC A;  3FEW X;  1QOH A;  1L0W A;  2NTT A;  4KMU C;  2FMM A;  4RGN A;  4HJ5 A;  1WI5 A;  4LF5 Q;  3H6M A;  3NHH A;  3I91 A;  1GUG A;  1R9T B;  2F0H A;  2KCT A;  5H1S E;  2F4V Q;  4AQY L;  5CV6 A;  1WTW A;  1VF7 A;  2OQ0 A;  4CHT B;  4DNI A;  2LXK A;  4OX9 Q;  3K7A H;  1YHB A;  4ALP A;  1FGU A;  1WJJ A;  3KJP A;  2CQA A;  3UDF A;  1CHQ D;  1Y8O B;  1E1T A;  4XT3 B;  3ITP A;  5LMN W;  3HOW B;  1EY9 A;  4OXP A;  1IKM A;  1LTT D;  1B2T A;  3V05 A;  5FLM H;  3D8G A;  5FK9 C;  2CWA A;  4IN3 A;  1FNU A;  4R4C A;  3OIQ A;  3MZ5 A;  2KEC A;  3RR5 A;  1QG7 A;  4DR3 Q;  3J81 L;  2XGT A;  4LF4 Q;  5CR3 A;  1CQV A;  3S15 B;  4I7Z C;  3CCU A;  1TS4 A;  2F0L A;  5J39 A;  2LKV A;  1FYC A;  2E2I H;  5E4W C;  2IW3 A;  3AFP A;  3I4N G;  4KJO A;  2K1B A;  3MXU A;  2ZXR A;  3PF5 A;  4IPG A;  2E8G A;  2Q2H A;  4MZ9 A;  4YHH Q;  5FLM G;  1JMC A;  4OWX B;  1IBL L;  1HPC A;  4DV1 L;  4C3J B;  2FXQ A;  3SHL A;  5I4D A;  1BBW A;  3A8I E;  2Q2U A;  3F2D A;  1EQQ A;  3C2P A;  4DV2 Q;  1ZYR C;  2WAC A;  5JAV A;  4A3J H;  3VR6 A;  4DV5 L;  3EBE A;  1GUS A;  2XTI A;  3OPO A;  4ZLT F;  4NPS A;  4G4K A;  1IBK Q;  4MTK A;  1G2S A;  4PMB A;  1FL0 A;  4RGM A;  4NP5 A;  1KDA A;  1FNW A;  2FMC A;  2KJX A;  1IXR A;  1SMY D;  3HOY H;  1DZ1 A;  4JI2 Q;  2ZTD A;  3I90 A;  2EY5 A;  4A3B B;  2MFI A;  5M5X H;  1HA5 A;  1PTO C;  4C3H B;  2CHB D;  3DXJ C;  1I94 L;  1SFO B;  5EAY A;  1F2Y A;  1S3O A;  3G6J B;  3NPP A;  3I55 A;  2ZTE A;  2I07 B;  5FJ8 H;  5KNC A;  1RTN A;  1I5F A;  5JJI A;  3RZO H;  3KJO A;  3J80 E;  3J7A V;  1SYB A;  4TSS A;  3NTI A;  5IGE A;  4DV7 L;  1Z6H A;  2F0G A;  3HOY G;  1Y69 U;  2M2L A;  1H9M A;  2F0F A;  1J9O A;  1TS5 A;  1KQS A;  1SRO A;  2EYM A;  4JI0 Q;  1BCP D;  4RWS C;  2R92 H;  5EBD A;  5IT9 L;  3TN2 A;  2F0D A;  2RCN A;  5CBA E;  2EXD A;  3TME A;  1XWE A;  2F3I A;  4OEL B;  3KOJ A;  1DON A;  1YEZ A;  3TP7 A;  1RIP A;  2R93 B;  1H9J A;  2XIW A;  2NZO A;  3DHQ A;  3PSI A;  1E3P A;  3BU2 A;  1AN8 A;  3A0J A;  1VQA A;  3MA2 B;  3JAM i;  3NEN A;  2G9H D;  1MIU A;  2F4V L;  2C9O A;  2QA4 A;  2A19 A;  4UAI A;  1Y1V H;  5DLQ E;  3TDQ A;  5EPJ A;  3TS2 A;  4DR1 Q;  3U58 A;  4H02 A;  4LFB L;  1PH1 A;  3AFQ A;  2KBN A;  4JBJ A;  1PTO B;  3VDY A;  2VS1 A;  3ND8 A;  1EOT A;  4G7O C;  3W3A A;  1N34 L;  4DUY L;  4XTC S;  4DR3 L;  2Y0S B;  4KK7 A;  4LF4 L;  2NVX H;  4FDB A;  4IFD J;  1EWC A;  2BE5 C;  5KNB A;  1Y1V G;  2G5D A;  2NUC A;  4R4T A;  1AEX A;  4A75 A;  4JBM A;  2O5I C;  3JC6 6;  4HR7 B;  4UY8 C;  2D62 A;  2EY6 A;  1NSN S;  2O4X A;  4JOI A;  4YHH L;  2KA7 A;  1O7Y A;  1C0A A;  1C4Q A;  3OTO L;  1GM5 A;  2A6H D;  4BY7 G;  1ENA A;  1D5X C;  2L1B A;  4RCN A;  4ZKB B;  2KCN A;  3HZX A;  2I5L X;  3D4W A;  1VQJ A;  3HOX H;  1STG A;  3UI2 A;  2K5D A;  3K7A B;  2WB1 B;  5EJW A;  4APV A;  3S9W A;  2YTX A;  2I5M X;  3KLS X;  1D5Z C;  5FOB B;  1UEA B;  5EPL A;  1KLG D;  4UP9 A;  1GHJ A;  3FDT A;  2D9U A;  1M8A A;  1QJO A;  1TWA H;  4DF7 A;  2MQH A;  2F4I A;  2ICE C;  1VQC A;  1IW7 C;  1HUM A;  1WYD A;  4RKB A;  3M4O H;  2F0I A;  2UUB Q;  3PF4 A;  1SN8 A;  3V2T A;  3I4O A;  4X62 Q;  3PO2 G;  3F2B A;  3EFX D;  2NN6 I;  3KLR A;  3KDF A;  2EQS A;  1L0Y B;  5I6Y A;  3HKZ E;  1A2T A;  1UNS A;  1SMX A;  1IYJ B;  3VR3 A;  3TRZ A;  4P2C B;  3OSO A;  2F0T A;  1LUZ A;  1OXU A;  3VYR A;  2PYK A;  4JI0 L;  2PQA A;  5IGC A;  1HZC A;  2JE6 I;  1Q8K A;  1HZB A;  2QW7 A;  3OW2 A;  1UE6 A;  1LT3 D;  2A5H A;  3JAM L;  4A3J B;  4RH6 A;  1QUQ A;  2ID0 A;  4KHP L;  1AP0 A;  1D1I A;  1MKH A;  3PGZ A;  4GNX C;  4DNT B;  1JB3 A;  2JA6 H;  3GTG H;  5IYB H;  4TVA B;  2C5C A;  5M5X B;  2DJF C;  1SBB B;  1O7Z A;  4F7X A;  2IHE A;  2UUA Q;  1N33 Q;  1UAP A;  1CHP D;  3ZJY C;  4C56 C;  1XMQ Q;  2Z1C A;  3BDL A;  4GKJ Q;  1SAP A;  2ALY B;  4LF7 Q;  5T1G A;  5F2D A;  4JI8 Q;  1K0S A;  3RZO B;  1CTM A;  3ULP A;  1DCZ A;  1XTC D;  1YNX A;  1E0B A;  2L9H A;  1XXG A;  2FJ2 A;  4QUF A;  3HOU G;  2WKD A;  4JCV E;  2IT1 A;  4JVZ A;  1EEI D;  3RNU A;  4F87 A;  4KN4 C;  1XNR L;  1F9Q A;  2CH4 W;  4KY7 A;  4R8I A;  2B63 H;  1QUQ B;  2MGS A;  4X65 Q;  1HNW Q;  1H9R A;  1TWF H;  4IUT A;  4CDE C;  2H1E A;  2QF7 A;  2JXM B;  4I65 A;  1S72 A;  5BN5 A;  1U9R A;  1PH2 A;  1II3 A;  4UHV A;  3SK5 A;  1VQI A;  3CCL A;  2R92 B;  5GAE C;  1CT1 D;  2D2C C;  5IY0 A;  1PFM A;  3T56 B;  2ZTC A;  3H3V H;  2F0W A;  3J7A F;  5C4X H;  3CF5 A;  1Q1B A;  3A54 A;  4K0K L;  3AB9 A;  3DUZ A;  1STY A;  2B63 G;  2EYL A;  1PRT C;  4LFA Q;  4UDU C;  3BVZ A;  2OQK A;  1AE3 A;  1Y1V B;  2PZT A;  4CDF C;  1HR0 Q;  1ENC A;  4ID6 A;  3ERO A;  4YWL A;  4U67 3;  4BBS G;  3QR8 A;  1Y1W G;  4NMZ A;  4A3I G;  3I8Z A;  1Y8N B;  1B53 A;  3NUC A;  1CA6 A;  1HUN A;  4YWM A;  4NDX A;  1SLJ A;  1X6O A;  2Y0S E;  3A7A B;  5C4X G;  1VF5 C;  3C1E A;  1U5K A;  3CP0 A;  1B3Q A;  4DR2 L;  1FJG L;  4AH6 A;  4GN5 A;  1VQK A;  2NVX B;  2E5L Q;  3HOZ H;  3RZD H;  1XPR A;  2V1C C;  1SSO A;  3QJY A;  4GOP C;  5JJL A;  1JWS D;  2PI2 A;  1S5B D;  2CW0 C;  3J7Y W;  2OEO A;  2UU9 Q;  5IE8 A;  1Y14 B;  4HIM A;  5IYC G;  4IUR A;  3D0F A;  2AQ2 B;  5JVG 3;  2GVA A;  3J7Z C;  4IJL A;  3PIP 3;  1I4Q A;  4LF6 Q;  2E2H H;  3S1N H;  4A3G G;  5D3D A;  3T1H Q;  3J81 E;  3H91 A;  5AJ3 Q;  1R9T H;  1AH9 A;  4IAL A;  2HDL A;  4OEM B;  1ICW A;  1STA A;  4A3D G;  3H0G B;  2CH4 A;  2WB1 E;  4BBR G;  2D0O A;  1YNN C;  4HCE A;  3HOX B;  4L5T A;  4YWK A;  3UDI A;  4DKA C;  4JI4 Q;  2JA5 G;  3FHW A;  3R2T A;  1L0X B;  4GOP A;  4C3I H;  4CBV A;  3NTH A;  3HOW H;  3PO3 H;  4IUV A;  5C4J B;  1J8I A;  1SJH D;  2RDG A;  2F0V A;  1WTO A;  1PRT B;  1I4H A;  3IL8 A;  3RLN A;  2NB0 A;  3Q6S A;  5M9O A;  3KBG A;  3E9I A;  1PLF A;  1JIC A;  3I4L A;  2J0T D;  3IFD A;  1W6J A;  2F0N A;  2OXP A;  2UUA L;  2RQX A;  4B08 A;  2PZW A;  1QVF A;  4FXD A;  1GOZ A;  1O78 A;  1FD7 D;  3M4O B;  4JI8 L;  3PUV A;  2B29 A;  2I46 A;  5IP7 H;  3HOW G;  4V19 0;  3E9H A;  3TP6 A;  5C0X H;  1MSG A;  1S5E D;  3J81 j;  2A69 C;  5KND A;  4X64 Q;  2BDN A;  4XYO A;  4GOP B;  1L2F A;  2IL8 A;  4X65 L;  4OIK A;  4B3T Q;  1HQM C;  5LL6 X;  2ZXP A;  4QB4 A;  2XSC A;  5BR8 L;  3H3V C;  4L63 B;  1RTO A;  1PFN A;  4AQY Q;  3K58 A;  1S40 A;  4ZK9 B;  1JWU D;  3S1Q B;  5D14 A;  1IKL A;  1NBW A;  3HKS A;  3DWP A;  4IPH A;  2MO0 A;  4X6A H;  2QDL A;  1N8R C;  3BYY B;  4XXE A;  1LTS D;  1NNX A;  1BKB A;  4A3M H;  5JJZ A;  4K5X A;  5DNF A;  5C0X G;  2Z0S A;  2E75 C;  4NW2 A;  4QCL A;  2HT1 A;  2BA0 A;  2JA6 B;  3GTG B;  4LFA L;  4C3H H;  5J1Z A;  3MXN A;  3S17 B;  3RUZ A;  4DAV A;  2LMC B;  2VB2 X;  4GKK L;  1NE3 A;  3TP5 A;  4DNR B;  2MJ8 A;  3M9B A;  1O7L A;  5I2X A;  2F0S A;  3CCQ A;  2LXJ A;  1EWH A;  1VQM A;  3T13 A;  5ELD A;  3QOJ A;  3H09 A;  1A3U A;  4ZRZ A;  3F8T A;  2YYZ A;  3CW2 C;  3K0Y A;  1F2L A;  3X3M A;  1LM0 A;  3S1M H;  3EJI A;  4YIJ A;  3E0E A;  4DV1 Q;  4IQZ A;  2AKW B;  5GQO A;  1DGS A;  1TWF B;  2GN5 A;  2KOL A;  2M00 A;  4IO9 A;  4A3B G;  1MBY A;  5ELB A;  4C3H G;  2I0Q A;  1S5F D;  4L6T B;  3OIP A;  4HJ8 A;  4N9T A;  3U4V A;  2UU9 L;  1ZEQ X;  4HJA A;  5IYD H;  3WOE A;  4DV5 Q;  4DPG A;  4H0L C;  3MXN B;  3OHX C;  4FF3 A;  4LF6 L;  3SK6 A;  3M7G A;  5ISR A;  1MJE A;  5GAG C;  4KI0 A;  2F0O A;  1G51 A;  5A2Q E;  2IY5 B;  3DM3 A;  4OO1 H;  1RL2 A;  1IYU A;  2KUM A;  4KHZ A;  2XWJ B;  1I94 Q;  4HJ9 A;  4DAY A;  5AFW A;  3NWT A;  2ASB A;  2L4N A;  2EJM A;  3AQQ A;  5IYD G;  1B50 A;  1VQE A;  1D1K A;  1GO3 E;  2JJQ A;  2WAQ B;  1A63 A;  4DV7 Q;  2R93 G;  2XRS D;  3NK9 A;  1F9P A;  5JEA J;  4WFN 3;  3K7U C;  2SEB D;  4OO1 G;  3HOZ B;  3RZD B;  2PMZ E;  2RCF A;  1ZYR D;  4R4O A;  4TRD A;  1D6E C;  2PW5 A;  2DGY A;  1IBM Q;  2MNA A;  4C2M H;  4EQO A;  3M3Y B;  2VZA A;  3A8J E;  3P7J A;  3OW7 A;  3S1N B;  2E2H B;  4X3T A;  4DAY B;  4X64 L;  2F52 A;  3HG9 A;  2HDM A;  4B3T L;  2N3S A;  1HNZ L;  3CRK C;  1JOQ A;  1PTO D;  3SE0 A;  2K28 A;  1JE5 A;  2X6L A;  3IKJ A;  2Y0S G;  4JC0 A;  1B4O A;  1XNQ L;  2R7Z B;  5BN4 A;  1N9W A;  4TQU S;  2SNM A;  1KLU D;  2B2Y A;  1TY0 A;  4C3I B;  3J80 c;  3PO3 B;  4LFB Q;  4S3S A;  1HZ9 A;  3DLL A;  3B6Y A;  2Q8R E;  5FLX L;  4A76 A;  2K33 A;  2K52 A;  4JK1 C;  1I4G A;  1EIY B;  3A7L A;  1JJG A;  4Q5V A;  1X55 A;  5G3L F;  1N34 Q;  1JR0 D;  2D5D A;  4DUY Q;  1CSQ A;  2CVR A;  2L55 A;  1J5E L;  2EY1 A;  3TP8 A;  3H15 A;  5FKA C;  1NUC A;  3U9S A;  2WB1 G;  3CQZ B;  3PCO B;  2NYZ D;  1DYQ A;  1B9M A;  1OXS C;  1SNQ A;  2PW7 A;  2HIX A;  1HNX L;  4NXM Q;  1XMO Q;  4HMJ A;  5E7N A;  4GN4 B;  1EY7 A;  1PZI D;  3OTO Q;  2FFK B;  4IUP A;  1RD9 D;  3G4S A;  3NQI A;  3T1Y Q;  4P71 A;  4QIW E;  2MP1 A;  4MHE A;  4KN7 C;  4XYQ A;  2K50 A;  3QO2 A;  3S24 A;  3GD7 A;  4DV3 L;  1JQY D;  1SND A;  2R7D A;  2CWP A;  2F3W A;  2B8G A;  4EGV A;  4A3M B;  5BN3 A;  1LTG D;  1RDP D;  5GRO A;  3SDZ A;  5COR A;  4LF9 L;  1VS0 A;  3A55 A;  3CCM A;  1A3V A;  2BE5 D;  4OL7 A;  4XT1 B;  2KHI A;  2JEA I;  2K5N A;  3KK7 A;  2I5H A;  4HMI A;  2DY8 A;  3GP7 A;  3I3C A;  2JA9 A;  1EU3 A;  3U50 C;  2NZH A;  3HOV B;  3GQB A;  3NTK A;  4A3J G;  1EY5 A;  2J4X A;  1YZ6 A;  1S5C D;  2MHV A;  2VW9 A;  4RHR A;  5D3I B;  1EU4 A;  1SE2 A;  3D6C A;  3BZC A;  1RF2 D;  3NSW A;  3Q8D A;  1HHV A;  1TXY A;  3ONA B;  3S1M B;  4FO2 A;  3GTP H;  3LWU A;  2VL6 A;  4RAU C;  2EYH A;  5JJK A;  3GV6 A;  3A56 A;  2LSS A;  4H44 C;  1IBM L;  5LMU L;  1BQQ T;  1SNP A;  1SE8 A;  1MGS A;  5FJ8 G;  1KRT A;  2VXW A;  4PZ6 A;  4HJ7 A;  4KHP Q;  2K5H A;  5KYL A;  1YIT A;  5DM7 3;  5FO8 B;  5HUR A;  3ND9 A;  4PMW A;  1LT4 D;  1EYA A;  1I4P A;  4JBW A;  3NEM A;  3T16 A;  1LYL A;  4A3L H;  4C1N K;  2OTJ A;  1ESF A;  1IW7 D;  1ILQ A;  1S4Z A;  2XRQ D;  1ASY A;  4LMQ D;  1I50 H;  2QCP X;  3GTM H;  3TSS A;  1QZH A;  1PH7 A;  1EYC A;  1EY4 A;  1TVX A;  2LFN A;  4POG A;  1PYB A;  4JOI C;  1KAW A;  2WAQ E;  2R92 G;  5CV5 A;  2OTL A;  1X3P A;  1GHK A;  1QNK A;  4RG1 A;  3I73 A;  2G9D A;  2PNR C;  4ZKC B;  4QF4 A;  4DR5 Q;  4IFD H;  1XNR Q;  2KHS A;  4ULL A;  3FKI H;  5EQ0 A;  1YNJ C;  1X3E A;  3CU7 A;  2IPK D;  1H95 A;  2A1A A;  4L5R C;  2VQE Q;  4QMG A;  3NXW A;  2QEX A;  4ZQ3 A;  3R93 A;  3KF6 A;  2RF4 A;  5E3F A;  1VQF A;  4ZUI A;  4NB3 A;  4DAP A;  1ML0 D;  4C2M B;  5EPK A;  1BCP F;  2N78 A;  4M8A A;  2E74 C;  3VA7 A;  4DV6 L;  3G6E A;  4NXM L;  2EIF A;  1XMO L;  3UDG A;  1XPU A;  2A74 C;  1TQO A;  4JG2 A;  4N9P A;  4K0K Q;  4A3F B;  2JYO A;  1PH3 A;  4DK0 A;  3T1Y L;  1TS2 A;  3H0G H;  2B2W C;  1IL2 A;  3C1F A;  3GTK H;  3EA6 A;  1EIH A;  3J7A 5;  2A73 B;  5C4J H;  3GTL B;  4B3S L;  1A3T A;  3N6R A;  3PV0 A;  1RHP A;  2K05 A;  4RCO A;  1RJT A;  4X3K A;  1X9N A;  1E24 A;  2WV6 D;  1TS3 A;  4B3R L;  1KL9 A;  2AUK A;  2B8F A;  3CPW A;  4IJH A;  1AZQ A;  3CME A;  3D31 A;  4K8I A;  1E22 A;  5EKI A;  2RVL A;  1KDC A;  4DR2 Q;  3A8K E;  1FJG Q;  1VQP A;  1SRU A;  2K03 A;  3J80 i;  3H0G G;  5I2Y A;  4HCS A;  3HOX G;  2B2W A;  4BS9 A;  4LJZ C;  2L0C A;  1G6Z A;  4X3S A;  3RLF A;  3L3O C;  1UE1 A;  4DUZ L;  5EKL A;  1JC7 A;  2PZU A;  1T5E A;  4XDX A;  4JI6 L;  1PYW D;  1B8A A;  2BA1 A;  1FVI A;  3QWN A;  2CQO A;  2PPB C;  3L7Z C;  3W2D A;  1YHA A;  1PRT D;  3HS0 C;  3P20 A;  3CPF A;  2F0K A;  3C3L A;  1BXT A;  1E1O A;  4B9W A;  3IFT A;  1GXD C;  3S1Q H;  3LX0 A;  5CMD A;  3VYS A;  1MD2 D;  2L11 A;  1OXX K;  1TWG B;  5CYU A;  4HSV A;  1G2T A;  4A3K B;  1BUV T;  1VCI A;  3UE0 A;  1Z47 A;  1VMC A;  4GZY C;  1EEF D;  2HQL A;  1X3F A;  3HEJ A;  5JOB A;  4Y7N H;  1PH5 A;  4CDD C;  3KDF B;  5C4Z A;  1S5D D;  2RA4 A;  3S17 H;  1A15 A;  2XNA C;  3TBI B;  4GS3 A;  1SDF A;  2JEB I;  5IOD A;  2CW0 D;  3PUW A;  4K5V A;  1K8O A;  2Q2T A;  2OWO A;  3OWE B;  2RKS A;  1ZKO A;  1EFI D;  3VR4 A;  3X3N A;  3C46 A;  1JJC B;  1VQ6 A;  1LO5 D;  3PIO 3;  5M3M H;  2PQA B;  3NWS A;  2F0U A;  3CMA A;  4RGO S;  1LTR D;  1V1P A;  3J81 c;  4DR5 L;  4QUC A;  1PMR A;  4P75 A;  3RLO A;  3MXG A;  4XQQ A;  3GTP B;  1OO9 B;  5M5W H;  4R1J A;  4DXF A;  2JA6 G;  2F0E A;  1LTB D;  5IYB G;  5BR8 Q;  2SOB A;  2VQE L;  4RGT A;  1YNN D;  4K6D A;  3R3O A;  2JA8 B;  3KLW A;  1CFM A;  3MWY W;  4IUU A;  1EYG A;  3DMU A;  4HSP A;  4JYA L;  1K3R A;  3OMC A;  2A68 C;  4PG3 A;  2EVB A;  3CCJ A;  1QNU A;  3O13 A;  5M3M G;  2YU9 B;  1CKM A;  3I2Z A;  1Q86 C;  2KHJ A;  1CK1 A;  4AYB B;  3U4Z A;  3PIP A;  3A5U A;  1T9H A;  5D65 A;  3SR1 A;  1V43 A;  1V1P B;  1I50 B;  4LFC Q;  3CRL C;  3GTM B;  4GKK Q;  1Q7Y C;  3QIA A;  4AIM A;  3CAM A;  4JI3 L;  4IZ8 A;  2E76 C;  4X3U A;  2N8N A;  1PZJ D;  4BWG B;  2HIV A;  4FVM A;  4DGZ A;  3KLS A;  2A69 D;  3NQT A;  4XQN A;  4LUO A;  4HID A;  1JJ2 A;  1HTP A;  1VQ7 A;  2RBM A;  1KRS A;  4GLV B;  4X66 L;  1VMP A;  3AMU A;  1JCK B;  1STE A;  2GVB A;  1EWI A;  3FKI B;  4FF2 A;  1BVS A;  4YCW A;  2IWH A;  2Z8L A;  4BY1 H;  1NTG A;  2B39 A;  1XX8 A;  1AW7 A;  5FLX E;  3RMH A;  3M3Y H;  2WII B;  1F2M A;  1GKH A;  1K8A C;  4NXN Q;  5M3F B;  2WAQ G;  1WVL A;  2NVQ H;  4ZYS A;  5IIF A;  3CXC A;  2A6E C;  1PFB A;  2Q8T A;  2Z4I A;  2PQE A;  3ULL A;  2JA7 B;  1D5M C;  2DY7 A;  2KCC A;  1B70 B;  2R7Z H;  3GTK B;  1K8M A;  3HOZ G;  3S1R H;  5IWA Q;  3SVM A;  2IX1 A;  4V0B A;  1PH8 A;  3I4M H;  1TWH B;  1QVG A;  4DR7 L;  4POF A;  1KNE A;  4J8Q A;  4B9X A;  1VQ4 A;  1AZP A;  4LW1 A;  4GN3 B;  1LAB A;  3U9O A;  5LL6 S;  1SNC A;  2QDB A;  5IP9 H;  5GAH C;  1EY0 A;  5C5L A;  1EOV A;  2R7Z G;  1OTC A;  3EIV A;  1WCM H;  3CQZ H;  2K5Q A;  3OYY A;  2L12 A;  3S14 B;  1SNO A;  3I7F A;  4C3I G;  3CKI B;  3PO3 G;  1TII D;  1JOK A;  3VR5 A;  2DJG C;  5CV9 A;  1K3B C;  2K32 A;  3M4Q A;  2MUY A;  1Z9F A;  3K80 C;  3Q23 A;  5KGU A;  2OF1 A;  1HZA A;  1L1O A;  1HNZ Q;  3CCV A;  3M4P A;  1G6P A;  1A6X A;  1K0R A;  5IP9 G;  1G91 A;  1XNQ Q;  4N8X 1;  1E2W A;  1E7Z A;  1GUO A;  3EN2 A;  3NE5 B;  5J22 A;  4UP7 A;  2VQF L;  4KD4 A;  2GA4 B;  1QIL A;  1J6Q A;  1TT2 A;  1BDO A;  5IP7 G;  3BS1 A;  5C6A A;  2AQ3 B;  5CC4 A;  2F03 A;  1VQD A;  2L15 A;  3RN5 A;  1PH9 A;  4B3M Q;  1B9N A;  2F0P A;  5C0X J;  4R4Q A;  1EQT A;  4Y7N B;  3M4Y A;  1F9S A;  3VYT A;  3P75 A;  3H94 A;  2RHS B;  1J5E Q;  1N32 Q;  1M90 C;  4LFC L;  2HHH Q;  2KCM A;  3BDC A;  1K83 H;  2BCO A;  5IT9 E;  3MFY A;  2K4K A;  3UDX A;  3HOV H;  1Q1E A;  2C35 B;  1Q46 A;  2NN6 H;  3K5O A;  1KAA A;  1U0L A;  1SJE D;  5M3M B;  2K75 A;  5KEE A;  4A3M G;  1HNX Q;  3I70 A;  3E6Z X;  2H4O A;  4ZAI A;  1I6V C;  1LT6 D;  4IPC A;  5M5W B;  1AFP A;  2F1M A;  4A93 H;  4YCV A;  2EXZ A;  4FF1 A;  4NKL A;  2IJ0 A;  1EZ6 A;  4WJ4 A;  3J81 i;  4DR4 L;  4E6I A;  4DV3 Q;  3HOV G;  2D0P A;  4DN4 M;  3PUZ A;  3T53 B;  4BA2 I;  4NXN L;  4BA1 I;  3PQI A;  4K2L A;  2YTV A;  2DNC A;  4MTN A;  4ME3 A;  1I4X A;  3CCE A;  1Q12 A;  1VQ8 A;  3AYH B;  1EQR A;  1SE4 A;  1D8L A;  1LAC A;  4KTA A;  4LF9 Q;  1LTA D;  3K59 A;  2E2D C;  4F88 A;  1D2B A;  2B2T C;  2OT2 A;  1WTX A;  1RKN A;  5ELN A;  1E2V A;  5IWA L;  4OHJ A;  1SYD A;  1LTL A;  3LNN A;  1Z7T A;  2HUG A;  4N8F A;  1X3Q A;  4BXX H;  5C5M A;  5JEA H;  5K36 H;  1XJV A;  2TSS A;  4DV0 Q;  1BOS A;  2ZJP A;  4K5W A;  4GLA C;  1MI2 A;  1A2U A;  1UE5 A;  1QZG A;  1MHW C;  5IGD A;  1E2Z A;  2B2Y C;  1NY4 A;  1KDB A;  3D4R A;  4KKU A;  2KQ3 A;  4BY1 B;  3PUY A;  1UWV A;  2B2T A;  2BH8 A;  5ELF A;  2VUM B;  1GJX A;  4K6L A;  2B2U C;  4ILW A;  5LMU Q;  1GUT A;  4ODG A;  2WFW A;  1VQG A;  3ERS X;  5JPM C;  3EVQ A;  2NVQ B;  4A3F H;  3R8B A;  1VQN A;  1YJ9 A;  3BDO A;  2X6G A;  2K14 A;  3KF8 A;  3FP9 A;  5A35 A;  4JW0 A;  1EQV A;  2AQ1 B;  1U4M A;  3S1R B;  4LNQ A;  2BDO A;  2ENB A;  3K5M A;  4O42 A;  4H13 C;  2AMC B;  2UXC L;  3GTL H;  1CA5 A;  3I4M B;  3OWF A;  2PI2 E;  2B2U A;  1RCV D;  1H9K A;  4KV6 A;  2AWN A;  4B3M L;  1YHQ A;  2N88 A;  1PH6 A;  1CSP A;  2XWB B;  4ZUJ A;  4UP8 A;  2K7V A;  1CKO A;  1X32 A;  5C3X A;  4A3F G;  2Z6K A;  2EJF C;  5TSS A;  1N32 L;  1NMF A;  1IZ6 A;  2HHH L;  5IGF A;  3GTO B;  3I4N H;  4A3E B;  1BO0 A;  1TKW B;  2KEN A;  2Z6B A;  4K14 A;  3JAM E;  1A0I A;  5HGQ A;  1QE6 A;  3D3R A;  4R9W A;  1WCM B;  3KF8 B;  2JSO A;  1SYE A;  1O7I A;  4DV6 Q;  5C3W A;  2JK8 A;  2EE1 A;  5I6W A;  3E0J A;  1HJP A;  1TU2 B;  2RSO A;  2UXB L;  1P16 A;  5EKK A;  3MXP A;  2ZM6 L;  1XPO A;  2R6G A;  1NR4 A;  3G7L A;  2RDH A;  3AEV A;  1PTO F;  4YCU A;  1QVC A;  1C8C A;  3LGJ A;  4EX5 A;  3S16 H;  3STB C;  1KHI A;  3GDE A;  4OWW B;  4IPD A;  1X54 A;  1W2B A;  4JI7 L;  1TWG H;  4CJ0 B;  4B3S Q;  4DXG A;  4A3K H;  2WP8 J;  2VNU D;  2QEJ C;  1PHJ A;  1EIG A;  3HKZ B;  1GD7 A;  4B3R Q;  3FPU B;  1NJI C;  1K73 C;  4G57 A;  3TZD A;  1YNJ D;  1CKN A;  1I6H H;  3GTJ H;  2NWG A;  4KY5 A;  4KJN A;  2UXD L;  4LAA A;  2CKZ B;  1EUJ A;  1K83 B;  3GV3 A;  4O1N A;  3CD6 A;  3VYU A;  3H3V I;  3G48 A;  1M4V A;  5ELE A;  1GVP A;  4DUZ Q;  1C9O A;  4DV4 L;  1Q90 A;  4DV0 L;  4A3K G;  4HN7 A;  5EGT A;  3W1B A;  4JI6 Q;  1X65 A;  4JI5 L;  3SK4 A;  3DM1 A;  5KYI A;  2YV5 A;  4Q0F A;  3UE1 A;  4TKO B;  4A93 B;  2LY7 A;  3F2U A;  5J3B A;  2JA8 H;  4IUQ A;  1CKN B;  1ESR A;  4DK6 C;  1CQF A;  5C4H A;  4CGY B;  1T5X D;  1G29 1;  1JOR A;  5FO9 B;  5HGT A;  4O2D A;  3NBI A;  2PCF B;  5DAU A;  1QCB D;  3P1H A;  4DFA A;  1EZ8 A;  5E1F A;  2YU9 H;  2UUC L;  1MJC A;  2HCI A;  3MFG A;  1YJN A;  3MTS A;  4LF8 L;  3Q24 A;  2WIN B;  4HTH A;  4RA8 A;  3LWE A;  2OCE A;  3DEP A;  3PUX A;  5C44 B;  1VQ9 A;  4R4I A;  2JA8 G;  4QY7 A;  3ERQ A;  1N36 Q;  1Q82 C;  1UUP A;  5JVH 3;  4LF5 L;  1SR3 A;  3F1Z A;  2E2J B;  2K01 A;  1V1O A;  2SDF A;  1CZG A;  1PH4 A;  4F8M A;  4OX9 L;  1HQR D;  4AYB G;  4CJ2 C;  3TRE A;  4A3L G;  2EYO A;  1DXM A;  3BZK A;  3K81 C;  1YI2 A;  1FR3 A;  1OXT A;  1NMG A;  1W6K A;  3CC2 A;  1DOM A;  4BY7 H;  4JYA Q;  2ZXO A;  4QJF A;  2HCC A;  3L0O A;  1SMY C;  5M3F H;  3GTQ B;  5IGG A;  3HFZ B;  5A2Q L;  4JBK A;  2BH2 A;  4IFD G;  2V4D A;  2O5J C;  2JA7 H;  3NP8 A;  1JT8 A;  3FKI G;  2RDF A;  1V1Q A;  1BBU A;  1KAB A;  4J15 A;  1SYC A;  4P73 A;  2FHT A;  3IRB A;  1EYD A;  1ET6 A;  4EQ5 A;  5I9O A;  2YTY A;  2F0J A;  1ROD A;  1TWH H;  4JI3 Q;  4FNF A;  5C0X I;  2EPB A;  5GAD C;  1HFN A;  3QB3 A;  1P8L A;  1WTP A;  1ILP A;  5IOC A;  5M3F G;  3KF6 B;  2NVY H;  1CI3 M;  1IHZ A;  4LUV A;  3WOF A;  4X66 Q;  3BG3 A;  2AHO B;  4DV2 L;  4CKE A;  2EDG A;  4KLK A;  4WJW A;  2CFM A;  3MAQ A;  2JA7 G;  3MVV A;  1ENF A;  1KIX A;  3I4N B;  3PO2 H;  1BCP C;  1EY6 A;  1CM9 A;  1GUW A;  4LWC A;  3TS0 A;  2ES2 A;  4A3C H;  1BF4 A;  1PDQ A;  3G71 A;  3S14 H;  3FVQ A;  1IBK L;  1KTK A;  5JPN C;  1STB A;  1DJR D;  2A68 D;  3BVG A;  1HCZ A;  1HTL D;  3K5N A;  4JI2 L;  3S2D H;  4CJ1 B;  1NR2 A;  4FXG C;  1F9R A;  3K5L A;  3S2H H;  1B1Z A;  3I56 A;  1PYS B;  1LV9 A;  3DWA A;  4A4I A;  2ZJQ A;  4RHS A;  3HP3 A;  3PIO A;  3BJU A;  1SXT A;  4ABN A;  2E2I B;  1H9S A;  5EBC A;  2KEE A;  3NBH A;  3S16 B;  3SGI A;  5CGK A;  4A3C G;  1HFG A;  2RHQ B;  1PA6 A;  1JWM D;  1QB5 D;  2R3Z A;  4DR7 Q;  4K8J A;  4R8N A;  2VY3 A;  2Z9H A;  3K6O A;  5C3E H;  3D4D A;  2AUJ D;  1VQ5 A;  4FYD A;  2TMP A;  4CKB A;  1SNM A;  4KHV A;  1KC8 C;  3E3X A;  1B3A A;  4OGQ C;  4IUN A;  3GTJ B;  1I6H B;  2ICI A;  1CZW A;  1SYG A;  4WOR A;  1K28 A;  4FF4 A;  1R4P B;  5FLX c;  3OMG A;  1TWC H;  1EIF A;  1QWY A;  4JI1 Q;  1N36 L;  3MC0 B;  3HOU H;  3SEB A;  1R4Q B;  2KED A;  1Y8P B;  3HOY B;  1JOO A;  1H9S B;  1HRJ A;  2A6H C;  3NBH B;  2ATW A;  1I3Q H;  1BR9 A;  2ZT9 C;  4OO1 I;  1BCP B;  2F3V A;  1UE7 A;  5C3E G;  2EZV A;  2A6E D;  3L9A X;  4OON A;  3I72 A;  1YJW A;  1WTH A;  1VQL A; 
#chains in the Genus database with same CATH homology
 1Y1V H;  5DLQ E;  4DR1 L;  1XNQ Q;  3TS2 A;  1N9W A;  4TQU S;  2PNH A;  4DR1 Q;  1E7Z A;  3U58 A;  3EN2 A;  4H02 A;  4LFB L;  4UP7 A;  1PH1 A;  3AFQ A;  2VQF L;  1K9M C;  3J80 c;  2NVT H;  4IOA A;  4LFB Q;  1HZ9 A;  3DLL A;  1J6Q A;  3B6Y A;  2KBN A;  4JBJ A;  2VQF Q;  3GO5 A;  5HY6 A;  5IP7 G;  4A76 A;  2VS1 A;  3VDY A;  2K5V A;  2K52 A;  1VQD A;  2L15 A;  3RN5 A;  1EIY B;  1PH9 A;  4B3M Q;  1N34 L;  2AWO A;  1JJG A;  1X55 A;  4GNX A;  5C0X J;  4DUY L;  4XIG S;  4QL5 A;  4XTC S;  1N34 Q;  4R4Q A;  4DR3 L;  4DUY Q;  1CSQ A;  4LF4 L;  4HIO A;  2NVX H;  1J5E L;  4FDB A;  4IFD J;  2R7F A;  4BBS H;  2RHS B;  1J5E Q;  1N32 Q;  1M90 C;  4HIK A;  4LFC L;  1Y1W H;  2HHH Q;  3H15 A;  1Y1V G;  4A3I H;  2KCM A;  3CC7 A;  3L2P A;  1K83 H;  1KXL A;  4R4T A;  4JBM A;  4A75 A;  2K4K A;  2WB1 G;  3PCO B;  3JC6 6;  3UDX A;  1OXS C;  4UY8 C;  3HOV H;  2D62 A;  1A8V A;  1Q1E A;  2C35 B;  4JOI A;  1Q46 A;  4YHH L;  2H5X A;  4L5S A;  2HIX A;  1C0A A;  1U0L A;  1HNX L;  4NXM Q;  2K75 A;  3OTO L;  1XMO Q;  4A3M G;  1GM5 A;  5E7N A;  4BY7 G;  4GN4 B;  1HNX Q;  3OTO Q;  1KD1 C;  3G4S A;  3KFU A;  2I5L X;  3T1Y Q;  4P71 A;  4IPC A;  1VQJ A;  1C7Y A;  4QIW E;  3HOX H;  3M7N A;  4A93 H;  2K50 A;  5IYC H;  4GNX B;  2VUM H;  3S24 A;  4YCV A;  3GD7 A;  1YVC A;  4APV A;  1OXV A;  2YTX A;  4DV3 L;  2I5M X;  3K0X A;  3M85 A;  4WJ4 A;  3J81 i;  2R7D A;  1PV4 A;  2CWP A;  4DR4 L;  4A3G H;  4DV3 Q;  3HOV G;  2D0P A;  3PUZ A;  4UP9 A;  3TEH B;  4BA2 I;  4DR4 Q;  4NXN L;  4BA1 I;  2YTV A;  1ASZ A;  1D7Q A;  2IHF A;  4MTN A;  5GRO A;  4ME3 A;  3CCE A;  1Q12 A;  1VQ8 A;  3AYH B;  4A3D H;  4LF9 L;  1EQR A;  1TWA H;  1VS0 A;  5M5Y H;  2MQH A;  1D8L A;  4BBR H;  1Q81 C;  4LF9 Q;  2DUD A;  3CCM A;  1VQC A;  1WYD A;  1W3S A;  2CCZ A;  2KHI A;  2JA5 H;  2JEA I;  2K5N A;  5ELN A;  5IT9 c;  5IWA L;  2UUB L;  3M4O H;  2I5H A;  1LTL A;  4X62 L;  1V9P A;  4PZ7 A;  4BY1 G;  2UUB Q;  3PF4 A;  1SN8 A;  3I4O A;  2VUM G;  2JA9 A;  4X62 Q;  3PO2 G;  3F2B A;  3U50 C;  2NZH A;  4A3J G;  2NN6 I;  3KDF A;  1EFW A;  1X3G A;  1HH2 P;  1YZ6 A;  2EQS A;  4BXX H;  2VW9 A;  3HKZ E;  2JQO A;  3BZC A;  1XJV A;  1L1O C;  4DV0 Q;  2ZJP A;  3Q8D A;  4GLA C;  1TXY A;  1SMX A;  1IYJ B;  3GTP H;  3TRZ A;  1UE5 A;  1QZG A;  1A62 A;  2VL6 A;  1LUZ A;  1OXU A;  5JJK A;  4JI0 L;  1NY4 A;  2PQA A;  3GTO H;  1HZC A;  4A3E H;  2JE6 I;  1Q8K A;  1HZB A;  3PUY A;  1UWV A;  2BH8 A;  2LSS A;  1IBM L;  3OW2 A;  1UE6 A;  5LMU L;  4PZ8 A;  4JI1 L;  1SE8 A;  5FJ8 G;  1QUQ A;  2ID0 A;  1KRT A;  5LMU Q;  4KHP L;  2WFW A;  4PZ6 A;  4HJ7 A;  3I4M G;  4KHP Q;  2K5H A;  1MKH A;  1VQG A;  3ERS X;  3PGZ A;  3CCS A;  2N49 A;  3ULJ A;  4YY3 Q;  4GNX C;  1YIT A;  4JV5 Q;  4PMW A;  3K8A A;  4A3F H;  4JBW A;  3NEM A;  1VQN A;  2JA6 H;  3GTG H;  5IYB H;  4TVA B;  1LYL A;  1YJ9 A;  1N33 L;  4A3L H;  2K14 A;  3TQY A;  3W1G A;  3FP9 A;  3RN2 A;  3S15 H;  2IHE A;  2UUA Q;  1XMQ L;  1N33 Q;  2OTJ A;  1ASY A;  5LMN Q;  4GKJ L;  3ZJY C;  1I50 H;  1XMQ Q;  4LF7 L;  3GTM H;  1QZH A;  2ALY B;  4GKJ Q;  4A3E G;  4LF7 Q;  4LNQ A;  1PH7 A;  4JI8 Q;  3A5Z B;  4L5Q A;  1PYB A;  2AMC B;  1KAW A;  4JOI C;  2WAQ E;  3ULP A;  4POG A;  1WCM G;  2R92 G;  1YNX A;  2OTL A;  3GTL H;  2PI2 E;  2UXC Q;  4RG1 A;  2AWN A;  3HOU G;  4B3M L;  4JCV E;  2IT1 A;  1YHQ A;  3RNU A;  1PH6 A;  1XNR L;  1CSP A;  4WJ3 M;  4UP8 A;  4C3J H;  4DR5 Q;  1HNW L;  1CKO A;  1YBY A;  2B63 H;  1QUQ B;  4X65 Q;  1XNR Q;  3MEF A;  1TWF H;  3F2C A;  2Z6K A;  3FKI H;  4A3F G;  1HNW Q;  1X3E A;  3ICE A;  1H95 A;  2A1A A;  1NMF A;  1S72 A;  1IZ6 A;  4L5R C;  1N32 L;  2VQE Q;  2HHH L;  3I4N H;  2KEN A;  1PH2 A;  2QEX A;  1A0I A;  3KF6 A;  5HGQ A;  1VQI A;  5ELO A;  1L1O B;  4DK3 C;  3CCL A;  2UXC L;  2RF4 A;  5GAE C;  1VQF A;  3KF8 B;  4NB3 A;  5IY0 A;  4QGU A;  2N78 A;  1M1K C;  4DV6 L;  2ZTC A;  3G6E A;  3H3V H;  1O7I A;  4NXM L;  2EIF A;  1XMO L;  4DV6 Q;  5C4X H;  2JK8 A;  3CF5 A;  1Q1B A;  3UDG A;  1VQB A;  1XPU A;  4JG2 A;  4K0K L;  1HJP A;  2UXB L;  1P16 A;  3HKZ G;  4A3B H;  4K0K Q;  1PH3 A;  2ZM6 L;  1XPO A;  2UXB Q;  3W5O A;  2R6G A;  3T1Y L;  2B63 G;  2ZM6 Q;  4LFA Q;  3H0G H;  1SFO H;  1HR0 L;  1IL2 A;  2OQK A;  1YIJ A;  3GTK H;  1AE3 A;  1HR0 Q;  3AEV A;  4BBS G;  4YWL A;  4YCU A;  1QVC A;  3KYH C;  3LGJ A;  4EX5 A;  1Y1W G;  1AE2 A;  4A3I G;  3J7A 5;  3S16 H;  3STB C;  1KHI A;  3GDE A;  4OWW B;  5C4J H;  4IPD A;  4B3S L;  1X54 A;  3PV0 A;  4OWT B;  1W2B A;  3NEL A;  1TWG H;  4JI7 L;  4B3S Q;  4YWM A;  4DAM A;  1X9N A;  1SLJ A;  1K8G A;  4A3K H;  4P72 A;  1E24 A;  2WP8 J;  4JI7 Q;  2VNU D;  1PHJ A;  4B3R L;  1KL9 A;  4GLX A;  4IFD I;  2NN6 G;  1GD7 A;  1X6O A;  2Y0S E;  3CPW A;  2A8V A;  5C4X G;  4IJH A;  4B3R Q;  4AYB E;  3CME A;  1NJI C;  3D31 A;  1IBL Q;  1K73 C;  1U5K A;  3CP0 A;  4DR2 L;  2E5L L;  1E22 A;  1FJG L;  4AH6 A;  1X56 A;  4P74 A;  1PFS A;  4GN5 A;  1VQK A;  1CKN A;  4DR2 Q;  2E5L Q;  3HOZ H;  1FJG Q;  3RZD H;  1VQP A;  1XPR A;  2V1C C;  1SRU A;  3GTJ H;  1I6H H;  3J80 i;  3H0G G;  3JAM c;  4GOP C;  5JJL A;  2PI2 A;  3HOX G;  2UXD L;  2B3G A;  2CKZ B;  4Y52 H;  2Q2I A;  2UU9 Q;  5IE8 A;  1Y14 B;  1EUJ A;  5C44 H;  4A93 G;  2UXD Q;  4HIM A;  5IYC G;  3CD6 A;  1HR0 W;  3H3V I;  3G48 A;  3RLF A;  3D0F A;  2IX0 A;  1UE1 A;  4DUZ L;  2GVA A;  3J7Z C;  4IJL A;  4LF6 Q;  2E2H H;  1GVP A;  4DUZ Q;  1C9O A;  3S1N H;  4A3G G;  4DV4 L;  3T1H L;  4JI6 L;  2R93 H;  4DV0 L;  4IOC A;  4A3K G;  1JB7 A;  1PVO A;  1B8A A;  2BA1 A;  1FVI A;  4UPA A;  3W1B A;  5AJ3 L;  4DV4 Q;  3T1H Q;  2E2J H;  4JI6 Q;  1X65 A;  2CQO A;  4JI5 L;  5AJ3 Q;  1R9T H;  2QGQ A;  3L7Z C;  1AH9 A;  1YHA A;  4JI5 Q;  4A3D G;  4RMF A;  2YV5 A;  3CPF A;  2WB1 E;  4BBR G;  2D0O A;  3UE1 A;  1E1O A;  4JI4 L;  4L5T A;  4YWK A;  3UDI A;  2MO1 A;  2ZJR A;  4DKA C;  4JI4 Q;  3S1Q H;  2JA5 G;  3FHW A;  4GOP A;  5J3B A;  1UEB A;  4C3I H;  1OXX K;  2JA8 H;  4O0A A;  3HOW H;  3STB D;  3PO3 H;  5C44 G;  1CKN B;  4DK6 C;  1G29 1;  3A74 A;  3CC4 A;  4YY3 L;  1VCI A;  3UE0 A;  4O2D A;  3WWV A;  1B7Y B;  3RLN A;  3GTQ H;  4JV5 L;  1WFQ A;  1Z47 A;  4BXX G;  1VQH A;  3E9I A;  1CUK A;  2HQL A;  5JEA G;  2UUC L;  2Z6K C;  1X3F A;  4LUZ A;  2YU9 H;  4Y7N H;  1MJC A;  1VQO A;  5K36 G;  4MNO A;  1PH5 A;  4QQB X;  1YJN A;  2UUC Q;  3KDF B;  2UUA L;  4LF8 L;  1QVF A;  5LMN L;  3S17 H;  4LF8 Q;  4GS3 A;  1XTD A;  2JEB I;  2OCE A;  3ER0 A;  3PUW A;  4JI8 L;  3PUV A;  3PUX A;  1VQ9 A;  2B29 A;  2Q2T A;  4R4I A;  4DR6 L;  2OWO A;  2JA8 G;  4QY7 A;  5IP7 H;  3CCR A;  1N36 Q;  1Q82 C;  3HOW G;  1WOC A;  3E9H A;  1L0W A;  1JJC B;  1VQ6 A;  5M3M H;  4HJ5 A;  2PQA B;  4LF5 L;  1WI5 A;  3J81 j;  3CMA A;  1SR3 A;  3J81 c;  3F1Z A;  4X64 Q;  4DR5 L;  4GOP B;  4LF5 Q;  1L2F A;  4P75 A;  3RLO A;  4X65 L;  4B3T Q;  1PH4 A;  2KCT A;  5BR8 L;  5H1S E;  5M5W H;  4R1J A;  2F4V Q;  4OX9 L;  2JA6 G;  4AYB G;  4AQY L;  5IYB G;  2OQ0 A;  3TRE A;  5BR8 Q;  4DNI A;  2LXK A;  2VQE L;  4A3L G;  4OX9 Q;  3BZK A;  3K81 C;  4AQY Q;  3K7A H;  1S40 A;  1YHB A;  4ALP A;  1FGU A;  1WJJ A;  3KJP A;  1YI2 A;  3UDF A;  1NBW A;  3HKS A;  1E1T A;  4IPH A;  5LMN W;  2MO0 A;  1OXT A;  3KLW A;  4OXP A;  1NMG A;  4X6A H;  1N8R C;  1EYG A;  1K0R A;  4JYA L;  1BKB A;  1K3R A;  4A3M H;  3CC2 A;  5FLM H;  4BY7 H;  4JYA Q;  4QJF A;  4PG3 A;  2CWA A;  3L0O A;  3CCJ A;  5M3F H;  5M3M G;  4R4C A;  5C0X G;  3HFZ B;  2Z0S A;  3RR5 A;  1CKM A;  4JBK A;  3I2Z A;  1Q86 C;  2KHJ A;  2HT1 A;  2BA0 A;  4DR3 Q;  2XGT A;  4LFA L;  2BH2 A;  3U4Z A;  4IFD G;  4C3H H;  4LF4 Q;  3PIP A;  3A5U A;  2JA7 H;  1T9H A;  1JT8 A;  3FKI G;  3CCU A;  4GKK L;  1V1Q A;  1BBU A;  1NE3 A;  1V43 A;  4J15 A;  4P73 A;  2E2I H;  4LFC Q;  4GKK Q;  3AFP A;  1Q7Y C;  3M9B A;  3IRB A;  4AIM A;  3I4N G;  4EQ5 A;  3CAM A;  4JI3 L;  3CCQ A;  2LXJ A;  2YTY A;  1TWH H;  3PF5 A;  4IPG A;  4JI3 Q;  1VQM A;  2E8G A;  2Q2H A;  5C0X I;  2N8N A;  4MZ9 A;  5GAD C;  2HIV A;  4YHH Q;  3F8T A;  2YYZ A;  3CW2 C;  4OWX B;  5FLM G;  1JMC A;  1P8L A;  4LUO A;  4HID A;  4DR6 Q;  5M3F G;  1JJ2 A;  3KF6 B;  1LM0 A;  2NVY H;  4LUV A;  4DV1 L;  1IBL L;  1XNQ L;  3S1M H;  2FXQ A;  1VQ7 A;  1KRS A;  3E0E A;  4GLV B;  4X66 L;  4DV1 Q;  1BBW A;  5GQO A;  2AKW B;  4IO9 A;  1DGS A;  2Q2U A;  2GN5 A;  2GVB A;  1EWI A;  4X66 Q;  4A3B G;  2AHO B;  4DV2 L;  1BVS A;  4YCW A;  3F2D A;  4KLK A;  2I0Q A;  1EQQ A;  2CFM A;  4BY1 H;  4DV2 Q;  2JA7 G;  1KIX A;  4HJ8 A;  3U4V A;  3PO2 H;  2UU9 L;  4A3J H;  4LWC A;  3TS0 A;  2ES2 A;  1NTG A;  4DV5 L;  3EBE A;  4HJA A;  4A3C H;  3S14 H;  3G71 A;  5IYD H;  2XTI A;  4DV5 Q;  1IBK L;  3M3Y H;  4DPG A;  3MXN B;  4NPS A;  1IBK Q;  4LF6 L;  1FL0 A;  1GKH A;  3HOY H;  1MJE A;  1K8A C;  1IXR A;  5GAG C;  4JI2 L;  4KI0 A;  2WAQ G;  4NXN Q;  3S2D H;  1G51 A;  4JI2 Q;  2NVQ H;  2ZTD A;  2IY5 B;  3CXC A;  2MFI A;  3S2H H;  5M5X H;  3I56 A;  1VQL A;  3DM3 A;  1PYS B;  4A4I A;  2ZJQ A;  1RL2 A;  3ULL A;  1I94 L;  4KHZ A;  3PIO A;  3BJU A;  1I94 Q;  1B70 B;  1S3O A;  5EAY A;  3I55 A;  2R7Z H;  4HJ9 A;  3HOZ G;  3S1R H;  5IWA Q;  2IX1 A;  2ZTE A;  2ASB A;  5FJ8 H;  1I5F A;  5JJI A;  3RZO H;  1PH8 A;  3SGI A;  3I4M H;  4A3C G;  3KJO A;  3AQQ A;  2RHQ B;  4POF A;  5IYD G;  1QVG A;  1PA6 A;  4DR7 L;  1VQE A;  1GO3 E;  2JJQ A;  4DR7 Q;  2VY3 A;  1A63 A;  1VQ4 A;  4DV7 L;  4LW1 A;  3HOY G;  4GN3 B;  4DV7 Q;  5C3E H;  2R93 G;  5JEA J;  1VQ5 A;  5IP9 H;  3K7U C;  4OO1 G;  1KC8 C;  5GAH C;  2PMZ E;  1KQS A;  1EOV A;  1SRO A;  4R4O A;  4JI0 Q;  2R7Z G;  2DGY A;  1OTC A;  5FLX c;  3EIV A;  1IBM Q;  1WCM H;  3CQZ H;  2R92 H;  3OYY A;  2MNA A;  1TWC H;  1EIF A;  4C2M H;  4JI1 Q;  1N36 L;  2RCN A;  3I7F A;  2EXD A;  3HOU H;  3PO3 G;  2F3I A;  2VZA A;  3KOJ A;  1YEZ A;  1RIP A;  3M4Q A;  4DAY B;  4X64 L;  2F52 A;  1Z9F A;  2NZO A;  3K80 C;  3NBH B;  2ATW A;  3PSI A;  4B3T L;  1E3P A;  3BU2 A;  1I3Q H;  2N3S A;  4OO1 I;  1HNZ L;  3A0J A;  1VQA A;  1HZA A;  1L1O A;  1UE7 A;  3NEN A;  3JAM i;  5C3E G;  1MIU A;  4OON A;  1HNZ Q;  2F4V L;  4JC0 A;  1JE5 A;  3CCV A;  2Y0S G;  3M4P A;  1G6P A;  1YJW A;  2QA4 A;  2A19 A;  5IP9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...