2ES9A

Crystal structure of q8zrj2 from salmonella typhimurium. nesg target str65
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
100
structure length
100
Chain Sequence
TAIEKALDFIGGMNTSASVPHSMDESTAKGILKYLHDLGVPVSPEVVVARGEQEGWNPEFTKKVAGWAEKVASGNRILIKNPEYFSTYMQEQLKELVLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative cytoplasmic protein
publication title Crystal structure of Q8ZRJ2 from Salmonella typhimurium NESG TARGET STR65.
rcsb
source organism Salmonella typhimurium
molecule tags Structural genomics, unknown function
total genus 32
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08986 DUF1889 Domain of unknown function (DUF1889)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1290.30 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 2es9A00
2ES9A 2JN8A
chains in the Genus database with same CATH superfamily
2QEUA 2OYOA 1GU9A 3D7IA 2PFXA 2KXPA 1LW1A 2OUWA 2PRRA 5DIPA 2GMYA 3AA6A 5ADXK 2KZ7A 2CWQA 2O4DA 1VKEA 3AA1A 5DIKA 3LVYA 1KNCA 3BEYA 3C1LA 3AA0A 3AAAA 3LK3A 3AA7A 3LK41 4G9QA 2JN8A 3AAEA 4AKRA 1P8CA 3LK2A 2IJCA 2Q0TA 1IZNA 2ES9A 2AF7A 1ME5A 5AFUK
chains in the Genus database with same CATH topology
2QEUA 2OYOA 1GU9A 3D7IA 2PFXA 2KXPA 1LW1A 2OUWA 2PRRA 5DIPA 2GMYA 3AA6A 5ADXK 2KZ7A 2CWQA 2O4DA 1VKEA 3AA1A 5DIKA 3LVYA 1KNCA 3BEYA 3C1LA 3AA0A 3AAAA 3LK3A 3AA7A 3LK41 4G9QA 2JN8A 3AAEA 4AKRA 1P8CA 3LK2A 2IJCA 2Q0TA 1IZNA 2ES9A 2AF7A 1ME5A 5AFUK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ES9 A;  2JN8 A; 
#chains in the Genus database with same CATH topology
 2QEU A;  2OYO A;  1GU9 A;  3D7I A;  2PFX A;  2KXP A;  1LW1 A;  2OUW A;  2PRR A;  5DIP A;  2GMY A;  3AA6 A;  5ADX K;  2KZ7 A;  2CWQ A;  2O4D A;  1VKE A;  3AA1 A;  5DIK A;  3LVY A;  1KNC A;  3BEY A;  3C1L A;  3AA0 A;  3AAA A;  3LK3 A;  3AA7 A;  3LK4 1;  4G9Q A;  2JN8 A;  3AAE A;  4AKR A;  1P8C A;  3LK2 A;  2IJC A;  2Q0T A;  1IZN A;  2ES9 A;  2AF7 A;  1ME5 A;  5AFU K; 
#chains in the Genus database with same CATH homology
 2QEU A;  2OYO A;  1GU9 A;  3D7I A;  2PFX A;  2KXP A;  1LW1 A;  2OUW A;  2PRR A;  5DIP A;  2GMY A;  3AA6 A;  5ADX K;  2KZ7 A;  2CWQ A;  2O4D A;  1VKE A;  3AA1 A;  5DIK A;  3LVY A;  1KNC A;  3BEY A;  3C1L A;  3AA0 A;  3AAA A;  3LK3 A;  3AA7 A;  3LK4 1;  4G9Q A;  2JN8 A;  3AAE A;  4AKR A;  1P8C A;  3LK2 A;  2IJC A;  2Q0T A;  1IZN A;  2ES9 A;  2AF7 A;  1ME5 A;  5AFU K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...