2ESCA

Crystal structure of a 40 kda protective signalling protein from bovine (spc-40) at 2.1 a resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGSERFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGGWRGTVGHHSPLFRGNSDGSSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSSTRVGAPISGPGIPGQFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bovine secretory signalling glycoprotein (SPC-40) at 2.1 Angstrom resolution.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2escA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2escA01
4AD1A 1FA2A 1FH8A 2UY4A 1CGWA 3VKKA 1OD0A 3W6MA 1ECEA 4OKDA 2DT1A 2VX6A 5D8WA 1E4IA 2VRQA 1C90A 1V6WA 3WN6A 4YHGA 3UCQA 4CUCA 2DSWA 3VGDA 2XGIA 5DFAA 3OLGA 2J7FA 4B3KA 2WMKA 2VL4A 1JF6A 2ZXAA 3M07A 4PSPA 1CXKA 1NOUA 1VENA 5FCZA 1WDQA 2Y8KA 1WNOA 2ZUSA 4CD6A 4BQ5A 3WH6A 2WMGA 4S3KA 2XVNA 3QGVA 2J75A 5BXPA 1O7AA 4JKKA 3UR8A 3VX0A 4C7FA 4LQ1A 3MMDA 4W7WA 3ZJ8A 1KQZA 2WZIA 4UFMA 2D3NA 1H11A 3IJ8A 2ZX5A 3AMKA 2FGLA 4AZHA 4X0VA 1XYZA 1XH1A 5CGMA 1KXTA 2GVYA 2J7CA 2O9RA 4QCEA 2UY2A 3W25A 1ZBCA 2BV9A 2BS9A 1HKMA 3WMBA 2E0PA 2CBVA 2VRJA 2J4GA 4D71A 2GK1B 1DWAM 1HJVA 4GQRA 3CHFA 3B9AA 3EDJA 1UWTA 2GK1A 4ZE4A 3WD4A 4GI8A 2VZVA 1ZB5A 3T2OA 1BAGA 1TA3A 1R8LA 5BRPA 3SURA 1JYNA 1E55A 3EMCA 5ABHA 3T2QA 2D0GA 4P8WA 3DYOA 1L0PA 3OLDA 4JFWA 3QOKA 2WC3A 3RM8A 3BAKA 4J3SA 3RDKA 2BXZA 3ARWA 3TA9A 4ZXOA 2WCGA 1KR0A 5GNYA 4U5IA 4CKQA 5A6LA 5D9MA 2ZX6A 1XSIA 4P8UA 2WAGA 2WKLA 5M03A 1V3LA 3ZO9A 2W62A 1KCKA 1V3HA 3SCTA 4NZCA 4Z2LA 2WMFA 4GINA 1VJZA 3S2CA 5E09A 4JAWA 5HXMA 2BHZA 3RM4A 5JBDA 4HOZA 4J3TA 1E9LA 4NF7A 4WSKA 3GXFA 1QI4A 1J10A 4CD5A 2RGMA 1JYXA 3IAQA 4UOQA 2X0HA 4OUEA 5HPOA 1FH7A 2X05A 4AZBA 1VIWA 2BVYA 2E9LA 1W2PA 1H49A 3EMQA 3AMGA 4TX6A 1IZJA 3UETA 1C7SA 3WD0A 3GNPA 2V3FA 4PBGA 3WEMA 2VQUA 3AS0A 1QVBA 3WNPA 4U2YA 1J11A 2HISA 1IT0A 2JALA 1E0XA 3GXDA 1JI2A 3O2LA 2JEPA 4LXFA 4PUEA 5JUVA 2DH2A 1E0WA 4W7VA 3WF0A 4F66A 3G6LA 3F5JA 5GQBA 2YA0A 1XV8A 4ACZB 3N12A 2V5DA 4U33A 1CYGA 1E15A 1UH3A 1E5JA 5A6KA 1NM9A 1TZ7A 2EPLX 5JIWA 1ZBWA 1JGIA 4M8UA 1C93A 2WXDM 1UD6A 1GNXA 1V6YA 3N15A 4UQAA 3AHZA 1ZL1A 3VMNA 1GORA 1BLIA 2J78A 3VDCA 3IAPA 3SIMA 4M80A 1LL7A 3F5KA 3K8KA 1J01A 3AIWA 2ZX8A 5CSYA 3DC0A 4Z2JA 1JDAA 1XSJA 3SCPA 1DEDA 1V3MA 3L2LA 5BRQA 4DM1A 2V3GA 1WAWA 1UWRA 2GJRA 1B3YA 2G4FA 2WNWA 1XRVA 5LA1A 2XHYA 2WB5A 3MSGA 1OIMA 1HVQA 4CN1A 4W93A 4XUYA 3AROA 3N1AA 3RCNA 1FOBA 3L4TA 1JZ8A 2J7HA 3GBDA 3WIJA 1KGXA 4JHZA 5BXSA 2YL5A 1H0GA 5A1AA 1LF1A 1CLXA 4GO8A 1W1TA 5E70A 5IHSA 2X2YA 4H04A 1QNSA 5JIPA 1M53A 1U30A 3K1DA 3TOPA 1WO2A 3T08A 1X6NA 5EFDA 2YIHA 1O6IA 3CTTA 4MJ4A 4URIA 3AISA 3CZ8A 4HOXA 2OSYA 1UKQA 3BMVA 1E3ZA 4J27A 3W38A 4KMQA 3WNNA 4CD8A 2CPUA 1UKOA 1XH0A 5AY7A 1LQ0A 1W91A 3THDA 3OLEA 4PCSA 2VT0A 4FK9A 3PZUA 5FIPA 2GFTA 2WYSA 2VCBA 1PAMA 3ZT6A 4AMCA 1ZBVA 3WNKA 3A47A 2J8GA 4MPKA 1JD9A 2NT1A 4HZ7A 1EQCA 2BY2A 1X6LA 3EYPA 2XSBA 2WANA 4Y7EA 1DWIM 1V0MA 3W81A 2O9TA 1J0YA 3AHTA 2JF6A 3AZTA 2GJPA 6CGTA 2YDQA 1HP5A 4WLCA 1QW8A 1MW2A 1NARA 2ZWYA 3OB8A 2NSXA 1GHSA 3O9NA 5EBAA 1KBKA 3ARSA 5AC5A 1V08A 1UR2A 3SCRA 4RE4A 5IXEA 1MFUA 3MV11 1UUQA 2EPMX 3RO8A 2QLYA 4JIEA 1CGXA 1B90A 1GQIA 3EDEA 1VFFA 2WWDA 4HMEA 3UEQA 2CEQA 4E2OA 4TTUA 4ACYA 4DWSA 3WQVA 1UR0A 4MJ2A 4U5KA 1US2A 2W92A 2EXOA 3I3BA 1DWHM 1G01A 4P8VA 3MANA 4XZBA 5A2BA 2J25A 3MMUA 1E6ZA 1PPIA 1OGSA 2CYGA 3ZR5A 3ARRA 3EDFA 4LYPA 4LGXA 2JIWA 1C3FA 3MUIA 4XZWA 1H1NA 4TOQA 4DUVA 2YLAA 5A2CA 1F4HA 4H2CA 1XD0A 2XVKA 4P7QA 2QPUA 3WUFA 4H41A 2XPKA 1W2VA 1UR4A 1RPKA 1VBUA 4S3JA 1Q6CA 1TE1A 2ZUNA 5CG0A 3CLWA 5KEZA 2XVPA 1PIGA 3BLPX 1BHGA 1KXQA 1QI0A 4MB5A 3WUBA 1GHRA 1PX3A 2WC7A 3OZOA 1UQZA 3J7HA 4BZYA 2G3NA 1ZU8A 1G5AA 5HOSA 2DT3A 1WB0A 2DSVA 1BVNP 3NCOA 1I1WA 1KQYA 1W9DM 1I75A 4DM2A 3K8LA 2VMFA 3L4XA 1TA3B 4RE2A 1Z32X 2UY3A 2CXGA 1H09A 3L4VA 2Q8XA 2WBGA 3WEZA 3VMOA 1G94A 2WW5A 2VVNA 4HZ8A 1JZ6A 4OBRA 1UD5A 4YN5A 1JZ7A 2ZUTA 4GI6A 4ATLA 2ZUUA 4MDOA 1ZBKA 3CHCA 2CBIA 1QNOA 4PRWA 4QLLA 2X09A 2XM1A 3CBWA 3BGAA 1GOOA 2Y5EA 4AISA 2WSPA 1VFOA 3NSNA 1E6PA 3VIJA 4BCEA 1ITCA 3VD5A 3WQ8A 2JE8A 3AJ7A 4J3VA 1GVIA 2XGBA 3VIHA 1JF5A 4M56A 3AQUA 3VNZA 3AZSA 4ATDA 1VRXA 4PMXA 4UR9A 5FL1A 5CPTA 4L4OA 5ABEA 3AYSA 2OYKA 3K4AA 2NW0A 1TG7A 3FN9A 4KH2A 1LG2A 3CUHA 3NIYA 5A2AA 4Z2GA 3SCVA 1MW0A 3WF1A 2GDUA 3PZOA 3CUIA 5C70A 3WH7A 3AZRA 2ZUVA 1GQKA 2EPNA 3AIVA 1B3WA 2PF0A 3LPPA 3AIBA 2EBNA 4OZOA 1UWQA 2W63A 1VEOA 5D9PA 2Y2WA 3GBEA 3ARUA 1G0CA 2CHOA 2QPSA 1R87A 1SMAA 1WCGA 3VGGA 1RP9A 4BQ4A 4FLSA 3AS1A 1CXFA 3W82A 2D0HA 5ECUA 5CGTA 3CGTA 1H2JA 1MFVA 5IDIA 3QOMA 1OSEA 1PX4A 1E3XA 3AHXA 4AZGA 3ZIZA 4HP5A 3RILA 2VOTA 1F4AA 1J0HA 1GJUA 5A6JA 1NOWA 1HKKA 3ZT5A 1H41A 2G3JA 4HU8A 3JUGA 1V02A 1X1NA 2ESCA 5A69A 3PHAA 3CH9A 2ZOXA 1TVNA 2E9BA 2JIEA 2OSXA 3TTQA 1A3HA 1FHLA 2FHBA 4B3LA 3FHQA 3PN8A 4D6FA 3NDYA 1XC6A 1XH2A 4P7LA 3WENA 4GI9A 1E1FA 2V5CA 4MNKA 1E70M 1DP0A 2WLYA 1K9EA 2C7FA 3VIOA 2G3IA 3KE0A 3ARZA 3WDHA 4GQQA 1MVYA 4PMOA 1VJSA 1MQRA 2YL8A 1HXJA 2VTFA 1KWKA 4AYSA 1CLVA 1HP4A 3POHA 4ATWA 4AWEA 4MB4A 3VM7A 4A3HA 5FKYA 4EE9A 1KCLA 2PWGA 1CIUA 2W66A 1QNPA 2CBJA 3ZM8A 2ZXBA 3N18A 3RJYA 4MADA 3SUUA 4M24A 3IJ7A 4MAZA 1MQQA 3AIEA 3MV01 5ABFA 2XFRA 1DWJM 1CXLA 1VAHA 2J62A 2J77A 3DHUA 2BXYA 4EANA 1PBGA 4AXNA 4UFJA 4H8HA 1SYTA 1PJ9A 2ZICA 1FP9A 1ODUA 3AS2A 3BAIA 1UA7A 1OINA 5A8MA 4BF7A 2BVDA 1GJWA 1E4MM 4WKFA 1CWYA 1D7FA 1RD6A 2WZEA 3WF3A 3AIUA 2Z1KA 3NJ3A 5A94A 5FOOA 4WIWA 2GDVA 3SCUA 1UR8A 3KL0A 3BMWA 1WZLA 3UR7A 1QHOA 2WSKA 2YDRA 1HKJA 2DH3A 4C7GA 4UTFA 3SUSA 1M7XA 2E9MA 1OGBA 2DSZA 3GZAA 4MNMA 4NI3A 4PMNA 1EHAA 1H3GA 2W4XA 3VGFA 4UQBA 4ZE5A 1EDTA 2VZSA 5M3WA 2PI6A 4Z2IA 4NRRA 2YDSA 3OA5A 4HU0A 2DSKA 4ACZA 3MU7A 5DT5A 1ISYA 5CLWA 1ITXA 3AIRA 4J3WA 1GW1A 2FGZA 1N82A 2OLHA 3PZVA 3U57A 3BCDA 5I77A 4AZIA 4M1RA 4W7UA 3L4ZA 5GPRA 3MMWA 4CN6A 4F8XA 1SMDA 2YBTA 3GH7A 1FFQA 2X1IA 1CXIA 3OLIA 4AD5A 1UD3A 1QI2A 2OWXA 3BSGA 1UHVA 2G3MA 1LL4A 3ZQ9A 1H4PA 4NSBA 1GVYA 1Q6DA 3K46A 4AIUA 2TAAA 3L4UA 4FMVA 4HTYA 4HPGA 3L4YA 4CCDA 4WSJA 1L8NA 1VFMA 3OG2A 5BXTA 1MXGA 1Q6EA 1WE5A 4H7VA 1E4LA 3VIMA 3ZSSA 1K9TA 1E6RA 1M04A 3WFZA 5BWFA 3KL3A 3WDIA 2BNJA 4PN2A 1VEMA 4QDMA 1V3IA 2E40A 3GNOA 3VD4A 1JIBA 1EO7A 3ZJ7A 3NSXA 3WELA 5IFPA 3BC9A 3W29A 4JKLA 3CZEA 3N9KA 3CUGA 5DO8A 3WD2A 1XSKA 3SEPA 3M7SA 3VDAA 4AZCA 5EFFA 1CGVA 1KR1A 3U7BA 4UFLA 4CGTA 4IPNB 3UG3A 3WKZA 4QCFA 3F4VA 2WCSA 3WBAA 2XM2A 1QI3A 1ISVA 4D6JA 2VCAA 1QNRA 1UWIA 1W9BM 3GXIA 3B9DA 1W3HA 3APGA 1J0KA 2UWFA 4W89A 4W88A 3AXHA 3A4XA 1UKTA 3RMEA 3QHNA 2E8ZA 3W4RA 3N13A 1J0ZA 1E1EA 4W5ZA 5I3DA 5E6ZA 1J0JA 3PZTA 1GONA 5A6BA 4H8UA 3D3AA 4TVDA 1GOIA 2E3ZA 3CUFA 1XCWA 3BH4A 2YOCA 2QF8A 3AMDA 1PIFA 3NSMA 4PTMA 5E6YA 4E8CA 1NWUA 4RE3A 1US3A 1ISZA 2XYLA 1EGZA 2VNCA 9CGTA 1KGUA 5A3HA 3FAWA 4V28A 1V3JA 2XTKA 1QBAA 5D9NA 3BAWA 3BXWA 3VUPA 3WD1A 5CQ1A 2PWEA 5I23A 3U7VA 2VI0A 3AICA 4GZJA 3CO4A 5FL0A 3MUZ1 1BQCA 1E6XM 4UFIA 3NUKA 5HDRA 2JFEX 3GYCA 1HT6A 2GJXA 2NT0A 1NWSA 2E8YA 4PTVA 4B16A 1XCXA 1U2YA 3EBVA 4TUFA 5C71A 4N0RA 4EK7A 1HJSA 3AHVA 3WH8A 1BFNA 3MSDA 5I0DA 1BYCA 5AYIA 3GDBA 4D6CA 2EJ1A 4DWSD 1CDGA 4AZ6A 5HNNA 3TONA 1XD1A 3OGRA 3OGVA 4CD7A 4D1IA 5A8OA 4WKAA 4AIOA 1JG9A 1UKSA 3T2PA 3LPFA 4HOWA 3VIPA 4WJXA 4R5EA 3WFLA 3DYPA 2HVMA 2G8ZA 3II1A 5LA0A 1AQMA 3QHMA 1GOMA 3KL5A 2MANA 4Q22A 3TTYA 2VX4A 2D23A 5EMYA 3WDJA 2O9OA 3W28A 1B3XA 3T0BA 1E72M 1GCYA 4TVUA 2XVLA 2OSWA 1C8XA 5A6MA 1UH2A 2ZUWA 1ZJAA 2BHUA 1VBRA 2PC8A 5I5RA 3FXYA 3W37A 2D3LA 2CKSA 1UZ4A 2A3HA 1UYQA 1JD7A 2PBOA 3ECQA 1BYAA 4LX4A 4JCMA 1E71M 1B9ZA 4C7DA 2DT0A 3WUGA 2VUYA 3POCA 3GH4A 1BYBA 1FH9A 3ZMRA 4JFTA 4D6GA 1G1YA 3AXXA 3VILA 2FHCA 5I2UA 1DTUA 1V0NA 2EO7A 5HBFA 1E6QM 2WKGA 3BSHA 3PTKA 5E9AA 3WF2A 1EOKA 1CENA 1H5VA 1CGTA 1R86A 4BA0A 4KGJA 3PZQA 4D1JA 1NP0A 2BVTA 1NQ6A 4M81A 1BG4A 1A47A 1C7TA 3M6DA 4UQDA 2BY1A 4PUDA 3W24A 1IV8A 1HL9A 5A8NA 1BG9A 3D5HA 3VMPA 3WMCA 1EIBA 4OOZA 1WP6A 2WHLA 1J18A 2YLLA 5BCAA 4MB3A 3GM8A 4HA1A 1JI1A 1MXDA 5I24A 4AEEA 1TR1A 2YJQA 4OOUA 3VOCA 3DHPA 3WBEA 1W9VA 1DWGM 1WDRA 3B9EA 5CZKA 3WL1A 3ZJKA 4UZUA 4QP0A 5CSUA 1FFRA 1OGGA 3QR3A 2WBKA 1S46A 2YKKA 2JEQA 1WKYA 4DWSB 1VF8A 5DF0A 3VX1A 4XV0A 1PX8A 2AAAA 4P7RA 4MNLA 3CZLA 2J7GA 2J74A 4AZCB 1LLOA 1MYRA 3EMZA 2OYMA 4QLKA 1CECA 3ZOAA 4AD0A 4LYRA 4XX6A 2AOSA 3PTMA 4JZ5A 1HKIA 3FY1A 4KRTA 1PEZA 2EEXA 1CZ1A 4MDPA 4W8BA 2VX5A 1J9YA 4W86A 3EDKA 4K68A 2BY0A 2OYLA 3PZGA 2XFFA 3VGBA 3BAYA 4TXEA 2ZUMA 3ARTA 2QV4A 2VX7A 1KB3A 3BAXA 3L2MA 3ARQA 4UQCA 2UY5A 1ODZA 4V27A 4JKMA 2A3EA 2WVSA 4F9JA 4H8VA 4MNJA 2WK2A 2WVUA 2C8NA 4GO9A 1K9FA 1JYWA 1EOMA 3K8MA 5CJ5A 3W26A 3CZGA 4LPCA 3CIVA 2Y24A 1E40A 2CKRA 4J7RA 4HZ6A 2Y8VA 1Q6FA 3WQWA 1EH9A 1JXJA 1GPFA 3CPUA 3VDBA 4UFKA 4CVWA 1WZAA 3VTRA 1JZ3A 4WKHA 2E4TA 2WWCA 1UA3A 1V03A 2W61A 1JZ5A 1JZ2A 2Z1SA 1E4NA 3CHDA 1R85A 1OD8A 2PWFA 1YHTA 2VZTA 5TD4A 2WPGA 2CITA 3SCOA 2OWCA 1JFHA 5DMYA 1UQYA 4AEFA 3EDDA 1ESWA 2W5FA 2FH6A 4EKJA 1UOKA 3PTQA 1CNVA 4WF7A 1BF2A 2J7EA 4B9ZA 1C8YA 1E0VA 1V0KA 3AS3A 4UZSA 4A4AA 5BYWA 1GUVA 3VINA 2ZXQA 1YQ2A 3A4AA 3M46A 4QFUA 1OM0A 1GOWA 1TVPA 5A6AA 2WMHA 3T09A 3VGEA 4PEEA 1JXKA 3VDHA 2J79A 3N11A 3RM9A 1JL8A 3HJEA 3WH5A 1G9HA 1CGUA 1RH9A 2V3DA 2FH8A 2V3EA 2WCAA 1LJYA 1W3KA 2D22A 3VIIA 1TMQA 3WUEA 2WMIA 3WNOA 1E6NA 2GSJA 4N42A 2YL6A 2YA2A 2J47A 2IXUA 1NWRA 2EQDA 2XUCA 5CPSA 5FD0A 4AIEA 3VM5A 4PYSA 1B3ZA 2C0HA 4AW7A 1ZJBA 3WNMA 4X9YA 5CLTA 1RP8A 3AMLA 3FW6A 1C92A 3A3HA 1ISWA 3AI0A 4PMDA 4UOZA 1GOQA 4JL2A 3FAXA 3SUTA 3O6AA 3N17A 4DUWA 4TVCA 2F2HA 1OBAA 4GPNA 2CNCA 4AZ5A 2ZX9A 1WDPA 1UKPA 1UWUA 5I79A 3GXMA 3A6OA 2CHNA 4QAWA 5IFTA 2PWDA 2CCRA 5LA2A 5DT7A 1AVAA 2YL9A 4PMVA 2FHFA 2ZX7A 5HPCA 2XWDA 1QW9A 2IXVA 1R7AA 5CXPA 5A8PA 1E6SM 3IANA 1HX0A 4XB3A 3WH9A 1XGZA 4B9YA 2J7BA 2WVVA 3AIQA 5C8BB 3VGHA 2J7DA 4GZEA 3G6MA 1DHKA 4D6DA 1W1VA 1UR1A 3B8SA 4FLQA 4A3YA 4D6EA 1HIZA 1EHNA 1W9XA 3CUJA 4V2XA 1HL8A 2VJXA 5E0FA 3PZNA 4UNIA 5M17A 2VZUA 2X8RA 2ZWZA 5A8QA 5CPQA 2DPEA 3WDPP 1DWFM 2DT2A 3OGSA 4UQEA 5A6BD 4YHEA 3VPLA 1E43A 4W8LA 6TAAA 4JCLA 2OWWA 2W91A 1SFSA 3AXIA 3VD9A 2A3BA 5GNZA 4F9DA 1H0IA 5KZ6A 3SCQA 1HNYA 1CGYA 1E5NA 3UESA 1EDQA 1GQJA 4R27A 5JH8A 1W1YA 2D2OA 3UG4A 2CIPA 2WHKA 3GNRA 3ARXA 1MW1A 4IM4A 2GUYA 4QLJA 1BSIA 1JAEA 1B0IA 1QNQA 5IHRA 4L4PA 3IJ9A 4ML4A 3UERA 2VVSA 4J28A 4CCCA 2EPKX 2QHAA 1QI5A 1JNDA 1VFUA 2V38A 1K6AA 4PTXA 3SCSA 1EO5A 3LMYA 2XSAA 4U31A 4UQ9A 1PZ2A 1JAKA 1J12A 4AZ7A 3SUVA 1QPKA 2ZIDA 2BHYA 4KRUA 3K4DA 2O92A 2F8QA 1UD4A 1VB9A 4BQ2A 4ZFMA 2ZE0A 2XJ7A 1BTCA 5AYBA 4D72A 1JFXA 2D0FA 8CGTA 1VEPA 1NOFA 1EXPA 4JFVA 4CU8A 2JF7A 4Q7NA 5I6SA 1OB0A 1QHPA 1GOKA 4F79A 1CPUA 5ABFB 4HA4A 4CN4A 1W3JA 5DEZA 3PZIA 1E73M 1HN1A 2BY3A 3AHYA 1EA9C 4U3CA 2WLZA 2B31A 1D3CA 1FHDA 2DDXA 1UR9A 1C91A 1B31A 4HMDA 4AD4A 4UOJA 2DEPA 4OIFA 1I1XA 1QOXA 3U5UA 3W27A 1CBGA 3HU7A 1JYVA 4Z2HA 7TAAA 4P8XA 2O9PA 2VC9A 3PZMA 4W8AA 4D6HA 2Y4SA 5GNXA 1NWTA 1NH6A 1W32A 4FLOA 4AC1X 3WF4A 1WZMA 3MUY1 4E4PA 1CXHA 1CTNA 3LPOA 2XG9A 2XVGA 4JFSA 4BQ3A 3KWXA 2VO5A 2YA1A 3RIKA 3ALFA 1Q6GA 4TTGA 1TCMA 4HPHA 2BFGA 1EDGA 1UH4A 1W3LA 4UFHA 1UWSA 4KGLA 1V0LA 3F5LA 1ISXA 1FP8A 1AMYA 4YPJA 1V6XA 4KWUA 4PMQA 3PZ9A 1M01A 4NRSA 5M5DA 3THCA 3TTOA 1UD2A 4MB1A 1OCQA 3TTSA 1NP2A 2FDMA 3NDZA 4PMZA 1C8QA 2ZXDA 4PTWA 3WD3A 3KEHA 2WHJA 4CD4A 2CESA 2VRKA 1J0IA 2IUZA 3E1F1 2PBGA 1R7OA 3VVGA 3VU2A 4IPLA 1QBBA 3FHAA 3DYMA 3VIGA 1KGWA 5E0CA 4JL1A 4J3XA 4CU6A 4Z2KA 4AD2A 2VR4A 5BXRA 4PMUA 1KWGA 1BYDA 2D1ZA 4PMYA 1B30A 4CU7A 3RJXA 4DWSC 1LWJA 3QHOA 1OIFA 5EB8A 4RL3A 2W67A 1OWQA 1TFVA 2CERA 3RPMA 1WPCA 4IISA 3CHEA 1JDDA 2AMGA 1BPLB 2XIBA 3I3DA 2X0YA 3AYRA 3S6TA 3N04A 4DUXA 3MUAA 3FNDA 3GTNA 1LL6A 2VR5A 8A3HA 2VQTA 5D8ZA 1V6UA 4OJYA 5D9OA 3WEOA 1HJWA 4B15A 1ZS2A 4AY1A 3CZKA 1XHGA 1CXEA 4HMCA 1BGAA 3ZSTA 3CMJA 1B2YA 3VD3A 1SR0A 3LPGA 4PCTA 3OIHA 4U3AA 5A6SA 3WL0A 1JNEA 4U2ZA 4IUGA 3BAJA 1QHZA 4FF5A 2XWEA 3W6LA 3WDRA 1WZKA 3VO0A 5JBFA 1EQPA 3I3EA 4W87A 4D6IA 2PWHA 4W84A 1HJUA 2GJXB 4X0NA 1W9PA 3WSUA 4CVUA 3CMGA 4ZENA 3ALGA 3GH5A 4W85A 3T0AA 2G41A 3ARYA 3SCWA 2WVVB 1HF6A 3VIKA 3VIFA 4P7OA 1KXVA 1GQLA 3L4WA 1V6VA 2EPOA 2XFYA 3HMCA 2D24A 3VD7A 2PB1A 1OT1A 5JBEA 1GZJA 4OBSA 1P6WA 4JFUA 3ARPA 3ZT7A 1WDSA 1TUXA 2RGLA 2QMKA 3TP4A 3MS8A 3SCNA 1LWHA 1MW3A 4ZEPA 4PSRA 4TX8A 4BS0A 2WMJA 2WVTA 4AD3A 3WY1A 1XYFA 5LYRA 4CCEA 5F7UA 1HJXA 2VZOA 2DGAA 1UZ1A 2YBUA 3BLKA 3VNYA 1CEOA 1PZ3A 1JZ4A 1KFWA 1KXHA 3KZSA 1HJQA 4WK9A 4EAMA 1D2KA 4J3UA 2J8FA 2XIIA 3U5YA 4GXPA 1BGGA 3UG5A 3WQ4A 4ZXLA 2D20A 3T0DA 3W0KA 3A4WA 2A3CA 1OT2A 4GIAA 5ABGA 4E8DA 1MWOA 2WHMA 1Y7VA 3AFBA 5AC4A 2WZHA 3NYDA 2DIJA 4M29A 3W53A 3ZJ6A 5D4YA 1E56A 2VCCA 1B1YA 3HN3A 1AQHA 4MTVA 1U33A 2CETA 1W9UA 2QMJA 2WM0A 3WNLA 3MO4A 1HVXA 1K9DA 3AOFA 1UD8A 2CBUA 4MAVA 4GKLA 2DIEA 4P7NA 1KBBA 1IZKA 3DECA 4M82A 3CZJA 4LYQA 4FLRA 1BVZA 2VURA 4JHOA 1MQPA 3WQ6A 3OZPA 6A3HA 2WC4A 1Q4NX 1UG6A 3WDQA 2F61A 4UCFA 3SUWA 7A3HA 3OBAA 4W5UA 1JDCA 1B3VA 3IK2A 7CGTA 1W1PA 4PMRA 1M03A 1AQ0A 2DSUA 3ARVA 3AMCA 4GZIA 3WQ5A 3ZR6A 4HA3A 2WMIB 3PBGA 5BROA 1V02E 1LG1A 2A3AA 1V3KA 3WMSA 5I78A 2DQXA 3BCFA 5A95A 3MKKA
chains in the Genus database with same CATH superfamily
4XVEA 4GVHA 1KV5A 2IKJA 1OD0A 2QV5A 3UI4A 3QM3A 3LEPA 1N8WA 1ZRQA 2DT1A 4HBEA 1SO5A 1DJQA 1UW9A 4YHGA 1FWSA 3UCQA 3LHYA 2HK1A 2GGHA 3OLGA 1TV2A 5F1UA 5I02A 3DESA 1TRDA 3H12A 1OFRA 3SIZA 1KTBA 1MUWA 2D2GA 3H55A 2UZ5A 1EZ2A 4BQ5A 4X9SA 3GFZA 3NPXA 4QGCA 4JKKA 4ZGYA 3N25A 3W7KA 1TX2A 1UIOA 3ERPA 3MC5A 3ZJ8A 2A7RA 4CQ9A 1P1MA 2D3NA 1H11A 5FF0A 2P4VA 2J6XA 2NZLA 1MEWA 5I3JA 2OO6A 3IGSA 1GT8A 3W25A 1OFBA 2BV9A 1TWWA 2VRJA 2L2SA 4JTIA 4GQRA 3TYZA 3XISA 4ASTA 2FFCA 2Y5SA 3EDJA 3QY8A 3LGDA 1I60A 4US5A 4ZE4A 1UWAA 3P8JA 4JQ1A 3ANUA 3T2OA 3M0KA 3ZLGA 3SJ3A 3T07A 3LBCA 1JJKA 2ZRVA 1EGMA 5BRPA 1E55A 1TCOC 3V36A 5ABHA 3T2QA 2VWSA 3DYOA 1N55A 4TV6A 4AXKA 2ZQ0A 4JFWA 1PDYA 5CPLA 2WC3A 2Y6ZA 4QE4A 3AJXA 1SW7A 1P0BA 3BAKA 3RDKA 1KBLA 4XSMA 1XRFA 2Z28A 4KEZA 4ZXOA 1F8IA 4C6OA 3VE7A 1O68A 3S2MA 4KCVA 1XSIA 2ZX6A 3O63A 3FA4A 4ZL1A 1FWWA 3QPYA 4GINA 1VJZA 3S2CA 5E09A 3RM4A 5JBDA 5HW8A 3PVFA 3GXFA 1J10A 1LYXA 1TTPA 1EB3A 1JYXA 4UOQA 2X0HA 3OTRA 1VIWA 1DOSA 1PCWA 3LM3A 3EMQA 1YPXA 3UETA 1RK5A 2GUBA 3LHUA 1RQEA 4XD4A 3WLNA 6REQA 3C0SA 1V77A 1F3EA 1XINA 3CXOA 1QVBA 1V6TA 1V51A 2HISA 4F3HA 3TN5A 3W1MA 3TW9A 2HBXA 1ZJHA 3RGCA 4PUEA 1TQJA 2HDJA 4OV4A 4LOCA 2GOKA 3KFTA 3RFAA 4JX6A 2YA0A 3QVQA 3STGA 5I06A 1E5JA 2WSQA 3VOIA 3DZ1A 1AJ0A 5D03A 1J5SA 4I3GA 2NUYA 1OC7A 2P0OA 1F3XA 1GZGA 1J6OA 4GVFA 5G4HC 2HE5A 5LIYX 2C16A 3S2LA 3HTWA 4MKVA 1BLIA 4DYKA 1AMKA 1L6GA 3GUWA 1V79A 4J4OA 4Z2JA 1XSJA 2WJDA 3H2OA 1OVDA 5JXQA 1DEDA 4UC5A 4LAKA 3UZJA 3R0UA 2V3GA 2G4FA 1XRVA 2YBVA 2XHYA 2ISSA 3MSGA 3G5EA 2ZRZA 1DIDA 4W93A 4YL2A 3RN6A 4XUYA 3PB0A 3FAPA 1FOBA 1H7OA 3P74A 5LZLA 4NAFA 2VEIA 1EBHA 2Q71A 5BXSA 2YL5A 1MO0A 4Z1CA 4GO8A 4YYCA 3AWOA 5IHSA 1QNSA 3EKLA 3CT2A 2DUZA 3W87A 3ID7A 3MP5A 3DOPA 3TTEA 4LUSA 1L2UA 3C3NA 4HOXA 1E3ZA 3VKDA 1OQFA 3A24A 2VFHA 1OZMA 1R3QA 2EG8A 5DXXA 3UJRA 5CZTA 4IT4A 3KP1A 4A8RA 4UR8A 3OLEA 1FDYA 5G1TA 1AW1A 3SRKA 1X8CA 3W86A 1YE4A 3GW0A 1ZGDA 1IF2A 2PDMA 1ZBVA 2PP0A 4MZYA 6ENLA 3FDKA 2FZ8A 1EQCA 3O6DA 4HYWA 1Q1CA 3EYPA 2BOGX 1DWIM 4BJHA 1J0YA 1XFCA 4GGBA 6CGTA 3N3MA 4WLCA 2NSXA 5D2WA 1KBKA 4H19A 3GFXA 4RE4A 5IXEA 1MFUA 4DO6A 1JCLA 1XJBA 1ZNNA 4G1NA 3NQ7A 4WSHA 1GQIA 4O13A 2BBFA 2CEQA 2XSXA 1VKFA 2OOFA 3S3GA 3WQVA 2BLEA 2BG5A 2W92A 4C6IA 1XG3A 2DVUA 4XZBA 4HQVA 1E6ZA 2YB1A 4H1ZA 4LGXA 3NPUA 2NVCA 5FEZA 4TOQA 1GRJA 5A2CA 3LCGA 4P7QA 1DJXA 4CNTA 1SJDA 3G1SA 3LHTA 1G67A 3H2MA 1W2VA 1WXZA 3VZXA 3OQEA 4GBUA 3FA5A 3TW6A 1DJZA 1Q6CA 1TE1A 3KDNA 1YMYA 3H7UA 3CLWA 2PRLA 4S38A 4UTMA 2M2AA 3BOLA 3NR0A 1KXQA 2GSEA 2DZSA 3P84A 3WUBA 4HIBA 4OT7A 3PG8A 2WC7A 1UQZA 3VABA 1DV7A 1Z41A 1KM2A 4MZ8A 1G5AA 3TQ0A 2DSVA 3WLKX 3TC5A 2VR2A 5FI8A 4UBPC 1VQTA 1GKRA 1A0EA 1UBSA 2VMFA 2VD8A 1TA3B 2Q3OA 4RE2A 2YXOA 1H09A 3LERA 2A6LA 2WBGA 2PU0A 1FKHA 3DGBA 4HZ8A 1JZ6A 2KGJA 1XG4A 4YN5A 5T8GA 2ZUTA 4WDUA 3JZEA 1RVGA 4A22A 1ZBKA 3H9RB 3QZEA 4LBSA 4DRMA 1ME7A 4C6CA 4QLLA 3R2GA 3BGGA 3C6CA 4JTDA 3RF9A 3CBWA 1W5PA 2TPSA 1G6CA 3W7IA 3NSNA 4RZ5A 3GNXA 2GQ8A 4HBKA 4IOTA 3WQ8A 2J24A 3C56A 2XGBA 1JF5A 2PODA 3AQUA 3THAA 5LIKX 5TNVA 4ATDA 1VRXA 2B7QA 2QUTA 4UR9A 5HINA 4L4OA 4Q8PA 2J27A 1IR1A 4PBFA 3AYSA 1PYMA 4MOZA 4HU3A 1R3YA 3FN9A 4ICNA 1PZ1A 2ZQTA 4ZTXA 3TSDA 3CUIA 4K2SA 3DFHA 1GQKA 2EPNA 5CC7A 1B3WA 4I8YA 2PF0A 1QATA 1TZZA 5K4ZA 3LPPA 4GYPC 1UWQA 4NILA 2IF4A 4F0KA 2Y2WA 4PBEA 3SJNA 4ZS6A 5M1TA 5AZ0A 1DYSA 1G0CA 3UGVA 3VKCA 4QSFA 3BMBA 1SMAA 3VGGA 4FAMA 3WQGA 3MDYB 4H7CA 3LA4A 1CXFA 1SZNA 3QW4B 4FEZA 5ECUA 3CGTA 4Y9PA 4I8DA 5IDIA 4EAYA 3BO9A 5AC8A 3QOMA 3KOFA 3AHXA 4AZGA 2I9EA 2V2CA 3OZMA 3ZT5A 1H41A 2G3JA 4WJEA 3WK1A 4MUZA 1X1NA 4KIEA 3KLLA 3CH9A 3S9ZA 3DCPA 2E9BA 3KZPA 2JIEA 2OSXA 3ISIX 1FHLA 1LUCA 4IQLA 4B3LA 3C2OA 3PN8A 1KA9F 1H7NA 4Y9MA 4D6FA 3RITA 1XC6A 1XH2A 3EOSA 1Q66A 3KZ7A 4S3DA 4RDYA 2C7FA 2B5UB 3KE0A 3ZR4A 1GOXA 3UCCA 3WDHA 3KBWA 3FYPA 4PMOA 2VWTA 2GZXA 1HXJA 2VTFA 3L0GA 3POHA 2A0NA 2OG9A 3OHMB 1ZALA 3VM7A 1QU4A 2KI3A 1TJRA 4IMAA 3LXCA 1CIUA 1E9IA 2IW0A 4AF0B 5RUBA 2FKEA 2GSHA 2ZXBA 3GIYA 1H62A 4MADA 4P2VA 3SUUA 1MQQA 1SFTA 1ROUA 5ABFA 1ZPTA 5HJYA 5U7SA 2J62A 4AB4A 4EANA 3NQDA 5CBBA 1QUMA 4PA8A 2V9DA 3P81A 3O07A 3AS2A 2TYSA 2QF7A 2E6FA 2E6AA 3WLLA 1IGSA 2CLIA 1K8ZA 1D7JA 5HTGA 4QIBA 3GX9A 3EA2A 1RV8A 4TW6A 4G7EB 4FNUA 2PDWA 2EGZA 7PTDA 1O5KA 1PKMA 1RA0A 3GE7A 4MIMA 3W84A 3I7QA 4JTAA 4C7GA 5HATA 9XIAA 1DBTA 1IWAA 4HHHA 2E9MA 2V5BA 3WQOA 3GZAA 2V30A 4MNMA 6REQB 3PK7A 2W4XA 1EDTA 2PI6A 3GAYA 4AEOA 5CAKA 2YDSA 2VEKA 3LSBA 1N7KA 1HQTA 5CLWA 1ITXA 4J3WA 3M5XA 3MUCA 3B9OA 1RQHA 3P60A 4KFPA 3QMRA 4RJEA 3ICJA 5HNTA 2RDTA 3KACA 1TTIA 7TIMA 2QS8A 4C5YA 3MWAA 4F8XA 1SMDA 2YBTA 1FKIA 1SM9A 1FFQA 1SJBA 7REQB 2AQWA 4DZ3A 1DJHA 3M0HA 1E1CA 2NUXA 4NSBA 1Q6DA 1QWKA 4FAPA 1ONXA 1M65A 2CZFA 4ONVA 2A3LA 2DW6A 2X7VA 1RCOB 3TC7A 3CUZA 3H22A 3GD6A 4AAJA 4LUTA 4ODLA 4K7VA 1JDEA 5EMKA 5CBIA 3VD4A 1JIBA 4FNQA 1AZ1A 5IBXA 5ECVA 1RJRA 2Z2AA 1Q2RA 2PP1A 3MCMA 3NSXA 3F1QA 3NPVA 3WD2A 1XSKA 4H6RA 4AZCA 4R9OA 4NX5A 4J40A 5EFFA 1LBMA 2FZMA 2VEPA 3UG3A 3WKZA 2WCSA 1FY6A 1IHIA 4YTQA 4DJED 4LAUA 1UWIA 4AX7A 3IIXA 3APGA 1J0KA 2RKXA 3AXHA 6ALDA 3RMEA 4WCJA 3TROA 2PD9A 2E68A 1YDVA 3W4RA 4W5ZA 4O53A 5I3DA 5E6ZA 2KR7A 3PZTA 1GONA 4RNJA 2XN0A 3W76A 4OFCA 3HG5A 3QTPA 3PJWA 4E3TA 4GC3A 5CCZA 1A80A 4K8EA 4O8AA 2D9FA 4CCZA 1DE5A 5H8UA 2R1MA 5BMWA 3DBPA 3RU6A 1EGZA 1AD4A 4LAOA 3OZYA 5A3HA 3FAWA 3ODKA 1A0DA 5D9NA 3BXWA 3AICA 3HGJA 3CO4A 1E6XM 3ES8A 3NUKA 3GYCA 1HT6A 4QT3A 3UXKA 4D2JA 3R58A 1KBJA 3B04A 5HWMA 3EX2A 3AHVA 4ENLA 1BFNA 3MSDA 3LRKA 3O5GA 2C1IA 5AYIA 4L5ZA 3H21A 5G1MA 2EJ1A 1CDGA 2ZADA 2WNZA 5HNNA 3TONA 2ICSA 2OGYA 2PLCA 2VFDA 3LU2A 3JVAA 4IFKB 4CD7A 3GC5A 5A8OA 5EU9A 3APYA 4XTDA 1F5ZA 5J6EA 4HNNA 1HO4A 4JTSA 3WFLA 3DYPA 2HVMA 1AQMA 3RUBL 3QHMA 3U4FA 1XLBA 1GOMA 3F2DA 3KTCA 3QLDA 3WDJA 1K03A 3TWBA 4AHQA 2C15A 2ZKMX 4IIDA 5C9ZA 1UMYA 3GPKA 1B3XA 4TR9A 4ZQOA 1S3TC 1E72M 4Z1AA 5A6MA 3DDMA 4AH7A 1AQFA 3G0SA 3SN0A 4MLJA 5I3KA 1F6YA 2Y63A 3LZ5A 2CKSA 5ABTA 1SZRA 4AG0A 1Q6RA 4HN8A 4ZCWA 5D2VA 1R9ZA 4DRKA 1P5BA 2QIWA 5J5DA 2GVJA 4G2DA 3POCA 3GH4A 3AXXA 2NWSA 4XD5A 1DTUA 4MF4A 2NQJA 5E1QA 3L66A 3LV5A 3PNUA 3TYEA 3PTKA 2FZNA 3P7YA 3PZQA 1GWJA 2P76A 2YDAA 3E5BA 4A3QA 4HSHA 4JFIA 2BY1A 3MP4A 2RQSA 4H83A 3SQSA 2HROA 4NZ1A 2HNHA 1M3UA 3B0UX 3LCFA 3R8HA 2WHLA 2IQ0A 3A5VA 3UYIA 3RLVA 4HA1A 1K3UA 3I65A 5GJPA 3VOCA 1I2PA 3P5YA 2ZZ2A 4GJJA 4AVOA 2INZA 1SZEA 4Q4KA 3TR2A 3NL6A 5CSUA 3JR2A 3G24A 1S46A 2BB0A 4DROA 1F76A 2DU2A 1VF8A 1GVOA 3B8DA 1K8YA 4XV0A 1PX8A 1W5NA 3GG0A 4ZODA 3RLUA 3KCOA 4EIVA 2QPXA 4O52A 5REQB 2E6DA 3EMZA 2OYMA 2OEKA 4QLKA 3M0MA 4EF9A 4AD0A 4LNYA 4LYRA 4GHRA 4JZ5A 3FKKA 3FIGA 4DI8A 3UG8A 1CZ1A 4MDPA 4W8BA 2VX5A 1J9YA 2BY0A 1XLAA 1QK0A 4WXZA 2YYUA 3CV1A 2XFFA 2BGNE 4TXEA 4G8TA 2ZUMA 1HKVA 4QDPA 2VX7A 3EOOA 1Z44A 4OV9A 3BAXA 4UQCA 1JQXA 5F2LA 2UY5A 3R89A 1UJPA 5BZAA 4H8VA 1E9ZB 2PRMA 4IT1A 2Z6IA 5MKGA 1JYWA 1EOMA 3K8MA 3WQCA 3W26A 3CZGA 1QFEA 2G96A 3CIVA 3UQNA 3URNA 3D0CA 2OT1A 4DN1A 3LNPA 3RGTA 2CKRA 4J7RA 2QDEA 2Y8VA 3NAVA 2PURA 4JBRA 4GJ1A 3R1ZA 3VDBA 4JN7A 4UFKA 5HWBA 5E93A 4CVWA 1JZ3A 2OODA 1FQ0A 3CHDA 4UMCA 3NVDA 2WPGA 2CITA 4AEFA 3EDDA 2JKEA 3B06A 4EKJA 2J88A 2PV1A 4WF7A 4MSSA 1U5VA 1BF2A 3BDKA 3B40A 1KNWA 1HTIA 1E0VA 1V0KA 5MKGB 5BYWA 2C1HA 3BG5A 3VINA 2ZXQA 3NZPA 3WJYA 4QFUA 3M5VA 1OM0A 5A6AA 4R0XA 3LLFA 5G1YA 4PEEA 3GG8A 4JEJA 1ICQA 3IUIA 4ZPWR 1A53A 4JIQA 3HJEA 3WH5A 4E2VA 4M51A 5HQMA 2WCAA 4OU1A 1EJVC 1R46A 3WUEA 1TMQA 4Q8UA 3MYPA 1RALA 1S5WA 1A0CA 1D8WA 4HCLA 2IXUA 2BWGA 2EQDA 4UTHA 5FD0A 1TREA 4AIEA 1PXGA 3VM5A 2I17A 1B3ZA 2B7NA 4ZSTA 4DRPA 2PGFA 4O1EA 3WNMA 4X9YA 1RP8A 4QTGA 1C92A 2VEMA 3A3HA 4JICA 3FAXA 3PB2A 4TU1A 3GO2A 1FWGC 3VCNA 4N6FA 4W9OA 4XK2A 4GPNA 3MPGA 2RUQA 2AKZA 1Q3NA 2DUXA 4QJ5B 3CYVA 2CHNA 3SAZA 4QAWA 2PWDA 2CCRA 4FX6M 1XDJA 3BURA 5DT7A 1AVAA 2A2IA 2NQLA 4XAFA 1M7JA 4IMFA 1VYRA 2AKMA 5HPCA 2EJAA 2IXVA 4HTBA 2DY3A 4R7WA 4B2DA 1S2UA 2J7BA 1HFBA 2I5GA 3G6MA 1DHKA 3PBWA 4RDZA 1ZAIA 1U22A 3B8SA 1M5YA 1FKGA 4GUJA 1W8SA 3VKAA 3BLEA 4B5TA 2VJXA 4QT2A 4PH6A 5M17A 3GHRA 3H54A 3ZZ1A 5H8PA 2ZWZA 5CPQA 2Y7EA 3UR2A 3U2EA 1DHPA 1E43A 5LXXA 3C5QA 4Z1YA 2OWWA 3COTA 2W91A 1H0IA 1SZFA 5AVNA 3SB0A 1GQJA 4R27A 3NOYA 3UESA 2PWVA 4DJFC 5EYWA 3GNRA 5CKSA 3UQIA 4IM4A 2GUYA 4FSAA 4IMGA 2R91A 1BSIA 3NL3A 4WVXA 1Q6UA 1FKSA 4L4PA 3IJ9A 4ODPA 2R1KA 5K9CA 3TJLA 3UERA 1FWBC 1YEYA 4FXRA 3S1UA 4CCCA 5DMNA 1QI5A 5CSRA 4PTXA 2A1YA 3SCSA 1EO5A 4JIRA 2IQTA 4G7EA 1NDZA 1J12A 4AZ7A 1QPKA 4I7UA 1B6CA 3BJTA 1UCWA 3TK7A 1T6MA 3GRIA 2ZE0A 3LSCA 1S2TA 3O5RA 1FWAC 1UUMA 2CFFA 3T0CA 3BGJA 4D72A 3QQWA 1EXPA 4KPLA 2JGQA 2Z4GA 1QHPA 4L7ZA 1C9WA 4ZO9A 1NMWA 2GQ3A 4DNHA 4S3AA 1H63A 4CN4A 4ODKA 3V7PA 1W3JA 2ZQSA 4DRNA 4LTSA 3PZIA 1HN1A 1W3NA 2WJFA 1NELA 2WLZA 1D3CA 4GNJA 1X39A 2ETNA 2J9YA 3PTDA 1OK6A 4AD4A 3DFTA 5HW7A 1O95A 3HZ3A 2C13A 5DIVA 3U5UA 3JYMA 2CWNA 3W27A 3LXBA 3Q4DA 5J5RA 3HU7A 4X60A 4Z2HA 5FSDC 4LB3A 1NJJA 2VC9A 2PCQA 3PZMA 3ABRA 5HMEA 4B92A 4GI4A 3OIXA 4QR6A 4Y8EA 3WF4A 1WZMA 4DJDC 4MJZA 5HKGA 2XVGA 4TTGA 1XBVA 4LY4A 3SFWA 4G2PA 3PWGA 3THUA 2ZZ7A 4CLMA 4HPJA 3Q2DA 4KGLA 3H2FA 2GGJA 4QNWA 1AMYA 3S1XA 1NTHA 3TTOA 2CW6A 1IGWA 3WK2A 2R1NA 1UD2A 1XIFA 4KWWA 1OCQA 3GFYA 4L6OA 1TTQA 2FDMA 2QGYA 3NDZA 1J4RA 4PTWA 2QDHA 3M0JA 1TPB1 2W0UA 4QJ4B 3W02A 1J0IA 1OADA 4DRHA 3CL6A 1KLYA 4L72B 1R7OA 2Q5AA 2A4AA 4O4WA 4DF2A 3OOBA 3VU2A 3A21A 1QBBA 3FHAA 4O57A 2OZ0A 4LVGA 2PU1A 4JL1A 3ZVHB 4AD2A 1EQ3A 2OZ3A 4I5XA 4ZPVR 1B4EA 1EJRC 3VK5A 3DFQA 3QHOA 2FVLA 1QXLA 1EF3A 3QFEA 2CERA 2ACRA 3FV9A 1A5MC 5EL1A 3I3DA 1BPLB 2DZAA 3AYRA 3GTXA 1DE6A 1NEYA 3W71A 4DLMA 3BV7A 3N04A 3MI2A 3UA3A 4GJIA 5CZJA 5F2IA 2VR5A 3WG6A 4N6EA 2MF9A 1G4EA 4PFMA 5D9OA 1HJWA 4DVOA 1ZS2A 1CXEA 3W22A 1ZUAX 1J93A 4GNKB 3ZSTA 4FNTA 1GK8A 4QZVB 1B2YA 2MLYA 1SR0A 4WY0B 2V2HA 4PCTA 3OIHA 3QC0A 2C1GA 1L6WA 3NL5A 3KTSA 4HHMA 3QFWA 2NXIA 4IUGA 1XIHA 1FDZA 4FF5A 3W6LA 4XZIA 1WZKA 3W1TA 4JX4A 3M0IA 2DORA 2XN2A 4D6IA 1E0UA 1HJUA 2GJXB 3IV8A 1W9PA 3WSUA 1XLDA 4BR1A 4ZENA 7ODCA 2E67A 4Z1DA 1EZWA 1X1OA 3ALGA 3GH5A 4JD4A 3T0AA 3SI9A 4O14A 1HF6A 1LRQA 4P7OA 1IE7C 1OFDA 3O05A 4XVDA 3B9NA 4BI5A 2QW5A 3C86A 3ZVHA 1BWVA 5KINA 4UTTC 2OFJA 5DN1A 1OT1A 2FVKA 1X6UA 4OBSA 3N2TA 1I9CB 1WDSA 2R94A 1T7LA 3PANA 2SFPA 4WR3A 3VZYA 4IXHA 4ZO6A 1MW3A 1K77A 3WLSA 4BS0A 2AWGA 2QGHA 2WVTA 4FR6A 2ISDA 1SU5A 4KQNA 1BVWA 4JQAA 3WY1A 3H4XA 5LYRA 4CCEA 5F7UA 3UA4A 3SBFA 4GVIA 3EXSA 4QIUA 4KFNA 3OYZA 1JZ4A 4GQBA 3AXKA 3R10A 3KZSA 2VGIA 3V0UA 2J8FA 1Y5WA 4GXPA 1RZMA 3HURA 3UG5A 4ZXLA 4P5UA 3BPWA 2D20A 3KAFA 2A3CA 4N9CA 1OT2A 2RUDA 2OEMA 4DBEA 1Y7VA 4LYKA 2WZHA 4O0ZA 4JIIX 4M29A 3FXGA 3NFUA 2OKOA 5HWCA 5BOOA 2CLPA 1KV8A 3W85A 4HK7A 3TU9A 1W9UA 2GUUA 2QMJA 2VD9A 2WM0A 3QR0A 3VXGA 3MO7A 1LT8A 5F2MA 3AOFA 5C7HA 5D05A 2F38A 4KKXA 3T40A 2PZ0A 4GKLA 2DIEA 4LUTB 1KBBA 4M82A 3CZJA 4LYQA 4C6KA 1Z89A 2ONEA 4XD6A 4HB7A 1PTAA 3WQ6A 3EPOA 3QRHA 4YTUA 2YYTA 3CB3A 3WDQA 5KMYA 3SUWA 4DO5A 4BFAA 1R30A 2KE0A 1GKQA 3BWWA 3F4NA 2XIOA 2ZA2A 7CGTA 1M6JA 4GD0A 4ECLA 2ODOA 3LZ3A 4IQ2A 1EUNA 2DZPA 2GVLA 3AMCA 4GZIA 3WQ5A 3BG3A 3B0YA 5DY2A 9RUBA 4TYOA 1NFPA 3FJNA 3PBGA 3UWWA 3JW7A 1V02E 5J04A 3UF8A 4ITZA 4FOUA 2ALDA 2YCJA 1F9CA 1JPDX 1FH8A 1OCJA 1XLEA 4Z0SA 1OFEA 1OG6A 1S39A 3VKKA 1EPXA 4YTRA 2YXXA 1ECEA 4OKDA 4C1NA 1RUSA 1FWFC 5D8WA 2VRQA 1FDJA 1DQUA 4KWOA 4R88A 4ORIA 5E5CA 3TCEA 4CUCA 2DSWA 2VC7A 3VGDA 3R12A 3T4CA 4B3KA 2WMKA 2VL4A 4L9XA 2I14A 3M07A 3V16A 1BSLA 3NM1A 1VENA 1EX5A 2Y8KA 4CD6A 1X97A 3HQ1A 1O94A 4WY0A 1VPXA 3DBNA 2XVNA 4F2BA 1EYWA 2OZTA 4LU0A 2CLEA 4M6QA 3KTXA 2J75A 3UR8A 3FSUA 4Q8OA 4NJIA 3OP2A 4LQ1A 2QNEA 4KETA 2R1PA 1BRLB 4JTEA 2ZX5A 1XDMA 5C9XA 4AZHA 2ACQA 4Q4RA 4X0VA 1TPUA 1XH1A 2J7CA 2CZVA 3EB3A 4ML9A 2UY2A 3KCEA 2WJZA 2E0PA 2I1OA 1CB7B 4JPGA 3G1DA 4US6A 1Q2SA 4EPBC 4PCNA 2OZ8A 4H9TA 3B9AA 3TJ4A 5CPOA 5LNVA 2JQXA 2A6NA 1UWTA 3E0VA 1BAGA 2VGGA 1V4YA 2UZ9A 5C9RA 2QR6A 3SURA 3S5OA 3GU0A 2XZ7A 3EMCA 4HHPA 2XDFA 1J2BA 5F4SA 3GTHA 1W3IA 3HB9A 3OLDA 3IWPA 1T5AA 3W6YA 3RM8A 4BK9A 4WGXA 1ZP3A 1RK6A 2PDNA 3GVGA 1KR0A 5A6LA 5I3FA 4P8UA 1V3LA 1NIUA 2W62A 1KCKA 2W9MA 4NYUA 4NZCA 3W7HA 4JTHA 1EL3A 3DGRA 3FKRA 4GACA 5D38A 3PSWA 1D7KA 2BHZA 5B7ZA 1YTDA 3CAKA 4WSKA 3WX7A 1QI4A 4CD5A 4QS6A 2OTDA 2GGIA 1I2NA 4WEVX 2BVYA 2E9LA 2WQPA 1C7SA 2V3FA 4DEFA 1VPYA 1XCFA 1YDNA 3AS0A 3GHUA 3LB0A 2REQB 3A64A 3H26A 2NQ9A 3JYJA 3PP7A 1IT0A 1TMLA 3VKBA 1YE6A 1FX6A 4XZMX 3DI1A 1H7XA 2JEPA 3WK3A 5JUVA 2VYOA 4F66A 3G6LA 3HQNA 3H2AA 5A6TC 1XV8A 3WBXA 3HM7A 1W54A 4L61A 2W6RA 1UH3A 1FTXA 1LT7A 4U86A 5EY5A 4I7WA 5JIWA 2QXWA 3CL8A 2WXDM 4R85A 1BXNA 3N15A 4UQAA 2N87A 3LOTA 1GORA 3BMXA 4AHPA 3QTGA 3VDCA 1LL7A 3F5KA 3KBJA 2ALRA 1J01A 4GK8A 2PPPA 4MPQA 3AIWA 1PO9A 3TVAA 4CEUC 3LCWA 3SQMA 1KM6A 1WQ5A 3KBNA 2FDSA 5E0KA 3PWIA 4ERAA 4FA3A 6TIMA 3Q65A 3QV9A 2GJRA 4KW2A 1FKFA 5LA1A 5HAOA 2NSOA 1VLWA 1HVQA 4CN1A 1JRCA 3RCNA 3S4TA 2X16A 4JHZA 4MGGA 1I0DA 2P1FA 3ZFHA 4X2RA 1S1PA 3W1LA 2FZ9A 1W1TA 5E70A 4GISA 1M53A 4LEFA 1FKBA 1A7XA 4MY1A 1EP2A 3K1DA 1HG3A 1WO2A 3T08A 1X6NA 1E51A 5HANA 3MT1A 1N8FA 4ZSUA 5EFDA 4TIMA 4O1BA 4ZR8A 3N3TA 4PCPA 4URIA 1JPHA 3B05A 3AISA 3A23A 1UKQA 4J27A 2E09A 2VN1A 3GWQA 3W2UA 3WNNA 4CD8A 1SFJA 3TLQA 3NQ2A 3NGFA 1XH0A 3VC6A 1U5HA 1W91A 4PCSA 1RCXB 2FFIA 2HWGA 3U2ZA 3R13A 5D04C 3ZT6A 4KFOA 4AMCA 2OB3A 3UJSA 7ENLA 2J8GA 3G1VA 4MPKA 1OG0A 4O28A 4YTSA 1JD9A 3C8NA 2NT1A 1VFSA 1X6LA 3UNTA 4Q4MA 3T0TA 1EGVA 5HJLA 5JMUA 3CIWA 3GZ3A 2GJPA 3XINA 2D69A 3SQLA 1IXNA 1NARA 2POZA 3LI1A 4IP4A 1GHSA 4W9PA 2CHRA 3BG9A 3AYTA 3VOHA 1V08A 1UR2A 2QDDA 3C0QA 3TNOA 2JKAA 3UQAA 4LAYA 1A3WA 1P7TB 4GUGA 4REQB 2DUAA 1FWHC 1W1ZA 2JGYA 2WWDA 4C6MA 4HMEA 1O66A 1XIEA 4E2OA 1R9XA 4U5KA 4DELA 1US2A 2EXOA 2GYIA 3MANA 2ISFA 3MMUA 2CYGA 3ARRA 4LYPA 3TC3A 1EPVA 3MUIA 4NG3A 3LGEA 2OX4A 4DUVA 3HIJA 2FIQA 3PAOA 4C6FA 4DJEC 1XD0A 2XVKA 1GQNA 4IGSA 5D75A 2XZ9A 3EWCA 5I07A 1VZWA 2QPUA 3TSBA 3H70A 3QQ1A 5EGRA 2ABAA 2B0MA 1GYNA 1W5QA 1I2QA 3O5LA 3HOJA 4S3JA 4JOMA 1Q6HA 3T6CA 3OVQA 3P82A 2CLFA 2ZUNA 5CG0A 3UXAA 3HV8A 5DLCA 2XVPA 3LBMA 3FX4A 2Y0FA 3E0IA 1BHGA 1E9YB 3E2RA 1F40A 4MB5A 4WX2A 3PS7A 3JZUA 1ZU8A 1LROA 3E0WA 3O3RA 3NCOA 1BVNP 3MSYA 3BLLA 4UTWC 1KQYA 1NDWA 4JTQA 2PGEA 1Y5XA 3K8LA 3EPMA 2KZHA 1Q13A 2CZ5A 4FX7A 2VFGA 3MI3A 2KO7A 1N2VA 4RR4A 2P3ZA 2VELA 4JQ2A 4UTIA 5H91A 3MB9A 1T40A 1UD5A 4INFA 1JZ7A 4ATLA 3T42A 1C29A 4MDOA 2F9RA 4ODOA 1W0MA 4IIEA 1QNOA 1K7EA 2X09A 2XM1A 3BGAA 3WQFA 4E0CA 2Y5JA 3VD5A 5H2ZA 2ZDSA 4O1FA 1R2TA 3AJ7A 1QWGA 2YW4A 3CPGA 4KEMA 4M56A 3AZSA 4X22A 4N4PA 3OODA 2IKIA 4PMXA 5FL1A 4GX8A 4ZOBA 3BARA 1Z7AA 1TV7A 2DP3A 4ICCX 2OYKA 2NW0A 3GHSA 3CUHA 3RX4A 3W9ZA 2VENA 1L6SA 3WF1A 3PZOA 1AODA 5C70A 3WH7A 3AZRA 3UF9A 2ZUVA 3AIVA 1GTHA 1OCNA 1THFD 3RLGA 1ITUA 3VUSA 2EBNA 4FOJA 2NV1A 5D9PA 2ZA3A 4RPQA 3OBKA 4O10A 1ZLPA 1XR2A 2CHOA 2QPSA 1SSGA 3B3DA 4JTUA 5HW6A 1IEWA 3N9RA 4BQ4A 2V67A 3LQLA 4I9MA 4QROA 1OSEA 1E3XA 3N2CA 3GW3A 4A8NA 4EWND 3KLKA 4NJJA 4HU8A 1FKKA 4PE8A 3CV2A 3PHAA 2ZOXA 1D6OA 1FD9A 1A3HA 1M9HA 3N2BA 1YDOA 5JH2A 4P7LA 1L9WA 4GI9A 1FHVA 4KQZA 2WLYA 2G3IA 1TX0A 4BKNA 5IM51 4YVVA 1MVYA 4AWSA 1KRAC 3R7MA 2DVTA 4LS1A 4LUIA 4IIFA 1QASA 3QKZA 1HP4A 2H9AA 1D7IA 3A4JA 1WOBA 4XKMA 3MZ2A 3W73A 5FKYA 1Q63A 3QGAC 4IMDA 2DG9A 2W66A 3Q67A 3WJZA 3ZM8A 3N18A 2X1SA 4M24A 4MAZA 3CWNA 3AIEA 2VDGA 1DWJM 1CXLA 1VAHA 1KKRA 2BXYA 2GOUA 1PBGA 1OHLA 2PTZA 3SM0A 1SYTA 1HGYA 1FP9A 3UWEA 3R43A 5A8MA 3KOZA 4BF7A 5CZSA 3GU9A 3IJDA 4WKFA 1CWYA 3KABA 4S3GA 1BXBA 5K9DA 3WF3A 2BASA 3JRKA 1UC4A 2J9ZA 1HUVA 5HUOA 1DVJA 5FOOA 4WIWA 1L1PA 1YPFA 2X40A 1QTWA 3UQBA 3KL0A 5D02A 3E0LA 1QHOA 4NNBA 3WMLA 3ZLHA 3M5YA 3DG6A 5HUPA 1HKJA 1EWDA 5AFDA 4UTFA 4FOKA 4JQ3A 5EMJA 1OGBA 2DSZA 4JTRA 3VGFA 4UQBA 4ZE5A 5TF0A 4Z2IA 1YTEA 2QJMA 2FLIA 2DSKA 4ACZA 1ISYA 1GW1A 3ZXWA 2FGZA 2O4QA 1HL2A 4IXXA 3PZVA 3DN5A 3MUXA 5I77A 4AZIA 3UI5A 4M1RA 3L4ZA 4H00A 3GH7A 2X1IA 1TIWA 3MHUA 4HKPA 1QI2A 1OZQA 1IEIA 4PL1A 2BTMA 3ZQ9A 1H4PA 1GVYA 1EFZA 2DG4A 1K02A 3L4UA 3L4YA 4CCDA 3O06A 3UWQA 5AN7A 2QJGA 2Q02A 5BXTA 1XW8A 5FEPA 4AF0A 2RUSA 1XIIA 4H7VA 1E4LA 3DXIA 3RNDA 2QJNA 3WFZA 5BWFA 3WDIA 1XRSA 1CW2A 2RURA 2BNJA 4PN2A 1VEMA 4QDMA 4WOZA 3GNOA 1V93A 2D2HA 3F03K 4GY1A 5IFPA 3BC9A 3W29A 4JKLA 5SWUA 1QCWA 1JULA 1IEXA 2PDXA 4KCUA 1A5KC 1WXJA 5DO8A 3SEPA 4IPXA 5REQA 3APTA 3LQGA 4R53A 3UZXA 4QCFA 3C2YA 3IIZA 2XM2A 1QI3A 1SGJA 3G3MA 3B97A 1QNRA 1W9BM 4NZ4A 1LQ2A 3CEPA 1UASA 2Y70A 1UKTA 3DC8A 3VYLA 3O8AA 2Y85A 5J8LA 2E8ZA 2PN0A 2PAJA 3UXDA 1ZAHA 3T05A 3PUOA 1GYMA 1XC4A 4RLIA 4H01A 4C02B 2QVNA 4LW7A 4GGQA 5KZMA 5A6BA 4H8UA 5LNUA 3D3AA 4QJ3B 4TVDA 1GOIA 3UZYA 3W75A 4TO8A 1TPVA 4YVXA 3W1RA 2J13A 3CUFA 3S6OA 4NZJA 1XCWA 1SSDA 3NQMA 3HGRA 3AMDA 2OCZA 3NSMA 4RE3A 3M44A 3L0KA 4Q6XA 3EOEA 1S1RA 1US3A 3LMZA 4FR1A 2Y1HA 1ISZA 2XYLA 2Z0IA 4LBRA 4DXVA 2PDQA 3ONCA 1QBAA 3VUPA 3U7VA 2VI0A 2M08A 1BQCA 4UFIA 2JFEX 3ELFA 4PTVA 2O7QA 1U2YA 3EBVA 4JTJA 2P8CA 4TUFA 5BRBA 2PTWA 5C71A 4UNLA 4FZIA 3TX9A 2CLHA 4AMAA 4EP8C 5D2YA 1PE1A 1BYCA 2PDJA 4IHCA 4D6CA 4YS1A 4MWAE 4ZZ9A 2G50A 4OWGA 3QYSA 2PE4A 4RE0A 1DIEA 4QG6A 1JNSA 4WKAA 3UFYA 1IXQA 3NO3A 3RR4A 4AIOA 2ISVA 1JG9A 1FKXA 4JEQA 3VIPA 1MNSA 4R5EA 3II1A 2G8ZA 4LC8A 3TYCA 2Q8ZA 4NAEA 4WXYA 3FVMA 3GVQA 2VX4A 1S2VA 2O9OA 2QCFA 3NO1A 4DZIA 1DJIA 2P8BA 2H90A 3T0BA 4IFKA 1GCYA 4WQ6A 2XP7A 2OSWA 1C8XA 3MJYA 4HT3A 5LHEA 4FB7A 5AHLA 3BICA 3NXLA 4QX4A 2D3LA 3I10A 2DQWA 5I3GA 3LUOA 3LRLA 4J35A 2QVHA 1UYQA 1JD7A 2PBOA 3ECQA 1BYAA 4LX4A 1B9ZA 1JDFA 5FJTA 3REQB 2E7FA 5LIUX 2VUYA 1IWBA 3QV8A 1G1YA 2FHCA 4PTNA 1A4MA 4A05A 1E6QM 4QAIA 4L1GA 3B4UA 4IX2A 3KRUA 1XLCA 4YCPA 5E9AA 1I2OA 3WF2A 3WK0A 1H5VA 1OFPA 1R86A 4LH8A 4KGJA 4FNSA 3FA3A 4M81A 2FQIA 1EWEA 3UXIA 4B5WA 3ZWTA 1C7TA 4G1KA 4WRHA 3M6DA 5IRPA 5DBUA 2PS2A 4PUDA 5A8NA 3D5HA 3VMPA 2EKCA 4D8ZA 4FO4A 2NX3A 4V1YA 4H7ZA 1EIBA 1U83A 4OOZA 4NJKA 3OOQA 4N9BA 3GDRA 3VOFA 4Y9OA 1LRNA 3IIOA 2PDLA 1ZP4A 1AUSL 1MXDA 4AEEA 2KAUC 2YJQA 5AHEA 4OOUA 3DHPA 1W9VA 4K1WA 5CZKA 4QISA 1FCUA 3ZJKA 1B5TA 1ML1A 4UZUA 1RQBA 1B9BA 1AH4A 1YPIA 2VFFA 1ZJIA 2DJLA 4HHLA 1FFRA 1LOLA 4I5UA 3HMJG 2YKKA 2JEQA 3MI6A 4BI6A 3A13A 5DCBA 4MNLA 3CZLA 3W7RA 1FHUA 1OEPA 2GDQA 2NQHA 3EIPA 1LLOA 4AX6A 2IS7A 5AHNA 1CECA 3FYOA 3ZOAA 4RV3A 1OJXA 2AOSA 3PTMA 4IFOA 1HKIA 3FY1A 3M1ZA 3NTYA 4KRTA 3MSRA 2EEXA 3N73A 3MKCA 3ATYA 3O7UA 1SW0A 3OJGA 4N9EA 1WOAA 4DYEA 3VGBA 1GVRA 3L5LA 4L6DA 3ARTA 2Y8UA 5DBTA 3O5EA 1TUFA 3R11A 4POCA 4NJHA 4DNMA 1W5MA 4O54A 1J8VA 2RDWA 4FIRA 6XIAA 2A3EA 2R1LA 4F9JA 4O16A 4ZA0A 4MNJA 1K9FA 1O4UA 5CG7A 2D2JA 1SUXA 2Y24A 4NU7A 2HBVA 4ADSA 4MKNA 1E40A 1F6PA 1TKKA 4ICMA 1PZ0A 3UCDA 3UU0A 3IK8A 5DY3A 3CEUA 1EH9A 4TW7A 1JXJA 1GPFA 4KIRA 1IYXA 4BF8A 1F61A 3UPWA 1WZAA 4DF1A 2F4EA 4WKHA 4OHQA 4NHVA 1JZ5A 4UTTA 1JZ2A 1E4NA 6PTDA 1OD8A 3B8IA 2EAWA 4IIGA 5TD4A 3M16A 3SCOA 5KITA 1ESWA 2Q3RA 2FH6A 1UOKA 3PTQA 3B8WA 4OVXA 4UXDA 1EP1A 1TPWA 4E4FA 3P80A 1W17A 1EIXA 4EXQA 3BJFA 4J4NA 4A4AA 3ABSA 3D46A 3LTSA 4OECA 5ENLA 4BY3A 1GUVA 1PBKA 4MFDA 4NQ1A 5HMFA 2WQDA 1YQ2A 3M46A 3EEZA 2WMHA 3W7LA 4RNFA 3VGEA 1JXKA 3VDHA 2J79A 5AC7A 3S9YA 1EF2A 1JL8A 3O16A 1CGUA 2V3EA 3TKFA 5K2ZA 3TC6A 1VCVA 3IGHX 3CB8A 4U10A 4DRSA 4CQBA 1E6NA 1HKWA 2YL6A 1UIPA 2J47A 4WHBA 3T81A 2XUCA 5CPSA 1A5AA 1CT5A 5KETA 2C0HA 4AW7A 5I00A 1ZJBA 1J6PA 3W83A 2ZZ1A 4C6DA 3AMLA 3CWOX 1WYIA 1ISWA 1GOQA 3PPCA 3HO8A 3N17A 4PB3A 4L64A 1OBAA 4AZ5A 1WDPA 1GYLA 3A6OA 3C61A 3AALA 3N4AA 3GVVA 4BEQA 4DI9A 4DLFA 3KAGA 3MCNA 8XIAA 5LA2A 4YMZA 3O0KA 3QJAA 1W1A1 2FHFA 1BWLA 2OLAA 1XWYA 4FHAA 1GG1A 1ECQA 3UVIA 5CXPA 4GLEA 4FI4A 3WH9A 5I98A 2WZTA 4UTUA 3QLLA 2ZC1A 4ZQNA 2J7DA 3VGHA 3QPZA 1ONWA 1UR1A 1VFHA 4A3YA 3M0VA 3CUJA 3K4WA 4V2XA 4HYVA 1W1IE 3USBA 3ZLFA 4JIHA 4G50A 5C2XA 2XH2A 3BTNA 2X8RA 2Z25A 4PC8A 1DWFM 5D09A 4X3ZA 3M0YA 2YFNA 4UQEA 5C7VA 1DKWA 4Z1BA 2ACSA 4F0HA 1HW6A 6TAAA 4JCLA 3AXIA 3VD9A 1I8JA 4BWLC 4GRSA 2JBMA 1EDQA 3KVMA 2PDUA 1W1YA 1PWLA 2G97A 1F73A 1ZCNA 2D2OA 3NDOA 2WHKA 2ACUA 3ARXA 1MW1A 4QLJA 1R47A 5F4WA 1Z3NA 3T8QA 4DIAA 1B0IA 1POKA 4IMEA 3QF0A 4Q4QA 2PSNA 4H4IA 5FJRA 2VVSA 4J28A 1JNDA 3A3WA 3NM3A 5KSWA 4EXAA 3LMYA 3GR8A 4U31A 3TYAA 4UQ9A 1TPH1 3SUVA 3LUTA 1JCMP 3TAOA 1S5VA 1QPNA 4K7YA 2PUZA 4DBUA 2HV5A 4OBTA 1U79A 2DFAA 3TMQA 1SVDA 2XJ7A 3CQHA 3SSJA 8RUCA 1JFXA 3L68A 1GKPA 1FXQA 4JFVA 1R3VA 3DFNA 5CPNA 1OB0A 4IJRA 2ZE3A 3PUDA 4DPPA 1GOKA 3Q45A 4LB4A 3QN3A 2BY3A 3L65A 3E74A 3AHYA 2X1UA 2B31A 3L2IA 2DDXA 3IVUA 3LCHA 1UR9A 1RHCA 3S1WA 3ZS4A 1FXPA 1I1XA 3EGJA 5K9XA 1IEVA 3A5FA 3W2KA 4Z42C 5K4XA 4GQGA 1H61A 1JYVA 2J6VA 4P8XA 3FSTA 3VNDA 4W8AA 4D6HA 3I6TA 1XIDA 4GXMA 1NH6A 1Y65A 1FCBA 4H6KA 4FLOA 4LSBA 4AC1X 1CXHA 1EC8A 4FXJA 4JFSA 4BQ3A 1ME8A 3O15A 1ZFJA 2D73A 2BFGA 1A5NC 1EDGA 3VOJA 1UH4A 3W7MA 1Z8AA 1UWSA 2BVWA 3NPWA 3KOYA 3N2OA 1US0A 5KZDA 3KW3A 4YPJA 4PMQA 2VEGA 1M01A 4C6LA 1X1ZA 1H7WA 1JCXA 2QAPA 4JTFA 4H9YA 4S39A 3TTSA 2GGGA 3KEHA 1A5LC 4V15A 1Q45A 4CD4A 2OO0A 5HWJA 1AG1O 1ADSA 1U5JA 2PBGA 3W1PA 3W1AA 3VVGA 3W7OA 2AGTA 1YATA 4PZVA 1KGWA 4N02A 3HV9A 3UGRA 1KWGA 4D9PA 4M6UA 1TWIA 4ZBCA 2D1ZA 1BEUA 1NF7A 4CU7A 3RJXA 1OIFA 3CYJA 5LSMA 1OWQA 3CQIA 4ZO8A 5IOBA 4LBUA 1Q6OA 3LX9A 5BNKA 2XIBA 2HRWA 3S6TA 2DZTA 3QW3A 1RJQA 1TPDA 1JRBA 2XISA 3MUAA 3FNDA 3KVKA 2QCDA 1SR9A 1LL6A 8A3HA 2VQTA 3NZGA 3KADA 1EP3A 4IGNA 4Z08A 4B15A 3P6LA 1RCQA 3NTPA 1RBOB 1PHWA 2HXTA 3H53A 3TQVA 1QOPA 3CMJA 1K8CA 1X7IA 1ZCCA 1P1XA 2H6RA 2L5HA 3NG3A 1MZHA 3GNDA 4U2ZA 5EA9A 3S5YA 1AL8A 3VO0A 1EQPA 3I3EA 4W87A 4W84A 4DXXA 2CU0A 3S46A 4HK6A 3CMGA 1O1ZA 1P5QA 1TSIA 4ZVJA 4F0RA 3GQYA 4ZQPA 3EX6A 2XH4A 3D47A 2J8TA 3ARYA 2WVVB 3VIKA 3W7DA 1R3SA 5B7YA 3CK5A 2EPOA 5H6HA 3VD7A 1TVLA 5JBEA 4XIAA 1N1AA 3Q94A 1KT0A 3BLFA 1FKLA 2RGLA 1ICPA 3TP4A 2PGWA 1OFAA 2FPTA 4KBXA 2NLIA 1SQ7A 3SCNA 2MPHA 3U8GA 4Q32A 2IPWA 1KFJA 3KRBA 1IQ8A 1S2CA 2VFIA 4H9MA 3EB2A 4J1OA 3LHVA 3DFOA 1YLVA 2NLYA 5DANA 1CX9A 1CEOA 1A3XA 1FCVA 1KFWA 1KXHA 1QJWA 4M7TA 4WK9A 1EC9A 4EAMA 1T99A 1D2KA 4JY8A 3ITGA 2XIIA 5FACA 3UJ2A 3U5YA 3SO7A 1SPQA 2W27A 3T0DA 3W0KA 4AWTA 2IPGA 2BZNA 4GIAA 4NAFB 4R7OA 5AKQA 2V68A 1IEQA 2XH0A 2WHMA 4PUMA 4Q4SA 3NZQA 3THQA 1E56A 4L65A 4QS5A 2NQ5A 2VCCA 1B1YA 3HJZA 4RV8A 3M9YA 4DRQA 1AQHA 2PMQA 3WLOA 4B5NA 4MTVA 2WNNA 2HCVA 1KTNA 1QT1A 1B3OA 3TDBA 3MO4A 1NDYA 3OVGA 1HVXA 1K9DA 3UPBA 1K4HA 4JN6A 1IZKA 3KCJA 4CQ8A 1AJ2A 4LALA 4DXKA 2PP3A 4JFLA 2VURA 1Q85A 4WGHA 2A79A 3OZPA 6A3HA 4XTIA 3WH0A 1UG6A 4RKAA 1L8PA 4S3EA 2F61A 4DY1A 1Q7MA 3TYDA 1FWRA 7A3HA 4CEXC 3RU8X 3ZYZA 3LCIA 1B54A 3B4YA 4Q4OA 1PDZA 1RLDA 2QEZA 2FTPA 5XIMA 3GXTA 2QJJA 4HA3A 1IZCA 3V75A 2YCLB 2Z7KA 1LG1A 3B0XA 1VYPX 3E2VA 3WMSA 3N4EA 1NDVA 5HWNA 1HXVA 2C6QA 1RJPA 2BMBA 5L9FA 2UY4A 4EPKA 3W6MA 4LUYA 4HNUA 3MVTA 2VX6A 4HSOA 1C90A 1V6WA 1P0NA 5CGQA 3MBDA 1XLGA 2XGIA 5DFAA 2J7FA 4PCFA 3ES7A 3WJSA 2ZXAA 5FCZA 1WDQA 3LV6A 1WNOA 3FDGA 2ZUSA 3QY6A 2BXVA 2HS8A 3R94A 2C79A 3HQOA 3WH6A 2WMGA 3MP3A 3TZNA 4S3KA 1AJZA 1EJSC 2FB2A 4I6VA 4LY8A 1A49A 1XKYA 2E77A 3ITVA 1L2QA 5BXPA 1J79A 5T26A 1YTKA 4C7FA 4Q4PA 4W7WA 2NUWA 1KQZA 2ZRUA 3ENLA 2V0TA 4UFMA 5U4NA 3DEQA 4B4HA 3S1GA 2G5WA 3AMKA 2FGLA 3OW1A 4DHGA 5DO2A 4CQDA 1DIKA 3U48A 1UROA 1TWZA 3SN1A 4IICA 1ZBCA 1HKMA 3A3XA 3TJIA 2CBVA 1F7BA 4DRIA 5BOFA 4GY7A 2GK1A 3WD4A 4RZBA 3AYVA 2AL2B 2IMRA 5CJNA 1TA3A 1F3WA 2PV2A 1R8LA 3S2JA 1AA1B 2WKJA 2Y7FA 2OGJA 1ZSXA 2GVGA 4P8WA 1EX1A 4DBSA 1JCTA 2HVNA 4RW5A 4J3SA 4XKYB 2BXZA 3TA9A 2ITKA 3GXNA 3DFPA 2GPTA 4K38A 2WCGA 1FAPA 1KO0A 4DPQA 5GNYA 1I2RA 3MHFA 2H9AB 2WAGA 5M03A 1U1JA 1KC7A 3ZO9A 3TMLA 3V4BA 1V3HA 5BXJA 1AW5A 4FPSA 1EJUC 3GVRA 2LPVA 4JY9A 2RHGA 4ADUA 4JAWA 3PA7A 4HOZA 4J3TA 4M0XA 4IG2A 4NF7A 1GZ1A 3RK8A 3K5XA 2RGMA 3IAQA 4MG4A 2E5DA 5HPOA 1FH7A 2X05A 2YFOA 2ABBA 1T11A 2TODA 3IVTA 1H49A 2QUVA 3AMGA 3C2VA 3WD0A 2A21A 3GNPA 1Q6LA 4CQAA 4PBGA 3WEMA 2VQUA 4GYJA 1MDRA 3S5ZA 1XIBA 3MDWA 1WUEA 3WNPA 3OHIA 4IH3A 1QPRA 2JALA 1E0XA 3QXBA 1JI2A 4NNRA 4KCWA 3VCRA 2IKGA 4NL1A 4RDVA 5CJMA 4W7VA 3WF0A 2ZZ4A 3F5JA 5C6MA 5GQBA 4ACZB 3N12A 2AQOA 1PIIA 8XIMA 2DZUA 4WZHA 5DMMA 1E15A 4PTDA 1QR7A 5A6KA 1NM9A 5MHBA 3LTYA 1TZ7A 1ZBWA 4EPEC 3QZAA 4M8UA 1C93A 1UD6A 2IPJA 5I3IA 3DG3A 3WLRA 3VNMA 4NNCA 1DJNA 4M5PA 1JR1A 2ZDRA 3GAKA 1OF8A 3PY2A 4JGDA 2J78A 5DCDA 3IAPA 3SIMA 3VCCA 2YGYA 4UMAA 3DX5A 1JDAA 1OC6A 3SCPA 1V3MA 2PPGA 3L2LA 4L4MA 3STCA 3E2SA 2NWRA 1T41A 1UWRA 2INEA 1B3YA 2WNWA 2WB5A 4XG1A 2KFWA 3AROA 2Q6ZA 3N1AA 4GIEA 3GBDA 2CLMA 3IVSA 3UXLA 1TV8A 3CT7A 3W01A 3M5ZA 3NURA 4EXBA 5H8MA 1XKJA 1C9DA 1G7VA 1H0GA 5A1AA 1QPLA 1UUOA 2AL1A 1CLXA 2M1IA 5LNSA 3H4WA 2X2YA 3K2GA 2FTWA 5JIPA 3DKJA 4C6EA 2GGEA 4O0KA 1U30A 3UW6A 2IQDA 3N4FA 2YIHA 7XIMA 4ZOCA 3CTTA 4MWAA 3V5FA 3W7GA 3CZ8A 2G95A 1LQAA 2NX9A 3PNZA 4PUNA 3RYSA 2CPUA 1UR3M 5AY7A 1LQ0A 1I45A 1W6TA 3BQ6A 3UZWA 3WJWA 3THDA 3MY9A 1F8AB 1LRTA 4UUIA 4FK9A 1WBJA 3TEVA 1LWIA 4GG9A 3PZUA 5FIPA 1DIOA 2VGBA 2MNTA 2WYSA 3F4CA 2VCBA 1PAMA 4I9AA 1F05A 1K7FA 3WNKA 3A47A 3KHDA 1XBZA 3URAA 2A7NA 3GUGA 2BY2A 4Y7EA 2QJIA 1V0MA 4C65A 3RX3A 1AW2A 1AL7A 2O9TA 3AHTA 3AZTA 3CV7A 2YDQA 1HP5A 2RDXA 3VI2A 2ZWYA 4S3CA 2B81A 1D3GA 3CO8A 3O9NA 4V33A 5EBAA 3BW2A 5AC5A 3MV11 1UUQA 2V82A 4NT0A 1K4GA 3RO8A 1CGXA 2Q8LA 3EDEA 3GB6A 1VFFA 3GK0A 2ATSA 3DERA 3UEQA 5GJNA 4TTUA 4ACYA 4DWSA 1L6YA 4GH1A 4C6BA 4NYYA 3HQPA 1G01A 4P8VA 4LCRA 5G5IA 4GUIA 3EDFA 1NMVA 3FOKA 2JIWA 1C3FA 5A8GA 4XZWA 2YLAA 2E1DA 1F4HA 4PODA 2QCMA 3EKGA 5FF2A 1FBAA 1ZQ5A 4H41A 2XPKA 1VP5A 1OX4B 1RPKA 1OYBA 1VBUA 3NQGA 2VUNA 4YWIA 1KFCA 3R6IA 4XBSA 3TOYA 3MTWA 5KTLA 3M0XA 1PIGA 4LVFA 2PPOA 1R5YA 3VNLA 5CBJA 1QI0A 5A95A 2QIIA 1GHRA 1PX3A 4NIRA 4GYFA 1VCGA 1KKOA 4JHMA 3J7HA 2G3NA 4ORMA 3SW6A 4BEUA 2DT3A 4GKTA 2Y62A 3L67A 1I75A 2X41A 1Z32X 2CXGA 4O17A 2C19A 2Q8XA 2ZRYA 1G94A 4HNCA 2DZXA 2GLKA 2WW5A 4JTKA 1I6NA 3I68A 3R0DA 3WJXA 4O50A 1H50A 1XYLA 3I7RA 4GYKA 2ZUUA 1P4CA 3O5MA 4HZMA 4DBDA 4G7FA 2CBIA 3SN4A 4PRWA 1G4SA 1P0KA 1X8FA 4DZ2A 1K8XA 3G1RA 5LIXX 3EWYA 2WPBA 2Y5EA 1FWEC 1M7PA 2WSPA 4IT6A 1VFOA 2V63A 3T44A 1E6PA 2ASHA 1T96A 4ZMGA 3CH0A 3N2XA 3TXZA 3WLIA 2YCIX 5CC3A 1DORA 4TW8A 4OTKA 2JE8A 4J3VA 3TN3A 4Y6GA 3VIHA 1JQVA 3TH6A 2Z00A 2ZBTA 1PTDA 5CPTA 4K36A 3UD6A 5ABEA 3K4AA 1NQKA 3W74A 3DIPA 1TG7A 1U1UA 1LG2A 4NVTA 1SO4A 1RXOB 2TSYA 3CIXA 3NIYA 3SCVA 3TA6A 1MW0A 3M7WA 4LAXA 2BODX 2P88A 2F6KA 2OT0A 5EBUA 3ANVA 5BOEA 2PWUA 2PDCA 3RCMA 4OZOA 1OC5A 3EKZA 3WLTA 2EG6A 5EMLA 2QUNA 3ARUA 3BVJA 4ERGA 1R87A 1H60A 1YXCA 4FLSA 4REQA 3W82A 4BWLA 3VFLA 1H2JA 2ZCGA 3MZNA 1PX4A 3N9SA 1MEHA 3KAHA 4JFMA 1Q8JA 3KS5A 1EJTC 3QBUA 3RILA 4Z17A 3FGCA 1J0HA 2ZC8A 3URQA 3KOXA 2HVOA 1TWSA 3JUGA 4GY0A 4Q8QA 3CNYA 2C71A 3P3BA 3TTQA 4G6CA 1ZCOA 2FHBA 3QPEA 3F2BA 4JTTA 3FHQA 5LHFA 3LLDA 3NDYA 2E25A 2WV8A 3WENA 3AU2A 1GEHA 1FWTA 1EYEA 1E1FA 4MNKA 1E70M 1DP0A 3CV6A 1O5XA 1K9EA 1ITQA 1XISA 3HGSA 4K3ZA 4GQQA 1VJSA 1X96A 2YL8A 2Z29A 2X1TA 3VNIA 5AYZA 1CLVA 1WUFA 4AWEA 1KCLA 2PWGA 4GE8A 3AXMA 3ITOA 3OEXA 2O56A 3RJYA 2OXNA 4Y9NA 4IFRA 3ITLA 3IJ7A 4DJDD 1AZ2A 4J4KA 4JYDA 4M1BA 3DHUA 1ONEA 4AXNA 2XINA 4H8HA 1ZHAA 3FYYA 2ZICA 4H8NA 1PYFA 1UA7A 1FUYA 3O5IA 1P0EA 3O1NA 2BVDA 1E4MM 3C8FA 4HYRA 4PMJA 3WLPA 1Z69A 1D7FA 3T1GA 2OJPA 2WZEA 3LHWA 3R4IA 4L3NA 3NJ3A 3W1NA 2GDVA 4J2PA 1ZY9A 1JUBA 4BF5A 1MXSA 3SCUA 1YADA 4H3DA 1PCKA 1WZLA 3UR7A 1P43A 2QKFA 2WSKA 2YDRA 3RMJA 2DH3A 3R25A 3ABZA 4RK8A 4XAPA 4O2TA 4UTWA 1M7XA 3UNDA 4NI3A 4PMNA 2X2GA 3G1FA 4JXCA 3OYXA 4NRRA 3BSMA 3B8VA 3IK4A 1YDYA 3OA5A 2CLOA 2VCDA 4MYXA 2ZVIA 2PC4A 3QQ0A 1N82A 2PLKA 4DBWA 1XGEA 3U57A 1F07A 3C2RA 3O0FA 3MMWA 1O5RA 3INPA 4MFEA 4AD5A 4S23A 1XBYA 1UD3A 2OWXA