2ESCA

Crystal structure of a 40 kda protective signalling protein from bovine (spc-40) at 2.1 a resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGSERFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGGWRGTVGHHSPLFRGNSDGSSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSSTRVGAPISGPGIPGQFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bovine secretory signalling glycoprotein (SPC-40) at 2.1 Angstrom resolution.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2escA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2escA01
4AIUA 5A8PA 5EFFA 3B9DA 4M56A 1BYAA 3PTKA 1ZL1A 1C90A 5BYWA 2UY2A 5HOSA 4U3AA 4D6JA 1GCYA 2FHCA 2NW0A 1KWGA 2WHMA 3VIPA 4W85A 3SCTA 1UH4A 1DP0A 4A3YA 4DM1A 1R7OA 2ZICA 4KRTA 3MSGA 4QCEA 3NIYA 5M5DA 4BQ4A 3W82A 3AIUA 2VCCA 1KXVA 4JKKA 1GUVA 1PJ9A 3VDCA 4HZ8A 1J11A 1QI4A 2XSBA 1G01A 3DHPA 3OLEA 4XV0A 4RE2A 2PWGA 1YQ2A 4UFLA 1ISXA 3RM4A 1UD4A 3CPUA 4ATDA 1WKYA 4M24A 1U2YA 1E0WA 2QMKA 3MUIA 1G5AA 2WHJA 4F66A 4AZIA 1JZ3A 1VFMA 2JALA 4Z2GA 2DQXA 1IZKA 1JYWA 4FLRA 4W7WA 3KL0A 4PMOA 3W6LA 5I23A 3VGHA 1G1YA 3QGVA 4ZXLA 1ZS2A 4WK9A 4U3CA 1H41A 6CGTA 3EDFA 5E0FA 3B9EA 1LF1A 1E6ZA 1TR1A 4N0RA 4AZCA 2YKKA 4TTUA 1OB0A 1I1WA 1UD8A 4JHZA 2BHUA 3AHZA 1QNPA 2E8YA 4W86A 3BLPX 3W37A 2YA0A 3ALGA 4E4PA 2WPGA 3A3HA 4JFSA 1OIMA 1E56A 2W61A 2VL4A 3WBAA 1B3ZA 4HTYA 5D9PA 2GJXB 3SCVA 5DFAA 3VIKA 5DO8A 4CCCA 2ZIDA 1ZBWA 2WCSA 4JIEA 2BXZA 3UETA 3RPMA 1UKQA 4PMDA 1BYDA 4HMEA 3PZGA 2E9MA 4HP5A 3VU2A 1E73M 1PX8A 2DIJA 4QAWA 1HKKA 4P8WA 3OB8A 4IISA 1V3JA 3W25A 1DWHM 1KGXA 3FY1A 1UZ4A 1CGUA 3SCUA 2GUYA 2O92A 5M3WA 2FDMA 1ZU8A 1GPFA 5I5RA 3WIJA 4P7RA 4U5KA 1E0VA 1QI0A 3RM8A 3WD1A 5AC5A 2OLHA 2WZHA 5A6AA 1NQ6A 2WKLA 1NOWA 3LMYA 4X0VA 1GHSA 1OBAA 4F9DA 1UKPA 1WDQA 1UR9A 2EJ1A 3L4UA 4W89A 3KWXA 3SUTA 4CN4A 1BVZA 3SCOA 4WKFA 2WWDA 5LA1A 3SEPA 3AICA 1W1VA 1QNOA 1GOMA 3BSGA 4QLLA 1C8YA 3AQUA 1CGXA 2PWFA 2C8NA 4JKLA 2WM0A 2WMFA 3ARZA 2G3JA 4YN5A 4UFMA 1HL8A 1WDPA 1F4HA 2V3DA 3DHUA 2X2YA 1BGAA 3UG5A 1HP5A 3VIMA 1E5NA 3LPOA 4D1JA 4GKLA 1GOQA 3SCWA 3OIHA 5AYIA 4QCFA 2ZUWA 1HT6A 3N9KA 1UH3A 2YA1A 3WQ4A 3OLGA 3NSNA 4AZHA 4IPLA 1J10A 5FL1A 3WH8A 5FL0A 1GNXA 1K9EA 4C7GA 1BGGA 2OWWA 3K8LA 3ARTA 2VZOA 3AZTA 3AIBA 3MSDA 3VIFA 3QHOA 4L4OA 1V02E 3GBDA 2BVTA 1JFXA 3AMGA 3WNKA 2VI0A 4LX4A 1TA3B 2A3BA 4AD0A 4AD5A 3POHA 3W27A 4ACYA 1ZBKA 4U31A 1QW9A 3FXYA 4ZXOA 2GFTA 2WBKA 3UCQA 2W91A 2PBOA 1E43A 4E2OA 4WIWA 3ZR5A 4WJXA 4GQQA 2VUYA 2J74A 4AY1A 1Q6GA 3AIWA 2VZSA 1CXEA 4NI3A 3SCNA 3ZR6A 3M07A 3ARPA 4QP0A 4DUVA 1DTUA 4ACZB 2NSXA 2ZUTA 4IUGA 1JYVA 3K4DA 3F4VA 3T2QA 2YBUA 1PEZA 4PEEA 2X8RA 1KBBA 3TONA 3W81A 3A6OA 3WKZA 5I2UA 5I6SA 3VIIA 2BFGA 1UD6A 1W9DM 1SMDA 3IAQA 4H2CA 1E6PA 2V5DA 2VX4A 5EB8A 4BZYA 1UA7A 4TTGA 5FKYA 4DWSB 2WC7A 2Z1SA 4PMUA 4X9YA 2ZXDA 2XVKA 1XSKA 2YL9A 3VD3A 2DT2A 4ZENA 3SURA 1G9HA 5CSUA 2WZEA 4CD4A 1E72M 2VT0A 3WF2A 1GOOA 1VB9A 4PMVA 4UFIA 2O9TA 2ZWYA 4LGXA 1J18A 2X0YA 1CIUA 4FF5A 2J7DA 4DM2A 1JZ8A 4FLSA 1EIBA 4NF7A 5FOOA 4JFTA 2WMKA 1JFHA 4MAZA 3RMEA 3GH5A 4B9YA 1JZ5A 1J0ZA 3AHYA 3GH7A 3WUFA 4L4PA 3CHFA 3O6AA 3WUBA 4W8AA 1E6XM 1V0LA 5IHSA 5IFTA 1BTCA 3N12A 3GYCA 3SCRA 5ABHA 5I77A 2ZUNA 1JF5A 2D0FA 5KEZA 2ZUSA 2CKRA 3GXDA 3VIHA 2CIPA 5CPSA 1UWIA 5JBEA 1JIBA 1MXDA 3EMQA 3AMLA 3FHQA 1DWGM 2EPNA 1D2KA 4MNJA 3BGAA 3ZJ7A 1PZ3A 1VENA 1IV8A 3CTTA 3OLIA 2HISA 4HOZA 2G4FA 1RH9A 1EQCA 5FD0A 1OT1A 3IANA 4UR9A 3UESA 1B1YA 2IXVA 3AXIA 3MUZ1 4UNIA 1OINA 2WAGA 3CIVA 3VGBA 1VEMA 4QFUA 4DUWA 3UR8A 2D0GA 4AEEA 1LLOA 4AZ6A 1E0XA 1XSIA 5D4YA 1JXKA 3A47A 3THDA 3VM7A 2J79A 1V0KA 4OOUA 2J77A 4W84A 1OGGA 4TUFA 4ACZA 4PTWA 4UOQA 4ZE5A 1BYCA 5FCZA 3VKKA 4PSRA 3TA9A 4D6GA 1HIZA 3WDHA 2E4TA 3GTNA 1HP4A 5ABFA 3AZRA 2WC3A 4E8CA 5A6LA 3EBVA 3PHAA 4DWSC 4B16A 2CKSA 4N42A 2ESCA 1VJSA 3CZLA 3U7VA 4DWSD 1JZ2A 1I1XA 4PTXA 4CN1A 4NRRA 3PBGA 5CZKA 3E1F1 1V3HA 4LYPA 2CBIA 4D6DA 2GDVA 2DSZA 1E70M 4CGTA 1TFVA 2WZIA 3NDZA 2XVPA 1DWIM 3T0BA 3AS1A 2DSUA 3OA5A 1LWHA 3K4AA 1FOBA 1KQZA 1SFSA 4H7VA 2G8ZA 1GQLA 3AIEA 3IJ7A 5BWFA 4NRSA 4AZGA 4F9JA 1JDCA 1NOFA 2CESA 3EMZA 2VNCA 5BRPA 4P8VA 1H1NA 1E6QM 3S6TA 1TUXA 2EO7A 9CGTA 4Z2KA 4R5EA 4HA4A 4UCFA 4YHEA 4KH2A 4PMXA 1LL4A 4ATWA 2VX6A 1H4PA 5BXSA 3K1DA 1WP6A 2XG9A 1OGSA 1CXFA 2JF7A 3W24A 4OIFA 4QLJA 3MS8A 5E9AA 2FGLA 3OBAA 3WNPA 1J0KA 3SUWA 1E6NA 3IJ8A 4D1IA 3BAXA 1UYQA 1OM0A 3AIRA 3WF4A 4XZBA 2BXYA 1S46A 2Y8KA 3VO0A 4GXPA 3MV11 5I79A 4CD5A 1CECA 4MDPA 1M7XA 4MJ4A 1W9UA 3CUFA 3PN8A 4OOZA 4UTFA 3S2CA 3LPFA 5BXPA 4JHOA 3WD0A 1NOUA 3LPGA 4JFUA 5D9OA 5DT7A 4PUDA 1QNRA 4PMQA 3MO4A 3AZSA 3WDQA 1J0JA 1JZ7A 1C91A 1EO7A 3FN9A 4LYRA 2C0HA 4RE3A 3SCQA 2G41A 1E4NA 2VRKA 2VQUA 3VX0A 1J0IA 3ZT5A 3VIGA 1KB3A 4ZFMA 2ZOXA 3WUEA 3FHAA 1RP9A 1UR4A 1AMYA 1CWYA 3PZVA 1WZMA 1K9TA 1UOKA 4W7UA 2WBGA 3W4RA 1UR0A 4XX6A 3L4ZA 4B3KA 1XHGA 1EGZA 1EDGA 2XUCA 1Q6CA 3OG2A 1M01A 2JEQA 3AI0A 1KFWA 4JFVA 1RPKA 5DEZA 2DDXA 4IM4A 4CU8A 4Y7EA 3VMPA 2XTKA 3VD7A 4J7RA 3KZSA 1ISVA 2DH2A 1C8QA 2XJ7A 5CSYA 5CXPA 4GPNA 3UERA 3A4AA 3ZQ9A 3ZOAA 3ARQA 4OJYA 4W88A 1ITCA 1Q6FA 1QI2A 3WFZA 1H11A 1QBAA 4V27A 5C70A 3EYPA 1JZ4A 2E9LA 3L4WA 4TXEA 3N1AA 4CKQA 1NWRA 4M82A 1W1TA 3VVGA 1XCXA 2DH3A 4UZSA 4CU7A 4JZ5A 4CCEA 2E0PA 3ARSA 1GOKA 4KWUA 1MQPA 1DWFM 2ZUUA 4D6FA 1KQYA 2Y24A 1AVAA 1D7FA 5BRQA 2G3NA 4ZE4A 3GH4A 3VX1A 5HBFA 5GNYA 4PCTA 4GZIA 1D3CA 3IJ9A 1ZBCA 4OBRA 3U5YA 3QOKA 3BXWA 2IUZA 2XFFA 3CMJA 1U33A 2W62A 1MVYA 2J4GA 3WMSA 1C92A 1K9DA 5A6KA 1JI1A 2BV9A 1QHOA 2DEPA 3K8MA 1UQYA 4HOWA 3HN3A 1HKIA 4UOZA 4X0NA 1G94A 1CGWA 1LL7A 4AZ5A 4U33A 3WUGA 1TVPA 2OWXA 5GNXA 2VJXA 3WQ5A 3K46A 2CNCA 1JNDA 2JIWA 1JD7A 2DPEA 2ZE0A 3OZPA 2YLAA 4P7LA 1JYNA 3PZTA 2PWEA 1XRVA 1X6NA 2ZXQA 2ZXBA 3SIMA 8CGTA 2GJXA 4JKMA 4PMNA 1MW1A 4PBGA 3KL3A 5AC4A 5JBFA 1JD9A 4NZCA 2GK1B 2J75A 1QW8A 2W92A 7TAAA 5E6YA 4AISA 3WD2A 3BC9A 4FK9A 5LYRA 2VRQA 5E09A 1UH2A 3VDHA 3CUGA 1BF2A 3CH9A 5A6MA 3AHXA 1LG2A 2VX7A 3WBEA 1XH0A 1OGBA 2WSPA 3U7BA 1E6SM 4AIOA 3RDKA 1GVYA 2E40A 4W5UA 1W3LA 2V5CA 2WVTA 2FH8A 3CZ8A 5D9MA 1J9YA 4GO9A 2DIEA 3ZSTA 5HDRA 1ZBVA 2VR4A 4EK7A 1BVNP 4TX6A 3AIQA 2RGLA 4J28A 4AWEA 3F5KA 3DYOA 1FFQA 5A95A 3MKKA 2Q8XA 2WVUA 1E1EA 1HKJA 3DYMA 4D6CA 2J62A 2BHZA 3WDRA 1QPKA 4GIAA 1GVIA 1U30A 1VIWA 1E40A 3ZT6A 1UWUA 1OSEA 2DT0A 1B3VA 3ZM8A 5CGTA 3PZQA 1K6AA 2PWHA 1A3HA 4W7VA 1GJUA 2J7BA 5CPTA 2GJPA 3WF0A 5A6JA 4MB4A 1RP8A 5E70A 1UQZA 1W9VA 7A3HA 4PSPA 2X05A 1UWRA 4U2YA 1CXIA 1OD8A 1XYZA 5A6BA 2WXDM 5C71A 3KL5A 5D9NA 1B90A 2DSKA 4AYSA 2O9RA 1E3XA 3CUJA 4F8XA 4TVUA 2VZVA 1NWTA 5JIWA 2W5FA 2J7FA 4P7OA 4UQBA 3G6LA 1WB0A 2XWEA 3TTOA 1PX3A 3U57A 4C7FA 2ZX8A 3MUAA 3TTQA 1CNVA 3NSXA 2RGMA 3ZO9A 1LL6A 3T2OA 2VZTA 1E4LA 4JCLA 4Q7NA 4MNMA 1M53A 5ABEA 1JI2A 5GQBA 1FH8A 5DT5A 2TAAA 3WH6A 3W38A 3AS3A 2DSVA 1VBRA 1PAMA 2C7FA 1UD2A 3F5JA 1FHLA 4MNKA 2AAAA 4AZ7A 2J47A 1QHZA 2E9BA 1FP9A 3CZGA 3WNOA 2VZUA 3D3AA 2QPSA 2VTFA 3VTRA 1CGTA 3GXFA 4A3HA 2B31A 3CZJA 3J7HA 3DECA 1ISZA 4JAWA 1J01A 3QHMA 1PIFA 5CGMA 3VDBA 4OZOA 1CTNA 1DHKA 1J12A 1EDTA 5IHRA 1GHRA 1MW0A 1JZ6A 2V3EA 3A4WA 3VMOA 4P7QA 4FLQA 2CXGA 4AD4A 1E9LA 4J3WA 3HMCA 3POCA 5A8OA 2JIEA 2CHOA 2BY2A 4J3TA 3BCFA 5EBAA 4BQ3A 2GSJA 3MMUA 1Q6DA 1OWQA 2OYLA 1FHDA 1BPLB 3ZJKA 1NARA 1JNEA 1JDAA 2XVLA 3UR7A 1CLXA 3AFBA 1KWKA 4P8XA 1UHVA 1F4AA 2BY1A 1R87A 2UY5A 4W93A 1WNOA 5A8MA 2WC4A 1UD5A 5HPCA 3N18A 3VUPA 3VGFA 2OYKA 1ISWA 4KGLA 2F2HA 1US2A 5AYBA 4HMCA 3OZOA 1BYBA 1WZAA 1NWUA 3AMKA 3QOMA 1GORA 4HZ6A 3CBWA 2YJQA 3WNLA 4RE4A 4M80A 1BQCA 2A3AA 1EHAA 1EOKA 5FIPA 2Z1KA 4H8HA 2WB5A 3AMCA 2XM2A 4AZCB 1HJXA 4GINA 4BF7A 3T0AA 1B31A 1GQIA 1GOIA 1LQ0A 4PN2A 2WMIB 5ECUA 1B2YA 4CVWA 4B9ZA 1W3JA 2X0HA 2OSYA 3GNOA 3M46A 4M81A 1W9PA 1C3FA 2WVVB 1M04A 4V2XA 1KCKA 1UKTA 1H0GA 3EDEA 3SCPA 1JDDA 1HJQA 1B3WA 5KZ6A 1A47A 1UA3A 4U5IA 3VGEA 1CYGA 3VPLA 4M8UA 1E5JA 4J3SA 1MQQA 6A3HA 3WEOA 3IAPA 3EDKA 3WF1A 2DT1A 2XPKA 1PBGA 5HNNA 5EFDA 3TOPA 1UZ1A 2J7HA 1NP2A 3RIKA 1OT2A 2V3GA 2VRJA 3N17A 4TVDA 2D2OA 5IFPA 1WZLA 1VFOA 5CJ5A 4LXFA 3SCSA 3AS2A 3W28A 1BHGA 1OIFA 2Y5EA 4S3KA 4D6EA 3O9NA 1KXQA 4EKJA 3BLKA 1OCQA 2XVNA 2EXOA 4M1RA 4K68A 4NSBA 1DWAM 2WHLA 3CZEA 1W32A 3FAWA 4BA0A 3AHVA 2YLLA 3GDBA 2OSXA 2WMJA 3ARXA 2W4XA 3W53A 3B8SA 1FH9A 2EPKX 3JUGA 2D20A 3AXHA 2JEPA 4F79A 4FLOA 3CHEA 1KBKA 4D71A 2NT0A 2CBJA 3D5HA 4AD3A 1P6WA 3T0DA 3UEQA 1BLIA 2QHAA 2UY4A 4Z2LA 3L2MA 2D24A 1WZKA 3CO4A 4W8LA 4OKDA 1KGUA 4WLCA 2UWFA 2ZXAA 3GZAA 4B15A 2EPMX 3VILA 1VF8A 8A3HA 1C8XA 3MV01 2VVNA 4MAVA 2CETA 3WDJA 3MU7A 3ARRA 1CXLA 1HNYA 2GK1A 3L4YA 2CEQA 3B9AA 3AYRA 3CMGA 3AXXA 2X1IA 1AQ0A 4GI9A 1NWSA 4R27A 1W9BM 2CHNA 5ABGA 2J8FA 4BS0A 1XCWA 7CGTA 3RJYA 3WD4A 2J7EA 3OGSA 2YA2A 1V03A 4H41A 2OWCA 1J0HA 1XYFA 3PZ9A 2JFEX 5CLTA 2V38A 3FAXA 4U2ZA 2W67A 3WL0A 2J8GA 2FHBA 1X1NA 2QF8A 3GNPA 1ZB5A 3DC0A 1ISYA 4KMQA 4M29A 4MB3A 1B3XA 2VX5A 3AJ7A 4ATLA 1E55A 1H49A 2PI6A 4P7NA 2QMJA 1EHNA 3WMBA 4WKAA 4AZBA 4YHGA 2E3ZA 1JL8A 2WMIA 4MTVA 5A2AA 1ECEA 3IK2A 1FA2A 3W6MA 1RD6A 1TMQA 2XWDA 4UQAA 1GZJA 2GJRA 2CITA 3VGGA 4HA1A 1JG9A 1TCMA 2XIIA 5I24A 3PTQA 3N11A 1VFFA 3OLDA 2W63A 3PZOA 3BAIA 4CCDA 3RJXA 1Y7VA 4AIEA 2WVSA 1W1YA 3WL1A 1V3LA 4HU8A 2BY0A 3LPPA 4KGJA 3K8KA 1JF6A 1WPCA 1MYRA 2BVDA 1H5VA 1JYXA 5A1AA 2WMHA 5A94A 1VAHA 1JXJA 2ZX7A 4DUXA 5BXRA 1MW3A 1H0IA 5A69A 2WNWA 5CQ1A 2D22A 5CG0A 1CXKA 4WKHA 1DEDA 3L2LA 1H2JA 1W2PA 4LPCA 1B0IA 3OGVA 4UFKA 1V3IA 4MPKA 2EEXA 3II1A 3O2LA 5D8WA 3CHDA 3ARYA 3NYDA 1MWOA 4UQEA 1O6IA 1PPIA 4PUEA 1UG6A 3SUUA 3M7SA 1KCLA 1JAKA 1EQPA 4JFWA 1V6XA 1WAWA 1AQHA 2ZWZA 3VIJA 1E4MM 1V6WA 1UD3A 5A8NA 1W3HA 2J78A 4GZEA 1HF6A 5M17A 4JCMA 3W26A 3VD9A 1V6YA 2G3IA 3TTSA 1FP8A 2O9PA 5BCAA 1GW1A 3WN6A 1G0CA 5ABFB 2J7CA 1TE1A 4GO8A 4GQRA 5TD4A 1XD0A 2UY3A 3BMVA 5I78A 4URIA 4AMCA 5A3HA 4MNLA 1HJUA 3WQ6A 4GI6A 1CDGA 4CD7A 1HJWA 1MW2A 1W9XA 2A3EA 2O9OA 3NDYA 4W8BA 1V6VA 5DMYA 1I75A 3WQVA 4XB3A 3WQ8A 1HVQA 1MXGA 1QNSA 2VOTA 5IDIA 3T09A 3VD5A 1V3KA 1XC6A 1HJVA 1UUQA 4AD2A 2A3CA 4PMZA 2YL6A 2PF0A 3W0KA 4Q22A 2VO5A 1PZ2A 2WSKA 1GQKA 3SUVA 1B3YA 5E0CA 3CUIA 1R85A 1R86A 2VQTA 2WANA 2QV4A 2EBNA 3VOCA 2EQDA 1QHPA 2BY3A 3L4XA 2FH6A 4KRUA 3ZT7A 1HX0A 4QDMA 1FH7A 1TA3A 1NP0A 4JL2A 3EMCA 3ALFA 1C93A 4OUEA 2DSWA 3MMWA 1ODZA 2D23A 3BAJA 4UFHA 4OBSA 3AROA 4MB5A 4HOXA 4W5ZA 3QHNA 4MJ2A 1ZJBA 2PC8A 2ZX6A 2PB1A 3WNMA 1WO2A 2E8ZA 3W29A 1HVXA 1SR0A 4PCSA 1Q6EA 3PZIA 1B30A 5F7UA 3KE0A 3TTYA 1XGZA 2D0HA 1H3GA 1CGYA 1M03A 2ZX9A 4D6IA 1CXHA 1W91A 4XZWA 2BNJA 3WENA 4JL1A 2QPUA 1QNQA 2CBUA 4LQ1A 3WMCA 4UQDA 3MANA 4YPJA 1VJZA 3UG4A 6TAAA 2VMFA 2V3FA 2XGBA 3BMWA 1C7SA 3BH4A 4CD8A 1ESWA 1Q4NX 1XV8A 1EXPA 4CN6A 4EANA 2PWDA 1IT0A 1V3MA 3RCNA 3PZNA 2AMGA 3ZSSA 3VMNA 4H8VA 1KXTA 1O7AA 4HZ7A 1VEPA 1PX4A 1XD1A 2YDQA 1V6UA 1NH6A 1MFVA 3RO8A 4D6HA 5LA0A 2VR5A 4CUCA 2YDSA 1XSJA 2VURA 1WDRA 4A4AA 3AISA 3TP4A 4J27A 3SUSA 1BFNA 1GOWA 1GQJA 3G6MA 3GM8A 1HKMA 2J7GA 4CU6A 2YIHA 1JAEA 3ZJ6A 3CLWA 3N04A 3WSUA 2YBTA 3AYSA 2BVYA 1MFUA 5D8ZA 4PYSA 3ZIZA 1BG4A 2XM1A 1US3A 1UWSA 2YDRA 2VC9A 4H8UA 1UKSA 3MUY1 2CBVA 2XYLA 1TG7A 4UFJA 3GNRA 2W66A 1E15A 4S3JA 3VD4A 2FGZA 4RL3A 2XSAA 1VBUA 2IXUA 1XH2A 1V0MA 4PMRA 4LYQA 2WLYA 3BCDA 3WELA 2WK2A 4HU0A 1IZJA 1R7AA 3I3BA 2EPLX 5HPOA 3GXIA 3WNNA 2QLYA 3M6DA 3VGDA 3WDIA 2G3MA 3F5LA 1B9ZA 1EOMA 4EAMA 4PRWA 4GZJA 3PZUA 2CPUA 1VFUA 1UR8A 2WCGA 2CCRA 2XVGA 3PTMA 3WF3A 5JIPA 3MMDA 5HXMA 2EPOA 1UKOA 4W87A 2WHKA 5M03A 4CVUA 2VVSA 3CZKA 3BAYA 1EO5A 5GNZA 1SMAA 1VRXA 2DT3A 3EDJA 1QI5A 1OD0A 4MDOA 3VINA 1W3KA 3THCA 5GPRA 5CLWA 4B3LA 4P8UA 2ZUVA 3FNDA 4UQ9A 2NT1A 2Y8VA 1NM9A 5A6SA 5JUVA 1ODUA 2WYSA 2XHYA 3L4TA 1CZ1A 3ARUA 3NSMA 4D72A 1EA9C 5C8BB 4XUYA 4MADA 3EDDA 2X09A 1C7TA 1E71M 2YL8A 3VDAA 4Z2IA 1XH1A 2XFYA 1CENA 1YHTA 1L0PA 1MQRA 3I3EA 4PMYA 5A2CA 3BAWA 2A3HA 1VEOA 2BHYA 3AIVA 1BAGA 2GDUA 1E1FA 1EDQA 1CLVA 1LJYA 2JF6A 2WWCA 3VM5A 1J0YA 4WSJA 3UG3A 3WEMA 1UWQA 4Z2JA 1UWTA 4J3XA 3ARVA 2MANA 5A6BD 4ZEPA 5I3DA 5I0DA 5BXTA 1SYTA 1E3ZA 2WLZA 2YOCA 4Z2HA 2AOSA 3WY1A 3CHCA 4AW7A 2BS9A 1UR2A 5LA2A 5BROA 1K9FA 3WH9A 1Z32X 3AOFA 1BG9A 1E6RA 4QLKA 3WQWA 2ZX5A 2GVYA 2D1ZA 4BQ2A 3VNZA 3BSHA 4MB1A 3RILA 4J3VA 2VCBA 1V02A 1KR0A 2PBGA 4IPNB 1KXHA 3RM9A 1LG1A 4WSKA 2WMGA 3KEHA 4PTMA 4AC1X 4BCEA 1X6LA 5IXEA 1QOXA 3WDPP 4HMDA 1ITXA 2XGIA 3NJ3A 3FW6A 1HJSA 3VNYA 3GBEA 1EH9A 4AXNA 4EE9A 2F8QA 3N13A 2VCAA 1W2VA 1HL9A 3L4VA 3N15A 1FFRA 3DYPA 4WF7A 5A8QA 1HXJA 3BAKA 3VIOA 1R8LA 1L8NA 4UOJA 2OSWA 3NUKA 2WW5A 4HPGA 3T2PA 1QVBA 1UR1A 2FHFA 2JE8A 4CD6A 4TVCA 1CGVA 3WH5A 2J25A 3I3DA 2XFRA 2D3NA 5DF0A 3CUHA 5E6ZA 1CBGA 3A4XA 2WKGA 2YL5A 3WD3A 3AHTA 1CPUA 5JH8A 2DGAA 3WFLA 1DWJM 4AEFA 1N82A 4V28A 3OGRA 4HA3A 3PZMA 5CPQA 3U5UA 3ZMRA 3HU7A 1LWJA 4J3UA 4PTVA 1V0NA 4H04A 1PIGA 2ZUMA 3ARWA 2F61A 1WCGA 1JGIA 1E4IA 4HPHA 3CGTA 2WVVA 4TX8A 4E8DA 1W1PA 4ML4A 2Y4SA 2XIBA 5AY7A 4GI8A 1BSIA 1WE5A 4DWSA 1WDSA 3HJEA 1V08A 1TVNA 1QBBA 2D3LA 3AMDA 3WEZA 4AD1A 3T08A 1HN1A 4TOQA 1GONA 3ZJ8A 4FMVA 1QI3A 2WCAA 3AS0A 1TZ7A 2HVMA 5JBDA 1KR1A 5A2BA 3QR3A 1H09A 3APGA 3GXMA 5EMYA 4UQCA 1ZJAA 2OYMA 2Y2WA 3WH7A 1AQMA 3ECQA 2CYGA 4C7DA 2CERA 1KGWA 4BQ5A 1CEOA 4UZUA 3NCOA 1GJWA
chains in the Genus database with same CATH superfamily
3ONBA 1ZUAX 3T07A 3MJYA 4PEKA 1W5OA 2NXGA 1BYAA 2FZNA 4RLIA 2UY2A 4JTQA 2WHMA 3PR2A 4G8TA 4JFIA 3VIPA 4YVXA 1UH4A 5MKGB 3V0TA 4LAWA 1V5XA 3NIYA 1M3UA 2ZQVA 4AVOA 4LU0A 2E6YA 2PDLA 4MZYA 1KXVA 2PP0A 1GUVA 4C90A 4O0QA 3VDCA 4XVDA 1SJCA 4B3ZA 4N9CA 2BOGX 5D32A 3OLEA 4DJDA 3CLMA 2PWGA 1O1HA 2E28A 3SGGA 1ZCNA 3P93A 3H7VA 4XAYA 1VFHA 4A29A 4L1XA 1QASA 1VFMA 4MJMA 4LY4A 4S3AA 2QPXA 2VDGA 4Z17A 1DORA 3KL0A 2YYUA 4TX9A 1OFAA 5I23A 3TYEA 4RCXA 1X38A 5CAHA 4WK9A 1YNQA 2Z2UA 5E0FA 3QPZA 4N0RA 4CQAA 4TTUA 1VS1A 1I1WA 1QNPA 4DHGA 1JPKA 1XCFA 2E8YA 3BLPX 4S3CA 2YA0A 4E4PA 1OIMA 3OHIA 4DNHA 3FJNA 2VL4A 4QDPA 1TTPA 5D9PA 2PDBA 2ZIDA 1OC5A 3LBMA 4NX0A 5F1VA 1BYDA 1RHCA 1I0DA 4MSSA 3CV2A 4WEVX 2DIJA 4IISA 3ME3A 4LUSB 1V3JA 3N6HA 1EWEA 1P5BA 4MYXA 1CGUA 5C9RA 3C2VA 3C2OA 2R8WA 2H90A 2FLIA 3QN3A 2FVKA 3TIMA 5AC5A 3LCFA 5A6AA 4GJIA 2WKLA 4NQ1A 3P82A 2BWGA 2NVAA 3IACA 5KMYA 1UKPA 4V1YA 1H7XA 3VZYA 4W89A 3KWXA 2PDPA 3SEPA 1QNOA 1XFCA 4QLLA 1ZLPA 1K3UA 6REQA 2PWFA 4JKLA 4K3ZA 1QRQA 3LY0A 2WMFA 5XINA 2G3JA 1XIJA 2DW7A 1OG0A 4C1NA 3PJXA 3DOPA 2ZR6A 1BGAA 1ZNNA 1I8JA 4GA8A 5FJTA 4NNBA 1ITUA 4U10A 4D1JA 3PG9A 4C1LA 4IQ2A 3T55A 3OIHA 4XUGA 2WSRA 4MG4A 3SECA 5BNKA 3GG8A 4OU1A 4K1WA 3OLGA 1B6CA 1OCJA 3NSNA 3O5DA 3E96A 2FJKA 1K9EA 3R13A 2A1YA 1Q2SA 1FKFA 4HKPA 2DY3A 2VZOA 4A6GA 4DVOA 1HGWA 1T99A 4L4OA 3HQPA 1V02E 4S39A 2QCLA 4G7FA 3W1XA 4Q32A 1CX9A 1IHIA 2NWSA 5K9CA 2C0AA 3MTWA 3FEMA 1QW9A 3FXYA 4ZXOA 2WBKA 2XINA 3RCMA 1GQNA 2VEMA 1M5WA 4WIWA 3BG5A 3ZR5A 1YNYA 3A5VA 4EVZA 2WOQA 3KBWA 2X30A 1Q6GA 1SPQA 4AG0A 3W7RA 3H53A 3I6EA 4NI3A 3SCNA 5HWMA 3ZR6A 3CV6A 4DUVA 4HHPA 1DTUA 4ACZB 1Q8AA 2NSXA 2ZUTA 5K4XA 1JYVA 1GK8A 3K4DA 3F4VA 3T2QA 1PEZA 4PEEA 3NOYA 4DZ3A 4UNKA 1XBZA 3A6OA 3B8WA 3WKZA 5I2UA 1B57A 3NR0A 3LOTA 1J93A 3DFNA 3WQOA 2BFGA 1IF2A 1EP2A 3CAWA 5HTGA 4H8NA 2V5DA 3P74A 4L7ZA 5I02A 4BZYA 4E8GA 3BW2A 4ENLA 5FKYA 2Z1SA 3N2TA 2XVKA 3JRKA 1IEWA 4CNOA 2YL9A 1XKJA 3SURA 3NZ1A 4CD4A 3PBUA 1GOOA 1EEPA 2O9TA 4FF5A 3NA8A 5LKYA 2ALDA 3NZQA 1TJ2A 4JEQA 1EIBA 2C1IA 4YTRA 5HA7A 2C1GA 1JZ5A 4GIRA 4JTEA 4L61A 3RAOA 1D7KA 4L4PA 3TC6A 2BDQA 5AYZA 1GYNA 4KEUA 1V0LA 5IHSA 5IFTA 4F2BA 3GYCA 4GE8A 3KBMA 5EMUA 2ZUNA 2KZHA 1R47A 2N87A 2Y7GA 3GXDA 3UQAA 2VYOA 3R5EA 3W07A 3NL3A 4JYSA 5CPSA 3KDOA 1UWIA 3EMQA 2LGOA 3AMLA 1E9IA 1TPB1 3FHQA 1YW1A 3BK0A 1D2KA 3BGAA 3GXTA 2ITKA 3ZJ7A 1PZ3A 4LAXA 2HISA 3TMLA 4PBFA 2G4FA 2DZBA 4UR7A 3F2BA 1OT1A 3IANA 4IP4A 1B1YA 2NSOA 2IXVA 4HJWA 2OU4A 4GC4A 4UNIA 4C60A 2QCNA 3VGBA 2J27A 5HUAA 3WQCA 3UR8A 3UXIA 4AEEA 4K38A 4AZ6A 2V81A 4OUIA 4ALDA 4JNZA 2ATMA 4NZFA 2J77A 1RCQA 2GJNA 4PSRA 4ORIA 5ABFA 4C6FA 3B06A 2WC3A 5A6LA 2YGYA 4N42A 3CZLA 3PFRA 1RBLA 3OG3A 4DWSD 1JZ2A 3QXBA 3BUVA 5F2MA 4XISA 4CN1A 5CZKA 3E1F1 1XLDA 2OQLA 3NDZA 3MDUA 5HUPA 3PBWA 3YPIA 4B5NA 3AS1A 3VYLA 3OA5A 1REQB 1YBQB 3VAWA 1YTKA 3AIEA 3BSMA 3OZMA 1XLAA 4MFDA 5HKGA 1YXDA 1NOFA 4LFYA 1GVRA 4KCWA 2X1RA 3CQKA 3EMZA 3T78A 5BRPA 1E51A 4O11A 1OYAA 3O06A 3S6TA 1TUXA 4Z2KA 2R6OA 5BOOA 3VC5A 4S23A 5AHIA 2Z1BA 4WXYA 3RFWA 4ATWA 3R43A 5BXSA 1ONRA 4OGZA 4C6JA 2K8IA 1OGSA 3H54A 3MSRA 1VC4A 2BOEX 3MS8A 5E9AA 2YFNA 3P0XA 3OBAA 3BV7A 4UBPC 3BAXA 5EBUA 2BXYA 2Y8KA 5FF3A 1W26A 3A64A 1AFSA 2Q3OA 3S6OA 3M9YA 4RZ4A 3OYXA 2ZTJA 5BXPA 4JHOA 2V63A 3ELFA 1NOUA 5D9OA 3MKVA 5REQA 3S5NA 3MO4A 4DPPA 1XLJA 3GRIA 2FJUB 1OFQA 1JZ7A 4HNNA 1SO6A 2C0HA 1Z41A 1Z89A 4LW7A 2G41A 5EL1A 2HK1A 1FHUA 4H7ZA 3SSJA 1KM1A 2XIMA 3VX0A 3GPKA 2Z6IA 3UU0A 3ZT5A 1EBGA 1AMYA 3PZVA 4LUSA 4ZPTR 1WZMA 2ZYFA 1EC7A 2ZVIA 1D8CA 3I6TA 3L4ZA 1PWLA 1XGEA 1TTQA 1EGZA 2XUCA 4QM1A 1RBAA 1KFWA 1DE5A 1X1OA 1FKIA 4JFVA 4O57A 1RPKA 2AQWA 2DDXA 4CU8A 4HYVA 2XTKA 3NM3A 3P2VA 4US6A 5DITA 2A21A 1W37A 4O13A 4GPNA 1O1ZA 1UZDA 3N6QA 2NZLA 5H91A 3NYZA 1QI2A 1ICQA 2A4AA 1QBAA 1H7RA 2VELA 3TCEA 4GABA 1N8IA 2E9LA 4TXEA 1D7IA 2P88A 4CKQA 3EEGA 2AMXA 3FDKA 2DH3A 2A2IA 4E6MA 4UZSA 2ZZ6A 1MQPA 3PF3A 1KQYA 4GUGA 1AVAA 1PSCA 1FWTA 3RX3A 1OCBA 3GH4A 5C0QA 5GNYA 4PCTA 4F2UA 1D3CA 2P50A 1ZBCA 4HB7A 3O8AA 2XFFA 1U33A 2W62A 1MVYA 2J4GA 1K9DA 3EOLA 1QHOA 2DEPA 1UQYA 4HOWA 1QFEA 3DU0A 1NVMA 1AJZA 4UOZA 4X0NA 1G94A 5DRCA 4G50A 1CGWA 1LL7A 3A24A 2PLMA 2P3ZA 2OWXA 2EGZA 4RDWA 4IX2A 4MLJA 2CNCA 3K46A 1JD7A 2DPEA 3O6YX 2ZE0A 2ZZ5A 5DN1A 2YLAA 1R2SA 4IX0A 1R3WA 4P7LA 3S47A 2CLHA 3O6CA 1L6YA 3PZTA 1EQ3A 3V3WA 3H55A 1T8XA 2GJXA 4JKMA 1FCUA 1MW1A 3KL3A 5AC4A 2ZBTA 1QW8A 3KM8A 4NVTA 2FFCA 5E6YA 4HTBA 4LEQA 1H63A 4EPKA 3V4BA 1UH2A 5D03A 3SQSA 3W7IA 2PU0A 3AHXA 1RLDA 3JZUA 4IJRA 2EG7A 1OGBA 4JBRA 3SY5A 1E6SM 2PDHA 2IKGA 1RALA 4W5UA 3STPA 2J13A 3FK4A 1IGWA 4IPPA 4KFNA 5D9MA 4NJJA 1EJTC 4CLMA 3KTXA 4K8GA 3UBPC 4YNGA 2OT0A 1OQFA 5C5YA 3F5KA 4DRKA 3DYOA 3EXTA 4MGGA 2XZ9A 1T96A 2Q8XA 3P8JA 4DXXA 2WVUA 2YDAA 2PPNA 4S2CA 4AWSA 2J62A 1EJXC 2BHZA 4R34A 4GIAA 4YVVA 5I00A 1Q7MA 4MOZA 1UWUA 1OSEA 3UWVA 2DT0A 3KTSA 2DUXA 3C5QA 3BG3A 3PZQA 2JBMA 1EJWC 2C16A 2CZVA 2J7BA 2A7NA 1PKYA 4TW8A 2GJPA 1UC4A 2AGTA 1THFD 3SRKA 4PRRA 2G0WA 3M0HA 2ACRA 3GR8A 1W9VA 7A3HA 1FAPA 2C19A 4U2YA 1OD8A 4MMWA 2WXDM 5D9NA 4MWAC 4E38A 1WAUA 4F8XA 5CPMA 2QJJA 4Y9NA 1K7EA 3WK0A 4KEZA 1LLZA 4GQBA 2Z24A 3D47A 1PX3A 1QO5A 3Q2DA 3U57A 2PV3A 2ZX8A 3UWQA 3NSXA 8XIMA 4WX2A 2KAUC 1GW9A 2PEVA 4D9PA 1WKFA 3CGMA 1DBTA 3P61A 1JI2A 4Q7BA 1UC5A 3C61A 3AS3A 1T6MA 2E1WA 3B3DA 1YPXA 3F5JA 2BTMA 2J47A 1QHZA 4WY0B 2E9BA 3WK1A 3CZGA 2LKNA 1Q8JA 4WCJA 3WBXA 2PDMA 3J7HA 5TIMA 3DECA 3C3NA 3DAQA 1PIFA 3VDBA 4Q8QA 1YDVA 3TK7A 1EDTA 5IHRA 1GHRA 1HUVA 4AF0B 3ABQA 3A4WA 2RHGA 5FF4A 4NZJA 2BMBA 5A8OA 4MJZA 2AKZA 5EBAA 1KRAC 3MMUA 1Q6DA 1OWQA 3G2GA 2Z26A 1FHDA 3E0LA 3ZJKA 3IIXA 1JNEA 3UR7A 4LNCA 3KXQA 1KWKA 5FSEC 4QSHA 1XW8A 2WC4A 3O5FA 1UD5A 3VNJA 3KABA 5C9UA 3PWGA 3IRDA 1UJQA 3TFCA 1B3OA 1J6PA 3HJZA 3M5XA 3HQOA 1W17A 3ZWSA 5LIYX 3QMRA 2C15A 1GORA 2C3ZA 2OQHA 2PDGA 1ZQ5A 3B05A 2F84A 4M80A 1F6PA 2DJXA 3W2KA 3W1PA 1B54A 2E6FA 4ZMGA 1RCXB 3T0AA 1GOIA 2OX4A 1LQ0A 1ZPTA 1LROA 2UV8G 4DLFA 1FWRA 1B2YA 4GMEA 4CVWA 3EPMA 1ADOA 1DIEA 1YYAA 1W3JA 1H7PA 4GNJA 1W9PA 1C3FA 3G1HA 1KCKA 1UKTA 1V93A 5HW6A 3DCPA 4O8RA 3SCPA 4KWWA 3DHFA 4U5IA 2HDJA 4DO5A 1O95A 5LIUX 2MNTA 4JICA 4MFEA 2DVXA 1JNTA 4TU1A 4KR0B 4J3SA 1YLVA 4XZMX 3IAPA 3BMBA 3MP5A 3WF1A 3LX9A 2HXTA 2XPKA 1LLWA 3VUSA 1WQ5A 2PSNA 2WSQA 3ITGA 3GC4A 4NG3A 2O4MA 1OT2A 3SJNA 2I56A 5BRBA 1R5YA 4TVDA 4WHBA 1OX5A 1WZLA 1YE4A 2PBCA 4O1FA 1XRTA 4Y90A 4UTLA 3SCSA 3W28A 4Z1BA 4R7WA 4S3KA 4D6EA 1UUMA 3O9NA 5B7ZA 2XVNA 4Q8VA 2EXOA 4NSBA 3CZEA 4IL2A 3GDBA 2X1SA 1AH4A 3TLQA 2HBVA 1P7TB 3ARXA 1TV7A 3TTEA 1FH9A 3JUGA 4PR4A 2ZDSA 2D20A 4JTCA 3LGDA 4F79A 3CHEA 4D71A 3D5HA 3Q65A 1FRBA 3G8EA 3KHDA 1QOPA 1BLIA 4C6EA 1X8CA 3PBMA 5I3KA 1OC6A 2YW4A 3WYZA 2D24A 3B8VA 1RLCL 3TU9A 4UTKA 4C6PA 3V75A 3BOXA 4H4IA 4RZBA 2VVNA 4N02A 4MAVA 1FKSA 2CETA 1OF8A 1VIZA 4HK5A 3LXCA 1ZP4A 1EGMA 3L4YA 2CEQA 3W76A 1XBXA 3CMGA 3GR7A 3ICJA 3JXVA 1AQ0A 2Y62A 5AVNA 4F2TA 3KBNA 3W7JA 3I4KA 3ZZ1A 1QXLA 3VCRA 1V03A 2X1UA 4JR5A 3CV1A 1P0NA 3CGNA 5EMLA 1V7YA 1BWVA 4U2ZA 2YBVA 5K9DA 1VQTA 3VE7A 3FAPA 2J8GA 3UWUA 3AJXA 3WLSA 1PHWA 1G7VA 3FLUA 3FKKA 2H8XA 3GO2A 3DC0A 1R9ZA 1FHVA 5J04A 1TIMA 3OEXA 3BDKA 4ATLA 2DFAA 1TCOC 1U83A 1ZTVA 2PI6A 3AALA 3OU8A 2W27A 2E3ZA 5HQEA 2V2DA 1S5WA 2HPMA 1JL8A 2WMIA 1OX4B 5A2AA 2QCEA 4A35A 1C9DA 1Q6LA 5I3GA 2XWDA 5LZLA 1JG9A 4L65A 1BVWA 5I24A 3N11A 3SR7A 1IZCA 4ZOCA 1VFFA 4YU1A 5EMMA 4U85A 3M0KA 3G1DA 2W63A 4ERIA 4CCDA 4DJDD 3DBNA 3T44A 4OT7A 5CC7A 3OTRA 4HU8A 1NDZA 2BY0A 3GFXA 1WPCA 2QCDA 1LBLA 1KTBA 1LBMA 3WCZA 4DUXA 2NVDA 5A69A 2CLMA 5CQ1A 3MYOA 3R0UA 2Q09A 3U6WA 2WKJA 3VC6A 3D0CA 1XL9A 5JMUA 4UFKA 1A0DA 3URQA 1TKKA 2H8ZA 2BXVA 3ARYA 3NYDA 2FKPA 3QSRA 5EY5A 1O6IA 1PPIA 1KLYA 3SUUA 1EQPA 2ZWZA 1E4MM 1EF3A 3H4WA 1A4LA 3BICA 5A8NA 3TC7A 4J4OA 3TVAA 2Y85A 2FTYA 3M5YA 1B4KA 1XLKA 3C0LA 3W26A 2OEKA 1OHLA 3TTSA 1FP8A 1G0CA 5ABFB 3SFWA 4LBUA 5CZSA 4RZ6A 2V68A 4JQ2A 4KRZA 3BMVA 3LCLA 3F4NA 4MNLA 3GTHA 4F0KA 3G1XA 4U28A 3WQ6A 4CD7A 2ACUA 3H6OA 1DJWA 4D8AA 2XPBA 3NDOA 3CL6A 1MW2A 1W9XA 2ON3A 4YTSA 2A3EA 5AC6A 5I07A 1OY0A 3B8DA 3UQIA 3L21A 1QNSA 1Q6RA 5ECVA 3G0SA 1HJVA 3ITLA 4A05A 3W7PA 5XIAA 5DXYA 3HPSA 1Q63A 1VKFA 3V5FA 1FY6A 2HNEA 4IQDA 7ODCA 2HMCA 2QJIA 3SADA 1GEQA 7REQB 2OVLA 2L5HA 1GVSA 2WANA 5D33A 4K8EA 4UTJA 3NQBA 3F7JA 1LQAA 1QHPA 2BY3A 4ODPA 3LD5A 4J3ZA 3PJTA 1TO3A 1FWHC 1NF7A 1SM9A 1FH7A 1TA3A 1F40A 2JQXA 4JL2A 2WPBA 3ALFA 1ZSXA 1C93A 3QLDA 4WVXA 3MMWA 3P3BA 1ROTA 1D3GA 4R3UA 3BAJA 2YB1A 1YE6A 4OBSA 1XLBA 5C2GA 3SGUA 4MJ2A 3MHFA 2PB1A 3H4XA 1DIKA 1FWJC 1XIEA 1HVXA 2V5KA 4GKTA 3QVQA 1R2RA 3JW7A 4IQLA 1TWIA 1F7BA 5C6MA 4JTTA 4B5VA 3SFKA 1B30A 5REQB 2EHHA 1H3GA 1K8XA 4NYYA 2ZX9A 4D6IA 3MPGA 3CXOA 4H9ZA 4JL1A 3KDNA 1QNQA 3WMCA 4UR8A 2C6QA 4UQDA 3MANA 4YPJA 2FGBA 1TPUA 3UG4A 5LIKX 1W5NA 3RN6A 3KRUA 1PXGA 3DFPA 4UMAA 1DJYA 2YZRA 3IHZA 2QULA 2FZ8A 1TV3A 2X1TA 4JFJA 1DQWA 1A3XA 3PZNA 3ZSSA 1DJQA 1VEPA 1P7TA 2H6RA 2QF7A 2YB4A 3U3HA 1NH6A 4ML9A 4D6HA 2YDSA 3EWDA 1JR1A 1MUMA 3LB0A 1WDRA 3TP4A 3SUSA 3CAQA 4HBEA 4GCAA 3E5PA 2J7GA 1TPVA 2HWGA 1ZK6A 3DI1A 3UCDA 5J5RA 3LZ5A 4QNEA 2DZTA 4B5XA 3IGUA 2YBTA 3EOEA 3L67A 3OVRA 4ITZA 2GQ8A 1B9BA 1BG4A 2XM1A 1UWSA 3W74A 4G7EB 4QR6A 1TG7A 3BJTA 3GNRA 2W66A 3KAGA 1FBAA 4S3JA 2FGZA 5HMEA 4RL3A 2XSAA 3F4WA 4FR1A 2R14A 3KLKA 2Y1HA 2A6NA 3GWQA 4IMEA 2WLYA 3WLKX 4HU0A 1R7AA 3I3BA 2IQ0A 2EPLX 1IQ8A 4DUOA 3WNNA 2QLYA 5TF0A 2F2KA 4GX8A 3ANYA 4F40A 3KOZA 2G3MA 1X1ZA 4S2BA 4EAMA 4CEXC 3EAUA 4PRWA 2Y6ZA 3CIWA 4POCA 2Y5JA 3ABXA 3QMSA 3PZUA 2CPUA 4I5UA 5D2YA 2HSAA 3R10A 3UW6A 2XVGA 1H5YA 3PTMA 3MMDA 1ZAIA 2EPOA 3KRSA 4Q4SA 2JKPA 5H8MA 1WUFA 1CT5A 2VVSA 3L12A 1X7FA 2ZQ0A 3PNZA 5GNZA 1VRXA 4MDOA 2HQAA 3KOXA 1GWJA 5B80A 1XLLA 4B3LA 4U4MA 2P3EA 3KS6A 3UZXA 4FB7A 3U2OA 1RJPA 1T41A 3UI5A 1VHNA 4UQ9A 2ISFA 3H2OA 3QPEA 5A6SA 4IQCA 2O0TA 3L4TA 4FXRA 4D72A 3W00A 2C71A 5C8BB 5HNUA 2JKEA 3GKAA 4M7TA 3EY6A 4MADA 3KVLA 4IG2B 1BXBA 3QYSA 4GLEA 4Z2IA 2VEGA 1G67A 2XFYA 2BG5A 4Y6GA 3IRSA 1L0PA 1BEUA 4PMYA 5LGXA 3O5MA 5I3HA 3GD6A 3TR2A 1CLVA 2WWCA 3VM5A 4WSJA 1BXCA 3UG3A 5HJXA 2KGJA 1LDCA 4A8LA 4LS1A 4J3XA 4I8YA 2MANA 2GGJA 4ZEPA 3AC0A 1SYTA 1N55A 2E5CA 1ZENA 3RR1A 3CHCA 5BMXA 2BS9A 4HPJA 5CBBA 3QGAC 5LA2A 1K9FA 1Z32X 4XD6A 3IUIA 2QZRA 1E6RA 5IDZA 4Z1AA 4B4FA 3WQWA 4DROA 3WLHA 5I06A 1O66A 1Z48A 3WLTA 3M5VA 4J3VA 2CHRA 3LXAA 4NNCA 2PBGA 1KXHA 1IE7C 3RM9A 3TX9A 2XN0A 3SO7A 3G1AA 4PTMA 3WDPP 1QPQA 3FW6A 3GBEA 3ABRA 2LLEA 4IFKA 5AN7A 1F9CA 3LCIA 3OP2A 1QUMA 2Z2AA 2D9FA 4L9YA 4R7OA 5B7YA 5A8QA 3BAKA 3USZA 1FDJA 3IS4A 4TMCA 4FX6M 4UOJA 4DJFD 1TTIA 1OFRA 3O5JA 4C6LA 2KX9A 2RDUA 3BZJA 3QZAA 4CD6A 2VDHA 4TVCA 3I3DA 1VLWA 2D3NA 3TWAA 4FA3A 4LF2A 3LM7A 1A5LC 4JQ3A 1BSLA 1TIWA 2B7QA 3UZ5A 1CBGA 3UNDA 3A4XA 2CZ5A 3BMXA 3WD3A 2EG6A 2A5HA 5JH8A 3DFOA 3TNBA 1V4YA 1S5TA 4AEFA 2XP7A 2FTWA 2PS2A 4H01A 1L9WA 4E3VA 1UPMB 1KT1A 4J3UA 4AMAA 2UZ9A 2C1HA 2F61A 1WCGA 3IKDA 1J4RA 3H2CA 4REQB 3U2ZA 3CGTA 4TX8A 1EEXA 1YX1A 4XBSA 1G4TA 1DTNA 3NQ7A 1F3XA 4ML4A 2Q8LA 4FNTA 2XIBA 5AY7A 4GI8A 3EOOA 1BSIA 1WE5A 3GNNA 2GJLA 4IFKB 3QV8A 1AZ2A 1TVNA 2POTA 3JR2A 1GONA 2Z1WA 2PDJA 3TCSA 1TZ7A 1AK5A 3HF3A 1KRMA 3NQ8A 2Y2WA 5FA5A 4ZCWA 4HT3A 3WH7A 2CYGA 3T40A 4GVHA 2Y63A 1A5SA 1FKWA 4AIUA 4ZFCA 5EFFA 3B9DA 3M43A 1I9CB 1VPQA 4L4MA 4OECA 4WXZA 1OX6A 5TQLA 3NZPA 1XLGA 1GCYA 3GIQA 4UTUA 2NW0A 1KWGA 3STFA 3OIXA 3SCTA 1DP0A 3FEQA 4A3YA 1KFLA 3TXZA 1JQXA 3EA1A 1S2CA 2ZICA 4PH6A 3MSGA 2CZFA 3OOQA 4Y96A 2CZEA 2OTDA 3VKJA 3AIUA 2VCCA 2DZAA 3M0VA 1PJ9A 4HZ8A 2VC7A 1O5KA 2A7RA 4RE2A 4ICCX 3BOFA 4UFLA 3GHUA 3EZ4A 4JQ4A 1UD4A 3NWRA 3RLUA 4ATDA 1U2YA 3MUIA 2WHJA 4MGVA 4KWVA 1JZ3A 2AL2A 2NQ9A 5FEXA 1JPHA 3NQAA 4KPLA 1IZKA 4AHOA 2DU2A 3CAVA 4PMOA 1T0OA 4A21A 2ISSA 3L0NA 3VGHA 3PULA 4BR1A 3KAOA 2DZSA 3G1RA 3S5OA 1NFPA 1E6ZA 3BLDA 3QKZA 5BXJA 3M47A 1SO3A 1EJVC 2PV2A 3NTPA 1OB0A 4JHZA 3AHZA 3RPTA 2ACSA 1EX1A 2YR1A 4ODQA 1F8IA 2HS6A 4W86A 4IFOA 1GKPA 3WLPA 1S2UA 2P8CA 2ZRYA 5FESA 5DANA 1PIIA 2OELA 1X98A 3LSBA 4H9VA 4HTYA 1FJDA 2Z27A 2WM1A 3WJXA 1BWKA 5DO8A 3OVPA 3WX7A 3AU6A 3ZR4A 4PMDA 1KFEA 1E73M 1NDYA 4NAEA 4KCVA 2X40A 4KW2A 3OB8A 1DWHM 1KGXA 3FY1A 1P0KA 1YXCA 3SCUA 1T40A 3GDRA 1IR1A 4IL0A 1TRDA 2NLYA 1QZ2A 3RM8A 4XO7A 3K1GA 1ZALA 4O28A 4LB3A 1GHSA 1ME9A 1OBAA 3NTYA 3M16A 4OWGA 2EJ1A 3L4UA 4CN4A 2DZPA 3SCOA 1A5CA 1EJRC 2WWDA 4QBXA 5LA1A 1AA1B 1R9HA 4B2DA 1W1VA 3DX5A 5ENLA 4TYOA 4F0RA 1GOMA 3BSGA 3LV5A 4PE8A 4DBEA 4ZQOA 4DJEC 2C8NA 4JDYA 1RBOB 4IJCA 3ARZA 3UPWA 3T9PA 4UFMA 2Z6JA 5H8UA 2X2YA 3UG5A 3VIMA 3PY2A 1E5NA 3WK2A 3LPOA 3GIPA 4GKLA 3SCWA 3PG8A 4DEFA 2D2GA 3PUEA 4BK9A 1PS9A 2OO6A 4QCFA 2YA1A 1X6UA 2GZXA 4Q4QA 2OXNA 4H9YA 3W3OA 4GJ1A 2XP8A 1J10A 5FL0A 1WXZA 5BU9A 4N4QA 4C7GA 3XISA 1ITQA 4C6BA 3AZTA 1JGMA 1UUOA 1QOQA 4NKCA 2OCZA 2VI0A 4AD0A 6XIAA 3W27A 1ZBKA 4JY8A 3H21A 3UCQA 3G1YA 2W91A 3KW3A 1E43A 2ZFAA 1KFCA 1CB2A 3GVWA 1M65A 4DAFA 2FPYA 2UBPC 2VZSA 3FOKA 3H2AA 3K13A 1CXEA 3RNDA 1SR9A 3NZRA 4QP0A 1ZCCA 4L4LA 3GTXA 4IUOA 3PA7A 4IUGA 2Y61A 1KBBA 3W81A 5AYXA 1S1RA 2ZR5A 4KCTA 4US5A 1W9DM 1SMDA 2YPIA 1KFBA 4H2CA 3V5CA 1OEPA 3LCXA 5EB8A 3E02A 1Z6KA 4WSHA 1TPH1 2WC7A 3WJZA 4UTWC 1WKEA 2F2DA 1XSKA 2GOUA 1QW7A 2W3ZA 3UVIA 1G9HA 4JHMA 5HJLA 2WZEA 3D6NA 5T9BG 5IBXA 1VB9A 2GVEA 4UFIA 5LGZA 1XYBA 4LGXA 3W2UA 5D37A 3OA3A 4ODNA 3LUTA 4UC5A 5FOOA 5HMFA 3GH5A 4XD5A 1Q2RA 4QT3A 2AL1A 3W7LA 4Z42C 4DXKA 3KOYA 3CHFA 2Q8ZA 3O6AA 3RLGA 3WUBA 4W8AA 1KLZA 2CU0A 1PCWA 2D0FA 3I10A 4RXGA 4UB9A 2CKRA 1R9YA 4NY2A 2HS8A 2CW6A 2PLKA 2QKFA 2CIPA 1EL3A 1MUWA 1MXDA 4NYUA 4GGHA 3E6EA 2ZRWA 2Y5SA 1UMYA 2PDKA 2ANUA 1VENA 4HU3A 4WY0A 3OLIA 4IQEA 2CXEA 4FOJA 4RW3A 3H70A 3MBDA 2PRHA 4Q7IA 1RH9A 2X2GA 5FD0A 1W1B1 1A5UA 1TJ0A 4LSBA 4LRSA 2XIOA 4XIAA 1HTIA 1FKHA 1OINA 2WAGA 3BJSA 3CB3A 3SIZA 3CIVA 1J4HA 1AQFA 4JTUA 2OT1A 4HK7A 3PPFA 4WGHA 1C9HA 4Q8NA 3GVQA 3FA4A 1XSIA 3R0KA 4LS2A 3TYUA 5D4YA 2PP1A 3THDA 2J79A 4E4UA 5AB3A 4OOUA 4ZQNA 3TC5A 3UI4A 3VKKA 2XP3A 3TA9A 1JEZA 1LRTA 1R3TA 4GGBA 4QXIA 2DZVA 2H9AA 5F1UA 3PHAA 1LM1A 2CKSA 4XG1A 3ITXA 2ESCA 3N2XA 5GJMA 3UXAA 4DBSA 4DELA 5D2VA 2HROA 1Z8AA 3SGZA 4I6VA 4BF8A 4HYRA 1NEYA 3LS9A 4LJ3A 3TCZA 1KM4A 2WZIA 4GJJA 3E12A 2WZTA 3NI6A 1KKOA 1SVDA 3GAYA 5MKGA 5BWFA 2ZC1A 1XYMA 4V1XA 3S6DA 4AIBA 4DZHA 4F9JA 5KZMA 2PV1A 2VENA 2CESA 1LOQA 1Q6OA 3A21A 3H2MA 3V36A 3AXMA 4P8VA 1H1NA 4ODMA 3NQEA 1D7JA 4P5UA 4R5EA 4PL1A 3PSVA 1E44A 5CZJA 2DZWA 3WQFA 1MMFA 1LL4A 4XAKA 2VX6A 4I9TA 4MIMA 5G1TA 4LAKA 2J24A 2XG9A 5FF0A 5AYYA 2BODX 4QLJA 1KM3A 3NQCA 3DKJA 1N7KA 3TOYA 2OGYA 3GW3A 3WNPA 4JEJA 2A79A 1RPXA 1OM0A 1Q6UA 3P60A 4CQCA 1GOXA 3MV11 4CD5A 4MDPA 3W23A 4MJ4A 2PU1A 1W9UA 4OOZA 3ES7A 5LXXA 4HNVA 3S2CA 2CLIA 3LPGA 4KF1A 4QISA 4PUDA 3LNPA 1QNRA 8XIAA 1PVNA 1J2WA 5FJOA 1M6JA 3AZSA 1J0JA 5FAJA 1EO7A 3PUOA 3PRBA 2G37A 2DVUA 4JD4A 3VAVA 1KV8A 4M6QA 4JY9A 2EPHA 3FVDA 2WJEA 1UIOA 2ZOXA 3S83A 2QJHA 3PWAA 3SBFA 1IWAA 3UYIA 3PBVA 1K9TA 3UG8A 4W7UA 4XX6A 1EYMA 1NMWA 4B3KA 1XHGA 4L6DA 1R46A 4IZGA 3OG2A 1IR2A 4LVBA 3AU2A 4WD0A 3AI0A 5SWUA 3CYVA 3MUXA 4QE1A 3IJQA 5LXEA 3LNMA 4P2VA 1PTAA 5KSWA 2NUXA 3KZSA 1ISVA 1C8QA 5G5IA 3WJYA 4KQZA 4F3HA 3KOWA 3UERA 3W9ZA 3A4AA 1OFPA 4KCUA 3TSBA 2BGSA 2PE4A 3GK0A 2QW5A 4GRSA 4W88A 3TEVA 1JZ4A 2HK0A 3L4WA 3IIZA 4IH3A 3QH2A 4MVAA 3N1AA 4M82A 1W1TA 2PTZA 1XCXA 5HWJA 4R0XA 4CU7A 4JZ5A 1IWPA 1E9ZB 2E0PA 3C86A 4S3GA 5C9XA 2ZUUA 4FNUA 4IP7A 4D6FA 4O52A 1D7FA 3EOUA 2G3NA 1X96A 4ZE4A 4XKYA 3VKBA 1DKWA 4GZIA 1MNSA 2G3FA 4OBRA 3CMFA 3U5YA 1UW9A 3BXWA 2VC6A 1ZJIA 4P61A 4GQ0A 3V18A 1K8CA 3ZWTA 5LIWX 4O8AA 5A6KA 1Y5WA 1ELSA 2G96A 3GLCA 2ONEA 2QCHA 4BEQA 4K1GA 4LV9A 4AZ5A 3WUGA 5EMJA 2DQWA 3LN3A 1ROUA 5CPOA 3WQ5A 1I60A 1FDZA 1A0CA 2FQIA 4AH7A 2F6UA 2PFHA 2CLKA 3LGGA 1FCQA 4FAMA 2PWEA 3W75A 2ZXBA 3HV8A 3SIMA 3A22A 8CGTA 1M68A 4MKNA 3I65A 2V0TA 4HHLA 3GU9A 3HPZA 4QS5A 7TAAA 3WD2A 5FJPA 3PAOA 4AX7A 2VRQA 1I2NA 3AUJA 3LTYA 1JUKA 2PCQA 1LG2A 2VX7A 5E9XA 3TAOA 3ANUA 2WSPA 4XAZA 3RDKA 1O60A 1R6WA 1A3WA 3RR4A 2FH8A 1PTDA 2VR4A 3OZYA 5FJRA 4M5PA 3U48A 3PJWA 2INFA 4Q6XA 3ORWA 4X22A 1RUSA 3AO0A 4QX4A 2PDWA 2FAPA 1YMYA 4KIEA 3MKKA 3FDGA 3IPWA 4PGLA 1HKJA 3DYMA 1EZWA 3V0SA 3M5ZA 1OYBA 1XWYA 5CPNA 3UF9A 1U22A 1DL3A 1YBQA 3AAMA 4IICA 4PUUA 3B4UA 1LYXA 3VZXA 4G2PA 4FXJA 2PWHA 1A3HA 2ZZ2A 3T42A 4W7VA 4UTWA 4MB4A 4RUBA 5CG7A 1RP8A 3GHTA 2AQVA 4AHQA 1HW6A 2DG3A 2W9MA 1ALDA 4GCXA 5AZ1A 5IBXC 1E1CB 1P6BA 5BZAA 1XYZA 3NPUA 4KQNA 2DSKA 2O9RA 1E3XA 3CUJA 5DLCA 3WO8A 1W3NA 4EF9A 4TVUA 2J7FA 3TN5A 3N34A 3G6LA 1J5TA 1GVEA 2XP5A 2OR2A 3AYVA 1VZWA 5CSRA 4C7FA 1P0EA 3TTQA 1CNVA 1X7IA 3S1VA 3ZO9A 1LL6A 4ODOA 5CC6A 2VZTA 1XYLA 3MHUA 4MNMA 1M53A 5ABEA 5GQBA 2OODA 1JUBA 1AMKA 5DT5A 1YTEA 4H9TA 4HVXA 1WV2A 4LANA 3M64A 2C7FA 1FHLA 5HATA 4AZ7A 2AL2B 2QCMA 3S1GA 1AW2A 2B4GA 2ZVRA 3WNOA 2QIWA 4R33A 3D3AA 2QPSA 4A3HA 1F2JA 1UCWA 2B31A 1PDYA 4S38A 1J01A 4DYJA 4RNHA 2R1MA 5DMNA 5HUOA 1JZ6A 4QIUA 4P7QA 3ZVIA 2PTWA 3HMCA 3R4IA 1MUCA 2ZRUA 3MUCA 2GSJA 5F4WA 2OYLA 4GI4A 2J9XA 2MPHA 2PDXA 1BPLB 1NARA 2XVLA 1Y0EA 4DWDA 1CLXA 1FWSA 1XDJA 4P8XA 2FYMA 3W70A 1UHVA 4E5TA 5C9ZA 1F4AA 1R87A 2UY5A 4W93A 3S9ZA 3ITTA 3TW7A 5C2CA 5TNVA 3N2MA 3VGFA 4KGLA 3OVGA 2F2HA 4FR6A 4IIDA 5GJNA 4QG6A 3O3RA 4HMCA 1SO4A 4Q4MA 1NWUA 3DEQA 1AL8A 3EXSA 3LMZA 3QOMA 4HZ6A 1SUXA 3CBWA 4RE4A 4JQ1A 4N4PA 1BQCA 4IIHA 2PWUA 1EOKA 3HPFA 4H8HA 3AMCA 2XM2A 3PPGA 4X2PA 4R85A 3W88A 3NG3A 2JZVA 1PCKA 4PN2A 4O53A 3QZ6A 5G4HC 4DLMA 4GUFA 3KZ7A 2YCLA 4B9ZA 1QTWA 1X39A 1M04A 4V2XA 4PCPA 4NASA 1JDDA 4JIIX 1B3WA 5KZ6A 1XI3A 1A47A 2MUCA 1CYGA 3MMTA 3VPLA 3CWNA 1MZHA 2IKHA 1MQQA 1R3VA 1R0MA 6A3HA 3WEOA 1EX5A 3HOJA 1REQA 4UCGA 4WY0F 2RKXA 1GRJA 4JQAA 5EFDA 3LLDA 2B0MA 3TNOA 4KFPA 3EEZA 3TJ4A 2WJZA 3RIKA 4NHVA 4LS0A 3DG7A 4NIRA 1A5MC 2D2OA 1XDLA 1VFOA 3IGXA 2YW3A 1UOZA 3UY7A 5JH2A 2YXGA 4U86A 1BHGA 1XYAA 5CZ0A 5DMMA 3R0DA 1DJGA 3SSZA 3NXFA 1DYSA 3G3MA 3BLKA 3KX6A 4BI7A 3GZ3A 3IV8A 4BWLA 4M1RA 2V82A 1TJRA 2DG4A 3FAWA 2I9EA 3ZFHA 2WMJA 2XFWA 3HBLA 2W4XA 3FYOA 3B8SA 2EPKX 1F07A 4FLOA 3ODKA 1KBKA 2CBJA 4B2DD 1JDEA 3M0XA 4ORMA 3MHGA 4GD0A 1BRLB 3L2MA 2D2HA 3BZGA 3B8UA 3G18A 1XIBA 4W8LA 4OKDA 4WLCA 4DRJA 5CC5A 1DQUA 1ME7A 4B15A 3ES8A 1NFGA 1YADA 8A3HA 5AHLA 1C8XA 1LT8A 3DN5A 3V1PA 3WDJA 3JVAA 1XPGA 1S39A 1CXLA 1HNYA 3QV7A 4QIBA 3UZYA 2FB2A 2A85A 3AYRA 4A8IA 1T7LA 4AWTA 4PC8A 4GI9A 1NWSA 4R27A 2VHLA 1KM6A 1W9BM 2J8FA 3MDWA 3EIPA 1XCWA 2PAJA 5BMWA 2J7EA 2NXHA 4M6UA 3CHVA 3LBOA 4RZ5A 1RVGA 2QCGA 4IIEA 1W3TA 2HNHA 3UT0A 2WQDA 2GLKA 3P8IA 2Y88A 3N4EA 4EP8C 5BU6A 3WL0A 2GPTA 2FHBA 3GHRA 1QPOA 2REQA 2Z25A 4O4WA 4NJKA 4E0CA 1ISYA 1P1XA 3QV6A 5TAOA 4NZ1A 7TIMA 3LBCA 3UWYA 3LZ3A 2HBXA 3U8GA 4EIVA 3PWIA 4O1BA 4AZBA 3P81A 4HMNA 1KA9F 2RSEA 3E0IA 3RXZA 4JYDA 1BD0A 1ECEA 3SB0A 4Y8FA 1TMQA 2VGFA 1GZJA 3HB9A 1EF2A 3LDVA 3NQ2A 3BO9A 3GSMA 2AWGA 1W0MA 3EX1A 3N2CA 4HGXA 1P48A 1HQTA 3PZOA 4W9TA 1H1YA 4GISA 1XIHA 5DRIA 1Y7VA 1CB7B 1Q1CA 2TSYA 3T4CA 3GW0A 3SDOA 4C6OA 1WKDA 4KGJA 1JF6A 1MYRA 1Z9AA 4BWLC 5A1AA 4LUTA 4PCFA 3P5ZA 1VAHA 1JXJA 3CV7A 1M9HA 1ZGDA 3M0LA 4QG9A 5BXRA 1MW3A 1IWBA 2B5UB 4WKHA 4MLRA 4WR3A 1H2JA 3OGVA 4MY1A 3EPOA 3N3TA 3O2LA 3II1A 3P84A 1FX6A 2VM8A 4IT1A 3OPSA 4AAJA 1EPXA 3VXGA 3M7SA 3NURA 4AY8A 1KCLA 1MNZA 1XR2A 4QE5A 1C9WA 2IPJA 4QT2A 4RPQA 3VIJA 1OVDA 3GY1A 4TV6A 1SGJA 3FGCA 4IG2A 1ENUA 3ID7A 1RD5A 1L8PA 5HWCA 2H9AB 5BCAA 4EWND 3WN6A 3MWAA 4GXMA 2J7CA 3W7NA 1TE1A 4GYKA 4HNTA 4HHHA 2ZZ7A 1ZHAA 2ICSA 1VYPX 3GG7A 3H2FA 4IT4A 3LQLA 5FJJA 3NDYA 2B81A 3WQVA 1LBFA 3WQ8A 1HVQA 3JZEA 1BQGA 2VOTA 4DJDC 2GUUA 1M7OA 3G77A 1XC6A 1XX1A 2M2AA 2A3CA 1SSDA 4PMZA 4WDXA 3G1SA 3HZ3A 1Q6HA 4ROPA 5E0CA 3CUIA 2NWRA 1TELA 2E6DA 3ONCA 2I57A 3ISIX 3MO7A 4XZIA 2FH6A 4NL1A 3ZT7A 4YWIA 1HX0A 1ZFJA 4RK8A 4QDMA 2PLCA 2WSYA 3E0VA 5C54A 3LG3A 5DY2A 2OJPA 5F2LA 3T0TA 4YXGA 1I2OA 3R8RA 1ODZA 4Q8PA 4I9AA 4MB5A 2BP1A 3GTIA 4W5ZA 1SR0A 1EZ2A 3U2EA 1JVNA 4PCSA 3PZIA 4Z1DA 5U4NA 5F7UA 4ZZ9A 1EPVA 5L6UA 1XGZA 5HULA 4ODRA 1CXHA 4NUWA 3NL5A 4ZVJA 4AQLA 2VOMA 3DZ1A 4HK6A 2V3FA 4PUKA 4C6MA 3BMWA 2IKIA 1S2WA 3UPMA 1GG1A 4MKSA 3ANVA 2PTDA 3LHTA 3ITOA 1V3MA 5I3JA 3RCNA 2AMGA 4IP5A 4H8VA 1KXTA 4S1FA 3UJ2A 1SFTA 3WG6A 3WLOA 2YDQA 1Y65A 5ABTA 4GVGA 1C8VA 1U1HA 3GS6A 2NUWA 2KO7A 1R38A 2J9ZA 1XSJA 4A4AA 1KC7A 2NUYA 4PCNA 3QPYA 1GOWA 3B04A 3PC0A 3PSWA 4LAUA 3WJWA 1HKMA 1XICA 2RDWA 3TJLA 1PO9A 3SN0A 1XLEA 3AYSA 3OODA 4PYSA 1P5QA 1HO4A 1IEVA 2VC9A 3EKZA 4K39A 1TWWA 1AW5A 1AH0A 4GYPA 4ZODA 4UFJA 4F0LA 2FZBA 4IPJA 1JCTA 2EF9A 5JVLA 3VD4A 3TMQA 1JCXA 2DUAA 4JTSA 1XH2A 3NM1A 2Q5AA 1NF0A 3Q67A 3WELA 3EWZA 2A3LA 4JTFA 4PRTA 1PV8A 1WOBA 1CCWB 5C9WA 2E5BA 2PDNA 2PN0A 3N4FA 4BY3A 2ZRZA 1B9ZA 4GVFA 4HNCA 1FKXA 3QV9A 3GU2A 2FDSA 4R7JA 4X60A 4RNFA 4DZ2A 2YCIX 3O5RA 4A8NA 1MEWA 4KKXA 1U1UA 1TV8A 3QRHA 2SFPA 1K6WA 4O1DA 3USBA 3BG9A 3T8LA 3G0XA 2PGWA 3HFTA 3CZKA 4DQWA 2P0OA 1VPYA 1TV5A 4GVIA 1PKLA 3MJMA 3VINA 3B0PA 4C5YA 3THCA 5CLWA 1I4NA 4CNUA 4IT6A 5EKYA 1SU5A 2Y8VA 2FTPA 4JTJA 2WYSA 4TX0A 2XHYA 1CZ1A 3NSMA 3OQ8A 4O4VA 1ZCOA 1UJPA 2NX1A 1U1JA 3CT2A 1A49A 5AHMA 3S5ZA 1O4UA 3EDDA 3SRFA 1NSJA 2X09A 5K9XA 2OZTA 1C7TA 1E71M 3U9IA 2YL8A 5T9CE 1S1PA 2ZA2A 1H51A 1XH1A 3W1AA 3RMJA 1CENA 1YHTA 4GQGA 1TX0A 2VCDA 3I3EA 1OFBA 2WJDA 3RITA 3QYQA 3REQA 1SFJA 2OO0A 4GYJA 3R89A 3UJFA 1LJYA 2PTYA 1J0YA 3WEMA 1UWQA 1K02A 3MI3A 3T6CA 4Z2JA 2MLXA 3ARVA 3OYZA 5H6HA 4UTIA 3CJPA 6PTDA 2WLZA 3W2MA 4Z2HA 2ACQA 2V69A 4KBXA 3SY8A 4B5TA 4L9ZA 1U5HA 4FNRA 3S2JA 2A6LA 5BROA 3WH9A 4QJ4B 4H83A 3AOFA 3M41A 4QLKA 1VCGA 4NZ3A 4HSOA 3AYTA 3VNZA 4MB1A 4QQ3A 1GYLA 4AEOA 4IPNB 3WQDA 4ZB2A 1LG1A 2RJHA 2V9DA 3EXRA 3LU2A 1H1ZA 2FZ9A 1X6LA 2B7PA 2I17A 4HMDA 1PTGA 1EH9A 2VCAA 1N1AA 1W2VA 3L4VA 1I2QA 3S2LA 4WF7A 1HXJA 3IV3A 4G6CA 4Z0SA 3QTPA 3LTPA 4TW6A 3GX9A 4XSMA 3NUKA 2OX1A 2VGBA 4PUNA 2V8ZA 3T2PA 2I1OA 2OFJA 2J25A 3VI2A 2XFRA 5DF0A 4B90A 4Q8MA 1WOAA 2Z0IA 5E6ZA 2WKGA 5DO2A 3PK7A 3WFLA 4YTTA 1DWJM 1SJDA 1N82A 2DUZA 3OGRA 2QVHA 3FKRA 5CPQA 3CYJA 2R1KA 2BX7A 1V0NA 3GU0A 2FIQA 2GL5A 4H04A 5D09A 4O54A 1E4IA 4Q8OA 4HPHA 2YXXA 4IIBA 4DPQA 3KLLA 4JTGA 2RUCA 1JCHB 5CBJA 2P1FA 5MHBA 1V08A 3TN4A 1CW2A 1Q5MA 4H3DA 3WQPA 1JPMA 5LNVA 3ZJ8A 4FMVA 3AS0A 5AOUA 3W7GA 4DJFA 4ZO6A 2HVMA 3P14A 2ZQSA 5JBDA 3O5OA 4NU7A 3NEHA 3DBPA 1H09A 3APGA 3GXMA 1XIIA 4UQCA 4JYEA 1EJ7L 1ZJAA 3RO6A 3ITVA 3LHUA 1AQMA 3ECQA 4FP1A 4FXFA 4BQ5A 3NQVA 4O19A 4BKNA 3TH6A 1GJWA 3KFTA 4WGXA 2PDQA 5A8PA 4M56A 5BOFA 5KTLA 3PTKA 1ZL1A 1C90A 2F6KA 4Y9PA 5BYWA 2QEZA 3SRDA 1ECQA 4U3AA 3CC1A 5HOSA 2FHCA 4M51A 1MO0A 5FAGA 2F23A 1IIHA 1TWZA 1S3TC 4HSNA 3L5AA 4DM1A 1K7FA 1R7OA 4KRTA 3IUDA 3WH0A 3BURA 3CWHA 3CQJA 3W82A 4JKKA 3FXGA 1QI4A 2XSBA 2NV2A 3LCWA 1YQ2A 3BLLA 1ISXA 3RM4A 1PB0A 1TVLA 4H6QA 5E1QA 1EWDA 3IKGA 2QMKA 3RG6A 1G5AA 4F66A 4ZPWR 2JALA 4LYKA 4Z2GA 2QUNA 3C56A 3BW4A 3RX2A 1FCVA 3W7HA 3K2GA 4H9XA 3DGBA 3O0KA 2RJGA 1TE6A 3VNIA 1G1YA 4FOUA 4ES4A 1W8SA 2W0UA 3UGVA 2Y8UA 1KNWA 1ZS2A 3O5IA 4U3CA 4C6QA 1EXBA 1H41A 6CGTA 3EDFA 3B9EA 1LF1A 1SO5A 3WLQA 1P0BA 3W86A 1TR1A 3PFMA 4WOZA 3KWSA 2YKKA 1Z3NA 1RQEA 1R3SA 2D2JA 2I14A 2IPFA 3G1FA 4NNAA 1IYXA 4H7CA 1RY8A 3LSCA 3W37A 4M7SA 1FKDA 3ALGA 3LTSA 2WPGA 4JFSA 3B03A 2W61A 3CUZA 1YKWA 1B3ZA 4NI8A 5CCZA 4MY9A 3SN4A 3RFAA 4L64A 4CCCA 4RDVA 3CT7A 4EPBC 2WCSA 3UETA 2Z7KA 4F0MA 4HSHA 1J79A 4Y2WA 3PZGA 3VOIA 1RZMA 1UROA 4ZQCA 4CQBA 4HN8A 4QAWA 2ZRVA 1HKKA 4P8WA 1P43A 2KR7A 3W25A 3A9BA 3VOJA 1RK6A 1UZ4A 5KZEA 1QK2A 2GUYA 2O92A 5M3WA 2FDMA 4O16A 4Q4KA 3WIJA 2GQAA 1E0VA 1XUUA 4D2JA 1NDVA 1QI0A 3WD1A 3FSTA 1HFBA 2OLHA 1H61A 4AVNA 1NOWA 3UQBA 3BJFA 4I90A 2FKEA 2R82A 1UR9A 4DYKA 1BVZA 4WKFA 2GVLA 1DJXA 3H4GA 4E2BA 1LRNA 1TUFA 4YJ5A 3AQUA 1CGXA 2ZR4A 2PODA 2WM0A 4WDTA 4FNSA 4QJ5B 3DHDA 4YN5A 1HL8A 1WDPA 3QY6A 3G8RA 1F4HA 2V3DA 3DHUA 4NXSA 1HP5A 3W7EA 4JS3A 4TW7A 3BV4A 4PUJA 4ZOEA 3GTFA 4DF0A 3ITCA 2QYGA 2FVMA 3B9OA 4HHMA 1TWDA 2ZUWA 4XZ9A 1HT6A 2ODOA 1UH3A 3N9KA 3WQ4A 1RA0A 2ZADA 3DGRA 3G0UA 2PD5A 4AZHA 4JPGA 5FL1A 3WH8A 1F3TA 4ASTA 5TBOA 1W5PA 1F8MA 3VIFA 5DX7A 3QHOA 4I8DA 1JFXA 2BGQA 3AMGA 1MEIA 1L1PA 3WNKA 1TA3B 2A3BA 3KP1A 4AD5A 3L66A 3POHA 2GQ9A 3IIVA 2VN1A 3LEPA 3TR9A 4WJXA 1TRIA 4GQQA 2TPSA 2FB3A 1EA0A 3B8TA 5CC3A 3AIWA 1TJ1A 4NILA 4EPDC 4ZB5A 3M07A 3ARPA 5AC8A 3TUUA 1VD6A 2ISWA 3M0ZA 4GFSA 1ZRQA 2YBUA 2R9RA 2X8RA 3B40A 4C1KA 3D46A 2C18A 5I6SA 3QM3A 1RXOB 1UD6A 1WDDA 4Q6JA 3IAQA 3W22A 1E6PA 1OFDA 1UA7A 3KP0A 4M3PA 4TTGA 4DWSB 4X9YA 4L80A 5AC7A 4I5XA 1W6TA 3VD3A 3WMLA 4ERAA 2DT2A 4HNLA 4ZENA 3NOEA 4K8HA 3VK5A 1US0A 5CSUA 5LHEA 2HPIA 4QAIA 1E72M 2PDYA 3WF2A 5I3FA 2ZWYA 2X0YA 1J18A 1CIUA 2J7DA 4DM2A 1JZ8A 2XDFA 2EG8A 4F48A 2YYTA 2YCEA 2AAMA 2WMKA 1JFHA 3GNXA 4JFTA 3CWOX 3NPWA 2O55A 2Y78A 2TODA 4FSAA 3WUFA 4EACA 3N3MA 4RXFA 4N19A 3O6DA 1TZZA 2E67A 4PODA 4AF0A 3PP7A 1TSIA 1ADSA 1KFKA 4TIMA 2QQ6A 3SCRA 5ABHA 5I77A 1N2VA 1JF5A 1P4CA 5C55A 1O5XA 5KEZA 5AVHA 2ZUSA 1I6NA 3Q94A 3GVVA 4M1BA 2QAFA 1JIBA 3S9IA 3AWNA 4Y9AA 3UXLA 4O15A 1O94A 1IV8A 3CTTA 3UCCA 4IPXA 3COTA 3M0YA 3M4HA 4LEFA 1JJKA 5T91A 2V5BA 2VGGA 3PAJA 2ZC8A 2P0IA 3UESA 1ML1A 3NAVA 4JFKA 6ENLA 4FX7A 3TN6A 3QKEA 4QGCA 3S5YA 1RY0A 2XIJA 5B8IC 1NDWA 2CC0A 3BPWA 3DC8A 2XP9A 3SQMA 2MLZA 4JTDA 2NXIA 4X2RA 2D0GA 5CAKA 5K4ZA 4UMCA 4G1NA 1JXKA 3VM7A 1V0KA 1VGAA 4IGMA 4LCSA 2VFGA 4W84A 1IXOA 1OGGA 1VH7A 2X0SA 4PTWA 3MZNA 4ZE5A 1BYCA 4ACZA 4CCZA 4D6GA 3WDHA 2OGJA 4DRIA 1YATA 1HP4A 4IMAA 2P8BA 3MVTA 3AZRA 3OO2A 4NNRA 2G97A 4E8CA 1R3QA 4DWSC 3BGGA 4HPXA 1VJSA 3IVSA 3TA6A 1EJUC 1I1XA 4PTXA 1W5MA 2DZXA 5DIUA 4LYPA 1G4EA 2CBIA 2GDVA 5FI8A 1M7JA 5DMLA 1XBYA 1GKRA 3B0XA 1TFVA 2XVPA 1DWIM 4G7EA 4C6CA 3DESA 4JTIA 3QTGA 4JFMA 2PDIA 3CO8A 3GR4A 2DSUA 4MPQA 2C13A 2R91A 3K4AA 1FOBA 3E74A 1KQZA 1SFSA 4H7VA 4O18A 1L6WA 4AZGA 1QT1A 4RJEA 3W1RA 3CL7A 3HMJG 3N4AA 3RU8X 4I7WA 4ZBCA 5HQMA 4Q8WA 2IPWA 1E6QM 4JNMA 3H2NA 3LCGA 3FS2A 4HA4A 3RRXA 4YHEA 2ZQUA 5IOBA 4KH2A 4PMXA 4YMZA 3CAKA 3TV8A 1C29A 3KOFA 1H4PA 3K1DA 1EIXA 1WP6A 1CXFA 4YYFA 3GVRA 1SW7A 4OIFA 1BRLA 1BTMA 1CI1A 3UWWA 1LUCA 3LI0A 3SUWA 4OBTA 4AY7A 4J1OA 1UYQA 3AIRA 4FF7A 3WF4A 3DG6A 3PB0A 3CS2A 1S46A 2P5NA 4C6KA 1V79A 1M7XA 3VE9A 2Z1XA 3CUFA 3PN8A 4GHRA 4DJED 1G4PA 4UTFA 5A8GA 5DELA 4GIEA 1WA3A 3TW6A 3WD0A 1YDOA 3O16A 5D38A 5DT7A 4PMQA 1PUDA 1KO0A 1C91A 3EPNA 3FN9A 3QGKC 4IXXA 4LYRA 1VLIA 2PDUA 4AUBA 3SCQA 1HZYA 1E4NA 4N6EA 3STCA 2VRKA 3W7DA 4GG9A 4W4QA 3LLFA 3REQB 1V7AA 2PTXA 1KB3A 4EXAA 2O4QA 1SZGA 2G95A 1K7XA 5GJPA 3I68A 3MT1A 5GVJA 1K1DA 1D3HA 1XFBA 1UOKA 4CQ8A 4PMJA 3W4RA 4UDMA 1ZZMA 2BGNE 3B7XA 3IJLA 4GY7A 4C6DA 1EDGA 3P6LA 4Y9OA 4NAFB 4JX4A 4LUTB 5I7GA 4O0ZA 4OHQA 5JU6A 4DRPA 1ZP3A 4IM4A 3CU2A 4M19A 4FZIA 3VD7A 1ONWA 3I7QA 5FF2A 4LCRA 4J7RA 4YL2A 1JPIA 2DH2A 5CXPA 1XLMA 4L6HA 3NQFA 1XISA 4J35A 4WOQA 3ZOAA 3EX3A 4L72B 4ICMA 4OJYA 2I7GA 3N2OA 2A0NA 1LOLA 1Q6FA 1RR2A 3WFZA 3TN3A 2PCEA 1H7WA 3FJ6A 1NWRA 5D75A 1XG4A 3BLEA 5J5DA 4MHBA 5I03A 3VVGA 1YEYA 3GG1A 2E1DA 3QC3A 3WK3A 4DRQA 4CCEA 3ARSA 1GOKA 1DWFM 2Y24A 5BRQA 2W6RA 3NL2A 4IFRA 3VX1A 5HBFA 4MWAA 4I6KA 3G22A 5T26A 5CKSA 3PANA 4MYAA 4JYFA 3W1QA 4EXQA 4LAOA 2BV9A 3DERA 3K8MA 3HN3A 1HGYA 2CWNA 1HKIA 3OHMB 4JXCA 2PLJA 1JULA 3UJSA 1V8EA 2WNZA 3B0VC 3MCOA 4U33A 1UP2A 1TVPA 4U84A 1Z42A 5GNXA 2VJXA 2NQZA 3KBJA 3VOGA 1F3WA 3QFEA 3W6YA 1GVFA 2V6AA 3E0WA 3KCOA 4HZMA 3VZZA 2HEJA 2PZ0A 1JYNA 2O56A 4DO7A 3C3UA 3IVTA 1AZ1A 4LVDA 1IXQA 1JD9A 4IMCA 4NZCA 1Q85A 3LRLA 2J75A 2V2HA 5D2TA 2ZZ1A 3C2FA 1WYIA 4IJBA 1UR3M 3BC9A 4FK9A 4BF9A 2QUVA 5E09A 3VDHA 3CUGA 3S4TA 1BF2A 3CH9A 3LCHA 5FJUA 3WFAA 1YDNA 1F05A 3TQVA 4PFMA 4AIOA 2E40A 1MRAA 4XK2A 3UXDA 1W3LA 2V5CA 3URBA 3O1NA