2ESCA

Crystal structure of a 40 kda protective signalling protein from bovine (spc-40) at 2.1 a resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGSERFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGGWRGTVGHHSPLFRGNSDGSSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSSTRVGAPISGPGIPGQFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Structure of a bovine secretory signalling glycoprotein (SPC-40) at 2.1 Angstrom resolution.
pubmed doi rcsb
molecule tags Signaling protein
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2escA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2escA01
2EPOA 3MUAA 2WZIA 4ZFMA 2AAAA 4AEFA 3QOMA 1JZ3A 5D8WA 4J3TA 2WVVB 1B31A 3ZJKA 2CHOA 4MPKA 2FGLA 5LA1A 4HZ7A 1S46A 3ZSTA 4U2ZA 5ABGA 4ZEPA 1G5AA 3OLIA 1TMQA 1V3HA 3AIRA 4JHOA 2WSPA 4V27A 4C7GA 1R86A 3RM9A 1CXHA 1OGSA 3AMLA 3WH9A 1DHKA 4AMCA 5ABHA 5HOSA 2XPKA 1E56A 1W9XA 5CSUA 1W1VA 3VGDA 4LX4A 3AIUA 4GI9A 4URIA 2WXDM 3DYPA 3SUVA 1J0YA 1C8YA 1V6UA 3VNZA 4J7RA 1EGZA 2VOTA 4OUEA 4HA1A 1V0NA 2A3EA 5I24A 2WCAA 3WMSA 1LF1A 3B9AA 2FH8A 2GUYA 3GYCA 1EOMA 4AWEA 2OSYA 1K9EA 3HJEA 3IANA 1K9DA 4MNLA 3W37A 5IDIA 2CERA 4BZYA 2Y8KA 3UR7A 1W1YA 5A1AA 2J62A 5AY7A 1WZAA 2VTFA 1U30A 2VL4A 3N15A 1MVYA 3AHXA 1V02A 3AOFA 1EOKA 4YN5A 2ZUUA 1O6IA 4KMQA 1JXKA 1QBAA 1E6ZA 3MKKA 3AYRA 5I0DA 3HMCA 4AD1A 1XCWA 2QMKA 4FLSA 5A6MA 4DUWA 3NDZA 3RMEA 4TVUA 1GVIA 1MWOA 1Q6CA 4P7RA 2BHYA 2V3DA 3CZEA 1VEOA 2V38A 5E0FA 4CCEA 3WH5A 4AISA 1HXJA 4QLJA 1UR1A 4PCTA 1W9DM 1EQCA 1WDPA 1JF6A 3AS2A 3NCOA 4F79A 1CPUA 3POHA 2UY2A 1E6SM 4E2OA 4AZBA 4PMZA 1KR1A 2W92A 3PZ9A 4H8HA 3AXIA 2XVGA 1HKJA 4E4PA 2TAAA 2O9PA 2ZICA 1IZKA 1C7SA 3BAJA 1SFSA 4BQ3A 4TTGA 3RPMA 1G94A 3AMCA 4TVCA 1HJWA 1BYCA 3NSXA 3MSDA 3N9KA 3VVGA 4ACZB 1FP8A 2QLYA 2JF6A 4GZJA 2D2OA 5BROA 1C90A 4XB3A 4OJYA 4XV0A 5BCAA 1JZ8A 3ARYA 4AD4A 5M5DA 2XGIA 3FW6A 3WD2A 1V3MA 2WMFA 2EPLX 2JIWA 2OYKA 5C71A 3PN8A 3ARUA 1B30A 1E73M 3II1A 3A3HA 5AYIA 4HU0A 2XM1A 1E15A 5GQBA 3VDAA 5DT5A 5D9MA 2XVPA 4N42A 1ISWA 2ZX5A 2YDRA 2GSJA 5LA0A 2VI0A 1XHGA 4TVDA 4MB4A 2QV4A 1ZJBA 1BFNA 1QPKA 4M24A 4PMVA 2VR4A 2CETA 3BLPX 4W89A 1H5VA 4UOZA 4KGLA 3EDEA 1XH0A 2B31A 2GJRA 4GZIA 2WMJA 2XWEA 3FN9A 3WDPP 4Z2HA 1R87A 4U3CA 3SURA 1TA3B 2WPGA 2W66A 1HVQA 5JIWA 1J0ZA 3GM8A 3SUWA 1XD0A 1CBGA 2V3FA 1CLVA 3AZSA 3W26A 1UOKA 4LPCA 1WZLA 2UY4A 3M7SA 3T0AA 3WDIA 1NP0A 5A6BA 1VF8A 1KCKA 5TD4A 5E70A 4MAVA 3SUTA 2YA0A 3B8SA 4D72A 1FA2A 4CN4A 3VD4A 1QW9A 2G41A 1E6QM 4UFHA 2WMGA 4W88A 1D3CA 1E0WA 3CHCA 4Q22A 1V6XA 1QNSA 5M03A 1KQZA 2BFGA 1GCYA 2E8ZA 1V03A 4UQCA 1WCGA 1MQPA 4UFMA 5CJ5A 1CGTA 2PC8A 4F66A 1FH9A 2G8ZA 3IJ8A 4D6FA 1XV8A 3VD3A 3NUKA 4D71A 3VO0A 4PN2A 1QI0A 1BG4A 1VFUA 5A6JA 2PBOA 4W8BA 4RL3A 1PJ9A 4MDOA 1TR1A 3ZO9A 1JDCA 5CZKA 4PTMA 1IV8A 1QI5A 1HX0A 1KXVA 3AS1A 3OLGA 4WKAA 4CGTA 1KGXA 5ABFA 4NRSA 1W1PA 3BMWA 1UZ1A 3VGBA 2XWDA 2WAGA 3MS8A 1HIZA 2WNWA 1DWAM 1PPIA 1W2VA 3F5LA 1E3ZA 2E4TA 1HP5A 2QHAA 2CEQA 3PZUA 1M7XA 1CGWA 1KFWA 5FD0A 4P8VA 1MW2A 3GH7A 3WBEA 4Z2LA 1GW1A 3E1F1 3ZT7A 3NDYA 1CXIA 5M3WA 3AHVA 1E4NA 4BA0A 4DWSC 3W6MA 2Y5EA 4CD6A 1N82A 3WDHA 1US2A 2DIEA 1AQMA 1DWFM 4S3KA 3AHTA 4KRUA 3VGGA 4MTVA 3UERA 3VM7A 1H4PA 5FCZA 3GBEA 3D3AA 4J3XA 4KGJA 2O92A 1ZL1A 2BY0A 5BWFA 5A8OA 1J11A 4DUXA 3N04A 1G9HA 4D6HA 4D1JA 4UFIA 2D23A 4W8LA 3UEQA 2YL9A 5EFDA 3VU2A 3FY1A 4JFTA 3UETA 1GJWA 1XD1A 2VRQA 1GUVA 3PZIA 2VX4A 1FP9A 4FLRA 3VUPA 4JFWA 3EYPA 3W0KA 4KRTA 1UD5A 1OCQA 3RDKA 1WAWA 4JKLA 5CPQA 4AD2A 1HJXA 2DSVA 2WVSA 3WNOA 3WH6A 5I6SA 2VVNA 1PEZA 3MMDA 3VDHA 4W85A 2CCRA 1FFRA 2OSWA 1WZMA 2XUCA 2J4GA 4PMUA 4DUVA 5ECUA 2VX7A 2C7FA 1ZBKA 1HNYA 4HZ8A 3EDJA 1XYZA 1KXQA 5JBEA 2WZHA 2J7GA 3KE0A 2FHFA 6A3HA 4W7VA 1HT6A 4PUDA 4Z2KA 2ZOXA 3U5UA 3BAWA 4Z2JA 1WE5A 4HOZA 3WNNA 2WMKA 3WUFA 1VRXA 1H11A 1LG2A 5A8QA 1UWUA 3NSNA 2VJXA 1JD7A 2JF7A 4W93A 2WZEA 1U2YA 2WSKA 3MMWA 4F8XA 4CN6A 2FDMA 2VO5A 4AEEA 4JZ5A 2V3EA 5CGMA 3QHNA 3QHMA 1W1TA 2YL8A 3PTMA 2CBJA 3VGHA 2GK1A 3SCSA 4D6EA 2YOCA 1OWQA 2WHKA 1PZ2A 3BSHA 1F4HA 1W91A 1EIBA 1B2YA 2A3CA 1C3FA 2J74A 3ARVA 3O2LA 2D0HA 2ZXAA 4PMQA 1NWUA 1GOWA 5DF0A 1E4MM 2VX5A 2WYSA 5A6BD 2ZXDA 5BXSA 4UNIA 1EXPA 2HISA 5A8NA 3LPOA 5FKYA 2J7DA 1FFQA 4DM1A 1GQLA 3GZAA 4D1IA 3VILA 4PSRA 1SYTA 2J78A 3MANA 1ZBVA 1PX3A 2WC4A 3WH8A 1KGWA 4HOWA 5HXMA 2BXYA 2G3JA 2XHYA 1H0IA 5GPRA 2CBVA 1RP9A 5CLTA 4HMDA 1JNEA 2WK2A 1OIFA 3G6LA 1LJYA 1CWYA 2UY5A 2XIIA 4H7VA 4FLOA 3L4XA 1UD2A 3VMPA 5CLWA 1W3HA 2CNCA 4CUCA 2YDQA 3PTQA 1Z32X 2EBNA 1UG6A 2PWHA 1IZJA 3BH4A 4GI6A 3OLDA 5M17A 4Z2GA 2GJPA 2J8GA 4JIEA 2X0HA 2WANA 1DWGM 2E3ZA 4HTYA 4OKDA 3L4TA 4PSPA 1ISXA 3SCWA 5DO8A 3GH5A 1CENA 4J3WA 4BQ5A 3B9DA 1OT2A 3PBGA 1JYWA 3VD7A 4U33A 1TVPA 5I79A 1WPCA 1Q6FA 1HKMA 3CIVA 1TUXA 2ZIDA 4D6CA 3MSGA 3IJ7A 1WDSA 8A3HA 3SCTA 1FH8A 3L4WA 1K9TA 3TTYA 2DT3A 3WD0A 4AD5A 3K8MA 2VNCA 4LYPA 4H2CA 1WNOA 1M53A 3OZOA 3AS0A 4OBSA 1QHZA 3SCNA 3OG2A 4XUYA 5IFTA 1O7AA 3VNYA 4J28A 3WQ4A 1PX4A 2VCAA 1JFHA 1FHDA 2Y24A 4V2XA 4MNMA 3NJ3A 1E6XM 3BAXA 1HVXA 1UR2A 3VKKA 3T09A 3VMOA 3WUBA 5CGTA 1E3XA 4B15A 1KBBA 4IUGA 4ZENA 2CKSA 1LL7A 1OT1A 2YL5A 3BC9A 1EDGA 1BGAA 1BVNP 4MB1A 2OLHA 3B9EA 1C92A 4FMVA 2D3NA 4OBRA 1TFVA 1E1EA 2WBGA 2XYLA 3UR8A 1GNXA 3UG4A 3IJ9A 4JL1A 4P7QA 1W3KA 4WJXA 2JEPA 4F9DA 1A3HA 3K4AA 3W24A 3WQVA 3FHQA 3ZQ9A 5D4YA 1QI4A 3RO8A 3VD5A 1L0PA 2WM0A 1UR8A 4PEEA 4CVUA 3L4YA 2JFEX 2YIHA 3MUIA 1PZ3A 4A3YA 5FL0A 4J3SA 1ISYA 1QI3A 1V08A 3ZSSA 3T2QA 3CUGA 3AMGA 3WELA 4FK9A 5CPTA 3DHPA 3F5KA 1JI2A 2DIJA 4CN1A 3VMNA 3BAIA 2DSKA 2X05A 8CGTA 1UA7A 4JAWA 3OBAA 1BYDA 1DWHM 1E43A 4DWSA 3BAKA 4D6IA 5IHRA 1JL8A 3KL5A 1LL4A 1E6PA 1C8QA 1GJUA 4P8UA 3NIYA 3AS3A 1M03A 2W4XA 1QNOA 4UQAA 4ZXLA 1EO7A 2NT1A 5ABFB 1DP0A 3A6OA 4YHGA 1UHVA 3WEOA 4U2YA 5IXEA 1W32A 3TA9A 4WK9A 1UWRA 4WLCA 3WNMA 4AZCB 1MFVA 1NARA 3RM8A 1X6LA 1JYXA 1U33A 1BPLB 3EBVA 1VIWA 2X8RA 2OSXA 4FF5A 4UZUA 1BSIA 5A69A 3ARWA 2D22A 2J7CA 3ZT5A 1EDTA 4AZ7A 3WUEA 1OB0A 3LPFA 1OSEA 3WMCA 3W6LA 5F7UA 4NZCA 2D0GA 2WMIA 4MJ2A 4M80A 4Z2IA 1R7OA 1QNRA 5FOOA 1J9YA 1XSKA 1E0VA 4ATLA 5CXPA 2NSXA 3U5YA 3MUY1 1K9FA 4PMNA 1J10A 1CECA 1JIBA 2ZUVA 3I3EA 2J7BA 3VX1A 2ZX7A 4LGXA 1CXEA 1EH9A 3WNKA 5A8PA 4JKKA 3AMKA 3FAXA 5A6SA 3L4ZA 3DECA 2BVTA 3A4WA 1UKQA 3I3BA 2VT0A 2G3NA 1KQYA 3VDCA 2WLYA 1H2JA 2W61A 2QMJA 4AXNA 2IXVA 1HL8A 3L2MA 4PMYA 2ZUSA 3DYOA 4HPHA 1UA3A 2DT0A 1V3IA 2C0HA 2UWFA 1FHLA 1X1NA 1Q4NX 4LYQA 2WVVA 1V3LA 1VBRA 2CYGA 4CCDA 4CVWA 2Y2WA 4BF7A 1AQHA 2O9TA 3GDBA 2WWDA 4UZSA 2WLZA 3AIVA 5ABEA 1XGZA 1WDQA 1KWGA 1D7FA 3ARQA 1KBKA 4H8VA 2ZWZA 2WB5A 1UKTA 4BQ4A 4HPGA 3WEZA 1ZBCA 4CD8A 2GDVA 1JZ6A 2VURA 4CCCA 3WEMA 4PRWA 3DHUA 4W5UA 1OD8A 4KH2A 1B9ZA 1WDRA 4U5IA 4GXPA 1CYGA 4X0NA 4AIOA 1W3LA 3GXIA 3VGFA 4ZXOA 1JAKA 3CZGA 1E5NA 3AIWA 1CDGA 3BGAA 3CTTA 1EO5A 4B3LA 2J47A 3BSGA 4DM2A 3VIFA 1RD6A 4JFVA 5CG0A 2W91A 5BXPA 2D24A 1NWSA 1UH4A 3ARRA 1JZ7A 1BYBA 4CKQA 3AZTA 2A3BA 4GIAA 4U31A 1A47A 1E70M 2E9LA 1J18A 2F2HA 2ZUMA 2DPEA 4UQ9A 3SEPA 3CLWA 3FHAA 4W87A 3A4XA 1KCLA 4PMDA 1CGXA 2ZWYA 3MMUA 3N12A 1Q6EA 3F4VA 2YA2A 1ISZA 3KWXA 4YPJA 1C93A 4UFKA 1LQ0A 1NWTA 1BTCA 4ATWA 1HL9A 3AROA 1NOWA 1CXLA 3KL3A 3N18A 4PMOA 3D5HA 4TXEA 3PZMA 4EK7A 4UQBA 5D8ZA 3W81A 3PTKA 1NM9A 1V3KA 3TONA 5C8BB 6TAAA 4ATDA 1WKYA 1EDQA 4AIUA 4JKMA 1ITXA 1LG1A 1OGGA 2F8QA 3AHYA 2WCGA 3THCA 2RGLA 4HOXA 4D6JA 2F61A 3WF2A 5CQ1A 3ARXA 2OYLA 3W4RA 3WFZA 5E09A 5D9NA 1BQCA 4U3AA 3CZJA 2WMHA 4DWSD 1GQJA 4J27A 3WQ8A 1V02E 1VJSA 1JZ4A 3KEHA 2YBUA 3UESA 1J01A 1V6YA 1XSJA 4W7UA 2FGZA 1J0HA 5E6YA 4NI3A 4ACZA 1UKSA 4PCSA 3ZJ8A 4HMCA 3WDJA 4IPLA 4GO9A 3PHAA 3CHFA 4CD7A 3WKZA 1KB3A 2VCCA 5A2AA 1JDDA 4NF7A 1UD8A 4JL2A 4M82A 3VD9A 4ML4A 3K1DA 4EANA 1UZ4A 1VFFA 2E40A 1NP2A 4GI8A 3LMYA 4LXFA 1E6RA 3N13A 3A47A 2J79A 4A4AA 2VVSA 2X1IA 3OB8A 1OBAA 3ZMRA 5DEZA 2YLAA 3BMVA 1UD6A 1TA3A 1VEMA 3M6DA 3SCPA 2J25A 1WO2A 5DMYA 1UH2A 1BG9A 3APGA 2QPUA 3ZR5A 3AMDA 3WIJA 1EHAA 3S2CA 4GKLA 1JD9A 2ZX6A 3QOKA 4HA4A 2BHUA 4S3JA 3ARTA 2E9BA 1UUQA 3PZQA 1W9PA 5LYRA 1Q6DA 3U57A 3VTRA 2YJQA 1GOMA 3SUSA 1VEPA 4MAZA 2VX6A 3ARSA 2PWEA 3AIBA 3VIGA 3CO4A 3RIKA 2BNJA 1UKPA 3N1AA 3IAPA 3LPGA 4AZIA 4PMRA 1CXKA 4H41A 4E8DA 4MNKA 1MXDA 3PZVA 1TCMA 1K6AA 2XIBA 2DSWA 3PZTA 1G01A 2O9OA 1E72M 3NYDA 4C7DA 3ALGA 1TG7A 1US3A 1YQ2A 1QOXA 3RM4A 1J12A 1H49A 3AHZA 2VZVA 1SMDA 3UCQA 2OWWA 3U7VA 2PBGA 2IXUA 2CHNA 4MB3A 3TP4A 2EQDA 1JI1A 3UG3A 1SR0A 1NH6A 4OOUA 3UG5A 1CNVA 2PI6A 1UWQA 1E40A 1G0CA 1C7TA 1F4AA 1I1XA 4EE9A 4CU7A 1GQKA 3VIOA 4F9JA 2J8FA 2VZUA 5IHSA 2XFFA 1WZKA 4AZHA 2BV9A 1PIGA 1J0KA 1CXFA 1UR9A 1CLXA 3FXYA 2XM2A 5AC5A 2XG9A 1VB9A 4BS0A 1RPKA 2J7HA 4AY1A 2GFTA 3CZ8A 3AI0A 4MNJA 3I3DA 1E4LA 2XSAA 2YA1A 2DT2A 2YLLA 2OWCA 3WN6A 3QR3A 3M46A 2WMIB 1Y7VA 3ARZA 4HA3A 3W28A 2WBKA 2XGBA 1VENA 2VRJA 3SUUA 1XH1A 2G3IA 4W5ZA 4UQDA 3ZT6A 1OINA 3K4DA 4P8WA 3W53A 2BS9A 4M29A 2ZUNA 1XSIA 3WF0A 1H3GA 3QHOA 2WHJA 1GZJA 2JALA 1C8XA 4PUEA 5D9PA 3WENA 1HKKA 3VIPA 1V3JA 1W9UA 4WKHA 4QFUA 1AVAA 2GVYA 3AXXA 4A3HA 1C91A 5EB8A 2DSUA 4AZGA 1B3YA 5IFPA 1V0MA 4JFUA 2GDUA 3T0DA 2JE8A 1E1FA 4U5KA 3RJYA 1VBUA 4IM4A 3AYSA 3EDKA 2CPUA 1H41A 3ZM8A 3BLKA 4P8XA 2OYMA 3O6AA 1GQIA 4AZ6A 4B16A 3AIEA 1P6WA 4RE4A 3AISA 3N11A 1BGGA 3CHDA 4W86A 3J7HA 4W84A 4RE3A 1UWTA 1GOOA 5E6ZA 5A6KA 3JUGA 3T0BA 3BXWA 2YL6A 3GXMA 4JFSA 2EPNA 3OA5A 1GPFA 1VFOA 2GJXA 4LQ1A 1V0LA 3VOCA 2ZXBA 1BYAA 3O9NA 4JCLA 4BCEA 1E55A 4PTVA 1QVBA 1EHNA 3GNOA 2VZTA 1QI2A 3GNRA 3W29A 4TX6A 2ZUTA 3T2OA 1Q6GA 4WKFA 4E8CA 4D6DA 2A3HA 1HP4A 4H8UA 5DT7A 3OLEA 3MV01 3U7BA 3WD4A 4M1RA 5DFAA 1QNPA 1MW0A 2BVYA 4AC1X 3TTOA 5I78A 4P7OA 4PYSA 3WBAA 1JF5A 2DQXA 4H04A 4LYRA 3WH7A 3WF1A 3ZJ7A 4GZEA 2CBUA 3K8KA 4HU8A 3WQ5A 2WW5A 1AMYA 4CU6A 2G4FA 1R8LA 3WL1A 4IISA 3ZJ6A 1BHGA 1UQZA 3AIQA 3T2PA 3VX0A 5JBFA 1JYNA 2WKGA 2XFYA 3BAYA 2CKRA 1LWJA 5HPCA 3PZOA 5LA2A 2EEXA 1CTNA 2O9RA 3WFLA 4TUFA 1UYQA 1B3WA 2EPMX 1CZ1A 2PWFA 4TOQA 2MANA 1E9LA 3OZPA 1JG9A 3M07A 1JGIA 4R27A 1X6NA 2A3AA 2BY1A 3FAWA 1VFMA 2VR5A 3VIIA 3IAQA 3WDQA 2CITA 1W2PA 1XYFA 1RH9A 3WL0A 3GNPA 1PX8A 1VJZA 2QPSA 1GORA 3ZR6A 3PZNA 3AZRA 3CMGA 1AQ0A 2XTKA 6CGTA 3K8LA 1UD4A 1GHRA 1PAMA 4PBGA 2XFRA 1W9BM 3DYMA 4GQRA 2W62A 2WWCA 1M01A 1OD0A 1R85A 2NT0A 2VQTA 3TTQA 1QHPA 2PWGA 2ZXQA 1CGUA 3EMZA 4MDPA 2EJ1A 3KL0A 2QF8A 1GONA 4MADA 4PMXA 2VZOA 1ECEA 3BCDA 1UWSA 3WF4A 4B9YA 3CMJA 1HKIA 2ZUWA 4L4OA 1UWIA 2VZSA 2YBTA 1EA9C 1SMAA 1HJVA 5GNYA 5JUVA 5C70A 5A6AA 4WSKA 1KXHA 1JYVA 5BRQA 3WQWA 4W7WA 2YKKA 3W27A 1BF2A 4GPNA 3S6TA 3CPUA 2VCBA 2WKLA 2JIEA 3VIJA 2EXOA 5AC4A 4CU8A 3T08A 4UTFA 3VM5A 2BHZA 3N17A 1B0IA 1V6VA 2Z1KA 2AOSA 5A2CA 4TX8A 2ZX8A 2D3LA 3MV11 3CH9A 4QAWA 3AXHA 1JXJA 2C8NA 4V28A 5E0CA 3WSUA 1B3VA 5JH8A 1FH7A 1LL6A 2G3MA 4HZ6A 1B3XA 4P7NA 1XRVA 1NOUA 4GO8A 4AD3A 2VRKA 5EBAA 2VMFA 2CESA 3AQUA 5KEZA 3CZKA 5EFFA 1KR0A 2E9MA 2CBIA 3THDA 2W67A 4WIWA 4J3UA 3VGEA 9CGTA 1XCXA 2GK1B 3RILA 3FNDA 3CUFA 1OGBA 5I23A 4OIFA 3WMBA 4L4PA 5BXTA 3EDDA 2W5FA 5A94A 1E5JA 1GOIA 1IT0A 1V0KA 5GNZA 4ZE4A 1QBBA 5BXRA 2DDXA 3CHEA 2D1ZA 2J7EA 2Q8XA 1ESWA 4UCFA 1J0JA 5E9AA 3CUJA 5BRPA 2ZX9A 4NSBA 4B9ZA 2RGMA 4M56A 4B3KA 1UKOA 2WCSA 4QLLA 2XVLA 3GTNA 4XZWA 5A3HA 1GHSA 4XZBA 2BXZA 3OIHA 4OZOA 2CIPA 4QCFA 2NW0A 3L2LA 7CGTA 1OIMA 1ZJAA 1NQ6A 7TAAA 2YDSA 1BLIA 3CBWA 4BQ2A 2XVNA 4D6GA 2IUZA 5A6LA 4QDMA 2Y4SA 2VUYA 1L8NA 1E0XA 2Y8VA 3CZLA 1NWRA 3GH4A 1MYRA 4GINA 3NSMA 4AZCA 1ODZA 3CUIA 3K46A 1CGYA 2D20A 1E71M 3OGRA 3BCFA 2DSZA 2WVTA 4ZE5A 1TZ7A 4NRRA 5I3DA 3F5JA 3OGSA 4QLKA 3SCRA 5AYBA 1MQQA 1OM0A 1HJQA 4UFJA 4Y7EA 1B90A 1KWKA 3ARPA 1I1WA 1HF6A 5I5RA 2E0PA 5BYWA 1W9VA 4QP0A 3VPLA 2DH3A 3L4UA 1JDAA 3WNPA 4YHEA 4CD5A 1TE1A 1JNDA 4X0VA 4PTXA 3VDBA 2EPKX 2AMGA 3WD3A 5A8MA 4UFLA 4X9YA 3EDFA 2J77A 1CEOA 2PF0A 5CSYA 5EMYA 1HJSA 5HPOA 2V3GA 3VIMA 1UQYA 1RP8A 1XC6A 3EMQA 2VC9A 3G6MA 3KZSA 4FLQA 2BVDA 2V5DA 3GBDA 3QGVA 3ECQA 1UD3A 3GXFA 1JFXA 4R5EA 1H1NA 2UY3A 1H0GA 4UR9A 4EKJA 4IPNB 1DWJM 4AZ5A 3WNLA 4CD4A 3WY1A 1JAEA 2FHBA 4WSJA 2Z1SA 1VAHA 2DGAA 3SCQA 3VINA 4JCMA 4HMEA 2XVKA 4PTWA 1G1YA 1DWIM 1WB0A 4N0RA 3VIKA 3AJ7A 1BAGA 1LWHA 5JBDA 1JZ5A 4QCEA 4W8AA 3SCVA 1MQRA 3AFBA 1HJUA 2GJXB 2CXGA 1E4IA 1MXGA 1HN1A 5HNNA 2W63A 4TTUA 2HVMA 5A2BA 2EO7A 1UR0A 3WDRA 3RJXA 5FL1A 2WVUA 1E6NA 2X2YA 2DEPA 2ESCA 1CGVA 3RCNA 1B1YA 3LPPA 4J3VA 1GOQA 1B3ZA 1R7AA 3W82A 2V5CA 1DEDA 1W3JA 4DWSB 2WC3A 1ZB5A 2DT1A 3MUZ1 2J7FA 2X0YA 5HBFA 4RE2A 4AIEA 4UOQA 1D2KA 3VIHA 1GOKA 3SCUA 1LLOA 3CUHA 4XX6A 2PB1A 5GNXA 3WD1A 3HU7A 4WF7A 1BVZA 4K68A 2JEQA 1UR4A 3W25A 1ZS2A 2J75A 1ZU8A 3ZIZA 1J0IA 1WP6A 3PZGA 3POCA 1KXTA 4M81A 1ITCA 1NOFA 2X09A 4AYSA 1MFUA 2OWXA 4EAMA 2DH2A 3MU7A 1FOBA 4GQQA 4ACYA 3SCOA 2WHMA 2FHCA 2BY3A 4Q7NA 2ZE0A 1PIFA 3HN3A 1MW3A 3L4VA 4UQEA 4AD0A 1V6WA 3TOPA 4KWUA 3WQ6A 4P7LA 3SIMA 3DC0A 3WUGA 1QW8A 2XJ7A 1ISVA 4MB5A 2VQUA 3MO4A 1H09A 3CGTA 3AICA 3EMCA 5KZ6A 1QNQA 2WC7A 4HP5A 4C7FA 4OOZA 1QHOA 2PWDA 3GXDA 5HDRA 4AW7A 5JIPA 2D0FA 5D9OA 3OGVA 1CIUA 1M04A 2BY2A 5I77A 3A4AA 4M8UA 1JZ2A 1DTUA 2XSBA 1PBGA 3IK2A 1TVNA 7A3HA 3TTSA 2WHLA 1GVYA 1MW1A 5FIPA 1KGUA 4JHZA 2E8YA 5CPSA 3W38A 4UOJA 1YHTA 1ODUA 3WF3A 1XH2A 1ZBWA 1EQPA 4MJ4A 5I2UA 1UH3A 5A95A 3ZOAA 1I75A 3ALFA 2FH6A
chains in the Genus database with same CATH superfamily
2AL2B 4DJFA 4QIUA 3HURA 2YFNA 1JDEA 3RXZA 1Q13A 2BP1A 3EOUA 3LBCA 4MPKA 3QMRA 4P2VA 4WY0B 4AXKA 2E6FA 3E5PA 3W1PA 3ZSTA 2QF7A 3NOYA 5ABGA 3B03A 1V3HA 2NQJA 1MUWA 1N1AA 5CPLA 4IHCA 3RM9A 4A8NA 1CXHA 3AMLA 3WH9A 1Z69A 3H4GA 4MUZA 1NSGA 1DHKA 1P6BA 5ABHA 2VWTA 1PDYA 1OG6A 1FDYA 1OQFA 3AIUA 4LCSA 3UP8A 4URIA 5G1YA 3DYPA 1J0YA 4OTKA 3O1NA 3VNZA 1X8FA 1V0NA 2A3EA 4FX8A 3DFHA 2QJNA 2V8ZA 1L6GA 2WCAA 2A85A 4IH3A 4XSLA 4RZ5A 4DVOA 3UZWA 1U79A 2IKIA 3WQOA 4XIMA 4JTCA 4MNLA 1LZOA 4BZYA 4XO6A 3UY8A 2J62A 3LCGA 3BMXA 2IMRA 2XDFA 1W5QA 3N15A 3RUBL 3WZ0E 1FWJC 5AHFA 5FF0A 4KMQA 3RITA 1FCUA 1JXKA 1OYAA 3UF8A 1F9CA 1E6ZA 3MKKA 4LEQA 1BWLA 5A6MA 2DJXA 3NDZA 1Q66A 3ISIX 1Q6CA 2BHYA 1PV8A 1SSGA 5FJRA 2V3DA 2D69A 4FOJA 2E7FA 2FZ9A 4K7YA 1U1UA 1TPUA 2NXHA 2F2DA 3OVPA 1JF6A 5F4WA 4HYWA 4RX0A 3D0CA 3R12A 4RDWA 3PUEA 4H9MA 4ZFCA 4MHBA 2ZE3A 2W92A 4DAIA 3RNDA 3IEBA 4XAZA 4H8HA 1TRIA 3KRSA 2O9PA 2ZICA 4AY8A 5K4XA 3BAJA 1C7SA 1DXIA 3R43A 1G94A 5EA9A 1TTJA 1A0EA 1HJWA 1GZ1A 3BW3A 4ACZB 1FP8A 2QLYA 4GZJA 2D2OA 4XB3A 1Q6QA 3OYZA 2DG9A 4XV0A 3NQ2A 3LX9A 4C1LA 3T0CA 3MSRA 3W02A 3UF9A 2X30A 2FIQA 4C6EA 1V3MA 2WMFA 3ARUA 1E73M 4FF7A 1IXOA 3KS6A 4HU0A 3O5PA 1X97A 4IPPA 2R82A 3GTXA 1EYMA 4DF1A 4N42A 2YDRA 2GSJA 5KZMA 4NU7A 3QN3A 5CJNA 5LA0A 3PBWA 3VFLA 5F1UA 4TVDA 2QV4A 4M24A 4PMVA 4IT1A 2CETA 3BLPX 4C1KA 1FWEC 3NQVA 3G0UA 3A9BA 2OFJA 4IL0A 3W83A 3BQ5A 5EU9A 5CGQA 2B31A 4KWOA 2GJRA 2WMJA 1ROUA 3BLLA 1R87A 5C7HA 1J0ZA 5HA7A 1CLVA 3MYOA 3N3MA 4LPCA 1U5JA 1KCKA 3XIMA 1ZY9A 3SUTA 2YXXA 4HBEA 3LHUA 2OLSA 1O5RA 2E09A 4BKNA 1LRNA 3U48A 1PCKA 1QK2A 3IVSA 1UB3A 4D72A 1FA2A 4DJED 1TPEA 1XYCA 2BLEA 4P5UA 2PDQA 3CV6A 1E44A 1GCYA 3G0XA 1V03A 1WCGA 4UFMA 1LQAA 5CJ5A 4HNNA 4C90A 3KAFA 1FH9A 3OYXA 4C6MA 3VD3A 1W1IE 2ZZ2A 4ERGA 1IXQA 2IPFA 1QI0A 1VFUA 3P2VA 1F73A 1AJZA 1G7UA 4W8BA 1K8YA 2VGGA 3S5SA 4DZ5A 4MZ1A 2C1IA 1TR1A 4NZFA 1HO4A 3QKEA 1QI5A 1BRLB 4FR1A 4CGTA 4NZJA 1W1PA 3EWXA 3VGBA 2XWDA 4QE4A 3MS8A 4JQ2A 4BK9A 2WNWA 4NL1A 1XBVA 1E3ZA 3EGJA 3TUUA 2CEQA 3PZUA 1CGWA 4IP4A 1MW2A 1TQJA 3GH7A 2QYGA 3TV8A 5HR7A 3NDYA 2CWXA 3TAKA 3VOHA 3AUJA 2ZQSA 1CXIA 4DBDA 4JTTA 4DWSC 3W6MA 4CD6A 4KFPA 3WDHA 4AWUA 1AQMA 4S3KA 3PFRA 3BG3A 3WLSA 3PM6A 3BICA 1EJ7L 4DUXA 4BI7A 3FJ4A 1F40A 1XRTA 2Z1XA 3B0XA 1OFOA 2Z1BA 2D23A 5A8GA 1D3GA 4DF2A 3UEQA 1FD9A 1PB0A 2YL9A 3K4WA 3UETA 1D7IA 1GJWA 1GG1A 3KOFA 4ZOAA 4FNTA 2X40A 5HNUA 4CNPA 3EOLA 3C56A 3EYPA 2DZTA 1OCQA 6ENLA 1SJBA 4UB9A 3M47A 4LU0A 4AD2A 2WVSA 3KABA 1XDJA 2VVNA 3JVAA 3MMDA 4DO7A 1FFRA 2YXOA 1QNVA 2XUCA 2FB2A 4N2YA 1VRDA 3NPXA 2XP3A 2VX7A 2ZA2A 1UJPA 1ZBKA 4FHAA 3EDJA 1HL2A 4HSOA 3LG3A 2MLZA 3Q67A 4W7VA 4A35A 4PUDA 4Z2KA 1SJCA 4I6VA 2G96A 1TPFA 4LVAA 1WE5A 2R1LA 2WMKA 3TJ4A 1AODA 1F6PA 1P0DA 3EEGA 2QDHA 3GDKA 4AG0A 1PBKA 4FS9A 1SUXA 4M3PA 1XLKA 5JH1A 2WSKA 1ELSA 3OOQA 4CN6A 3F2DA 4AEEA 3VC5A 2QZRA 5I02A 2EJAA 4QDPA 3QHNA 1JEZA 3QHMA 2AQWA 2P4VA 3SCSA 4NP7A 5EMJA 1F4HA 1W56A 3TLQA 2EHHA 3KBSA 4A3RA 1NMWA 2XP9A 1NWUA 1GOWA 1MDRA 1E4MM 3MHUA 3MA8A 5A6BD 5I00A 2FTWA 1FDJA 4I7UA 4TR9A 3OVQA 4A29A 1EXPA 3GR4A 2J7DA 2X1SA 4DM1A 3VC6A 3GZAA 4O50A 3CH0A 4AUBA 3W75A 1UASA 4PSRA 1XYLA 4JIRA 4GIEA 3MANA 3TN6A 4HOWA 3GXPA 3WQFA 2VM8A 4GVGA 1H0IA 3S5OA 5CLTA 1JNEA 3N14A 4FLOA 3ZZ1A 4XWUA 1Z32X 2O55A 3DBPA 4AEOA 1W3IA 3BZJA 4GUFA 1XLAA 3BH4A 4Z2GA 3NQ8A 3VKJA 2GJPA 2Y7FA 2WANA 2E3ZA 4HVXA 2VDGA 3SCWA 1ICQA 3GH5A 3B9DA 4AF0B 3PBGA 4W4QA 5HT1A 1JYWA 3ITYA 3A64A 1DV7A 3V36A 5I79A 2MUCA 3BMBA 1M7OA 4D6CA 4E2BA 2CZFA 3SCTA 3LCLA 4MY8A 3DU0A 9XIAA 5I03A 4Q4RA 2DT3A 1MUMA 2VNCA 4XUYA 1O7AA 2HS8A 3S4TA 2XGZA 3GXNA 2Y24A 3OW1A 1E6XM 3W2LA 1HVXA 1UR2A 1KRAC 1E3XA 3SI9A 1UP3A 4PE8A 3STFA 4BHYA 1EDGA 2P5NA 4FMVA 1E1EA 4PL2A 2PDKA 3LSBA 2XYLA 1VLWA 4S39A 1GNXA 4UNKA 4LBSA 1VR6A 4JL1A 1W3KA 4F0HA 4LUTB 2JEPA 4I9TA 4F9DA 4DB7A 4MMWA 3VE7A 4HJWA 1EC9A 2F84A 5D4YA 3ZQ9A 1QI4A 4LB3A 1C9DA 2YIHA 3MUIA 4C6OA 1KTNA 3EZ4A 3C52A 4WGXA 1QI3A 4POCA 1EYWA 2R94A 1Z44A 2R1NA 1RXOB 5DXXA 3F5KA 1ZNNA 1FHUA 2DSKA 2V2HA 3OZYA 4JAWA 1M65A 4OE7A 4EF8A 1E43A 4D6IA 4PCFA 5IHRA 3E02A 5B80A 3QW4B 1A5SA 3KFTA 1TX0A 1SGJA 2YCLA 1JVWA 1E6PA 4ZA0A 1C8QA 3LV6A 4JN7A 4ADUA 2CLHA 1XXXA 3QY6A 4C02B 2WSQA 5BNKA 1XPYA 4ZXLA 3QLLA 2B5UB 3RX3A 4YHGA 1XBXA 5T9CE 3O5KA 3EWUA 5IXEA 1HQTA 1W32A 4ZO8A 4JNMA 4WLCA 4DJDA 1GZGA 3D46A 3OVGA 3SO7A 3HFTA 4A22A 2EF9A 1YNPA 3W7QA 2X8RA 2OSXA 4DRMA 5AHIA 2IQ0A 1DIKA 4H01A 3R79A 5JVLA 2EULA 2J7CA 3ZT5A 3BARA 1OB0A 3K13A 4GJJA 2A2IA 4BJHA 3L0NA 4FXFA 5J5DA 1YXYA 1TIMA 4Z2IA 5G2IA 3UWQA 1E0VA 4ATLA 4D8ZA 5I3GA 3S1XA 5FF4A 3Q45A 4IG2B 4JX4A 1F07A 1S38A 1F3WA 1ME9A 3IJQA 4QNWA 4N6EA 2J7BA 1LOQA 1ZCCA 3VK5A 3ATYA 3DUGA 1YIXA 1EH9A 1YYAA 4MIMA 2PE4A 3AMKA 1GKPA 2G3NA 1L6WA 3R5EA 3VDCA 2WLYA 5ABTA 2Q8LA 3NM1A 2G50A 1MMFA 3IIPA 4FPSA 1ZP4A 1HL8A 3DENA 4PMYA 1UA3A 3FV9A 1K7FA 3M0XA 4I90A 2PDLA 4CCDA 4J5NA 4CVWA 4V1XA 3KBWA 1QZ2A 1AQHA 1IIGA 3UXDA 3UD6A 3KZ7A 3PANA 5ABEA 1K77A 1SW7A 1RLCL 3PRAA 1LLWA 4NAEB 1MZHA 3ARQA 3UU0A 1IT8A 4LAVA 1VD6A 1UKTA 3R8HA 3FJ6A 3W1QA 2GDVA 5XIMA 2VURA 4ODKA 3GVVA 3GC2A 5DBTA 1XC4A 4NXSA 1OD8A 4YVXA 4LY4A 4KH2A 3LV5A 1WDRA 3VI2A 1W3LA 4HA0A 3GXIA 4ZXOA 4H2HA 4HK7A 3IUDA 1RJRA 3AIWA 3FA4A 1YW5A 1UUMA 3BSGA 3P61A 4HPXA 1JUBA 2ZQUA 1S2AA 4MSSA 3W00A 2PMQA 5HNTA 4KW2A 4WDXA 2PDMA 5FJJA 1MNSA 3BOFA 1X38A 3LGEA 2PODA 1E70M 2F2HA 1I2QA 3NXLA 3BLIA 2QCEA 1KCLA 4PMDA 3QYQA 2MF9A 4R9XA 5LIYX 4OECA 1Q6EA 2Y1HA 5FSEC 1K4HA 4Q6XA 2YA2A 4E3TA 4OVXA 2Q8ZA 2KFWA 4UFKA 4WSHA 2V5KA 3NQMA 4ATWA 3AROA 1AD4A 1NOWA 1XX1A 2HNEA 1SZNA 2PC4A 1J79A 4EACA 2XFWA 1FXQA 3BVJA 3N25A 4LRTA 1PTDA 1O12A 4PUJA 3NDOA 3OA3A 3LLFA 5D8ZA 2EG7A 1NM9A 1V3KA 3VCCA 3W81A 3WLMA 1F3EA 6TAAA 4O1CA 1RCXB 3LY0A 4JKMA 1LG1A 1OGGA 2F8QA 3AHYA 3W22A 3RLVA 1BXCA 3THCA 3WF2A 5BZAA 4HHMA 2OYLA 3W4RA 4HU4A 4IIHA 3WQ8A 3O15A 3VUSA 3VZXA 4FNRA 1VJSA 3AXKA 4GYKA 4Z1AA 4CNNA 3UESA 2E5BA 4W7UA 1EF2A 4GVHA 2WJEA 4PCSA 3OHMB 3UVAA 4HMCA 3F4DA 3NEHA 1ME8A 4G7EA 2VCCA 3PSWA 3ZS4A 5A2AA 4DZ3A 4CQ8A 1LT8A 4M82A 1GG0A 2ALRA 4ROQA 4EANA 4L1WA 1F05A 1ONEA 2E40A 1I45A 1IWBA 1CB7B 3QV8A 3E2SA 3M7WA 4GI8A 4GYJA 2Z2AA 3DBNA 4LXFA 3AWOA 4FXSA 4NNRA 4INFA 3GXTA 3QTPA 3OB8A 3V1HA 3TWBA 3LERA 1YTDA 4NHVA 1GYMA 3WLKX 1HG3A 3SCPA 1VEMA 3M6DA 5IM51 4PUMA 1YPXA 2XN0A 4DZHA 1BG9A 4ADTA 3G1SA 3APGA 2E6YA 3CTLA 3AYTA 3RU6A 4Q3MA 1JD9A 5FJPA 3LYEA 2BHUA 3EA3A 2E9BA 1W9PA 1W54A 3DFSA 2UZ5A 5FI8A 1BEUA 1UMLA 5DO2A 2H90A 3W88A 4RNJA 3AIBA 4RNFA 2NVCA 4QBXA 2DJLA 3HFYA 4K39A 1UKPA 3C2OA 3N1AA 3IAPA 2EPHA 4H41A 4E8DA 4FA3A 1MXDA 5I09A 1TCMA 4GIYA 4DY1A 2XIBA 3NQGA 1AW1A 2PTZA 1XLCA 4HIBA 3DGBA 1FKGA 5I98A 3ALGA 2BX7A 3LI0A 2NLYA 4B5UA 3AHZA 6XIAA 1QK0A 2E5DA 1JI1A 1FQ0A 4GGBA 1S2WA 3UG5A 2PI6A 3G2GA 1E40A 4IGMA 5FF3A 4LANA 1F4AA 4EE9A 2PU1A 1KLZA 1ENUA 4KQZA 3PPFA 2BASA 3SADA 1SZGA 3TQPA 3UY7A 3KRZA 4HSNA 5EGRA 2ZRVA 2J9ZA 1JCLA 2J7HA 4Q32A 2M1IA 2GFTA 1XINA 3AI0A 3KVJA 5BOFA 3A24A 1J4IA 3S46A 1OC6A 1Y7VA 3ARZA 4HA3A 2WBKA 2L2SA 4KEVA 2G5WA 4EF9A 1WKEA 3URQA 4XZ9A 1GEQA 2DW6A 2G3IA 2PDXA 4HBOA 3F1QA 3R1ZA 4ZOBA 3DFQA 4IMGA 1Q85A 2FPVA 4PB4A 3NL5A 3K4DA 4V33A 3W53A 3H53A 2OQLA 4GNVA 4RV8A 4Z1BA 4H9XA 1OX6A 1R5YA 1O4UA 1H3GA 1PHWA 2WHJA 3RRXA 1EX5A 3GG0A 4JYFA 1UPMB 3WENA 4PUEA 3PF3A 4LVBA 1XIEA 1NIUA 4WKHA 3H24A 4QFUA 4NZ4A 3ITGA 4MLRA 4JFUA 4NIRA 5DX7A 4U5KA 2QAPA 4IM4A 2CPUA 4HKPA 3FYPA 3BLKA 4DPPA 1GQIA 1M7JA 4DRJA 4CQAA 3UFYA 1XIGA 3AISA 1V79A 3N11A 1BGGA 4W86A 4UTLA 4AWSA 4X3ZA 1S2TA 1V7AA 4W84A 4FOUA 1TV7A 4HNVA 1PYFA 4AVNA 5MF5A 3ITOA 4L5ZA 2EPNA 1GPFA 5D32A 1VP5A 4V1YA 1GKRA 3FEMA 1LRTA 1H1YA 4IP5A 1V0LA 1YKWA 2AQOA 4K3ZA 1EIXA 3PNUA 3H2MA 4BCEA 4PTVA 4B5XA 1PDZA 2OO0A 1ROTA 1Q6GA 2JQXA 4JTHA 4G7FA 1I0BA 3BJSA 3IVUA 3O6DA 3WD4A 2C71A 3I6RA 4F0MA 2J9XA 4I8YA 4H19A 2HBVA 4P7OA 4PYSA 4C5YA 2DUAA 3WBAA 3NZPA 2DQXA 4J1OA 3QM3A 4NY2A 3HM7A 3WH7A 4Q4SA 3RYSA 3MCOA 4RJEA 4GBDA 5AC8A 3WF1A 3PBMA 4A3UA 1W1ZA 2VC6A 3E0FA 1S2VA 4GZEA 3LDVA 2X1TA 1IR2A 1DJIA 5D02A 4Q4KA 8XIMA 4DWDA 2G4FA 3V35A 2VFFA 1QU4A 1OZMA 5JBFA 2QIWA 3BAYA 2CKRA 4ZPTR 1LWJA 3ELFA 1O5QA 2NUWA 1LROA 1UYQA 1B3WA 1V4YA 1DJGA 4LV4A 2PWFA 4HU3A 4IT6A 3U2EA 3N9RA 1JG9A 3TQKA 3BURA 4R27A 3N9SA 3V0UA 4ZPVR 4G5DA 4ZOCA 3IAQA 3BQ6A 4DELA 2Y5JA 1XYFA 1C9HA 1FDZA 1CCWB 1RH9A 5I07A 1GORA 3ZR6A 3PZNA 4B5TA 3CMGA 2PTXA 1AQ0A 2XTKA 3B8IA 3DYMA 5LXEA 2WWCA 1M01A 4DUOA 1WAUA 4CQ9A 4RZ4A 1R85A 4RKAA 2NT0A 1GRJA 2VQTA 2PWGA 5XIAA 1CGUA 3EMZA 4MDPA 2CW6A 4IQLA 1I60A 2QF8A 2VZOA 3WF4A 1UWSA 2QEZA 4JICA 3CMJA 1FCBA 3AYVA 2VZSA 1F2JA 1EA9C 4JTIA 1XRFA 1M7PA 2K8IA 4CNUA 1YE6A 3NO1A 4YTQA 5JUVA 4WSKA 1KXHA 3KBJA 1JYVA 5LGZA 1PHQA 3WQWA 2B7PA 4W7WA 3W27A 5AOUA 1BF2A 3CPUA 4Y9NA 2VCBA 1LWIA 5LHFA 5AC4A 2PV1A 4UBPC 3T08A 3VM5A 1VFSA 5FEXA 3WCZA 2HNHA 2Z1KA 4TQTA 4TX8A 3LMZA 3MV11 4N7QA 3GPKA 2V9DA 3GB6A 1JXJA 2R24A 4AX6A 4B2DA 4DLFA 5JH8A 2G3MA 1B3XA 4P7NA 5EL1A 1A3XA 4Q8UA 1EJWC 3UQAA 3AWNA 4J9JA 2FZBA 4K2SA 3TCSA 2VMFA 3XISA 2CESA 4YCPA 2VN1A 5F4SA 2V81A 2VXNA 4E4FA 4F4RA 1WDDA 3U2CA 4PFMA 3RLHA 2E9MA 3HTWA 3PK7A 5D2XA 3KBMA 3W72A 2CBIA 2C1HA 3UWYA 4WIWA 1D6OA 9CGTA 3FNDA 3TCZA 1V93A 3C2EA 3CUFA 2ZRZA 4GCXA 3UWZA 3VOJA 1GTEA 3EDDA 2TRSA 3V75A 1V0KA 1QBBA 2D1ZA 2J7EA 2P10A 5HNRA 4IQCA 1J0JA 5E9AA 3CUJA 2ZX9A 3C8NA 5HW6A 1BWKA 1KO0A 4NSBA 4JY8A 4M56A 2ZA3A 4B3KA 3IUIA 1PWLA 3WLTA 1R47A 4JIQA 4M19A 3UPMA 1XDLA 1GHSA 3OIHA 3MKVA 4WD0A 2V82A 2PP0A 4QCFA 7CGTA 1OIMA 1BLIA 1KBIA 3BLDA 4XISA 4BI5A 5D33A 4D6GA 4QDMA 3GG1A 4QQ3A 1FJDA 4KEZA 3QSTA 4FNSA 1NWRA 1SQ7A 4ZO6A 1MDLA 3NZGA 1D3HA 4AZCA 1E51A 1ODZA 5FJOA 2B7NA 5CBIA 1E71M 3OGRA 3PUGA 2DSZA 5HKGA 3G1HA 5I3DA 3IJ6A 4GWEA 3F5JA 4ADSA 1ITQA 3OBEA 4JFMA 4Y7EA 4K1GA 1P7TB 3FFSA 4QE1A 3A4JA 1KWKA 3EPMA 1I1WA 2BWGA 1T7LA 4QP0A 3L4UA 4YHEA 1CI1A 1Z9AA 5EBUA 4Y6GA 2Z28A 3VDBA 4XBKA 5G4WA 5DCDA 3CHVA 2AMGA 4KRZA 1QR7A 5A8MA 4UFLA 1SFLA 3EDFA 5HQMA 3OJGA 1R3TA 1CEOA 2PF0A 1R2RA 4WHBA 3W85A 3VIMA 4S3DA 2D73A 3KUMA 3LTYA 1I4NA 2ZQVA 1EJRC 3QGVA 4BEUA 3URBA 5E5CA 1P4CA 2UY3A 4UR9A 2INZA 3UVIA 2XP7A 4CD4A 3TA6A 3WY1A 1UIPA 2VGBA 3DC8A 3O5LA 4IPIA 1JAEA 1RA0A 4PL1A 2FHBA 4WSJA 3R8GA 4UDMA 4JTKA 3G3DA 3N6HA 3NQ6A 2P0OA 1UBPC 1A5OC 4DYEA 3VIKA 3WJXA 1MQRA 4DYKA 4HMNA 1MXGA 1XLDA 3SY8A 1HN1A 3TW6A 3MSYA 4IFKA 4QAIA 1UR0A 1KRMA 5FL1A 2VFDA 3P81A 5G4EA 2O7SA 1E6NA 2YDAA 1T8QA 2DEPA 2ESCA 1TCDA 3VKBA 1UBSA 3RCYA 2V5CA 1RALA 3HGSA 1T41A 1EWEA 4DWSB 1V6TA 3BTNA 2DT1A 1AK5A 1EZ2A 4GCAA 2KO7A 1LRQA 4UOQA 3EB3A 3SGUA 4F2TA 2PB1A 4WF7A 2O4MA 1BVZA 3T05A 4MOZA 5G2HA 1PE1A 2BOGX 1J0IA 3BJTA 3ZIZA 1R3WA 1A5NC 1KFEA 3NL3A 4DXXA 1GVFA 3POCA 4M81A 3M0YA 1BRLA 2J88A 1ITCA 3BUVA 3MQTA 1MFUA 3CT7A 3MU7A 1OFQA 3C5QA 1FOBA 3LU2A 1QASA 4GQQA 3F7JA 4IXHA 3SCOA 2OT1A 5DIUA 4Q7NA 3TC6A 1MW3A 4UQEA 4ILSA 1YEYA 2IW0A 4D8LA 3WQ6A 3SIMA 2QCFA 2DORA 4L64A 3UI4A 3HIJA 3AICA 1S2UA 2NVDA 4HP5A 4MVAA 2PDYA 1VFLA 1WDWA 2NQZA 4LS0A 3S5NA 2D0FA 1HO1A 3A4AA 1R3VA 3QQWA 3RU8X 1AFSA 2OR2A 4NQ1A 3B8TA 3M0KA 4IX2A 2WHLA 1M1BA 3Q94A 1MW1A 3B7XA 3UZZA 1UZDA 1YBQA 1A0DA 4FEZA 4HK5A 4A21A 3W38A 3NQDA 1A5CA 1U5VA 3BV7A 2PLCA 4MJ4A 2OB3A 2YXGA 2DZUA 3QW3A 4LCRA 3SSJA 3HBLA 1UH3A 5I3FA 4DJEA 4GPNA 4N4PA 3DDMA 4UTMA 1JZ3A 5D8WA 5C9XA 1ZAIA 2WVVB 4UXDA 1YX1A 3W7OA 3W23A 1ADOA 3ZJKA 3UA3A 4QS6A 3U4FA 2XIJA 1NF7A 2DY3A 1TMQA 4DRIA 4ZVJA 3A3XA 4C7GA 2QUVA 3A5VA 1MSSA 4YU1A 3W7EA 3EY6A 4I9JA 4S3AA 5HOSA 4R85A 1E56A 1W9XA 5CSUA 3F2CA 2HE8A 4LX4A 3STGA 2LGOA 4GI9A 2VFIA 3SUVA 3B9NA 1C8YA 5IRPA 4J7RA 4OUEA 3E12A 3O6CA 1KFLA 1FX6A 1TCOC 5JH2A 5HW7A 1LF1A 4DROA 1GPWA 1TWSA 1EOMA 4L56A 1DTNA 3KAGA 1K9EA 4C6KA 2E5CA 3IANA 2CERA 3Q37A 3UR7A 5A1AA 3NQCA 3UJEA 5AY7A 2VTFA 2VL4A 3U0HA 1TO3A 3AOFA 3GIYA 2W6RA 2ZUUA 1O6IA 4JX5A 5M1TA 2X1UA 4QSHA 1W8SA 1QBAA 5I0DA 1LORA 3HMCA 4QM1A 1U5HA 5FEZA 1MWOA 2OKOA 1AH3A 3LGGA 4JTEA 4Y2WA 4PCPA 1GVEA 4GH1A 2V38A 4UTJA 3W7RA 4LAOA 1C8VA 2C3ZA 1DPMA 1HXJA 4QLJA 1UR1A 3MUXA 3YPIA 1YPFA 3NXFA 3R13A 4O19A 3I6CA 3FYOA 3W7JA 3ZLFA 4F79A 3GW3A 2R14A 1O5XA 2PUZA 4PODA 2UY2A 4PMZA 4O10A 4FIQA 3JR2A 3NL2A 1O1ZA 4EPEC 2XVGA 1OYBA 4E4PA 1UC5A 2R9RA 4Y9PA 5F2LA 3KOYA 3M6YA 4S2BA 1LCOA 4BQ3A 3N4FA 2QUTA 2D9FA 2FGBA 3FGCA 3PBVA 1BYCA 3MSDA 3VVGA 2JF6A 2AKZA 4OJYA 5AECA 3KVLA 2XU2A 4PFHA 3NPUA 4RZBA 3SY5A 4IICA 2Z6JA 3O16A 3PUDA 1EA0A 3WD2A 1OFRA 4AF0A 2OYKA 4R7JA 5C71A 1R9ZA 2QJHA 5AYIA 2LPVA 1XIIA 4FX6M 3DHDA 2XM1A 4QNEA 1E0TA 1K7XA 3CAVA 4UTHA 5DT5A 3TH6A 1KV5A 2ZX5A 5DLCA 1PCWA 1H7XA 3S9IA 3R58A 1RQEA 2YW4A 4MB4A 5J6EA 1ZJBA 4W89A 1UW9A 1H5VA 4UOZA 3TTEA 1X1OA 3ZLGA 2H3DA 4UTKA 1VS1A 9RUBA 2C19A 4AMAA 4ODNA 2XWEA 4ZODA 1ICSA 2CFFA 2W3ZA 1XW8A 2RUSA 3CQHA 5JIWA 3SQLA 3GM8A 3SUWA 1WOAA 1XD0A 2CHRA 3FKRA 2V3FA 3GE7A 1P1XA 1UOKA 2ITKA 1WZLA 2SFPA 3DAQA 5A6BA 1LTDA 1KT1A 4MAVA 3DEQA 1NY1A 4RUBA 1FHVA 2DW7A 1QAPA 4LUTA 3H4XA 5K7JA 4TW6A 4X2PA 4GUHA 1XS2A 5HWJA 1QW9A 3T4WA 1V7YA 3TAOA 4FSAA 1D3CA 1E0WA 1GYLA 5B8IC 3LCWA 1UP2A 4A2RA 2A6LA 4UQCA 1REQB 1FKLA 5I3IA 1L2UA 1CGTA 2PC8A 5IBXA 5CEWA 3IJ8A 4D6FA 4D71A 1TPB1 2CZEA 3PG8A 4RNIA 3VO0A 1HXVA 1DORA 4D2JA 4DF0A 1KRBC 3TDFA 4RL3A 4I5UA 3TVAA 3BW2A 3KP1A 2QCLA 3CYVA 4QGCA 3BWWA 1JDCA 1TZ9A 5TIMA 3W73A 4TMCA 3AS1A 3VCNA 4NRSA 1PPIA 3F5LA 2OGJA 2E4TA 5E93A 1LLZA 4JHMA 3IRDA 5FD0A 4P8VA 3WBEA 4Z2LA 2Q3RA 2V0TA 3R4IA 1KFJA 3PPGA 1IQ8A 4Z0SA 1E4NA 4BA0A 2FJUB 2AQVA 3LGDA 4R3UA 1KM3A 1US2A 2DIEA 3B3DA 3DI1A 1FBAA 1DIOA 1TJ0A 1ZSXA 4MTVA 3WLRA 4QJ4B 1TTPA 3MCMA 5FCZA 3GBEA 4J3XA 3P0XA 5D2YA 5A8OA 3UT0A 1J11A 3N04A 1X7FA 3TJXA 1Q63A 1DE5A 3FYYA 3T78A 3QZAA 1WKDA 4JFTA 3GU0A 3T81A 1XD1A 2JKAA 3PZIA 2VX4A 3VUPA 1FWBC 4DRHA 2FB3A 3W0KA 4KRTA 2XSXA 1QATA 1FKTA 5L9FA 4UTTC 3GAYA 1HJXA 6REQA 2DZXA 3WNOA 5D09A 2DZAA 1PKLA 3BGGA 3WYZA 3VDHA 4FOKA 4LAUA 4DUVA 5DMLA 4ZR8A 4L9ZA 1HNYA 3CQKA 1GT8A 1M68A 1SZEA 1K8XA 4O14A 5JBEA 2CZDA 1W5NA 6A3HA 1D7HA 3U5UA 3BAWA 3LRMA 4AU0A 4HOZA 3WUFA 1UC4A 4Z08A 4WRHA 2INEA 1X96A 3LA4A 5A8QA 4A2SA 1BD0A 4G2PA 2HPIA 1JD7A 1P0NA 3KTXA 3BDKA 3KVKA 4O1BA 1K03A 2MNRA 4MYXA 4C1NB 2V3EA 1ONXA 1YADA 4DO5A 4JTDA 1Q3NA 1S1RA 3S1VA 1ZZMA 1W1TA 2OX1A 1R2SA 3HG4A 2GK1A 3KLKA 2AAMA 1VCVA 3I6TA 3CV1A 2WHKA 1ZGDA 4ERAA 2Z26A 5G4HC 4XTDA 4R7WA 4IMFA 4WEVX 3E0VA 1VPXA 2NUXA 3ZVHA 3V5OA 1B2YA 4B5SA 3WFAA 2FPTA 2A3CA 4C6CA 4BWLC 4HCLA 3KWSA 1Q6HA 4O57A 3OQ8A 1VYSX 1BKFA 4ZSTA 3JW7A 1RBAA 1KM4A 3EWBX 3QBUA 4JX6A 5A8NA 3NFUA 3LPOA 4ZO9A 3M64A 4D1IA 3VILA 3G1VA 2OZ8A 8TIMA 1ZBVA 4N9CA 2WC4A 1KGWA 3RK8A 1H7PA 5HXMA 2BXYA 4NASA 2G3JA 3O5MA 2XHYA 2JGYA 5GPRA 2H8XA 5TAOA 2NQ5A 4KIEA 2RURA 2PN0A 1VZWA 3KHDA 3UJSA 1DIEA 4H7VA 3M9YA 3VMPA 3MJMA 1W3HA 2CNCA 3PTQA 4H7CA 1UG6A 4GI6A 3FJNA 4HTYA 1JDFA 1WOBA 1FKBA 4JR5A 2GVJA 4REQA 1CENA 4BQ5A 1OT2A 3L67A 3VD7A 3S1UA 3JU2A 1Q6FA 5G2WA 2Y6ZA 3NURA 3HG5A 6XIMA 3VNIA 5LIKX 1FH8A 2P88A 3TTYA 3WD0A 4LYPA 4S3GA 3AS0A 3SCNA 3C0JA 3BL3A 3IHZA 5GJNA 3C3NA 3CEPA 1PX4A 2VCAA 2GLKA 4FR6A 1FHDA 3EX4A 4V2XA 4S3FA 3NJ3A 2GVEA 4H6QA 7ENLA 2Z25A 4J4NA 3T09A 5CGTA 3NPVA 3GR7A 4B15A 2QCHA 1KBBA 2CKSA 4ERIA 4F0KA 4ZO7A 2WO5A 1NSJA 4MB1A 2D3NA 3ERPA 4RPPA 1SO6A 1FKXA 3TYEA 1RAKA 2ISVA 4ZQCA 3QTGA 4IPXA 4WJXA 4EIVA 2QJJA 2WZMA 1Q8JA 3MHGA 4I6KA 1JRCA 5AKQA 3EX2A 3E2RA 2BMBA 4YWSA 4PEEA 1OYCA 4DRNA 3UNDA 2JFEX 2W27A 3PUOA 1FVPA 4GY0A 4E3VA 4UTIA 1VBGA 3ME3A 2XP5A 3CUGA 1M6JA 4L65A 5CPTA 3DHPA 1W8GA 3VNJA 1QO2A 1JI2A 2DIJA 1Z6KA 1H1ZA 4CN1A 3GVWA 3ZWSA 1U22A 3BAIA 4UC5A 3OBAA 3AU2A 1B4EA 4MG4A 3PBYA 1JCYA 4B4HA 4W9TA 5J5RA 2KZHA 3ODKA 3TOYA 1HW6A 4M7SA 5LNSA 1EBGA 4LAMA 1FKWA 1B9BA 2NT1A 5HUAA 5ABFB 2DUZA 4S3EA 4ITZA 3QY8A 4QQUA 1DVJA 2NXGA 3CWNA 3WEOA 4U2YA 3T07A 4S38A 4TW8A 2GWGA 1KFCA 3ANVA 4FNQA 2HSAA 3CLMA 1W26A 4DBWA 1MFVA 3W86A 1X6LA 3HZ3A 1JYXA 4KT2A 3A3WA 3UCDA 4GZ7A 4UZUA 5BOOA 5A69A 5FSDC 1KT0A 3ANYA 3ARWA 3CQIA 1N2VA 2RUCA 1ICPA 1TJRA 3WLHA 3RLGA 2XPBA 1EDTA 4AZ7A 1QPOA 3WUEA 3E0IA 5HK4A 3E2VA 4EX4A 3W6LA 5AHNA 2Q09A 3MW7A 4WOZA 1FKSA 4M80A 2XZ9A 1R7OA 1QNRA 1P43A 1J9YA 5FJTA 4L3NA 1X39A 4CLMA 2C13A 2NSXA 3BO9A 3MUY1 1K9FA 3RFWA 3L66A 3C3UA 2ZUVA 4HD5A 3VX1A 4ZQOA 3UZJA 3WNKA 2PGWA 4JKKA 2FTPA 4BY3A 2BVTA 3A4WA 3GTIA 8XIAA 3U3HA 2ZZ1A 2XIOA 2W61A 2QMJA 2VP8A 3SQSA 4DIAA 3TFCA 2DVUA 3L2MA 2ZUSA 3HG3A 3EWDA 2H9AB 2DT0A 3KCLA 4GUIA 1X1NA 3Q4DA 4I7VA 4P61A 1GYNA 4ICMA 1OCBA 2KI3A 4UZSA 2WWDA 3HPSA 1LUCB 1RVKA 4XBSA 4DHGA 1D7FA 2PDFA 4BQ4A 4HPGA 3NEVA 4CD8A 2WNNA 1I2PA 3H8AA 4CCCA 3FA3A 2A21A 1A50A 2G37A 3A12A 3DHUA 4W5UA 3TN5A 1B9ZA 3P74A 3KHJA 2VR2A 3HV8A 1CYGA 4GXPA 2X16A 4O52A 1TPVA 1XUUA 2F6UA 2FZNA 4JYDA 2RKXA 1Y65A 4J40A 4R88A 1DXFA 4B3LA 5TBOA 5FA5A 4DM2A 3VIFA 1RD6A 2W91A 5BXPA 3IARA 4IFRA 1NWSA 4NNAA 1XDMA 1JZ7A 3MI6A 2A3BA 3SR7A 4O8RA 2E9LA 1J18A 2DPEA 4LBUA 4K8HA 5EMUA 3FHAA 4W87A 3DKLA 4WDWA 3MMUA 3N12A 4NUWA 3H70A 2L5HA 3P7YA 2R1KA 1NAL1 2WM1A 2A5HA 1ISZA 1GVRA 2C91A 4FXJA 2PDBA 3W7GA 4ZTYA 1M5YA 4GI4A 1TV8A 1LQ0A 5LNRA 1BTCA 1HL9A 2C6QA 2I9UA 3KL3A 3N18A 4PMOA 4U85A 4L80A 2H6RA 4UQBA 4O4WA 5C8BB 5CSRA 5F2IA 4J2MA 2QUNA 5C2GA 3LXAA 1S5WA 2RGLA 4NAFB 3GC5A 5CQ1A 1YXDA 3WFZA 4H83A 4U3AA 1QT1A 2WMHA 3W1NA 1W5PA 1GQJA 3SRDA 1WXJA 4FZIA 4H7ZA 3MVTA 2A1YA 3GFZA 5JMUA 1XSJA 3HPXA 1J0HA 1M5WA 1WUFA 3CAWA 3GVQA 4GK8A 3CQJA 1Z3NA 3PJTA 2PLJA 2FZ8A 4JQ1A 4CD7A 2I56A 4O8AA 4ODLA 1PYMA 1MO0A 1X98A 1JDDA 3QQ0A 3FXGA 1UD8A 4JL2A 1LBMA 4US5D 4XZHA 5BWAA 4PH6A 1VCFA 1JCXA 1UZ4A 1FWAC 4TMBA 1FWSA 4WXZA 3LMYA 3N34A 2HQAA 3WQPA 3A47A 3S0CA 2J79A 2ZDSA 3XINA 2VVSA 2X1IA 3MP4A 3PTDA 3M5YA 2OELA 5DEZA 2HROA 3BPWA 3QH2A 3P14A 1TA3A 2W0UA 3QLDA 2G3FA 3OIXA 1UH2A 4KEUA 1SO5A 4HARA 2QPUA 5FESA 2QVNA 5TF0A 2WPBA 3AMDA 2OZ3A 3EXTA 2ZX6A 1THFD 4NILA 1TJ1A 5CBJA 3QOKA 5D38A 3ARTA 3KTCA 2HWGA 3R2GA 2X7VA 3VTRA 4UTWC 4RCXA 3NO3A 3L23A 4I5RA 2YJQA 3Q58A 4MAZA 3ARSA 3HQ1A 3S2LA 3RIKA 4MY9A 3RF9A 1QRQA 4HPNA 1XIDA 3PSVA 3AU6A 4HGXA 2MPHA 1KCZA 2O9OA 1E72M 4X22A 1G6CA 2ZQ0A 4EPBC 1XCFA 1K7EA 1ZCOA 3QC0A 3L0GA 3UG3A 1NH6A 4OOUA 3UYIA 1UWQA 2HZGA 4PBFA 4EPKA 2OXNA 3B0UX 3TQVA 3WK0A 1GQKA 2J8FA 3L9CA 5IHSA 3DH7A 2XFFA 1WZKA 4AZHA 1FWCC 2BV9A 4AY7A 5C7VA 1PIGA 5DRIA 2ACRA 1SW0A 3G1AA 2OQHA 3A22A 4LAKA 3MDYB 4NT0A 1WYIA 2GVLA 3H2NA 3QGKC 3H2EA 3B06A 4FP1A 5HMDA 1F8MA 3ZXWA 5CPNA 3TC7A 4Q8OA 4E0CA 2FPYA 2YLLA 3UPWA 2WMIB 4MF4A 3EX6A 2XGBA 3SUUA 2AKMA 1XH1A 1OX5A 4W5ZA 4PGLA 4UQDA 4AVFA 4P8WA 1NELA 2BS9A 1DJQA 2VELA 1XSIA 4FB7A 2VEMA 3HPAA 2V69A 1N8IA 4W9PA 1J5TA 5HWCA 4O13A 1C8XA 1EC7A 3BCJA 1HKKA 3VIPA 1V3JA 1W9UA 1AVAA 5EB8A 4EP8C 3OO2A 2HK1A 4MZ8A 5IFPA 2QJGA 3S2NA 2JE8A 1G4EA 1ONWA 1VBUA 3KCJA 2NZLA 4AH7A 3O63A 4DRPA 3ZM8A 1OK4A 4OV9A 3WJZA 5DY2A 3AIEA 3LHYA 3DN5A 3KAOA 1XBZA 2ZRWA 4RE3A 4XD3A 5A6KA 3T0BA 3BXWA 3GXMA 4MWAC 4YYFA 3RMJA 4LQ1A 4MY1A 3IJIA 1AUSL 4IQEA 1BYAA 4IMDA 3V4BA 1EHNA 3GNOA 1TVLA 1Y8BA 1QI2A 5BMXA 3PR2A 2ZUTA 3I7SA 4JYEA 1EWDA 4QJ3B 4WKFA 4Q6JA 4D6DA 3CUXA 2VC7A 4H8UA 4L4MA 4WY0F 3CYJA 3MV01 3U7BA 4LBRA 4LWWA 1QNPA 1RJPA 5C9ZA 4GIVA 1TYGA 3E74A 4AC1X 3TTOA 3T40A 4H04A 4YNGA 3S42A 3T9PA 3C0SA 3VFCA 2QV5A 1WXZA 2X7WA 3PB2A 5DITA 1IHIA 5D03A 3ZJ7A 7ODCA 2CBUA 4WGHA 1VFHA 1P48A 1AMYA 2CLFA 4M6QA 1R8LA 3WL1A 3QPEA 1RCOB 1B4KA 3UG8A 4IISA 1BHGA 2OVLA 4XD4A 3T2PA 3G24A 1JYNA 3T8QA 1Z48A 2WKGA 2XFYA 2PBCA 1EJVC 5HPCA 4Y9AA 5CJMA 3PZOA 5LA2A 2NQ9A 4KEMA 4TUFA 1FTXA 4TOQA 3OZPA 1GTHA 4GC4A 2DP3A 3FAWA 2ATSA 1E1CA 1VFMA 4WDTA 1W2PA 3NZ1A 5CZSA 3CAQA 3WL0A 3OODA 3GNPA 1DOSA 2I7GA 2QPSA 3AZRA 6CGTA 3K8LA 1UD4A 1GHRA 3RX4A 2W62A 2Z4GA 4L4LA 1V51A 2BDQA 4KIRA 3B04A 3DERA 4BF8A 1JPIA 4RW3A 2HBXA 4CQCA 4WQ6A 2RJHA 3UJFA 3KL0A 3O5QA 1GONA 4QE5A 4PMXA 2P1FA 4G1KA 4B9YA 1HKIA 1O5KA 4L4OA 1GWJA 5I3HA 1UWIA 1H7RA 5C70A 5A6AA 1ZQ5A 2O0TA 4PB3A 1TPWA 1H7OA 2ZKMX 4XAKA 4NZ5A 2WKLA 3KRBA 3VNDA 3TXZA 4Y96A 3T7VA 4CU8A 4OBTA 2GGIA 3GRIA 1IX5A 3U6WA 3R0UA 1JUKA 1UJQA 1V6VA 3R6IA 1A53A 3VYLA 5A2CA 4A05A 1YTEA 1J6PA 1TMLA 1L6YA 1MRAA 3AXHA 4Z17A 3TSBA 5BOEA 1FWDC 5E0CA 1WV2A 1FH7A 1LL6A 3QZEA 3GX9A 4QR6A 3S3GA 1NOUA 1DJXA 4PBEA 3GVGA 1EJUC 3IK4A 2AGTA 1OX4B 5K2ZA 5EFFA 4AX7A 3INPA 5FF7A 3THDA 1EB3A 4GYPC 4E5TA 3QV9A 3R0DA 5J8LA 3LLXA 1LM1A 3RILA 3CAKA 4OIFA 3WMBA 3B8DA 3V7PA 3B4YA 4L4PA 1Y0OA 2DQWA 4ZQPA 1CLKA 1KM5A 1IT0A 2YZRA 5GNZA 1IEVA 4DQWA 3IKDA 5BRPA 4HHHA 4F0LA 1YDNA 2RGMA 2Y88A 1XIMA 4G8TA 3O7UA 1US0A 2NW0A 3L2LA 4WCJA 1ZJAA 5D2TA 7TAAA 2YDSA 4YLWA 4GJ1A 3CBWA 4C60A 4BQ2A 3I10A 4Q4PA 3TU9A 5AZ0A 1UZHA 3CUZA 5A6LA 4NI8A 3M0LA 3W1XA 1L8NA 5T8GA 1E0XA 3GU1A 1MYRA 2E1DA 1ZPTA 4AIBA 3FDKA 3CUIA 1UCWA 1J4EA 2D20A 1B5TA 1FWTA 2F38A 3CASA 1J6YA 1JNSA 4JS3A 3VKAA 4JQ3A 3C8FA 3T42A 2VKZG 4WR3A 3OBKA 4K6AA 1NDYA 3OGSA 3LXCA 3RCMA 2WSYA 2FVLA 1MQQA 2WSRA 1RZMA 3TKFA 4UFJA 4J2PA 3W3OA 1HF6A 4X2RA 1XM3A 3VZYA 5LHEA 3B4UA 3C6CA 2DH3A 2QDDA 1JDAA 2J24A 2ZTKA 3UJRA 1EJXC 3NL6A 1PSCA 1DYSA 4C6QA 1XLJA 4XKYA 4Q8PA 5D2WA 2J77A 3CGMA 1LBFA 4ORMA 1RP8A 2GL5A 2VD8A 3EMQA 2VC9A 4MZYA 1ZJHA 3B05A 1DKWA 1ME7A 4K1WA 1FCQA 4R5EA 2GQ3A 1H0GA 1A3WA 3GHUA 3MBDA 3WNLA 3DFPA 3LQLA 1GVSA 3JXVA 1PKNA 4LAZA 3DG3A 2DGAA 3JZUA 3C2VA 3WQCA 4JCMA 2XVKA 3NTPA 1D7KA 1TV2A 3ICJA 5SWUA 1LWHA 1EP3A 3AFBA 1HJUA 3ITLA 5DMMA 2YZ5A 1EX1A 5HNNA 3RPTA 4TTUA 4LUIA 2REQA 3H12A 3RJXA 1OK6A 2X2YA 2RDWA 2RSEA 2UBPC 3KM8A 3RCNA 1A5MC 4XZIA 3LPPA 1B3ZA 3P8IA 3TIMA 4L6HA 1NDZA 1Q2RA 4R7OA 1ZB5A 1XG3A 2F6XA 3W1UA 1L1PA 4E8GA 2YCLB 3EPNA 2NUYA 2X0YA 4AIEA 3VIHA 1TZZA 3TYAA 3SCUA 2FFIA 3KXQA 1AMKA 3M0JA 1SSDA 1J4RA 3HOJA 3CB3A 4K68A 2JEQA 1FKJA 1UR4A 3P62A 3WK1A 2DZWA 4RZ6A 5DMNA 5CCZA 2TPSA 4MJMA 2DZBA 4UWMA 1D8WA 3KDNA 4KCUA 2Z7GA 4ACYA 1FKHA 2WHMA 4DAFA 2BY3A 2HVOA 3L4VA 3VNMA 1V6WA 4GIRA 4UR7A 3BV4A 3BOLA 1VQTA 4KWUA 5IBXC 4P7LA 1Q6UA 1QW8A 1HFBA 1XLMA 1FWRA 1ISVA 2XJ7A 4MB5A 1OZQA 1H09A 2HPMA 5MKGB 2A7NA 5F4XA 1POJA 1ZFJA 1A7XA 4OOZA 3TLLA 2QKFA 4O18A 2PWDA 4GNKB 3GXDA 2FMOA 5HDRA 3FEQA 4AW7A 1FRBA 3UWEA 2HVNA 3IVTA 3GHRA 1CIUA 1M04A 2BY2A 5I77A 4CQBA 3FSTA 3K1GA 1SFTA 1F76A 3O06A 2Z24A 3TTSA 2QUUA 4RDVA 4GGHA 4DBUA 5FIPA 1KGUA 3N6QA 3TZFA 1YHTA 1XH2A 2PDNA 2V2DA 3AC0A 5M2FX 4YYCA 3MC5A 5A95A 4HTBA 1I75A 3LI1A 1VYRA 4IMEA 3ALFA 2FH6A 2I5GA 2EPOA 3W70A 3VOGA 2O56A 2WZIA 4J4OA 2AAAA 3P5YA 4KERA 3LCFA 1P5QA 2FGLA 1KC7A 1VLIA 5LA1A 3HQNA 4U2ZA 1G5AA 3N6JA 5BMWA 3UQBA 3AIRA 2WSPA 1QFEA 3WQDA 3L68A 1OCJA 2E6DA 4JN8A 4FO4A 4RR4A 1OGSA 4HCDA 4JTLA 4F40A 4AMCA 1J2BA 3THUA 2XPKA 3ZYZA 2V5JA 3QC3A 1W1VA 1V77A 4N19A 2WXDM 3EKLA 4G1NA 1TE6A 3RLUA 4DIPA 3EIPA 2XINA 1BKHA 1J93A 5I24A 4TIMA 3WMSA 1KM0A 2Y5SA 3TMLA 2A7PA 3UGRA 4RK8A 4AWEA 4TNSA 2RDUA 3HJEA 2DZSA 1K9DA 4C1NA 3W37A 3M44A 5RUBA 4NKCA 4Q8WA 2OT0A 1W1YA 4RDYA 7REQA 1BL4A 3KAIA 1IT7A 3GK0A 4LH8A 4MKSA 3UXIA 4ODQA 2A79A 1VCGA 1U1JA 4MUPA 1V02A 2E6AA 4LB4A 1EOKA 4YN5A 3U2ZA 1DJZA 1VC4A 2VOMA 4ZQRA 3HG2A 4XO7A 3VZZA 4AD1A 1XCWA 2ANUA 3NYZA 1R9HA 4XQ6A 3S6DA 4TVUA 3OTRA 1R3RA 4JDBA 4LVFA 4P7RA 1OFAA 4IQ2A 1H50A 5G1MA 2FLIA 2B7QA 2A3LA 4U10A 4QS5A 2I5QA 4PCTA 1W9DM 3GU9A 1JPHA 3AS2A 1XICA 3P6LA 1B3OA 3LHVA 4NJKA 2TODA 1E6SM 2NLIA 4E2OA 1EZWA 1O94A 4HHPA 5XINA 1KR1A 3THAA 2ALDA 3PZ9A 4HPJA 3PRBA 1DJNA 2NWSA 1KRCC 1F6YA 1IZKA 1SFSA 1G4TA 3WBWA 3RPMA 2A6NA 4TVCA 3NSXA 2YCJA 3ITXA 3RHGA 3MWAA 4DZAA 1KW1A 5BROA 1C90A 1P1MA 4HCHA 2PDPA 3TYUA 5BCAA 4JYSA 3C0QA 1JZ8A 2F4EA 3ARYA 4AD4A 4GG9A 2XGIA 3BSMA 3SJ3A 2EPLX 2JIWA 4G7EB 1B30A 3II1A 1JNTA 1ONRA 3L12A 4ZTXA 4GQBA 1IE7C 4HK6A 1E15A 2P53A 4PUUA 5HTGA 3TR9A 2FQIA 1NVMA 3KBVA 1ISWA 1ZLPA 5CSSA 1Y5WA 4S3BA 4GH3A 5AB3A 4XVDA 4OQVA 1RQHA 1WUEA 1T40A 4Q8TA 5LIWX 1XHGA 3H22A 3HA1A 4ZSUA 4KWVA 3T6CA 3B8UA 1BFNA 1QPKA 1XLBA 4KGLA 1RK5A 1TSIA 3IIZA 1F3TA 3GLCA 3HF3A 4RXGA 4EWND 3FAPA 4S3CA 4GZIA 2ON3A 3MWCA 3FN9A 3WDPP 4Z2HA 4JTRA 2W66A 1HVQA 2F7FA 3C86A 3L5AA 4A8RA 3W26A 2QIIA 4KQNA 1Q5MA 3G1DA 3M7SA 5FJUA 1NP0A 4AAJA 4YTRA 1LYXA 1EL3A 1VF8A 5TD4A 3MZNA 5BRBA 4H8NA 3B8SA 1S5TA 3KDOA 1MUCA 4KS0A 4UFHA 3RGTA 2PRHA 5K9CA 1JQXA 2WMGA 4W88A 3CHCA 3GUGA 1V6XA 1QNSA 1KQZA 5EMKA 4IWWA 2BFGA 2J6XA 2E8ZA 1HKWA 1MQPA 3RGCA 2MLYA 3EXRA 4F66A 1HZYA 4LAYA 2C18A 2XIQA 1EQ3A 1BG4A 3PWGA 4M0XA 3LBOA 1FAPA 2G4JA 3DFTA 5C9WA 4MDOA 3W7DA 4XD5A 4X61A 5CZKA 4PTMA 1A80A 1IV8A 1KXVA 3GZ3A 1L6SA 1KGXA 3ITCA 3BG5A 5ABFA 3BMWA 3LENA 3RO6A 3S9YA 2PD5A 1W0MA 1DWAM 1W2VA 5FJIA 1HP5A 1PWMA 2QCNA 4LSBA 3RRAA 1M7XA 1MNZA 1KBLA 1VIZA 1OG0A 4NZ3A 1GW1A 3E1F1 3ZT7A 3AXMA 3KOZA 5HWBA 1A49A 1BXBA 2DZVA 3AHTA 4KRUA 3VGGA 5JU6A 2M2AA 3KADA 3VM7A 1H4PA 3D3AA 2VFGA 2O92A 1ZL1A 4YTTA 4OHQA 2PPNA 1OVDA 1G9HA 4JTFA 4D6HA 4XSMA 1T6MA 2HDJA 4W8LA 4FAMA 5EFDA 3FY1A 1DQWA 2VRQA 4R33A 4TV6A 4JFWA 1C9WA 4KCWA 4I7WA 1DL3A 1UD5A 2YYTA 1ITUA 3RDKA 3E6EA 3REQA 1XIBA 5K4ZA 2HK0A 4M6VA 4GKTA 1Q2SA 1W6TA 5CBBA 3E38A 2H9AA 3UI5A 1CB2A 1FKIA 1Q7ZA 2NVAA 2DSVA 4AHQA 2ZQTA 4S2CA 4O15A 4KBXA 1H60A 2VDIA 5D30A 4W85A 1WZMA 2J4GA 4PMUA 2PPPA 5ECUA 2I57A 2HMCA 1LUCA 3VAWA 1XIFA 2WZHA 3KE0A 2FHFA 4ORIA 1HT6A 1TUFA 4LOCA 4I3GA 2BSLA 1IEQA 2ZOXA 2V68A 4TV5A 1K70A 3WNNA 3O5GA 3IGXA 3PPCA 4ICNA 4XIAA 1TPDA 2I16A 3IUHA 2VC5A 3R10A 1Q7MA 2JF7A 4W93A 2ZBTA 2WZEA 3EWCA 3MMWA 2FDMA 2VO5A 3V5FA 4JZ5A 3VA8A 3G18A 3MYPA 5CGMA 1XLEA 5IOBA 2V2CA 3UZ5A 3PTMA 3KACA 1ADDA 1Q6RA 3T0TA 2F21A 1PZ2A 3E96A 2OOFA 5CC7A 1E9IA 3H2AA 1EIBA 4Y9OA 4U84A 3SGZA 3GO2A 3VE9A 3G8RA 3L65A 1C3FA 4O4VA 5HWNA 3ARVA 3O2LA 4H1ZA 2ZXAA 4PMQA 4GA8A 3T55A 1JCTA 5DF0A 2EG8A 3C4UA 3PBUA 3DZ1A 4QT2A 5BXSA 1T5AA 2HISA 5FKYA 1FFQA 2GJNA 3MUCA 2WJZA 4X63A 5HUPA 1XYBA 2PDWA 3OZMA 3WH8A 5T9BG 1KV8A 4H9TA 3VDGA 1RP9A 1YDYA 1OIFA 3G6LA 1CWYA 2OMAA 3TR2A 2UY5A 2D2HA 5CLWA 2YDQA 1JRBA 3M0IA 2PWHA 1IZJA 3L21A 4GXWA 3OLDA 2ZDRA 3GG7A 2J8GA 4HB7A 2F6KA 1GJPA 4WX2A 5REQA 1DWGM 4OKDA 1F74A 4H9VA 4DYJA 2YFOA 3WBYA 4F0SA 3IGUA 3KW3A 2Z1VA 2HV5A 4J3WA 4D8AA 2OEJA 4MKVA 3S9ZA 3H26A 4QSFA 5AHLA 1EJTC 2WJDA 2Y61A 1M3UA 4U33A 1WPCA 3FA5A 2YB4A 4IX0A 3V16A 1HKMA 3CIVA 3DFYA 2VEKA 3MSGA 3IJ7A 1UROA 1WDSA 8A3HA 3EPOA 1Q45A 2FKPA 4F2UA 3ES8A 4AD5A 3MBFA 3K8MA 4H2CA 1WNOA 1T96A 4NJIA 3OZOA 2PA6A 4M1BA 3MB9A 4Z42C 1QHZA 2QPXA 5IFTA 2JKPA 3VNYA 2BBFA 4H00A 5LKYA 1JFHA 2X42A 4H6EA 4IUOA 4ZOEA 3BAXA 4DRQA 1EF3A 1QTWA 1JQVA 3EAUA 1YE4A 4M6UA 2B81A 1H5YA 1G7VA 1XIJA 1RY0A 4HNLA 4ZENA 2ZR4A 4OGZA 2YL5A 3ZVIA 3BC9A 1SZRA 3BW4A 3B9EA 1C92A 4OBRA 4HYVA 2WBGA 4PZVA 1O66A 1RCQA 4UNLA 1I0DA 4UCGA 2GGEA 3IJ9A 4MWAD 3KCEA 5GJPA 2FYMA 5EMMA 3K4AA 3W24A 3WQVA 3FHQA 3IACA 1VHCA 4XAFA 4FI4A 1XIHA 3CGNA 4CVUA 3CEUA 5LIXX 4MWAE 3LRKA 3RAOA 1PZ3A 2OTDA 5FL0A 4CEUC 3QSRA 3ZSSA 1NDVA 2Q02A 3STCA 1R3SA 3T2QA 2QCGA 2QS8A 3LTSA 2QQ6A 2ZZ7A 2V30A 1GKQA 1IYXA 2X05A 8CGTA 1UA7A 4CNTA 1M41A 3BAKA 2VFEA 3D3FA 1JL8A 3KL5A 5LNVA 1LL4A 3QMSA 1RY8A 3TW9A 2VENA 3OHIA 1GJUA 5H6HA 1T8XA 1TWWA 4RLIA 5H8MA 1TWDA 3CPRA 4UQAA 1EO7A 1TMHA 3GFYA 1DP0A 3A6OA 5AYXA 3IJLA 2PGFA 3TSDA 4XG1A 2PSNA 5EKYA 1PVNA 3TA9A 4WK9A 1Z41A 3WNMA 4AZCB 3E3HA 1NARA 3BOXA 3LNPA 1U33A 1QUMA 1VIWA 4US5A 4YCOA 4Y90A 4FF5A 5KITA 1XLIA 4JFLA 4JOMA 4BF9A 2D22A 2GUBA 2WV8A 1JPMA 4RDZA 3QZ6A 4C6LA 3EB4A 2D0GA 2WMIA 3G1YA 3UI6A 1K8ZA 3TX9A 4EXBA 2TMDA 1L8PA 1BSLA 1IGSA 1XSKA 3EX3A 4J35A 3NQEA 4YTUA 1QCWA 4Z1CA 5CXPA 3U5YA 3B8WA 1AH0A 4PMNA 1CECA 1J10A 1JIBA 4MWAB 2CZVA 2Y7DA 5C2CA 5C0QA 2ODOA 1OC5A 3B0VC 4MGVA 5A8PA 3FAXA 5A6SA 3L4ZA 3DECA 1UKQA 3L5MA 3I3BA 2VT0A 1KQYA 1H2JA 1ZUAX 3PJUA 2P0IA 4ZS6A 5AYZA 2IXVA 1DE6A 1FXPA 1R30A 4I5XA 4HPHA 3PR9A 3W7MA 2AL2A 1OABA 2UWFA 4XBJA 3GKFA 3E0LA 5DCBA 3PS7A 1V3LA 1VBRA 3KOWA 2LJ4A 1XFCA 2CYGA 4WY0A 1KLYA 5FACA 3W1LA 4BF7A 5HQLA 3W7CA 3GDBA 3SRFA 2WLZA 3O5DA 3AIVA 1XGZA 1WDQA