2ESCA

Crystal structure of a 40 kda protective signalling protein from bovine (spc-40) at 2.1 a resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGSERFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGGWRGTVGHHSPLFRGNSDGSSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSSTRVGAPISGPGIPGQFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Structure of a bovine secretory signalling glycoprotein (SPC-40) at 2.1 Angstrom resolution.
pubmed doi rcsb
molecule tags Signaling protein
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2escA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2escA01
4A4AA 3AQUA 5E9AA 4BA0A 4PCTA 4Q22A 1MQRA 1U33A 4HU0A 1LG1A 3OZPA 4ATLA 4JAWA 2BY1A 1EO5A 2VVNA 2WHLA 3L4VA 1JNEA 2W91A 5DFAA 5F7UA 4IM4A 1I1XA 2WC4A 3PZMA 3I3BA 3VIIA 1WE5A 4D71A 5AC5A 4W88A 2BHUA 1EA9C 1DWJM 2WZIA 4S3JA 4CD6A 1EDGA 1E6PA 4RE4A 1GOMA 5HXMA 1IZJA 3WKZA 1V02E 1PIFA 4GPNA 1JDDA 3PBGA 1XH0A 4IUGA 2VZVA 1H11A 3WH6A 4ATDA 4JFUA 4M82A 1EDTA 3K4AA 3SCPA 1V02A 2JIEA 2CITA 2D24A 1EHNA 2JALA 3VIOA 2WHJA 2D1ZA 3PHAA 2FH8A 2X2YA 3WQ5A 3BH4A 3CUFA 4PTVA 3AYRA 1QI0A 2WSPA 4UFHA 4UQ9A 4W8AA 3FAXA 3AIQA 1JF5A 3BAKA 2DH3A 3ARTA 2CNCA 2YL5A 2G3NA 1UD3A 3AYSA 3L4YA 1V6WA 4HTYA 1JDAA 2VL4A 2DPEA 1QBAA 1GVIA 4ZE5A 5A3HA 1A47A 4J3XA 4FLRA 4BQ5A 4OIFA 1QNPA 1NQ6A 3AHVA 4PSRA 3L4TA 1YHTA 1B30A 4W7VA 3ARPA 1WZKA 1IV8A 5ABFA 3W82A 2QMJA 4OZOA 1W3LA 2VZUA 4GKLA 3CHEA 3QOKA 1BQCA 2Y24A 3VD9A 5A69A 1QNOA 3PZTA 1TVPA 3KL5A 1OT1A 2YL6A 1ECEA 4D72A 2QHAA 2YBUA 5HOSA 2OWXA 1NM9A 1GHRA 3VGHA 4MB5A 5DEZA 2D2OA 4U5IA 4PMDA 1TFVA 3IJ8A 1VB9A 1CWYA 4IPLA 3AJ7A 1BHGA 4AD3A 3PTMA 1MFUA 2UY4A 4X9YA 3TONA 2FHFA 2WCGA 7A3HA 2PBGA 5C8BB 2D22A 1GONA 3WDJA 1B3ZA 3D5HA 3KWXA 4DUWA 1VBRA 3WD2A 3IANA 3CIVA 1V6VA 4OJYA 2WB5A 4OBRA 3WNOA 4CN1A 3ZT6A 4J3WA 3WFZA 3VTRA 4JL1A 4ZENA 3RJXA 2XGIA 3PZQA 1OT2A 1GPFA 1JD7A 1JXKA 4UOZA 4CGTA 4TVCA 1CDGA 2E9LA 5A8QA 4PMQA 4X0NA 4XX6A 3WMBA 5BXRA 3VDHA 4MDPA 4CKQA 3OA5A 3BMVA 3VKKA 2PC8A 5EBAA 3VOCA 1E1EA 5BXPA 2X09A 2RGMA 2G3MA 3NJ3A 3POCA 3UG5A 2GJPA 2DIEA 2VURA 5JBEA 3LMYA 3WBAA 4ACZA 1E55A 3AS0A 3SEPA 1B31A 1CEOA 4LX4A 2XPKA 4W7UA 3KL0A 2JEQA 1BTCA 2XIBA 2YLAA 4U5KA 4JHZA 3BAWA 4A3YA 2QV4A 1JZ2A 2E3ZA 2ZUVA 5FD0A 1W9XA 2IXUA 2BY0A 1WKYA 1Z32X 1ISWA 3W24A 2ZWYA 1V3KA 4TUFA 2ZX8A 1FH7A 4C7DA 3BXWA 3MMDA 1BSIA 3W6MA 1EGZA 3WENA 1W1YA 4D6CA 1ZU8A 4ZE4A 4AIEA 2FGZA 4PMVA 4B3KA 4AW7A 1GORA 3CHFA 5LA0A 1HL9A 2VOTA 1BLIA 4PTMA 4XZBA 3ARQA 7CGTA 1NP0A 2BY3A 4UFLA 1AQ0A 3DYOA 4W85A 1R85A 4DM1A 3T0AA 3AZTA 4DWSA 2EPKX 4WF7A 1QI2A 2VTFA 3OLGA 4WJXA 5FKYA 3LPOA 1XSIA 4GINA 3MU7A 3AICA 3WL1A 3SCOA 7TAAA 1SFSA 3AHTA 3DHPA 3VMNA 1HNYA 4BZYA 1E6SM 2VRQA 3VIFA 1K9FA 4W84A 3TTOA 4GO9A 1V3HA 5I6SA 5TD4A 4EK7A 2G3JA 1JZ4A 1VJZA 1LL7A 2PBOA 5D9NA 2ZUMA 5DO8A 2TAAA 2WVTA 2W5FA 2VCAA 2ZX6A 4TTUA 1UWUA 1UYQA 2GDUA 4GI6A 4XZWA 5GNZA 2YDRA 1W9BM 3WUFA 2J77A 1VFOA 3CMGA 4OKDA 1E4LA 3DYMA 1EIBA 1VEMA 1UR2A 1V0KA 3BAYA 1MWOA 1PPIA 1PBGA 4MNLA 2CCRA 4M29A 3ALGA 2ZXAA 1ZJAA 4MJ2A 1GQIA 1KQYA 4P7OA 3WF3A 5E09A 2W62A 2ZWZA 3DYPA 1CXLA 1MQPA 5I2UA 4NZCA 4PMRA 1SR0A 1XH2A 3RCNA 3WF0A 3RO8A 2CBJA 1OIFA 2PWEA 3MV01 3M6DA 4M24A 4H04A 3ZSTA 2WANA 3N9KA 4BS0A 2W61A 4PMYA 2ZUWA 1UH3A 3ZQ9A 2VJXA 2EPMX 1J9YA 2D0GA 1XH1A 2Q8XA 1UKTA 3GBDA 5CLWA 5BROA 4GO8A 3M46A 1HVXA 3SUTA 1EOMA 1EO7A 1UD6A 2FGLA 4BQ2A 3A4XA 3OGVA 5A2AA 3WQWA 1FH8A 5CGTA 1ISXA 2UY2A 2VC9A 2YOCA 1XD0A 3GXDA 3N17A 1VEPA 4CU7A 2D20A 2O9OA 1WCGA 2EO7A 6TAAA 3VNYA 1W3JA 1AQMA 2XYLA 4JFTA 1WB0A 1W91A 2G41A 2WMKA 2VQTA 1J18A 4MJ4A 4PTWA 4GZJA 2A3EA 2VZOA 1CXIA 3BLKA 1E6RA 5HBFA 1HT6A 4PUDA 4UZUA 4WKAA 3EMCA 1RD6A 3PZNA 2ZOXA 1CIUA 3WEOA 1P6WA 2PWFA 1WO2A 4TXEA 3CO4A 1JI2A 1KR1A 3AOFA 1ESWA 2ZX5A 1VBUA 1ZS2A 3TOPA 3LPPA 2A3HA 3ARSA 4F9JA 3NDYA 5CXPA 1XGZA 4KMQA 1K9DA 2B31A 5IXEA 5AY7A 4YPJA 1Q6DA 3QHNA 1H49A 4HU8A 4P7LA 1GZJA 1KXQA 4LYQA 3SCRA 1D3CA 4UQCA 1KGUA 2EBNA 4PMNA 3T2PA 4WKHA 3N11A 4HPGA 4AZCB 2C7FA 3EDKA 1BYDA 3AMGA 3GYCA 2DDXA 2IXVA 2O9TA 3GNOA 4LPCA 2RGLA 4NRRA 5EFFA 5C71A 3W6LA 1E6QM 4UOQA 3N13A 4XUYA 3CZLA 2EEXA 1V3JA 3K8KA 2G8ZA 4KGLA 2BVDA 3MV11 2E9BA 1Q6FA 2V38A 5FCZA 2WZHA 1GUVA 1M04A 1TG7A 3ZSSA 1D7FA 4D6IA 1C8YA 3AI0A 3VIGA 3E1F1 3I3DA 1KWGA 3HJEA 2W92A 1KR0A 3GZAA 1EQPA 2NT1A 2JEPA 4CU6A 3VIMA 1CENA 1QI4A 2OSYA 1W1PA 4K68A 1TA3B 1HP4A 4UTFA 1XRVA 1GOKA 2G3IA 2GJXB 5HPCA 2UWFA 5CZKA 4UQDA 1OD0A 3BSGA 2WYSA 3UG3A 1E9LA 5EB8A 2WMHA 2CBUA 1WZAA 4W93A 1CGXA 4Z2IA 4UQBA 3GNRA 4OOUA 3EDFA 2FH6A 1E6XM 3DHUA 2J7BA 1UR8A 1VJSA 3OB8A 2G4FA 1UWIA 5HNNA 4U31A 3UERA 1HJWA 3WNMA 2EXOA 2YA0A 5KZ6A 1B90A 3VGGA 4DWSC 3GBEA 1BPLB 3ARRA 4P7RA 3VD3A 3QHOA 1UD5A 2XSBA 1W1TA 3OG2A 3POHA 1BVNP 4JFSA 4B9YA 4JCLA 2DEPA 4FLSA 5I3DA 4W5UA 3W81A 4DUXA 1E71M 2V3EA 1TCMA 1H4PA 1HJUA 5HDRA 3ZOAA 1W9UA 4PSPA 1B3XA 4F79A 2F2HA 3MUY1 3K8LA 3VU2A 3BLPX 4BCEA 3GXFA 3KE0A 1GOOA 2FDMA 3IAQA 4AYSA 3THDA 3WY1A 1WDQA 4QFUA 5D9OA 4Z2HA 1NOFA 4UR9A 4E8DA 5DMYA 4AZHA 2ZIDA 4WIWA 1X1NA 3GH7A 5CGMA 1TE1A 4AISA 1MW0A 4LQ1A 1J0KA 2YA2A 3ZJ8A 3QR3A 3CLWA 3AMLA 1WZLA 3SCQA 2E9MA 4QLLA 3ARYA 1UH4A 4AEFA 3U7VA 4D1JA 1X6LA 3IJ9A 1EH9A 4Z2JA 1QI3A 5LA1A 1OGSA 1BGAA 3CH9A 4L4OA 2NSXA 3VGBA 4JKMA 1EHAA 1XC6A 3AS1A 2GDVA 4J7RA 3J7HA 3VMOA 3RPMA 3G6LA 1W32A 5CSUA 1LWJA 3TTQA 3II1A 2Y8VA 2VX5A 2XGBA 1AQHA 4PMOA 2DT0A 2J25A 1LQ0A 2E8ZA 3U5YA 1B3YA 5HPOA 5AYBA 2WNWA 2D23A 1QHZA 2WAGA 4U3AA 3WDIA 4CCDA 2F61A 4RL3A 1E0WA 1BGGA 3GDBA 2YA1A 1JZ5A 1B1YA 4OOZA 1W9DM 3WQVA 2Z1KA 3EMZA 1KCKA 4UFIA 3B8SA 1E0XA 1Q6EA 1G9HA 3B9DA 1NP2A 3WUBA 3DC0A 1E5NA 1G01A 1BF2A 3CZ8A 2CPUA 2YKKA 2CIPA 1J0JA 1OINA 3FHQA 3VX1A 3APGA 1U2YA 5CG0A 1G0CA 3AMKA 1R7OA 1CECA 1BVZA 2OYKA 5A8OA 1UKQA 2VNCA 4HA1A 1BAGA 2V5CA 4N0RA 3OBAA 4J3VA 3CZKA 3AS2A 4GQRA 3AFBA 1E4IA 1NOUA 5FL1A 3AIEA 3VM7A 1JYNA 3WH8A 1LL6A 3OGRA 3MO4A 5FIPA 3FXYA 4MDOA 3DECA 1XSKA 1UG6A 1QOXA 4B3LA 2XVLA 4PUEA 1JGIA 2YJQA 1J0IA 2CBVA 2VO5A 4XB3A 1UR1A 3AIRA 3THCA 3BCDA 5E70A 2CETA 3VGDA 2EPOA 3UCQA 1HJXA 2YLLA 3WIJA 4PYSA 4AD2A 3NSNA 1DTUA 3LPFA 4J3TA 3SCNA 5M17A 1V6UA 5CPSA 3SCVA 2J74A 2BY2A 1V0NA 5A8PA 4CU8A 3MSGA 3L4XA 2BXYA 2E4TA 3WDPP 4HOZA 3WH7A 1HF6A 3OZOA 6CGTA 2EPLX 1UH2A 4D6GA 5A6BA 3PZIA 3AIVA 2CEQA 4AWEA 2WVUA 2DSKA 3SURA 3TA9A 1H5VA 1KGWA 4H8UA 3AIUA 1GCYA 4J27A 5D8WA 2BS9A 5A6KA 4H8HA 3M7SA 1DWHM 1TUXA 3GXMA 1ITXA 3CHDA 3O2LA 1GQLA 1KWKA 1KB3A 1RPKA 5I77A 3A4WA 1IT0A 5JBDA 1E0VA 1B0IA 5LYRA 2J7HA 3ZR5A 1C7SA 4GI9A 1CGYA 2OWCA 1MQQA 5EFDA 1UKPA 2GJRA 3UETA 2XWEA 1RP8A 4ACYA 4NSBA 2J7GA 2YIHA 2HISA 3N04A 4BF7A 1O6IA 2WHMA 4CVUA 3TP4A 2DH2A 3ECQA 2EPNA 3L4WA 2DSWA 1WDSA 1HJQA 4CD5A 4W7WA 1PX8A 4TVDA 4AD1A 4MADA 1HN1A 1NH6A 4UQEA 1EXPA 4AMCA 4F9DA 2CHOA 4MB4A 2V3FA 4QLJA 4MNJA 5IFTA 3W25A 2ZXDA 2ZXBA 3WD1A 5E0FA 1UD4A 4D1IA 3VD5A 1JIBA 4GI8A 2BHZA 4R5EA 3GTNA 2DSVA 4L4PA 1UQYA 3FW6A 1GHSA 2MANA 1UR0A 2VVSA 1OM0A 4AZCA 4WSJA 4PCSA 3VGFA 1VFUA 2CKRA 4HMDA 2UY5A 2OYMA 3MUAA 1WP6A 3FY1A 3K4DA 4CN4A 5D4YA 2JF6A 2VUYA 2J79A 2VZSA 3SUWA 3FAWA 1JZ7A 4GZEA 2NT0A 4M1RA 1E73M 1E6ZA 1KCLA 3WMCA 1NWSA 3RMEA 1HIZA 1U30A 1JDCA 1GQJA 1MXGA 5M5DA 1HKMA 2YDQA 1ISVA 2CHNA 1C8XA 4TOQA 3WN6A 1B2YA 2Y5EA 3PZ9A 1E3XA 2WCAA 4AY1A 3T0DA 1CGVA 2VX4A 1LF1A 3CMJA 3K46A 8CGTA 1Q6GA 1VRXA 4Q7NA 2DQXA 2J47A 2WCSA 3M07A 1V08A 1QPKA 3CUIA 4W5ZA 1TA3A 1W9VA 3G6MA 1CNVA 1E4NA 2WSKA 2V3DA 1B9ZA 2GJXA 2WXDM 1CPUA 4PN2A 2XJ7A 5BCAA 1H2JA 1K6AA 3NIYA 3ZM8A 1QW9A 1NWUA 3ZJKA 1JL8A 3W28A 1W9PA 4JKLA 4MB1A 1D2KA 3VDCA 2AOSA 4CCCA 3N12A 1V3IA 4U2ZA 4QCEA 1UZ1A 5IHRA 1XSJA 4H8VA 1M53A 1KGXA 4X0VA 3ZR6A 1PAMA 3WUGA 1JZ8A 5BXSA 2OYLA 1Q6CA 3WD4A 3SUVA 2BHYA 1JFXA 1WZMA 5AC4A 2ZUNA 2AAAA 1JYVA 1OSEA 1YQ2A 3QGVA 1L8NA 4B15A 2WK2A 2QMKA 1JD9A 3UESA 3FNDA 4FLQA 3WFLA 2HVMA 5FOOA 3GNPA 3HMCA 1ZBKA 3CPUA 4CUCA 3GH4A 1BYBA 4JKKA 3L4ZA 3OGSA 5A6LA 3WDHA 5I79A 2VCBA 1G5AA 4CD4A 3MSDA 4HP5A 3O9NA 2ZUSA 2WMJA 1OIMA 4AD4A 1AMYA 5BYWA 2DSUA 1KXTA 3RJYA 2WM0A 1US2A 1HJSA 2WC3A 1J0HA 3CUJA 3O6AA 4UQAA 4B16A 1V3MA 1QNRA 1DWGM 4P7NA 4Z2KA 1BYCA 1Q4NX 4P8WA 4IISA 4MNMA 1R86A 5A6AA 1JYXA 3VIHA 1J0ZA 1EOKA 5JBFA 1E15A 2XM1A 5IHSA 4WSKA 2E8YA 3F5KA 4NRSA 2PWDA 3VIJA 4P8XA 4UFJA 4V28A 2WBGA 5BRQA 1UUQA 4UFMA 1JFHA 4QDMA 1UKSA 3WDRA 5A8MA 3AIBA 1CGTA 1OD8A 3B9EA 1LL4A 5IDIA 1ZBVA 2ZUTA 3L2MA 4FK9A 1J0YA 2D3NA 3MUIA 3AMCA 1PZ3A 3EDDA 3WNLA 4AIOA 4CVWA 1PZ2A 1FHLA 1QNQA 1R87A 4PMUA 3NUKA 5A6MA 1QI5A 3RDKA 1M01A 5A94A 1DWFM 1UR4A 3VD7A 4AZ5A 3WQ4A 1ZBCA 3BC9A 3T08A 5GQBA 3OIHA 2E40A 3SUUA 3BGAA 4GQQA 4NI3A 1TR1A 2ZUUA 3W38A 2JIWA 4D6FA 5BRPA 4XV0A 3BAIA 2YL9A 1UQZA 5A8NA 4CD7A 4MNKA 4TTGA 4HMCA 1CTNA 3ARZA 2GSJA 1J01A 3ZJ6A 4AZ6A 2PWHA 3RM8A 1JG9A 1JYWA 3VM5A 2UY3A 2WW5A 2DT1A 2X05A 1V0MA 4MTVA 1E40A 3W29A 3VINA 2J8GA 3N15A 4PBGA 5A95A 1H3GA 5E0CA 1CZ1A 1FP8A 2W66A 1EQCA 3VVGA 4Z2LA 1MW1A 1VAHA 4BQ3A 4MPKA 4JFWA 1DWAM 3VMPA 3SCSA 1FFQA 1KXHA 2PWGA 1CXEA 4UCFA 2ZE0A 3S2CA 3BCFA 4KH2A 4QLKA 3EMQA 3ZO9A 2W63A 2AMGA 5C70A 3AISA 4PEEA 3WF2A 5KEZA 3RM4A 4UFKA 1W2VA 1PX3A 3MUZ1 1J10A 1LLOA 1E56A 1JNDA 2QPSA 3GH5A 4AIUA 3WMSA 4C7GA 3WL0A 2DGAA 3WELA 1C92A 1DP0A 4P8VA 2VCCA 2JF7A 3A4AA 2GK1B 2ZX7A 1OWQA 3VX0A 2WVVB 2XFRA 4DWSD 4JHOA 1WDPA 3MS8A 1BG4A 1M7XA 5FL0A 2J62A 3VD4A 1W3KA 5EMYA 3WQ6A 5D9PA 1O7AA 1XV8A 2VRKA 3S6TA 2A3CA 3EDJA 5JIPA 2CYGA 1OGBA 3WD3A 3VO0A 1XHGA 4JFVA 1E72M 3JUGA 3WQ8A 3OLEA 3VUPA 3U7BA 3PN8A 4W8LA 2J7CA 1XYFA 3OLIA 4AZ7A 2VT0A 2WHKA 2J7EA 2YDSA 1WDRA 3AHXA 2WMIB 3N18A 4HMEA 1UA7A 4D6HA 5LA2A 4UOJA 3HN3A 4M81A 2BVTA 4DM2A 1KQZA 4PRWA 4LYPA 4KRTA 1HX0A 3CUHA 5A1AA 2DT3A 3CHCA 5I23A 4A3HA 2EQDA 1UD2A 1Y7VA 1OCQA 1GOIA 1HVQA 2BNJA 1HXJA 1MW3A 4D6EA 3KEHA 1H0IA 1AVAA 4LYRA 3RM9A 2VR4A 3FHAA 3B9AA 1ISZA 4EE9A 5JIWA 2VZTA 3TTSA 1LWHA 1K9TA 3BSHA 1CBGA 3WNPA 4HOWA 4DUVA 3A6OA 3NSMA 4AC1X 3W4RA 3PTKA 2VX7A 3AXXA 2WKGA 4WKFA 3ARXA 1VEOA 3WBEA 1FH9A 5I24A 1QHPA 1UA3A 4GZIA 3U5UA 4OUEA 2CBIA 1KFWA 1G94A 2BVYA 2WBKA 2ZICA 4CCEA 3EBVA 2X1IA 1MW2A 5GNYA 2YL8A 5IFPA 1R8LA 5I78A 1E3ZA 4RE2A 4NF7A 2WLZA 1DWIM 2FHCA 3VGEA 2O9RA 2QPUA 4J28A 2VQUA 3VNZA 5JUVA 5A6SA 1SYTA 1DHKA 3WF1A 1I75A 3VDBA 1ZJBA 4Z2GA 3BMWA 2DIJA 1E43A 1CXHA 1VFMA 1UR9A 2XVPA 1OGGA 1FHDA 1VF8A 2IUZA 1CLVA 1TVNA 2PF0A 3PZVA 3QOMA 5A2CA 4IPNB 2XVGA 1UD8A 2VR5A 4UZSA 3CZJA 3NYDA 4B9ZA 2GUYA 4BQ4A 1UZ4A 1X6NA 4GXPA 2XVNA 9CGTA 3SCWA 2J75A 3NDZA 1RP9A 4J3SA 1BG9A 1JAEA 2BXZA 2GVYA 3AXIA 3PZOA 2XG9A 3TTYA 1JI1A 2Z1SA 4MAZA 4C7FA 1ZB5A 2OSXA 4M56A 2OWWA 3WDQA 5A2BA 1HJVA 3VPLA 1K9EA 3PZGA 1NWRA 1QNSA 4HZ8A 2CESA 3NCOA 4U3CA 1E4MM 2EJ1A 4E8CA 3ARVA 3ZIZA 4JCMA 3K8MA 3VILA 3AXHA 4TVUA 1HKJA 4LXFA 3L4UA 2J78A 3EDEA 3KL3A 1FA2A 3U57A 4H41A 4AD0A 1FOBA 5JH8A 1JZ3A 1R7AA 5ABFB 2FHBA 1W2PA 3AHZA 2BV9A 1J12A 1QHOA 4FF5A 2WMFA 3NSXA 3CZEA 3ARWA 1GOQA 4M80A 2XWDA 5ABEA 4F8XA 4AZBA 3F4VA 2Y2WA 4YN5A 2C0HA 3UR8A 4AZIA 3WEMA 2E0PA 3AROA 2J8FA 3W27A 3ZT5A 4EKJA 4KGJA 1LJYA 1S46A 1UHVA 3UEQA 3IK2A 5ECUA 3LPGA 4V2XA 1ZBWA 4D6JA 4PMXA 4YHEA 5DT7A 1M03A 4W87A 4S3KA 1JXJA 1PIGA 4GIAA 3BAJA 2CKSA 4AZGA 1N82A 5CQ1A 2CXGA 5D8ZA 2XTKA 3T2OA 3CUGA 3AZSA 4HOXA 1NOWA 3W26A 1CXFA 3IJ7A 1QVBA 4ZFMA 1E1FA 1V6YA 1ODZA 3MMUA 4V27A 2PB1A 3KZSA 5GNXA 4EAMA 2WMGA 2ZXQA 3VIPA 3W0KA 3SCUA 2A3BA 1GQKA 1WNOA 2WLYA 1L0PA 1PEZA 2OSWA 5AYIA 4CN6A 2WKLA 2A3AA 4W8BA 5CSYA 5ABGA 1CLXA 1F4HA 1UOKA 2D0HA 3K1DA 4R27A 4QCFA 2XUCA 2XFYA 2O92A 2F8QA 1JAKA 2YBTA 1UKOA 1KBKA 3D3AA 1G1YA 4KWUA 5DF0A 4ACZB 5BXTA 2WZEA 4URIA 4EANA 1I1WA 2ZX9A 4FMVA 2V3GA 3WH9A 1GOWA 3UG4A 4WLCA 3CTTA 4TX8A 1CGWA 3SUSA 1GNXA 4YHGA 4CD8A 4HZ7A 2JFEX 3MKKA 4P8UA 1H09A 4JL2A 4D6DA 1MXDA 2XM2A 4HA4A 4KRUA 2ESCA 3F5JA 3WH5A 4H2CA 1ITCA 2VI0A 2J4GA 1ISYA 1HKKA 4F66A 2WWDA 2V5DA 3WNKA 4PTXA 2X8RA 1W1VA 3UR7A 1J11A 3ZJ7A 1KBBA 3RILA 2J7FA 3AHYA 1ODUA 1NWTA 3CZGA 1A3HA 1EDQA 3AIWA 3ARUA 1WPCA 2O9PA 3W53A 1UWTA 3WNNA 6A3HA 3GXIA 3RIKA 3ZMRA 3PTQA 4QAWA 1C91A 2WC7A 3L2LA 3I3EA 1DEDA 1W3HA 1MFVA 1B3VA 2XIIA 3QHMA 4ZXOA 1E70M 2VMFA 1CXKA 1RH9A 1C8QA 4DWSB 1C7TA 3WUEA 1GJWA 4LGXA 2XSAA 2WPGA 1TMQA 1GVYA 1V6XA 3W37A 1KXVA 2DSZA 3F5LA 1TZ7A 2Y8KA 1XCWA 3T09A 2X0YA 4ATWA 3A47A 2D3LA 3EYPA 1F4AA 3PZUA 3ALFA 1PJ9A 1ZL1A 3WEZA 4AD5A 5CPTA 1CYGA 4W86A 1H41A 3WSUA 1MVYA 1B3WA 2GFTA 5M03A 3OLDA 3SCTA 1XYZA 1OB0A 1QBBA 1WAWA 2XFFA 4OBSA 8A3HA 3MMWA 2J7DA 4J3UA 5I0DA 1LG2A 2OLHA 2C8NA 5M3WA 1UWRA 1FFRA 1GJUA 4U33A 2D0FA 1NARA 1H0GA 3SIMA 2PI6A 5D9MA 1QW8A 4JIEA 1FP9A 2VX6A 3A3HA 4HPHA 2X0HA 4RE3A 3AZRA 1SMAA 1E6NA 3AS3A 2GK1A 3HU7A 5CPQA 4JZ5A 4UNIA 1IZKA 2W4XA 2NW0A 2WVVA 1VENA 1C93A 3BAXA 3FN9A 2W67A 1CGUA 1MYRA 1HP5A 4M8UA 1JZ6A 2XVKA 4HA3A 1SMDA 4TX6A 3GM8A 4MAVA 3WF4A 1HL8A 4MB3A 1PX4A 4U2YA 3ZT7A 1XD1A 3MANA 1H1NA 2WWCA 3WD0A 1VIWA 1UWSA 1XCXA 2XHYA 1BFNA 3IAPA 4AEEA 2DT2A 4N42A 4P7QA 2WMIA 1V0LA 3T0BA 5CJ5A 3N1AA 2QF8A 1BYAA 1UWQA 2WVSA 4W89A 2BFGA 4ZEPA 2CERA 1HKIA 2JE8A 3AMDA 4FLOA 5E6ZA 4ZXLA 5GPRA 3CBWA 3CGTA 4H7VA 4AXNA 1C90A 2QLYA 4ML4A 1C3FA 4Y7EA 1JF6A 5I5RA 1GW1A 5A6JA 2VRJA 4E2OA 1US3A 1VFFA 2Y4SA 3T2QA 1V3LA 1E5JA 4QP0A 5BWFA 3VDAA 5CLTA 5DT5A 1V03A 4E4PA 5A6BD 4PMZA 1OBAA 4WK9A 4HZ6A 3VIKA 5ABHA 5E6YA
chains in the Genus database with same CATH superfamily
2P0IA 4MUZA 1PE1A 3DFSA 3GIYA 1R0MA 2XDFA 3GW0A 2R94A 2FQIA 1VRDA 2VVNA 1S2CA 2FZBA 4I9MA 3CC1A 4Q8VA 1JNEA 3VNMA 2W91A 3LSBA 1EQ3A 2J27A 1XPGA 2Z2BA 1KT1A 3PZMA 2XH4A 1BKHA 3I3BA 1F05A 3DEQA 4D71A 3TYBA 5AC5A 2BHUA 1DWJM 1PDYA 2WJEA 2KX9A 1EFZA 2REQB 3GKAA 4FNUA 4GX8A 5HXMA 1IZJA 5I98A 1V02E 4GPNA 4KEVA 4FNQA 3P3BA 4DH0A 2V8ZA 4ATDA 4JFUA 1D7KA 1PDZA 3UF9A 1X7IA 5C54A 1A3WA 3E0VA 2JALA 1IZCA 1FY6A 2WHJA 2D1ZA 2FH8A 4BWLA 3BH4A 3CUFA 3FVDA 3FEMA 2HROA 5BMWA 1QI0A 1BL4A 3QSTA 3FYPA 1D3GA 3FOKA 2O4QA 4WHBA 4GI4A 1U5VA 1W3IA 4IQ2A 2CLFA 1FWRA 4RNJA 5DN1A 1V6WA 4DPQA 2DPEA 5HJYA 4LANA 2HRWA 2V6AA 1XF0A 2OQLA 4K8HA 1GVIA 1S2TA 2FZNA 2INFA 4LUIA 4EP8C 3UPMA 4FLRA 2GWNA 4OIFA 4EVZA 4R7WA 1G4EA 4QQ3A 3N6JA 3BLOA 1TV2A 3L4TA 2PDJA 1B30A 1X96A 3TUUA 4K8GA 2VYOA 5AHFA 3L5MA 2I9UA 3W82A 1V4YA 3MDUA 4ZGYA 3O5KA 2EG8A 1W3LA 4XAKA 2X7VA 2B7NA 2Y24A 4V1YA 5G2HA 4B5UA 1S1RA 3PZTA 3KL5A 1C9DA 4R0XA 1JUKA 2YL6A 5AC6A 3VOHA 3TMQA 1UZDA 4XSMA 2I56A 4C6KA 3W1MA 1WBJA 3FKRA 1LOQA 3VGHA 4LVFA 4RW3A 1P7TB 1REQA 4HN8A 5DEZA 3DFNA 3EWWA 3QF0A 3VA8A 5DITA 4PMDA 1PB0A 4IPLA 4WDWA 3EA2A 3AJ7A 3OIXA 3PTMA 1MFUA 2PDGA 3ABOA 2D22A 3VCCA 1XYMA 3ZS4A 3WD2A 1D3HA 1B6CA 4JX6A 1VLWA 3I6EA 3KS6A 3QH2A 4XAZA 1V6VA 1MXSA 3UZWA 3KUMA 3N2CA 4OBRA 1OG0A 1FWCC 1KTCA 3EKZA 2XN0A 1TIWA 3RJXA 1OFEA 1U79A 3PBVA 1OT2A 4ZOEA 1JXKA 4UOZA 2E9LA 4OV9A 1JUBA 5K9XA 3I7RA 1H50A 4X0NA 5BXRA 4ERIA 3C2VA 3VOCA 4N2YA 5BXPA 2AKZA 2VCDA 2X09A 4DY1A 2RQSA 3NJ3A 2A3LA 4N4PA 1Q6HA 1XCFA 2VURA 5JBEA 4ACZA 2VEFA 3P67A 4C6FA 3W88A 3SEPA 1CEOA 3W2NA 3BMBA 1XLMA 4TMBA 2XIBA 3F7JA 1F5ZA 2PURA 3DXIA 4GACA 5DLCA 3N19B 4MM1A 3BAWA 1O4UA 2QV4A 3TC3A 4AFYA 4QE1A 2E3ZA 3H54A 3CT7A 3IWPA 1ZUAX 5AECA 3B9OA 1ISWA 3MCOA 4FOJA 1GYMA 4C7DA 1UOZA 3PJWA 1FKWA 5FF4A 2XH0A 4ZE4A 4AIEA 5FAJA 1GORA 2Q8ZA 5LA0A 1MEWA 4ORMA 4PTMA 4XZBA 4Q3MA 1MEIA 3CQIA 1KCXA 3CB8A 3W7QA 2QCEA 3G1XA 1AQ0A 2YDAA 4W85A 1R85A 3B04A 1EIXA 2IQTA 3T0AA 4K7YA 4WJXA 4C65A 5CC3A 1FDZA 3C0JA 1TZ9A 3B06A 4HKPA 7TAAA 2ZVIA 1M41A 1RCXB 5KETA 4BZYA 1E6SM 3PSVA 1ML1A 2MLYA 1WUFA 4AXKA 5TD4A 3TQVA 3QV6A 3U4AA 4UMCA 1WX0A 5D9NA 3GXPA 5DO8A 1K8ZA 4UTUA 2KZHA 4N9BA 2PU0A 3FA4A 3GU1A 3IIOA 2HXTA 2YDRA 2WQPA 2XP7A 1VFOA 4IUOA 3DYMA 3HPXA 1VEMA 4BWLC 2X16A 2ZXAA 3GRIA 3NQ6A 4MJ2A 4CQ9A 1T96A 2A6LA 5I2UA 1DBTA 5KZEA 3LNPA 3MT1A 1Q63A 1QXLA 2PWEA 2PTXA 2NWRA 1PKNA 4H04A 3ZWTA 4L6HA 3ZSTA 4PMYA 2ZUWA 1UH3A 2R91A 3E49A 3QFEA 1B4EA 2E5DA 3WG6A 5BROA 1EC8A 4GO8A 4EPKA 3IACA 3THQA 3SUTA 2BWGA 3KOZA 1KBJA 4G1KA 3OGVA 2Y7GA 4M5PA 4KCTA 3KP0A 1ADSA 1ISXA 4C6JA 3QV9A 2Y62A 2VOMA 3WJXA 4CU7A 5F2IA 4YU1A 4MUPA 3O5PA 1NDZA 4IPPA 3QQ0A 2WMKA 2G41A 4I8YA 4L9YA 1XYLA 1J18A 4GZJA 1GGOA 4JXCA 3N2TA 1ZK6A 1XL9A 1CXIA 1R6WA 1E6RA 5HBFA 2OEJA 4PUDA 5J5RA 1RD6A 3DC8A 4PEKA 2J9ZA 1EJWC 2DORA 1WO2A 3UXAA 2ZC1A 2Y8UA 4KCWA 1ZS2A 3LPPA 6TIMA 4DXKA 5I3FA 2A3HA 3ARSA 4F9JA 5EMJA 4KMQA 3UZYA 5IXEA 2V9DA 3P7YA 2P88A 2P4VA 1H49A 4HU8A 4XBJA 1FXQA 4P7LA 4WUIA 5EYWA 1KXQA 1D3CA 1S5VA 4UQCA 1KGUA 2EBNA 4AZCB 2C7FA 4GKTA 4JIQA 1I45A 2O9TA 4KCVA 4MLJA 2E09A 3E2SA 4RXGA 5K3VA 5G2WA 4UMBA 2C18A 4QISA 1T99A 3CPRA 3OVQA 3PWGA 1Q6RA 1DJIA 1ZJIA 2E7FA 3WLLA 8XIMA 1MZHA 5HR7A 1LWIA 1TV4A 2E9BA 1Z9AA 2R6OA 2WZHA 1JDEA 1M04A 4F0MA 4G50A 4DO7A 3AI0A 2V5JA 3E1F1 1KWGA 1YDOA 5IOBA 3IGSA 2HQAA 2XZ7A 4DX3A 2JEPA 5FJUA 4CU6A 1KFKA 3HURA 1CENA 3W7MA 3SGUA 3ANVA 4QJ4B 1HP4A 3L0GA 4UTFA 2G3IA 3WLQA 4FAMA 1OD0A 3BSGA 4UMAA 3QPZA 3UG3A 1A5MC 5EB8A 4WRHA 1QT1A 1Q85A 5G1TA 4IL0A 2WMHA 3W01A 2CBUA 2VDGA 3GNRA 4OOUA 1E6XM 2WPBA 3S1WA 5BOFA 4O57A 3GAKA 4AEOA 4U31A 4JN8A 2Z7GA 2ZRXA 2EXOA 3OHMB 4QX4A 1YATA 5HQMA 5J6EA 1B90A 2ISSA 4MZ1A 1BPLB 3LSCA 5REQB 3SIZA 3MJMA 2QGYA 2XSBA 3GW3A 4C90A 2OVLA 2VELA 2RJGA 3URQA 3POHA 3NQDA 3FYOA 1BVNP 1DPMA 3GTHA 2ZYFA 4B9YA 2DEPA 3TYZA 3WBWA 4AAJA 3W81A 5HWCA 3DBNA 4HQVA 3OO2A 4UTWA 1Q6IA 3CQKA 3LRLA 5E1QA 1T0OA 4BHYA 4Q7IA 1Y5XA 2OELA 3BK0A 4QDWA 3S1XA 3IUDA 1YE6A 5H91A 1JGMA 3BLPX 4IPIA 4US5A 1CW2A 3O5LA 3WY1A 4QFUA 3E2VA 1SZEA 5D09A 4IT4A 4K37A 1KC7A 3REQA 2J9XA 3LM3A 4WIWA 1X1NA 2ISWA 3L9CA 5M2FX 2NQHA 1LQ2A 2NV2A 3LCIA 3T44A 1J4EA 2HZGA 1FDJA 2NQJA 1F8MA 1CI1A 5E9XA 4QLLA 3CXOA 1X6LA 2L5HA 3IJ9A 1EH9A 3ID7A 1QI3A 4NU7A 1LM1A 1FWAC 3CH9A 2J8TA 1GVOA 3GS6A 5CPMA 1ONXA 3AS1A 3D47A 4DJED 4KW2A 2R24A 4JQ4A 4B5SA 3NG3A 2PDMA 4ZL1A 3NEVA 1E1CB 3TNBA 1LWJA 3PC0A 4RR4A 1XLLA 2XGBA 1AQHA 2DT0A 2J25A 3U5YA 5D04C 1BRLB 2WAGA 4U3AA 1R5YA 3WDIA 4IQJA 2F61A 1WKEA 1KFJA 1MI3A 3DIPA 1J4RA 1E0WA 1U83A 1B1YA 3WQVA 1TJPA 3A3XA 4IJRA 1Q5MA 4Y9OA 4TIMA 1MRQA 2DW6A 2V30A 2H3BA 2CPUA 5LKYA 2YKKA 3L23A 2NQ9A 2FAPA 3HFYA 3C3UA 3HGRA 1U2YA 4ODMA 2AQWA 1UKQA 5D38A 3CPGA 3ONBA 1BAGA 2G4JA 2V5CA 2Z24A 2EPHA 3S4TA 1L6WA 2Y78A 4BI5A 3HGSA 4I9JA 3R25A 5FL1A 2IQ0A 4JEQA 4A3QA 1P6BA 1LL6A 3S2MA 5U4NA 5CC7A 3NO1A 3FXYA 4NASA 4MDOA 3DECA 3UVAA 3FS2A 4Q8QA 1JGIA 4NZ5A 1NF0A 2CBVA 1I2QA 5CZSA 4ZCWA 2VGIA 1HZYA 4ZQMA 2CETA 1A4LA 4QDPA 3A64A 3RAOA 1YKWA 4I6KA 3T6CA 4AD2A 4CQBA 3UGRA 3LD5A 1WKFA 1P48A 1DTUA 3M0VA 3NQBA 1ECQA 5M17A 3FJ6A 5CPSA 2J74A 2OJPA 3SSZA 2DZSA 2PSNA 4L1XA 1BSLA 1VFSA 3WH7A 2EPLX 4HN4A 1UH2A 3NPUA 2OMAA 2CEQA 2BP1A 2B0MA 4LAZA 1NSJA 3DH7A 3OQ8A 4K39A 5L6UA 1GCYA 4J27A 1RBLA 3H2EA 1XLKA 4H8HA 1KW1A 5DMNA 1YPIA 4I5UA 4UTKA 4UTMA 1ITXA 1DVJA 1JCMP 2RUCA 2Y85A 5JU6A 3HV9A 1V7AA 2PGWA 3EX2A 1SZRA 1RPKA 4HSHA 3JW7A 2N87A 2OZ8A 1B0IA 3ZR5A 3KACA 1C7SA 1IWBA 2NX9A 1W1ZA 3ZXWA 1MQQA 5EFDA 2GJRA 1RP8A 1KRCC 2ZZ1A 4BI6A 2HISA 2Z7KA 3N04A 5AFDA 4AX7A 3TP4A 3RLVA 4RPPA 2EPNA 4FOUA 2GVLA 4XVDA 4LRSA 4AWUA 2PMQA 4AY7A 2HNHA 1HJQA 1E9YB 3R13A 4AD1A 3VDGA 1Y5WA 4UTWC 4NZFA 1NH6A 3DFTA 4AMCA 1A0DA 1O66A 1O94A 4JFMA 3W25A 5I06A 2ZXDA 4O1EA 3KZ7A 2QCFA 3WD1A 3E0FA 4H6EA 4FO4A 1UD4A 4ICMA 3IK4A 1EP3A 2YGYA 3VD5A 1ENUA 4R5EA 3GTNA 1UQYA 3FW6A 3V0SA 2AMXA 5FSEC 4V1XA 4XZNX 2VVSA 2ZZ3A 3CUZA 1B5TA 5DBUA 4EWND 4JD4A 4JTEA 3K4DA 5TIMA 2VUYA 2J79A 3IARA 3PNUA 3PRBA 3FAWA 4DRNA 5AC7A 1L6GA 1KCLA 1T40A 4HBEA 4Q6XA 4AWTA 2XP9A 4IFRA 1X8FA 5M5DA 2YDQA 2CHNA 1C8XA 2HVOA 3TN5A 2NV1A 1K7XA 1E3XA 4AY1A 3GU0A 3URAA 4JQ3A 5H8PA 4Z0SA 1LF1A 4DXXA 1LROA 8CGTA 4IFKB 1Q6GA 3D3FA 3RLHA 3QTPA 3RUBL 1V08A 2Y89A 2YCLB 2R9RA 2VGFA 4G7EB 4R9OA 1TA3A 3G1HA 2FMOA 2Z2AA 3GR7A 4RZ6A 1CNVA 3BSMA 3G0XA 1AA1B 2ANUA 3GHSA 2GJXA 4KQZA 3FK4A 4ZA0A 3NM1A 3DENA 1EJXC 3PAJA 2XPBA 1QW9A 2R1PA 3ZJKA 3O5GA 1DJYA 4MB1A 2AOSA 2PD9A 3NDOA 1PYMA 1UZ1A 3QMRA 2AGKA 1PTDA 2QKFA 3ZR6A 2RDUA 1JZ8A 2OYLA 1YNQA 3WLMA 3C2RA 3V0UA 1XW8A 2BHYA 1WZMA 2Y61A 5AC4A 3H4XA 1TE6A 2OXNA 3ITGA 3T9PA 3QGVA 4B15A 2WK2A 1XUUA 2AL1A 4H7CA 1FWTA 4RK8A 3MW7A 7XIMA 3WFLA 5FOOA 1ZAIA 4XISA 1QK0A 4MY8A 1Z3NA 2DZUA 5I79A 1N1AA 4HP5A 4DYEA 3O9NA 2WMJA 3QR0A 1JDFA 4OV4A 1ONRA 5LIUX 1VKFA 1US2A 3RMJA 1A5BA 3ITOA 4UQAA 4KKXA 1UWAA 5HMDA 4C1NA 4XD4A 2F6XA 4O8RA 3FSUA 4MNMA 1RV8A 5C2CA 1R86A 2PDNA 1XR2A 4FSAA 3E5BA 1J0ZA 4B2DD 1KFEA 1OX5A 1DJHA 4NIRA 4NRSA 3NQCA 3ANUA 3UJFA 4Q6JA 5DCEA 4J2PA 2IPGA 4QHRA 3GVQA 3EPNA 5BRQA 4UFMA 3RK8A 3LG3A 1CT5A 4MWAA 1OD8A 1TV3A 4L3NA 3WZ0E 3T4WA 4GFSA 1PV8A 3L2MA 4FK9A 2ZZ4A 1J0YA 4E5TA 2D3NA 3AMCA 3D46A 4S2BA 1PZ3A 4JQ2A 4CVWA 1RY8A 2Y6ZA 2GGGA 4FHAA 4RDYA 2QAFA 1GZGA 4WOQA 1A5OC 1M01A 5A94A 3LTPA 2ZVRA 1MRAA 1BVWA 3C8NA 3WQ4A 2HXUA 1RSCA 3OIHA 1QWKA 4FXJA 3W7HA 1QASA 4YIWA 1Q66A 2V81A 1EZWA 2J24A 4NI3A 3W38A 2JIWA 3KOFA 5BRPA 3BJTA 3BANA 3N14A 2H6RA 4MNKA 1HO4A 2OCZA 1I60A 4HMCA 2GSJA 4XBSA 3RM8A 1JG9A 1JYWA 2F6UA 2D73A 2R1MA 1X1OA 1Y0OA 2Y1HA 2J8GA 1L2QA 4PBGA 2QF7A 4DRQA 4HZMA 2P76A 4Z2LA 3HQ1A 4M6UA 1EL3A 1SJBA 1OF6A 4N7QA 3SCSA 1GRJA 4Z1YA 2FTWA 1HFBA 5HQEA 1ZAHA 1K6WA 1LP6A 3BWWA 4GLEA 1YW1A 1N7KA 2AMGA 2W63A 3PG9A 4GK8A 4PUMA 4I3GA 5T9BG 4NX5A 3O5EA 5HWMA 3MUZ1 1DJGA 2QPSA 4GH3A 3O5OA 4AIUA 4PE8A 4C7GA 4M7SA 3CAKA 3WELA 5CPNA 1C92A 2QCHA 1C9HA 4EXAA 5T9CE 4OE7A 1MUCA 4HHHA 1OWQA 4TV6A 2WVVB 3A9BA 2CZ5A 2ZZ6A 2XFRA 4GGHA 4JHOA 1ZP4A 1WDPA 3BG9A 1P0KA 2NLIA 2J62A 3P0XA 2MLXA 4GY1A 1KLZA 4EXBA 5JIPA 2CYGA 1OGBA 3WD3A 1UBPC 1XGEA 3QFWA 1P5BA 3CWOX 3U9IA 4ZSUA 3BDKA 5LSMA 1XYFA 1A0CA 3M5XA 4IPJA 5HATA 2YXGA 1AJ0A 4HMEA 5HTGA 3G0UA 1UA7A 3UBPC 3V16A 4D6HA 1GVRA 5LA2A 3HN3A 1LORA 4M81A 4NXKA 1S39A 3MVIA 2PDUA 5C9ZA 3CUHA 3UWWA 5CG7A 1ELSA 4A3HA 3O6YX 3QW3A 5HKGA 1GOIA 5PTDA 1HXJA 3W7GA 2PTDA 4HB7A 1H0IA 4KEZA 2HSAA 5IBXA 1ZCCA 4HOWA 2HVNA 1XBZA 3PTKA 4ODQA 4CEUC 4WKFA 3B0PA 1KRAC 1GT8A 3U5UA 1U22A 3MC5A 3KW3A 1ZPTA 1V5XA 3PG8A 2WBKA 2ZICA 4CCEA 3O15A 1E3ZA 1UW9A 4A05A 2WLZA 4XUGA 4QITA 2FHCA 2QPUA 3DZ1A 1NDWA 3QGAC 3W02A 2VQUA 4B5TA 5JUVA 4HJFA 2YCIX 4NQ1A 1OX6A 3QKZA 2AKMA 2NQ5A 1I75A 1BXNA 4Z2GA 2DIJA 1VFMA 3PP7A 2F21A 2XVPA 3KWSA 1OGGA 4NAFA 1VF8A 5HMEA 2HMCA 4IPNB 2XVGA 4UZSA 2KAUC 4L4LA 1YPFA 4I7UA 3E0WA 4Q8OA 9CGTA 4MWAC 3SCWA 2WSQA 4DVOA 1YW5A 3AXIA 3PZOA 1JI1A 4C7FA 3QN3A 1MEHA 4X22A 2IPJA 5H2ZA 4DZ2A 1BKFA 1HJVA 4C60A 3VPLA 3QYSA 4JOMA 1F7BA 4XAPA 1XRTA 3LHWA 4WJ8A 3NCOA 3S5SA 1E4MM 3ZIZA 2RSEA 3OODA 4TVUA 1HKJA 3N29A 4LXFA 3N6QA 4GUFA 4XD5A 3P8IA 2ATSA 4H41A 2NUXA 2RDTA 1FWEC 5JH8A 3W2JA 4POCA 1QK2A 2FHBA 3AHZA 3IGHX 2EJAA 1YX1A 3ZYZA 3W9ZA 1NF7A 2BV9A 1J12A 2LGOA 4QTGA 1VBJA 3MKVA 4UXDA 4R88A 1ZY9A 4LBUA 3P5YA 4F8XA 4AZBA 4Y2WA 1KV5A 4ODRA 2GOUA 3PUDA 1QNVA 4LEFA 4MFDA 1KT0A 3NGFA 4G8TA 3SM0A 1REQB 4L9ZA 3W27A 3ZT5A 1XYBA 4C1KA 4EKJA 1LJYA 3GHTA 4XKYA 2HDJA 1UUOA 2KGJA 3M5VA 5FJTA 3N2XA 4PMXA 2J9YA 4QAIA 3AALA 2GPTA 4L56A 1PIGA 3BAJA 2H8XA 5CQ1A 5C7VA 3T2OA 3GYEA 1NOWA 3R8HA 1CXFA 1SFJA 1QVBA 5GPGA 3MBFA 3BGGA 5GNXA 4EAMA 2GQ3A 3W0KA 3RLUA 1WV2A 3OW1A 6XIMA 3C2YA 2WLYA 1PEZA 3B8IA 1RQHA 4CN6A 1D7HA 3T8QA 5ABGA 2A1YA 3K1DA 1CB2A 4R27A 1BTMA 3K2GA 3HG4A 3URBA 3G22A 3UXLA 2YBTA 1UKOA 4JBRA 3T7VA 5HNRA 3GDMA 4ACZB 2HJPA 1BEUA 2WZEA 1IIGA 1AL7A 5HJLA 3VABA 1I1WA 4FMVA 2V3GA 1GOWA 2V2DA 4N9CA 1UJQA 2V82A 4WLCA 4KS0A 4LCRA 4TX8A 4Z08A 2CU0A 4CD8A 2JFEX 4ODNA 1H09A 2AL2A 1OC5A 4OFCA 3TCSA 4IMGA 3UJ2A 1SU5A 3RG6A 4H2CA 4CCZA 2P8CA 1NFGA 3W7CA 1HKKA 3UWVA 3G1DA 4WDXA 3TYAA 3STCA 3B8VA 5CZTA 4YS1A 4Q7BA 1KBBA 3M47A 3FCPA 3RILA 3CZGA 1NWTA 1GVSA 1EDQA 3CGMA 3W83A 2CLHA 3KTSA 1GVQA 3AIWA 3ARUA 4AVOA 4Y9NA 3H7VA 6A3HA 2C3ZA 4XKMA 2Z4GA 2D9FA 1WYIA 4M19A 1LT7A 4NL1A 4HNNA 3DN5A 5IBXC 5MHBA 1ALDA 1A5LC 3QHMA 4GUIA 1OADA 1Q8AA 4N6FA 1IYXA 3WUEA 1GJWA 3EWBX 2XSAA 3R0KA 3BW4A 2WPGA 4B5VA 1TMQA 3W37A 4X9SA 1KXVA 2DSZA 3F5LA 1TZ7A 2DZTA 2I5QA 1UCWA 2FTPA 3A47A 2D3LA 1H1ZA 1I0DA 1T7LA 4PFHA 3WEZA 4NP7A 3E0IA 4PGLA 3IRSA 4EF9A 3OLDA 2DZBA 2ZZ5A 3W1NA 3KAFA 3ITTA 1NU5A 1WAWA 3EGJA 4ZB2A 3MMWA 4J3UA 3CWHA 3NQEA 2V69A 1GJUA 4U33A 3H2MA 2PWVA 1FWWA 1DKWA 5D9MA 4JTKA 3O63A 1FKSA 2X0HA 4XG1A 1M7JA 3S1VA 2GK1A 1E6NA 3OP2A 4YXGA 2I5IA 3HU7A 5CPQA 3KCJA 2VDHA 4Q8PA 5HUAA 1QTWA 3FN9A 1QMLA 2W67A 2ZQTA 1O1ZA 4D8ZA 3CGNA 4F0SA 3MP5A 3LYEA 4KCUA 4HSOA 5BNKA 2TODA 4TX6A 3GQYA 1J6OA 3GTYX 3UQNA 1PX4A 3O5JA 1BKSA 4PB5A 1JVNA 4IIFA 4ZQPA 2DZVA 2OX1A 1AW5A 1XCXA 1S2VA 4YMZA 5C7HA 5I09A 4DNHA 4AEEA 4LAKA 4P7QA 4N42A 3H22A 2WMIA 4YVXA 3EX3A 1DIEA 1IHIA 3LQGA 2ETNA 2QF8A 4ZEPA 1OK4A 2WVSA 1TKKA 4O4VA 3AMDA 4FLOA 5E6ZA 3S6DA 1A49A 2MLZA 3CBWA 3G0SA 4V15A 4LNYA 4DJFD 1C90A 4Z1DA 4GNVA 3A22A 3XISA 2XP3A 1VFFA 4UTLA 5BWFA 5EPDA 1TUFA 4C6IA 4PMZA 3W2MA 3GTFA 4HZ6A 5E6YA 4A4AA 5E9AA 3B4YA 1U33A 1MQRA 4K7VA 4DLFA 3OZPA 1MSSA 4ATLA 3TU9A 4JAWA 1XRFA 4QS6A 2WHLA 4H19A 4AHPA 2RURA 3EWZA 4Q8UA 1OCNA 5F7UA 3QMSA 3UI4A 3B03A 3FA3A 1Q2SA 3M41A 3WLOA 5LGZA 2X1SA 4W88A 2ALDA 1TPVA 3MY9A 3TYEA 4RE4A 1OCJA 1AW2A 3WKZA 1PIFA 5IDZA 5TBOA 1XH0A 4IUGA 2G0WA 2VZVA 1F6YA 4M82A 4LUTA 1V02A 2JIEA 2D24A 3NQAA 3KBSA 2GVJA 3EWCA 3PHAA 3EEZA 2X2YA 2YSWA 1SW3A 3PUEA 4Y8EA 4UQ9A 5CH9A 3HZ3A 2Z0IA 2DH3A 2ACQA 4GD0A 2ACSA 1MMFA 2DUAA 2CNCA 3WLJA 2G3NA 3AYSA 3BO9A 1HUVA 1R2TA 2P1FA 3L4YA 2RKXA 4ZB0A 1JDAA 3L67A 2RUDA 3ATYA 4AX6A 2QEZA 3RLGA 3UP8A 4J3XA 1IEIA 1QNPA 2PP3A 4QEHA 4A2SA 4IX0A 1YHTA 4W7VA 2XP5A 2QUNA 1PL9A 2QMJA 2ZADA 5TF0A 3GFXA 5MKGB 2VZUA 3P61A 1S38A 4HCHA 3CHEA 1JCYA 4FNSA 4IOTA 1RXOB 1OT1A 1WBHA 3DGBA 3QZEA 3IJQA 4H2HA 4H9VA 1UPPA 1IF2A 3ABZA 2XIOA 3IJ8A 1VB9A 4K38A 3VUSA 1OEPA 2ZA1A 3I10A 1JCNA 5D2WA 3PPFA 4Y9AA 4AD3A 2WCGA 7A3HA 1OC6A 5C8BB 2PFHA 4G1NA 4TO8A 2B7OA 4WZHA 3L0NA 2RJHA 3BPWA 4GA8A 3MHUA 1W5NA 4OJYA 3WQGA 4J3WA 3VTRA 3QM3A 1D8CA 3REQB 1AQFA 3UT0A 2A6NA 3PZQA 2QCNA 2ABBA 1JD7A 4P2VA 4CGTA 1CDGA 1RA5A 1W3NA 3WMBA 2PLMA 4PBFA 1TQJA 3FV9A 3UG8A 3FLUA 3RCMA 5F4WA 5CAHA 3KS5A 3G1VA 5EBAA 1E1EA 4HPNA 2ISVA 2OZTA 2RGMA 4IIHA 2DIEA 3WBAA 3PK7A 1B31A 1DXEA 3W6YA 1K8YA 4EPDC 2Y7DA 4DRKA 2FKEA 4U4MA 4OU1A 1GKRA 1JPIA 2JEQA 2W0UA 3SQLA 3OEXA 2YLAA 2PLCA 3CK5A 1VS1A 1EPVA 4A3YA 1XDJA 1EJUC 3UQIA 2FZ8A 5FD0A 2IXUA 3IPWA 2QCDB 1Z32X 3LTSA 3W24A 5HW6A 2R8WA 4PUUA 3QQWA 1FH7A 1YTKA 3MMDA 1KKRA 2H90A 4Z17A 4YNGA 3WENA 4D9PA 4F48A 4D6CA 3S5NA 2OX4A 4H83A 2XH7A 3TN3A 3L21A 3SQMA 2VOTA 4GCXA 1QJWA 2LKNA 1LBLA 1BWVA 3RF9A 3S9YA 1A4MA 3DYOA 3CEPA 3SZ8A 4WF7A 1LBMA 3WYZA 2DVXA 2EAWA 5FKYA 3GVRA 1B9BA 1XX1A 3S9ZA 3MU7A 3WLHA 4UC5A 3WL1A 5EMMA 1SFSA 4DYKA 3QRHA 3VMNA 1PZ0A 4ALDA 3VKAA 4HARA 1YE4A 4E38A 4DPPA 2V5BA 1Q8JA 1AH4A 2GSHA 3VIFA 1K9FA 4W84A 3TTOA 5I7GA 5I6SA 3B05A 4EK7A 1DHPA 1Y0EA 1VJZA 1LL7A 4WOZA 3GC5A 1EEXA 1XIMA 2WVTA 4EAYA 2VCAA 4UNLA 3W07A 1I2RA 3RFAA 2GDUA 4A8NA 4P61A 1PBKA 4OKDA 3QY8A 2GUBA 4LB4A 2J6VA 4MNLA 5FF7A 2CCRA 3W7DA 4M29A 4XZLX 3MP3A 3O5DA 3R2GA 3N3MA 3ALGA 3M64A 1ZJAA 1TSIA 2W62A 2ZWZA 3DYPA 1CXLA 1XH2A 3IUHA 3TDBA 2GVEA 3WF0A 1OIFA 1KFLA 2FVMA 3MV01 1EP2A 3MKCA 2E6DA 3Q4DA 3ZQ9A 1GYLA 5BOOA 4R7JA 4RNIA 1J9YA 2D0GA 1XH1A 3FGCA 1DV7A 1AODA 2R82A 4QSFA 2DZWA 3ERPA 2OKOA 3M46A 4DRPA 4NUWA 1UD6A 3R0UA 4AHQA 3A4XA 4O4WA 5A2AA 5HNTA 2XH2A 1QPRA 4IIDA 4YL2A 4KRZA 4L9XA 4PUJA 3M9YA 2A5HA 1XD0A 3OYXA 2PDPA 4NNCA 1RALA 2O9OA 3PPGA 1H7OA 6TAAA 5K9CA 1DIOA 3GB6A 3S1UA 1W91A 1TWZA 4PTWA 2A3EA 2Y5SA 3F4CA 3VFCA 2OLAA 1OFQA 1G7VA 1XKYA 1OQFA 4UZUA 5REQA 1P6WA 2Q6ZA 4GGQA 5D05A 4GVGA 4TXEA 2ONEA 3CO4A 4HNCA 2FIQA 3AOFA 2GJLA 3RR4A 2ZX5A 3T1GA 3TOPA 6XIAA 1FWBC 1SJCA 1ADDA 4BJHA 1XGZA 1RK5A 1K9DA 4YPJA 3P80A 3QHNA 5AB3A 5D75A 3CL8A 2E1WA 3DKJA 3EDKA 1BYDA 3UA4A 3AMGA 3GYCA 3F03K 4G56A 3R5EA 2DDXA 2X40A 2PPOA 2IXVA 3GNOA 2WO5A 3INPA 4WY0B 4DI9A 2I16A 3SN4A 3PA7A 2PPPA 3W1TA 4HSNA 2ZR4A 5C71A 5AVHA 1EX5A 1M5WA 4PRTA 3SJ3A 1RBAA 1E6QM 4UOQA 4XUYA 4JIPA 4DQWA 1KM6A 3LBMA 1V3JA 3MCMA 4I9TA 3E6EA 3K8KA 4H6RA 3IJ6A 4FIRA 2TPSA 4U86A 1Q6FA 3XIMA 1EJVC 2V38A 3SFWA 3DI0A 1OJXA 4DZHA 3U2ZA 3WLKX 1TG7A 4FNRA 1V6TA 3W1AA 2FFCA 5D2XA 5HINA 1D7FA 1BXBA 1C8YA 4IGSA 3VIGA 4D6IA 5CGQA 3HJEA 2W92A 4UTHA 1A5KC 4PB3A 1EQPA 4IMDA 2NT1A 3MSYA 7TIMA 3C3NA 3U2OA 3VIMA 4LS0A 3DG6A 1QI4A 2DG9A 4K68A 1TA3B 4RDVA 3GDKA 5CSRA 1GOKA 4IGHA 3JZUA 4Y9PA 2GJXB 2AWGA 3S46A 5HPCA 5CZKA 5HW8A 3CQ0A 3UCDA 4PCPA 1KO0A 1NMWA 1POKA 1WZAA 1VYRA 4W93A 4Z2IA 4UQBA 1GKQA 2B7QA 4S2CA 2J7BA 3KRZA 2HTMA 1UR8A 1WDWA 1ITUA 2C13A 1VJSA 1RA0A 1UWIA 3PTDA 3TWAA 2X30A 3UERA 1HJWA 4WXYA 2YA0A 3KDOA 5C2GA 1W8SA 3GBEA 1FKGA 4GNJA 3DHFA 1UD5A 2V0TA 4PCFA 2G37A 3BGJA 1GG1A 2VEGA 3T05A 4JCLA 4FLSA 3RFWA 1E71M 3S9IA 3UFYA 1H4PA 1L6FA 1HJUA 5HDRA 3NEHA 3I4KA 3HBLA 1TV8A 2C19A 3K8LA 2PPNA 3OZMA 3VU2A 2CLPA 4GVFA 3GXFA 1QPOA 3KE0A 4C1NB 1GOOA 2FDMA 3IAQA 5BMXA 5DMYA 1WDQA 4FR6A 1THFD 3LHUA 4QG8A 4LYKA 1PO9A 5CAKA 5CGMA 3GVVA 2PDLA 3O8AA 3ZJ8A 3QR3A 3CLWA 3MI6A 4FF7A 1WZLA 3P84A 3N4AA 3ARYA 1UH4A 4Y90A 3WO8A 4AEFA 1SQ7A 4D1JA 2QDGA 1DIKA 4Z2JA 4GYJA 4GVIA 4UB9A 4IPXA 2LJ4A 4L4OA 2NSXA 3SY1A 1EHAA 3SJNA 3GNNA 3MI3A 3NWRA 3IJIA 3NM3A 3J7HA 3LMZA 3VKCA 2Q09A 4N4QA 2VUNA 3APYA 2Y88A 3II1A 3IJLA 1LLZA 5EBUA 2Y8VA 4PMOA 2PGEA 3NZQA 1B3YA 3BL3A 3UXIA 5AYBA 2D23A 1QHZA 1S5WA 4QZVB 3P8JA 4RL3A 3GDBA 2YA1A 1JZ5A 2HEJA 2Z1KA 2NXGA 3EMZA 4UFIA 4OTKA 4FX7A 5FF3A 1J4HA 2ITKA 1NP2A 3ZVHB 4PTNA 3DC0A 2ZQUA 1IR1A 1G01A 1LBFA 1BF2A 3CZ8A 4GYPA 1YTDA 2CIPA 4IQEA 1J0JA 3R10A 3HF3A 3M0YA 3FHQA 1S2UA 3C6CA 4G5DA 4Q4MA 5CG0A 1BVZA 3SSJA 4MYAA 4DAFA 3UU0A 2VNCA 4HA1A 4N0RA 5J8LA 3OBAA 3CZKA 4GQRA 3AFBA 3VM7A 1LLWA 3OGRA 3MO4A 5FIPA 3ZWSA 1XSKA 1P4CA 1H51A 2YB1A 2JQXA 2VO5A 1JUEA 3AIRA 3LZ5A 2G5WA 4UTJA 2HE5A 3THCA 3BCDA 2PTWA 3VGDA 4WJEA 5DRCA 5JQ9A 7PTDA 1HJXA 2YLLA 3WIJA 2CW6A 4PYSA 2POTA 2IPWA 1FKKA 1DTNA 3LN3A 4GX9A 3FJ4A 5A8PA 2VKZG 3WDPP 3PJUA 2QJMA 3FJNA 1HF6A 4WGHA 4QQUA 4EF8A 2PDCA 1OC7A 2WKJA 4D6GA 2CXEA 2PCQA 5A6BA 3PZIA 2WVUA 2DSKA 1KRBC 2Y5JA 4OWGA 1DL3A 1RJPA 3SURA 1OYBA 4ZZ9A 3VE7A 3W7IA 5A6KA 2ZR5A 4DEFA 2PV2A 3CAVA 3P62A 3V36A 1XG3A 3IUIA 1MZRA 4KFPA 1KFCA 1QFEA 2HBXA 4QROA 3W7OA 1KB3A 3U8GA 4MKVA 4RZ4A 1QWGA 4FI4A 2JZVA 2I57A 3F4DA 1IT0A 5JBDA 4LEQA 4F2UA 1E0VA 3GE7A 4C02B 5LYRA 4OQVA 3CL7A 4M7TA 2ZA2A 2IKGA 1JEZA 1CGYA 5F2LA 1NFBA 2PDQA 3B8TA 4GC3A 2NX3A 2YIHA 3F2CA 2A7PA 4BF7A 4GABA 3IGUA 2WHMA 2EULA 3UYCA 1T5AA 3QPEA 2YW4A 5DX7A 2DH2A 3ECQA 2DSWA 3TH6A 4Y6GA 1WDSA 3BUVA 2Z25A 4CD5A 3NQ2A 4ZPVR 4LT9A 3N2BA 5G1YA 1HN1A 4GH1A 2B81A 4MB4A 4CLMA 3HPAA 4O14A 3OA3A 4MNJA 3WJWA 1FWJC 2OEMA 2ZXBA 2PTYA 5E0FA 4AG0A 3LS9A 4JTAA 3R0DA 4L80A 1YXCA 4QM1A 2QCCA 2VFEA 3GZ3A 1JIBA 4GI8A 4M6VA 1RD5A 2BHZA 4HD5A 3KOWA 4LAXA 5C0QA 1UR0A 4S3AA 4JS3A 1VQTA 5DIVA 1VFUA 1TPUA 1F6KA 1M1BA 1ZALA 2OYMA 2UY5A 3MUAA 3N6HA 5D4YA 1BD0A 1EX1A 1ROTA 3SUWA 4NAFB 1JZ7A 3GIPA 4GZEA 1E73M 2PDFA 4EWJA 2E25A 4WQ6A 1Q13A 3STFA 1JDCA 1HKMA 1ISVA 4HPJA 3WN6A 2A2IA 2HE8A 4H8NA 3T0DA 3PUOA 2VX4A 4C6QA 3D0CA 4LS2A 2FVLA 3G24A 3FA5A 4EX4A 1TJ0A 3RITA 3UYIA 2GSEA 2PDBA 1SVDA 3W84A 4INFA 2WSKA 2PA6A 1ICSA 2V3DA 1CPUA 2VFFA 4GWEA 1L9WA 4PN2A 2E77A 1H2JA 3MDYB 3CHVA 2WSRA 2BOFX 3CYJA 1HGWA 2YPIA 3NIYA 4KF1A 5E0KA 5FJRA 4Q8TA 1JL8A 4GYPC 4JKLA 3VDCA 4CCCA 1O95A 5AN7A 9XIAA 1H7RA 5IHRA 1XSJA 1PUDA 2QV5A 4OUIA 1KGXA 3ZR4A 2BLEA 3JS3A 4LBSA 1Q6CA 4OBTA 4YVVA 1K70A 3F4WA 2ZUNA 2AAAA 4QIUA 1YQ2A 1L8NA 5EGRA 3GUWA 2QMKA 4R3UA 3FNDA 4FLQA 1R9XA 4Z42C 3GNPA 3LX9A 1JNTA 1ZBKA 1YPXA 3H2AA 3PAOA 3L4ZA 3H7RA 1IWPA 5A6LA 4CD4A 1G5AA 1FWIC 4LH8A 3M0XA 2VGBA 2FPTA 4H01A 3VFLA 2JBMA 4B91A 4AD4A 3BTNA 3O5MA 1E51A 2DSUA 3TC7A 1EJTC 4NT0A 5C9UA 2WM0A 3LCGA 4WY0F 1J0HA 3CUJA 3O6AA 4FX8A 3VZYA 1F8IA 4P8WA 5H8UA 4IISA 3H53A 2OODA 4JY8A 1P1MA 1JYXA 2P3EA 3VZZA 3HPZA 5EA9A 4YWSA 2GOKA 5LIYX 5DXXA 1XLHA 3CV1A 5JBFA 1W5OA 2XM1A 4KWWA 2E8YA 3KX6A 5I3KA 2PUZA 1JCXA 5GJMA 2YCEA 3WJZA 4QDMA 1WXYA 1RY0A 1R46A 2C91A 5A8MA 2ALRA 3AIBA 3VC6A 3N9SA 1SZGA 2YCJA 4QRNA 1IXQA 2UBPC 3QQ1A 2ZUTA 3JXVA 4GXMA 4MIMA 2AL2B 1PSCA 1OFBA 2NX1A 4KFNA 4J40A 3VNIA 1XG4A 4TW6A 1PZ2A 1FHLA 3G1YA 1ICPA 2QVNA 2PDIA 4QXIA 3FJLA 3EOLA 4QNWA 4QT3A 3VKDA 3EX4A 5AHEA 1UR4A 2C14A 4NNBA 1XI3A 3RYSA 4Q8WA 4XD6A 5DBTA 5T91A 2E40A 4MVAA 3SUUA 1AH0A 3VAVA 1TR1A 3PRDA 4D6FA 3ELFA 3M0MA 5A8NA 4L6OA 2HV5A 1JCLA 1CTNA 3ARZA 4LCSA 3ZJ6A 1Z48A 3CV2A 3VE9A 3NPVA 4PUWA 2X05A 4ADSA 3NURA 3AYTA 4D2JA 3N15A 1FKJA 1H3GA 3I68A 3IVTA 1BWLA 4LV4A 1POJA 3P14A 2W66A 1ZHAA 1RZMA 1VP5A 4E2BA 1MW1A 3UR2A 1ZSXA 4MPKA 4JFWA 3VMPA 1OFPA 4ODLA 5KTLA 1NTHA 1KXHA 4IJBA 3S2CA 1H7NA 4S3BA 4QLKA 4ZPTR 3ZO9A 2OT0A 2ISDA 1A50A 3WF2A 1IXOA 5KEZA 3GTIA 1XLAA 1LLOA 1E56A 1JNSA 3GH5A 5F2GA 3TSBA 4PL1A 1NSGA 1LRTA 3AAMA 4P8VA 3Q67A 2JF7A 4K36A 2GK1B 5LNVA 3TN4A 4DN1A 4CEXC 4ROQA 3MMTA 1SZNA 2FPYA 3NOYA 1VR6A 2DG3A 1W6TA 2RDXA 3KM8A 2GGIA 1M7XA 3VD4A 4HCLA 1W3KA 5EMYA 2YBVA 1O7AA 2NWSA 1JR1A 3S6TA 3E74A 3EDJA 4JFJA 4IZGA 1JPMA 4JQAA 3HFTA 1FKBA 4NI8A 4ZSTA 3WCZA 1U5HA 3LY0A 2J7CA 4L7ZA 3M0JA 3OLIA 4IL2A 4AZ7A 4JTRA 2VT0A 4LAYA 2J7EA 3UWZA 2YDSA 1WDRA 2WMIB 2VGGA 3N18A 5G4HC 4MSPA 1I6NA 1JQXA 4E3TA 3HV8A 4PRWA 4LYPA 3V4BA 4KRTA 4GNKB 4C5ZA 4N02A 5I23A 5LGXA 4TW7A 4I8DA 1QPLA 2EQDA 2PCEA 1W17A 5CZ0A 1UD2A 1Y7VA 4F0LA 1OCQA 3IIXA 1W1B1 2QZRA 2HNEA 3KBVA 4S39A 1GEHA 5IM51 2F2DA 3KEHA 1GG0A 4LYRA 3RM9A 3H2CA 3B9AA 1ISZA 3LZ3A 4EE9A 3MSRA 1R2RA 1LWHA 5FAGA 5JMUA 2PAJA 4IP7A 2MNTA 3WLRA 3TJ4A 4DUVA 4WEVX 1K77A 5H1WA 3NSMA 5D2VA 2VX7A 3AXXA 3ARXA 2DY3A 1VEOA 3LHYA 3GY1A 1EP1A 1QHPA 4GZIA 3TR9A 2V5KA 4OUEA 1H7XA 2CBIA 3UNDA 5K4ZA 1FHUA 1MW2A 5GNYA 3FSTA 1R3QA 3E9AA 2DW7A 1DWIM 2B4GA 3QLLA 2O9RA 3WX7A 4J28A 5C9RA 5GJPA 1XLBA 3ZZ1A 3NZPA 3TSMA 2HCVA 2PLKA 4MZ8A 2C6QA 1J4IA 2PDWA 4LUTB 2I5GA 1FHDA 3PZVA 1CLVA 3C61A 2PF0A 2HS8A 1G69A 3QOMA 5A2CA 4ERGA 4UCGA 4F40A 2VR5A 3CZJA 1HXVA 2YXXA 2E1DA 3NFUA 3GD6A 3NDZA 4EXQA 1RP9A 4ENLA 3VNJA 1JAEA 2BXZA 2GVYA 4DZ5A 2Z1SA 5I02A 4DO5A 2ASHA 3PY2A 3A9IA 3RX4A 1ZB5A 1GWJA 2OSXA 3ATZA 2OWWA 1AG1O 3ES8A 3UPBA 4KFOA 1K9EA 2CESA 3P2VA 1KM1A 1TMHA 3TOYA 4JCMA 1ICQA 5CZJA 3KL3A 3CS2A 1FA2A 3U57A 4AD0A 1MO0A 1JZ3A 1NJJA 4F2TA 4KIEA 1SSGA 1M9HA 4E6MA 2OZ3A 4FF5A 2WMFA 3CZEA 4DXVA 2VFIA 4M80A 2XWDA 5ABEA 4AYGA 3S2LA 1VD6A 1EWEA 4YN5A 2D2JA 2PP0A 3AROA 5AHNA 2YX0A 4EPEC 1FCVA 3W2LA 1PCKA 3ES7A 3LPGA 4V2XA 4C6EA 1JULA 1ZBWA 4D6JA 3NR0A 3S47A 1Z8AA 4FXSA 1FWFC 5DT7A 1M03A 4IICA 4AQLA 4MGGA 1Q7ZA 4DRJA 4AZGA 1N82A 4CNSA 2QUVA 1T6MA 3AZSA 3W26A 1WAUA 2VENA 4PC8A 5KZMA 1Q4WA 2PB1A 1K02A 1EC7A 1R9ZA 2F38A 3VIPA 2A3BA 1VIZA 2WJFA 1L0PA 4YTRA 2WKLA 4W8BA 1VJIA 5KITA 4ODKA 4XD3A 2FYMA 1X38A 1YLVA 3LDVA 5DY3A 2YR1A 4GIYA 4L64A 4QEEA 1JAKA 3PFRA 5LIKX 3A5FA 1A80A 1MNZA 5JVLA 3TKFA 3A5VA 5EL1A 1VCFA 5CC6A 5DF0A 1P0NA 1UIPA 3OPSA 2ZX9A 4AIBA 1T11A 1CGWA 3GK0A 1GNXA 4HZ7A 1EF2A 1SJAA 4P8UA 1IT7A 4ODOA 4JL2A 4D6DA 2ESCA 3F5JA 1JPKA 4GY0A 3VOFA 1ZNNA 2J4GA 4US5D 2WWDA 2V5DA 3WNKA 1OX4A 4PTXA 4MPQA 1W1VA 3UR7A 4FPSA 1YEYA 2L2SA 5I00A 1ODUA 1A3HA 2JGYA 1KD0A 3LV5A 3TE9A 1YXYA 1WPCA 2O9PA 1UWTA 5AKQA 2OKTA 3V3WA 4LOCA 3GXIA 3RIKA 1K3UA 3ZMRA 1C91A 1TREA 1KM3A 3TAOA 1DEDA 1B3VA 1E9ZB 2Z26A 2VMFA 1CXKA 4HNUA 1RH9A 2C16A 2PF8A 4DO4A 1C8QA 1C8VA 1TPFA 3HQOA 3FFSA 4MOZA 1V77A 2IS7A 3GFZA 1QRQA 2ZA3A 5BXJA 3IGXA 3UWYA 3TQPA 4Q4QA 5AOUA 3V5OA 1R9YA 4XQ6A 3ZVIA 2X0YA 4ATWA 3HOJA 3HGJA 2BASA 2CLEA 4A3RA 5CPTA 4NXSA 3WK1A 3WSUA 1MVYA 1B3WA 1ZJHA 3WFAA 3MPGA 3G8RA 3SCTA 2XP6A 4XTDA 5F1VA 2DZAA 2XFFA 1UJPA 3L5LA 2FZ9A 1ME8A 2J7DA 1D9EA 1F07A 4N9EA 4US6A 1FD9A 4FB7A 3SIMA 1KM5A 3KXQA 3E02A 4JIEA 4HPHA 3KVJA 4RE3A 2XN2A 1SMAA 4NJGA 2NW0A 1VENA 4J35A 3K1GA 3QBUA 1MYRA 1YIXA 4JFIA 3DFQA 2RAGA 3NQ8A 1HP5A 3V18A 3GWQA 3GG1A 4FIQA 3BICA 5T8GA 1H1YA 1XFCA 3GM8A 3VNDA 2PTZA 4XK2A 3ZT7A 3FGCB 1R38A 4CNUA 1VIWA 4AVNA 3B7XA 1CX9A 3FDKA 3EA1A 3GNDA 3IAPA 5LZLA 3NL3A 3EIPA 3ZFHA 1BYAA 3N1AA 3TZNA 2JE8A 4ZXLA 3MP4A 1U1UA 3KTCA 5GPRA 3CGTA 5EY5A 3S0CA 2QLYA 1TCOC 1C3FA 4Y7EA 3W85A 2PWUA 1M7OA 3DFHA 1GW1A 2OT1A 1K8CA 4JEJA 4E2OA 3PJXA 3T2QA 5MKGA 3MHFA 4GUHA 5CLTA 1V03A 3KOXA 4WK9A 3TA6A 3CV6A 1UROA 1EYEA 5ABHA 2QUTA 1ZCOA 3TEVA 1P0DA 4WVXA 4HU0A 3BQ5A 1XJBA 2BY1A 3HIJA 3ORWA 3FIGA 4IIGA 4Q8MA 4XO6A 3L4VA 3JYMA 1UIOA 5DFAA 3CT2A 4IM4A 1CCWB 4JTHA 2XU2A 1I1XA 2ZZ2A 4DBWA 2UV8G 1PS9A 3QVQA 1KM0A 1WE5A 3WQEA 1QZ2A 1AK5A 3WBYA 4CD6A 4S3JA 2GYIA 1EDGA 5XIAA 1F3EA 4O13A 3UQBA 1GOMA 4H1ZA 4QJ1A 5AC8A 3PBGA 3QC0A 3BJFA 4ZO9A 3UWEA 3E5PA 1EDTA 3K4AA 2E67A 3SCPA 3CTLA 2CITA 4NNRA 4X2RA 3SI9A 4NNAA 3OTRA 2F7FA 1U5JA 3GAYA 3WQ5A 2E6FA 1EJRC 5I3GA 1TZZA 1FKIA 4JYSA 3AYRA 4PTVA 5EMUA 3WK2A 1EBGA 2WSPA 3T4CA 1ZTVA 4UFHA 1ZGDA 3ABSA 3M5YA 3V75A 4W8AA 4A8IA 3FAXA 3AIQA 3TW9A 1PYFA 4EACA 2C1IA 3DX5A 4JN7A 3ARTA 1BF6A 4H4IA 5G4WA 2GGJA 1UD3A 3TJXA 3QV8A 2XN1A 4O0QA 4S23A 5LNWA 4HTYA 1DORA 3LLDA 2OPJA 2VL4A 5HUPA 2VEIA 3Q94A 4ZE5A 3EWUA 5K2ZA 5A3HA 3MUXA 4O19A 4QBXA 1A47A 1Q6OA 2QCDA 4BQ5A 3KRBA 1NQ6A 4HA0A 3TR2A 1SO6A 4QJ3B 5C55A 1KFBA 3NQFA 5ABFA 4R85A 1IT8A 1OFAA 1XIDA 1SW7A 1TPWA 2PLJA 3IVSA 4GKLA 3O05A 1BQCA 4A6GA 3L0KA 5A69A 1QNOA 1QDSA 1TVPA 4X63A 3NVTA 3LUOA 1ECEA 1WKDA 4D72A 4MFEA 4LVBA 3MCNA 1X39A 5HOSA 4Q33A 1GHRA 4MB5A 4JTUA 2D2OA 4U5IA 1XWYA 3PWIA 1X98A 1TFVA 4AHOA 1CWYA 4KIRA 3PS7A 1ZQ5A 3KVMA 4YJ5A 4E0CA 5ENLA 1V51A 2EG7A 4JIRA 2BB0A 2FHFA 1I4NA 4A35A 4DNMA 1GONA 3S83A 3D5HA 3KWXA 2NSOA 4DUWA 4OHQA 4HMNA 1YDYA 3LLXA 1TVLA 3O07A 3CIVA 2WB5A 3Q37A 3WNOA 4DJDA 3ZT6A 2WOQA 2BBFA 3RO6A 3TN6A 4JL1A 3BQ6A 1ME7A 1GPFA 1W54A 2VDIA 4TVCA 5DMMA 5A8QA 1GW9A 2PPGA 1S5TA 4XX6A 4GGBA 3VDHA 1A3XA 4DBEA 4MDPA 1OZMA 4FXFA 1AJZA 3GUGA 3H55A 2PC8A 3M4HA 3S3GA 3UG5A 2VEMA 1XP3A 3AS0A 2RUQA 3Q65A 3ITLA 4XSLA 3WJSA 2Q8LA 1X8CA 3IS4A 3NL6A 3UWUA 2XPKA 2WZMA 1BTCA 4U5KA 1BWKA 2XZ9A 4JHZA 1T41A 1GK8A 1PIIA 4PULA 1JZ2A 2NXIA 2ZUVA 3WLTA 1WKYA 2JKEA 3O0KA 4IGNA 2IW0A 2ZWYA 1V3KA 2DUXA 2DZPA 2ZX8A 2BTMA 3BXWA 3FAPA 2BSLA 3G5EA 1JQVA 2I1OA 3SO7A 6ALDA 4JIIX 3W6MA 1EGZA 5TQLA 3U2EA 5FF0A 2PRMA 2A85A 1W1YA 3CJPA 1ZU8A 3K4WA 4PMVA 4AW7A 1SO5A 2CZFA 4O17A 1J5TA 2YW3A 3O16A 7CGTA 2BOGX 4IT6A 4KR0B 1NP0A 2BY3A 5A6TC 4DB7A 4UFLA 3W86A 1R47A 5H8MA 3UPWA 3UQAA 2FGBA 4DM1A 4DWSA 2QCLA 3OLGA 4MWAD 1I2NA 3RHGA 4GINA 4IF2A 2J13A 3AICA 1EPXA 3TIMA 1Y65A 3AHTA 3DHPA 3IIPA 4K6AA 5FEZA 1HNYA 3GDLA 4JDYA 2VRQA 1EGMA 4HYWA 1I9CB 2E5CA 2P53A 3ZLGA 4GO9A 3STEA 4IQCA 1JZ4A 3EWXA 1LOLA 4BKNA 2ZUMA 2TAAA 3H70A 1YDVA 2W5FA 2ZX6A 4GI6A 4XZWA 5GNZA 3P5ZA 4IG2A 1NDVA 3VOJA 3C0SA 3QPYA 4FXRA 4WY0A 3CMGA 3PF3A 1V0KA 1VFTA 3BAYA 1MWOA 1PPIA 1D7JA 1X6UA 1TJRA 3E0LA 5C9WA 2Z00A 1GQIA 5E09A 5HJXA 1EUAA 1MQPA 3O6CA 4NZCA 4MG4A 2QXWA 3RCNA 4HU4A 3RO8A 2FLIA 4B5NA 4PL2A 3BLDA 1OFOA 3H2OA 4M24A 1JCHB 2WANA 3N9KA 4WGXA 2W61A 2EPMX 1QCWA 3KZPA 4U85A 2QULA 3QV7A 4DT4A 4DLMA 3GBDA 1SM9A 4IWWA 1TPEA 1HVXA 1EOMA 1EO7A 2FGLA 4BQ2A 3EB2A 2FDSA 2LPVA 3WQWA 1FH8A 1KBIA 2FVKA 2QJIA 4W9TA 2UY2A 2VC9A 1VLIA 4LUSA 3N17A 2D20A 4IQDA 1TIMA 2E6YA 4B3ZA 3DU0A 2GZXA 4NHVA 1ITQA 4O10A 1W3JA 2HWGA 3OVRA 3BG5A 1WB0A 2ZTKA 2WV8A 3QTGA 4GJIA 2V5LA 4MJ4A 2X42A 3DI1A 2VZOA 3M0IA 4RNFA 4YTUA 1HT6A 1E0TA 7ENLA 3XINA 1CIUA 2ZOXA 3WEOA 3M0HA 2PWFA 5D33A 2F9RA 3T78A 1W31A 5DANA 1G7UA 1ESWA 1VBUA 3IIZA 2ZQ0A 3NDYA 4H9ZA 5CXPA 4O12A 2B31A 1RQEA 5AY7A 1GTHA 1Q6DA 1HL2A 5K4XA 1GZJA 4MMWA 4DJDC 4LYQA 4HCDA 4JY9A 3SCRA 4S3DA 4PMNA 4WKHA 3CV7A 3GHRA 3N11A 4HPGA 2IMRA 3UCCA 3W1XA 3OU8A 2RGLA 3KHDA 5EFFA 1LZOA 5HQLA 3MWAA 3CZLA 5HUOA 1DE6A 2G8ZA 4KGLA 3QLDA 1TPB1 3W3OA 4TX9A 3IVUA 1XINA 3TLQA 4C6PA 2YZ5A 4H6QA 3PBWA 1J6PA 1LTDA 3PFMA 3BVJA 3I3DA 3ABQA 1HKVA 1KR0A 3KCEA 3HPSA 3DCPA 4XTIA 3MA8A 5ECVA 2WJZA 4NZ1A 1QR7A 2X7WA 5DQPA 1GJPA 1DJWA 2HS6A 2OSYA 1W1PA 1XLFA 3DDMA 4LWWA 3I7QA 3HM7A 1F6PA 3B8DA 2PBCA 5D02A 2WYSA 4ZOAA 2G3FA 1DJQA 5JH2A 1CGXA 4QIBA 2ZTJA 5CKSA 3EDFA 1SFLA 1W1IE 5J04A 3LRMA 3SQSA 2RDWA 1FTXA 4PA8A 3I7SA 4GY7A 3C0QA 4GUJA 3DHUA 3OB8A 4REQA 3N4EA 3JRKA 1S3TC 4IH3A 3WNMA 3ZVHA 4NJKA 4DWSC 3S1GA 3ARRA 4YTTA 5FJIA 4HU3A 4I7WA 3QHOA 2V68A 1W1TA 3BV7A 3STGA 4PZVA 2V63A 3KVLA 1JJKA 3R12A 3TMLA 4W5UA 4DUXA 2V3EA 3WLPA 1H60A 4Y96A 2O7QA 5F4SA 4RLIA 3ZOAA 1KTBA 1XIHA 5M1TA 3MO7A 1W9UA 4F79A 2F2HA 3BMXA 3MUY1 3SR7A 2E5BA 3NL5A 1NOFA 3H9RB 3ITYA 4AZHA 4XIMA 4JICA 4RX0A 5HMSA 2ZIDA 3T42A 7REQA 1TE1A 1TWWA 3O5QA 4LQ1A 4OGZA 1J0KA 2QGHA 4R7OA 1H7WA 4JYEA 2NVCA 4UTTA 3SCQA 4I6VA 4LB3A 1NIUA 2H8ZA 3HB9A 3U7VA 3M0KA 5LA1A 1OGSA 4ECLA 3WMLA 4QT2A 3ANYA 4LAOA 3VGBA 4PBEA 1XC6A 3AWNA 1SW0A 2GJNA 4J7RA 1A5UA 3VMOA 2OG9A 3VNKA 3G6LA 1W32A 3TTQA 4ITZA 2BGQA 1Z42A 3F1QA 1LQ0A 3VCRA 5HPOA 3M6YA 3PBUA 4LAVA 1R3WA 3M5ZA 5CPLA 1O12A 5HANA 1RHCA 3QGKC 5KSWA 2BGSA 3H2NA 4L72B 5BU6A 3KLKA 3PB0A 3SDOA 1R2SA 5C9XA 3KFTA 3LCWA 1RPXA 3WUBA 4CQ8A 2DVTA 1EWDA 4HNLA 1M5YA 1IEXA 3H24A 5AVNA 5FEWA 3GNXA 4UDMA 3VX1A 5DXYA 3LV6A 1F3XA 4FOKA 4RW5A 1CECA 1TRIA 2OYKA 4O2TA 5A8OA 4QG6A 3T0CA 3MZNA 1H62A 2V2HA 3AIEA 1JYNA 3WH8A 5GVJA 1QOXA 5AZ1A 2XVLA 3HPFA 5I3JA 1F3TA 1M6JA 2YJQA 1XLGA 4OVXA 4XB3A 1R3VA 1TMLA 3N34A 2EPOA 3LERA 1F61A 1W0MA 1V8EA