2ESCA

Crystal structure of a 40 kda protective signalling protein from bovine (spc-40) at 2.1 a resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNFGSERFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGGWRGTVGHHSPLFRGNSDGSSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSSTRVGAPISGPGIPGQFTKEKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Structure of a bovine secretory signalling glycoprotein (SPC-40) at 2.1 Angstrom resolution.
pubmed doi rcsb
molecule tags Signaling protein
total genus 116
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2escA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2escA01
4DUVA 1PX3A 4E4PA 1GW1A 2X09A 3ZJKA 4AZCB 1LWJA 1J0JA 1EHNA 1TA3B 4TTGA 3GH4A 1E0WA 1I75A 1HXJA 5EFFA 3UETA 1D7FA 2OLHA 4CUCA 5JBEA 1EOKA 2E4TA 2VVSA 4WSJA 1PPIA 3M6DA 3GDBA 3SIMA 1W2VA 1LG1A 4AZ6A 3BC9A 4PYSA 4TTUA 1XYZA 2D0GA 1QNOA 2J8FA 1L8NA 3WH8A 4AIUA 3VDCA 2X1IA 4F79A 1CGUA 4PMZA 1GUVA 2XTKA 3VNYA 1ITXA 1ZJAA 5CSYA 3DYMA 5HOSA 2ZE0A 2DSZA 3WL0A 2J25A 5JH8A 1EH9A 5A8QA 3D5HA 1JGIA 2VOTA 2ZXDA 3E1F1 2XSAA 1MVYA 1WZAA 1GJUA 3CZKA 5IFTA 1H4PA 1J18A 1E3XA 2XVLA 4GPNA 2CYGA 1QI3A 3CUHA 1JZ2A 5FL0A 2XIBA 5DMYA 2FGZA 2YIHA 3AIUA 4GI8A 4HA1A 5D9MA 2VR5A 3FAXA 3SUWA 2CBVA 1CXEA 2XWEA 8A3HA 4YHEA 1BG9A 4NSBA 1UD8A 2E9BA 3BAKA 3K8LA 3FHQA 3T2PA 1H1NA 1CWYA 4AYSA 1J10A 3ZT6A 3SCOA 3AIEA 5IHSA 1VEMA 1R85A 2WKLA 1JFXA 4P8WA 4PMUA 4GO9A 7CGTA 2VCCA 4WF7A 2D3LA 1VRXA 3MANA 4V2XA 3UCQA 3WFLA 1QBAA 1B31A 1CEOA 1V3LA 2WCGA 3RDKA 1KXQA 3EDJA 1UQZA 1UR2A 2PBGA 4IPNB 1D3CA 4LXFA 1OD8A 1DWGM 1JZ4A 4LYPA 5A2CA 1K9EA 2CESA 3AOFA 5BXRA 2X2YA 3SUTA 1LJYA 1WB0A 1BVNP 3VMPA 4JFTA 1XV8A 1UWSA 1H09A 1N82A 4H41A 3A4XA 3TONA 3WNPA 3T0DA 1OIFA 2XHYA 3WKZA 3BMWA 2G3JA 4FLQA 4XV0A 5FOOA 4BZYA 5HNNA 1V02E 2DPEA 1X6LA 4P7OA 1W3KA 4FLRA 7TAAA 2ZX7A 1BYAA 1EA9C 3WF0A 2UWFA 1MFUA 2IUZA 2WHMA 3VGHA 1WCGA 4J3VA 3LPOA 1Q6EA 1BHGA 3OB8A 4QLLA 4U3AA 1GQLA 1NOWA 1TUXA 1HKJA 1C3FA 1VFFA 4TVDA 3CIVA 5BXTA 3WDRA 2CBJA 2CBUA 1W32A 1VB9A 5A8PA 3FHAA 3KZSA 1XRVA 1UD2A 3QR3A 1BSIA 4NI3A 3CO4A 3PZGA 4HOXA 4WLCA 2Y5EA 4MDPA 3VMOA 3L4TA 2XPKA 2ZWZA 1BLIA 1WZKA 5CXPA 4BQ2A 3AISA 1BVZA 3CZJA 4GZIA 1RPKA 2VRJA 4HP5A 3T2OA 2VC9A 3A4WA 4HZ8A 1LL6A 4DWSD 1PEZA 4UOQA 1JG9A 1JYWA 4Z2GA 3WDPP 1ESWA 1V6VA 4M1RA 4RE3A 1OIMA 4ACZB 5TD4A 1ISYA 1FH9A 1M04A 1AMYA 1HJXA 1QI5A 2FHBA 2YL8A 1XCXA 4UQBA 1YHTA 2ZUNA 3LPFA 1B90A 4QFUA 1NM9A 4XX6A 1KWKA 2DIEA 4Z2LA 1XH1A 1QI4A 1V08A 1R8LA 2WSKA 1LL7A 1NWSA 4UQCA 5IFPA 5JUVA 3BAXA 2W63A 1UH2A 2GUYA 1JDAA 3PZNA 3N04A 6TAAA 3B9AA 5DFAA 2WB5A 1EIBA 1C7SA 1KXVA 1FHLA 2WCSA 1HVQA 2W91A 3RO8A 4CKQA 2O9RA 3WMSA 1OWQA 2XFYA 2YDRA 2XG9A 1G94A 4QLJA 3QOKA 3WQ6A 4P8XA 1UKOA 4W7UA 4JFSA 3RILA 1UHVA 2VL4A 2QPUA 4JHZA 2ZX6A 4EAMA 3AHTA 2VZUA 5HDRA 1G1YA 1C90A 4JFWA 5A6LA 2XSBA 1WPCA 1ISXA 1UKTA 1J0ZA 4FF5A 3VM5A 1CXLA 4JAWA 3VOCA 1F4AA 3I3DA 4LYQA 1R7OA 3CZGA 3OLEA 4RE2A 4UOJA 4JL2A 1US3A 3IANA 1KR1A 1AQHA 3BMVA 3EBVA 3VNZA 1E43A 1M53A 4GO8A 3A3HA 2X0YA 3VD5A 5A6AA 1ZBCA 1OGSA 1WDSA 2WMIB 7A3HA 1KBKA 5ABEA 2OYLA 2D20A 3AROA 1E4IA 2Y2WA 3NSNA 1VF8A 4PSPA 4PSRA 3BAWA 1LF1A 2C7FA 1OD0A 4UNIA 4AZHA 1FFRA 3WFZA 3WN6A 1IZKA 4RL3A 4TVCA 3L4VA 3N13A 1VFMA 3PHAA 3UERA 4AZGA 1ISWA 3T08A 5C70A 1G9HA 2WZHA 5DT5A 2VZOA 3N11A 1HNYA 4MPKA 4CD8A 2VQTA 1W1YA 3CHCA 1ECEA 5JIWA 5IHRA 4W5ZA 1K9TA 6CGTA 1EDGA 1UD6A 4DWSC 4W84A 1GZJA 2VX5A 3PZTA 2CNCA 4EANA 1QVBA 4J28A 5I0DA 3VIIA 1UKPA 2XM1A 4UFLA 1OM0A 1W3LA 4DUWA 4W8AA 3ZR5A 1GORA 1WO2A 2VCBA 1J01A 3N17A 4MB1A 1NOUA 1SFSA 2WC4A 4B3LA 2EPKX 3WBAA 2W5FA 3GBDA 1UWIA 2J75A 4J3SA 1B3ZA 1UH3A 4QAWA 3VIJA 4GQQA 5CJ5A 3POCA 2QV4A 2WNWA 4ZFMA 5BXSA 3SUUA 2QLYA 4HA4A 3D3AA 4M29A 2CEQA 2BY0A 1BGAA 1E55A 3WBEA 2VCAA 4R5EA 1HJQA 3KL3A 2VZVA 1V0NA 1NP0A 1LL4A 4D6EA 5A6SA 3GNPA 3IAPA 2QPSA 1KXHA 1ZU8A 3VMNA 2WSPA 3DYPA 2D24A 2OWXA 4U5KA 1CNVA 1L0PA 1JXKA 4PN2A 1JZ5A 1GHSA 1MQQA 1VENA 1A3HA 1V03A 1HX0A 2GSJA 1XH2A 2J7FA 1C91A 3GXFA 3VDAA 2PWDA 1JF6A 4JKMA 5LA1A 2WVTA 5A6JA 2BY3A 4GI9A 4J3UA 3BLPX 4UR9A 3RCNA 5BCAA 1HKMA 4P7LA 1E4MM 4WK9A 1E6PA 3THDA 2J74A 2OYMA 4LQ1A 3CH9A 1E5JA 1BGGA 1E6XM 4JCMA 3K4AA 3ARTA 4AEFA 1OBAA 4RE4A 4F9JA 2PC8A 2PWFA 3VM7A 4D6GA 2VVNA 3ZT7A 4NRSA 3N15A 1K9FA 1E1EA 2YLLA 2DT2A 1XD0A 1M7XA 4R27A 3VGBA 2HISA 4IUGA 3VX0A 1U2YA 3MUAA 3CUGA 4C7DA 1KGWA 2XJ7A 1TE1A 2EXOA 2YJQA 5KEZA 2ZUMA 1NWRA 3WD0A 3CHDA 2ZXAA 4W88A 3BSGA 3U57A 4UQDA 2V5DA 5JIPA 1MWOA 5ABGA 2HVMA 2VTFA 2A3EA 5D4YA 1PIGA 1BPLB 4HMCA 5GPRA 4PUEA 3BGAA 1UD5A 3W24A 4AD3A 2AAAA 1MYRA 3UG3A 2Z1SA 4ATLA 1BYDA 3AYRA 1S46A 1J0HA 1Z32X 1QHPA 1QW8A 1W9UA 5I78A 4F9DA 3KL0A 3VVGA 2ZX5A 1W9DM 3EDEA 5A6BA 4FK9A 4TOQA 4JIEA 9CGTA 1QNQA 1C8QA 1QNRA 5ECUA 3L4UA 4ZEPA 3DECA 2E40A 4QLKA 2XM2A 1A47A 1VFUA 4F8XA 3BAYA 3VD9A 4Z2IA 5A69A 3FXYA 4CD6A 2XFRA 3NSXA 2DSWA 3SCPA 5A3HA 3CUJA 2J4GA 4GZJA 4WKHA 3CUFA 5E09A 2WC7A 3FNDA 5F7UA 1EHAA 2J77A 1W1VA 4H2CA 1CXKA 3ALGA 4UCFA 1KQYA 1DWAM 3CZ8A 1B3XA 3VDHA 5CSUA 3U7VA 3B9DA 4NF7A 4E8DA 2EPLX 1PZ2A 3L4XA 4W8BA 4MNKA 2W92A 3A4AA 1BFNA 2O92A 4L4OA 2A3BA 3AZTA 4BCEA 1ZS2A 4MADA 3ZJ6A 4LYRA 4QCFA 2GDVA 5ABHA 3PTQA 3WF4A 5ABFB 3WY1A 1OT2A 4CN4A 4D1IA 1MXGA 2YA0A 4MNLA 2WMKA 2D22A 1OCQA 1UZ1A 4BS0A 2J7GA 3NDZA 3CTTA 4HMEA 1FHDA 3VDBA 4J3WA 3UESA 3ZT5A 2EJ1A 1WDQA 5D9NA 1HJWA 3ZIZA 5CQ1A 2C0HA 4AD4A 1ZBWA 3L4YA 3WH5A 3WDQA 3AMCA 2CETA 4CN1A 3SCUA 1E6NA 3AIQA 3MV01 4PTXA 3ARQA 4M24A 1GPFA 1MFVA 1EGZA 3ZSSA 4PMDA 4AD0A 1QHOA 4M81A 2E9MA 2CERA 1B3YA 4IISA 5E0FA 4MJ4A 2CBIA 3SEPA 2ZUUA 5EB8A 5DF0A 3DHUA 2D0FA 1CBGA 4BQ3A 3RM9A 2J47A 3MO4A 2D23A 4Y7EA 4L4PA 1IV8A 1EDTA 1QW9A 4HOZA 4ZXLA 3I3BA 4HU8A 1JZ8A 1OINA 3ZO9A 5AC4A 2F8QA 4B15A 2C8NA 2NT0A 2QF8A 1XSIA 2Y4SA 3VILA 4UFJA 1B3VA 4PUDA 5AY7A 1UKSA 1VFOA 5D9PA 1PZ3A 1Q6CA 1UR4A 3O9NA 2F61A 3SUSA 4OBSA 3AHYA 1J0YA 2CXGA 3TOPA 1JAEA 5AYBA 4FLOA 4OIFA 3ARVA 3OLGA 1E0XA 4AY1A 1MW2A 1KBBA 2YBTA 3WNOA 3AIBA 4W5UA 3ZMRA 3TA9A 3PTKA 2VI0A 3WMBA 3BLKA 2UY5A 1ZJBA 1ODZA 2AMGA 3OBAA 4GKLA 3AFBA 4TUFA 1E4LA 3AHZA 2WVVB 3NIYA 2XGBA 3TTOA 1YQ2A 2DT3A 1KWGA 1PX8A 3GBEA 4KGJA 1UWQA 5IXEA 3KL5A 1JYNA 2YL9A 4Q7NA 3VGDA 3VD3A 1Y7VA 3OGSA 5DO8A 3G6MA 2PB1A 4MB3A 2E3ZA 4TX6A 1NP2A 4NRRA 3VIKA 2YKKA 1X1NA 4MTVA 1HN1A 5DT7A 1EQPA 3U5YA 3OGVA 4PTMA 1J11A 3N12A 3W4RA 1LG2A 1PX4A 5CG0A 3WEOA 1EDQA 1UUQA 2WVUA 1H5VA 4AISA 4CVUA 2CPUA 4PMXA 3T09A 1M03A 2NSXA 3MMDA 2FH6A 3AJ7A 3OZOA 1GQIA 4H7VA 4W93A 3CBWA 4X0NA 2CIPA 4AZIA 1JD9A 1BQCA 1EOMA 2VJXA 2V3GA 4DM1A 4YPJA 4CN6A 4CU6A 2VQUA 4OOUA 4C7GA 6A3HA 3W27A 3IK2A 1SR0A 4M80A 3MS8A 4PMYA 3EDDA 4JFUA 3VD7A 2J7EA 1H3GA 1RP9A 1V6YA 2OSXA 4AZCA 1GHRA 5CZKA 1TA3A 1XYFA 1KB3A 2GK1A 3AMLA 1PAMA 4KH2A 3MSGA 3JUGA 2FHFA 1QOXA 3ARSA 2V3DA 3ARRA 4B16A 1UR1A 4PEEA 2VMFA 3ARWA 1U30A 3AIVA 1BYCA 1GOQA 1QPKA 3K8MA 3GZAA 1XSKA 3N9KA 5AC5A 1JNDA 1BAGA 1DWHM 2YL5A 1QNPA 4AZBA 4U2YA 1GJWA 1UWRA 2WMJA 3QHOA 3AICA 3SCRA 5JBDA 3WNNA 5I23A 3VGEA 2GJXB 3SCVA 4OKDA 4D6HA 1GOIA 5JBFA 5CPSA 3PZIA 3PZOA 3SCQA 3OLDA 4W89A 1UG6A 5BXPA 1JDCA 1JYVA 3PBGA 4U3CA 1CGYA 1NOFA 4P7QA 3ALFA 4A3YA 3T0BA 3RPMA 1CXFA 4H8HA 2EEXA 4W7VA 2PF0A 4N42A 4HMDA 1TR1A 4JKKA 1TZ7A 4AEEA 1HKIA 2IXUA 4GI6A 2CHOA 1FFQA 5CLWA 3A6OA 4OJYA 3PZQA 1WE5A 1LWHA 4W7WA 1V3MA 2BHYA 4FLSA 4IPLA 1BTCA 1TMQA 4UQEA 2O9OA 3I3EA 2D3NA 3ZSTA 2CHNA 4KGLA 2VR4A 1XSJA 3RM8A 3EDFA 1J0KA 4ZE5A 2WBKA 3EMQA 1EXPA 1NQ6A 3VIMA 1US2A 3K8KA 1AVAA 5A8MA 4UFKA 5CGMA 4CGTA 1HL9A 3W37A 4AW7A 3U5UA 4WJXA 4KMQA 5FCZA 3K4DA 1WAWA 1P6WA 3BXWA 4ML4A 2ZICA 3OZPA 4CU8A 1GOMA 1B1YA 3M46A 5CLTA 2JFEX 5A2BA 3GNRA 4FMVA 3HMCA 1E70M 1H49A 3AHXA 4P7NA 1DWJM 3WH9A 4LX4A 1E15A 4PCSA 3FN9A 4D6IA 2VRKA 2J79A 2X05A 3DYOA 3VIOA 3NSMA 1UZ4A 4KWUA 1UR9A 3UR7A 3ZJ8A 4KRUA 3GH5A 1C93A 1MQPA 2X0HA 1W3HA 1E6QM 4PTVA 4E2OA 4H8UA 5FL1A 2DT0A 4GZEA 3GH7A 4W87A 1ZL1A 4MB4A 1GNXA 2XVPA 4EKJA 1H41A 3NDYA 3VKKA 3WNKA 2JEPA 2J78A 1E71M 4EK7A 2ZX9A 2WZIA 2WWCA 5HPOA 5CPQA 2FH8A 1ITCA 2UY4A 4J3TA 5A94A 1XCWA 3AIWA 3VIHA 5A2AA 4AD2A 3F5LA 5EMYA 2WC3A 3OLIA 3WDJA 1XD1A 4UFHA 4ACZA 2ZOXA 3VD4A 1O7AA 4JL1A 2WHKA 5GQBA 2F2HA 1UR8A 4X9YA 4C7FA 3MU7A 1TVNA 2DH2A 4CCCA 1UD3A 3THCA 3SUVA 5BWFA 3AYSA 5E6ZA 3F5JA 2BNJA 3PZUA 4ZXOA 3WUFA 1VJZA 1UWUA 1EO7A 2X8RA 3N18A 2OSYA 3VIFA 3WELA 3AIRA 4AXNA 1ISVA 3IJ8A 2BY1A 2Z1KA 2WMFA 3ZQ9A 2JEQA 5LA2A 4HOWA 3AHVA 3KWXA 1JI1A 3PZMA 4Z2KA 3W6MA 1C7TA 1KCKA 1JL8A 1X6NA 2PBOA 1R87A 2YLAA 3M7SA 1TG7A 4BQ5A 4AIEA 1UA7A 4ZENA 4PBGA 1JD7A 1KFWA 3WQ4A 3ZJ7A 3CZEA 4XB3A 2NT1A 4W85A 3VO0A 1WDRA 2VO5A 5AYIA 1CGTA 3VX1A 1ZBVA 1MW0A 2J62A 3S2CA 1WDPA 1AQMA 1TCMA 3MMUA 3O2LA 2PWEA 1E6RA 1PIFA 4HZ7A 4MAVA 2J7CA 2BHUA 4GINA 3G6LA 4TXEA 3WQWA 3RJYA 1XGZA 4PMRA 4TX8A 3TTQA 2NW0A 4OZOA 2WVSA 2DEPA 1E40A 3POHA 2V38A 3A47A 3W82A 1V3HA 3LPGA 3WQ5A 3VGFA 1KR0A 3T2QA 2E8YA 4JFVA 1OGBA 4V28A 1JZ7A 4DM2A 3U7BA 3ECQA 4MNMA 2UY3A 1WP6A 1KXTA 1I1XA 1E5NA 5KZ6A 1OT1A 3NCOA 2WANA 3RIKA 3GXIA 3IJ9A 4A3HA 4MJ2A 2WAGA 1JI2A 4CVWA 3VTRA 1HT6A 1V3JA 4AMCA 5HPCA 2EQDA 3AMKA 5D8ZA 3WF1A 1AQ0A 2D0HA 1CGVA 1CGXA 4AD1A 2A3HA 5BYWA 2D1ZA 2XVGA 1GCYA 5A95A 4EE9A 3ARZA 4P8UA 2WK2A 2JF7A 1CXHA 5I24A 1DWIM 3W0KA 4WKAA 4JZ5A 1CYGA 2YBUA 1QI0A 1PBGA 1CXIA 2GFTA 3AZRA 2WYSA 4AZ7A 3W26A 2FHCA 2GK1B 3QHNA 3PN8A 4DUXA 1KQZA 1M01A 1V3KA 2MANA 3OGRA 4HPGA 3MUZ1 1G5AA 1HJUA 4B3KA 4LPCA 1FH7A 4WIWA 4AIOA 2WMHA 3ARYA 3PZ9A 3SCNA 1E6ZA 5I2UA 5HBFA 1HL8A 4UFMA 5GNXA 5BRQA 4HTYA 1H0IA 2QMKA 1J12A 2ZUWA 1GOOA 3CPUA 3WNLA 3WH7A 2G3NA 2QHAA 3FAWA 4MDOA 2JF6A 1E6SM 2YA2A 1GQKA 3SURA 1V3IA 2V3EA 4D6DA 1V6XA 1W9BM 3BAJA 1O6IA 4JCLA 4Z2HA 3GXMA 2XYLA 1CIUA 1V02A 1FA2A 3AXIA 1Q6GA 4PMVA 3WEMA 3B9EA 2G3MA 1R86A 2XFFA 1ZB5A 1V0KA 2JIWA 4GIAA 3WEZA 4UQ9A 1DTUA 1OGGA 3AZSA 3W38A 3L2MA 4D6CA 2UY2A 5A6BD 4DWSA 3EDKA 4LGXA 5CGTA 1SYTA 1E9LA 1HF6A 2GVYA 3HU7A 5A6MA 2WHJA 4S3KA 1GOKA 1G01A 2VT0A 3LPPA 3VU2A 2YOCA 3FW6A 4W86A 3RM4A 4D72A 4U31A 1B9ZA 3M07A 3VIGA 2AOSA 2RGLA 2DSKA 4D6JA 2YL6A 1BYBA 4KRTA 3SCTA 3OA5A 4OBRA 2DGAA 1UA3A 1GVIA 4HU0A 5E0CA 4PMNA 4H8VA 3WUGA 2ZXBA 3DHPA 1J0IA 2ZIDA 3SCWA 4S3JA 2ZUSA 3OG2A 3W6LA 3VUPA 5I77A 2WKGA 1BF2A 5EFDA 5I6SA 3CGTA 1IZJA 1E4NA 2BV9A 2XVKA 1SMAA 2J7BA 1CGWA 4PCTA 1XC6A 5A8NA 2WHLA 2XUCA 2DDXA 3WD3A 3W53A 1UQYA 4UOZA 3CUIA 4HPHA 1JF5A 5LA0A 2DQXA 1XH0A 1R7AA 3QHMA 2B31A 1QBBA 2Y24A 1FOBA 4U5IA 4UTFA 4Q22A 3W81A 4W8LA 1DP0A 1V0MA 2BVYA 1V0LA 2G41A 3MSDA 3L2LA 4XZWA 1ODUA 3W25A 1OB0A 1E72M 3NUKA 3WF3A 2D2OA 3RJXA 4URIA 2IXVA 2GJRA 3F5KA 2JIEA 1LQ0A 4AD5A 1OSEA 2ZUVA 1CZ1A 1EO5A 5I3DA 3RMEA 4MAZA 4AWEA 8CGTA 2BHZA 4CCEA 2GJPA 4MB5A 3TTYA 1JXJA 1DHKA 3CLWA 1JZ6A 1Q6DA 4H04A 3WL1A 4WSKA 2YDQA 3CZLA 2W62A 4ACYA 5BRPA 4U33A 4XUYA 2W66A 1MW1A 1JIBA 1HP4A 4YHGA 2WZEA 3UG5A 2GDUA 1VJSA 2CCRA 2TAAA 1JFHA 2YDSA 2E0PA 2BY2A 3EMCA 1FP9A 1C8XA 3PTMA 1FH8A 1NWTA 1UD4A 3F4VA 5ABFA 1VEOA 5IDIA 2FDMA 2O9PA 5BROA 3WIJA 1W2PA 2DIJA 3QGVA 1GQJA 3CHFA 3ZM8A 1F4HA 3VPLA 5A8OA 5A6KA 2W61A 2J7HA 3N1AA 2V3FA 2VRQA 3UR8A 3S6TA 4CD4A 5I5RA 4OOZA 1ISZA 1K6AA 4BQ4A 1V6WA 1NH6A 3WSUA 1UYQA 2G4FA 2OYKA 1W9VA 1UKQA 3GNOA 2ZXQA 1GONA 1KGUA 3IJ7A 4JKLA 1DEDA 1CTNA 2BVTA 3II1A 3WUEA 2OSWA 3MKKA 2WWDA 2EPOA 4V27A 3ARXA 1QNSA 2PWGA 5C71A 4D6FA 4NZCA 2ZX8A 1B30A 2BXYA 1CENA 2WW5A 5GNYA 3AS1A 5EBAA 4TVUA 1JZ3A 2J7DA 4D71A 3IAQA 3QOMA 5D8WA 4P7RA 3MUIA 1H2JA 1W1PA 1GOWA 1MW3A 1TFVA 4UZUA 2XIIA 1Q4NX 1UOKA 3KE0A 1QHZA 4HA3A 1HJVA 3CHEA 3WENA 1KCLA 1LLOA 4UFIA 2A3CA 4J27A 1WZLA 3VINA 2J8GA 2WM0A 1U33A 3BCDA 1CPUA 1B2YA 3J7HA 3MUY1 3WQVA 2DSVA 4K68A 3KEHA 4J7RA 4M8UA 3SCSA 1W1TA 2BVDA 3WMCA 2RGMA 4PMQA 1VEPA 2FGLA 4ATDA 4J3XA 1ZBKA 5HXMA 2DSUA 1UWTA 2WVVA 3K46A 3HN3A 3AS2A 2QMJA 1CLXA 3BSHA 2O9TA 5FD0A 1TVPA 1H0GA 2WXDM 3BAIA 4P8VA 1I1WA 4GQRA 1E3ZA 3TTSA 2A3AA 3TP4A 3ZOAA 4ATWA 2EPNA 4CD5A 3W29A 4OUEA 2G3IA 4M82A 4D1JA 1DWFM 1MXDA 2OWWA 1RP8A 1GVYA 3WD2A 3WQ8A 1BG4A 5DEZA 2BFGA 3AXXA 3GXDA 1CLVA 1Q6FA 2PI6A 3UEQA 1JDDA 1MQRA 5GNZA 5I79A 4CD7A 2DT1A 2ESCA 3DC0A 4X0VA 4QP0A 3PZVA 1G0CA 2WLZA 1W9XA 1WKYA 3WNMA 4BA0A 4E8CA 2EO7A 2VX6A 3HJEA 2Q8XA 1JYXA 1J9YA 3GYCA 1XHGA 3OIHA 2VX4A 3UG4A 3WD4A 5A1AA 2WLYA 1CECA 2E9LA 2DH3A 1FP8A 4Z2JA 1W91A 3AS3A 1VIWA 2WCAA 4F66A 1H11A 2ZWYA 4BF7A 4WKFA 2V5CA 2XVNA 2YA1A 2OWCA 2EBNA 4N0RA 4DWSB 2BXZA 1UR0A 1E73M 1E1FA 3AMGA 3B8SA 5M3WA 3WDIA 2E8ZA 4M56A 2WMGA 1NWUA 2CKRA 1HP5A 2WPGA 3K1DA 4A4AA 3O6AA 1JNEA 2XGIA 4MNJA 1HKKA 1E56A 1UH4A 4PMOA 2JE8A 1NARA 1HIZA 3AS0A 5D9OA 4B9YA 3T0AA 1B0IA 1RD6A 4HZ6A 3AXHA 2JALA 3MMWA 3ZR6A 4UZSA 2G8ZA 5E6YA 1CDGA 1PJ9A 2W67A 1VAHA 2VX7A 2ZUTA 2PWHA 1V6UA 3APGA 3BH4A 1C92A 3EMZA 1K9DA 4PTWA 3AQUA 2VZSA 2BS9A 4QDMA 5M03A 3ARUA 3CMJA 2GJXA 3WH6A 4XZBA 1KGXA 3AMDA 3CMGA 4GXPA 3VIPA 2WBGA 2CKSA 1SMDA 3L4WA 1B3WA 1HJSA 1QI2A 2CITA 4IM4A 4U2ZA 2VUYA 3LMYA 3W28A 4B9ZA 2XWDA 4JHOA 1W9PA 5FKYA 1EQCA 1VBUA 3WDHA 2WMIA 1WNOA 2Y8KA 4QCEA 2W4XA 5C8BB 3VGGA 1C8YA 5M17A 4ZE4A 4CU7A 1RH9A 1W3JA 2VNCA 4AC1X 5CPTA 5E70A 3WF2A 4AZ5A 3BCFA 2VZTA 4UQAA 3AI0A 1VBRA 1HVXA 3MV11 3ARPA 3WD1A 2VURA 1E0VA 3WUBA 4CCDA 3GM8A 5E9AA 5M5DA 5FIPA 4PRWA 4YN5A 3L4ZA 3NJ3A 1JAKA 3FY1A 5LYRA 3GTNA 1WZMA 1D2KA 1IT0A 2EPMX 3EYPA 3NYDA 2Y8VA
chains in the Genus database with same CATH superfamily
4DUVA 1XLCA 4N9CA 4XD6A 2X09A 1LWJA 4KR0B 4TTGA 1EF3A 4PULA 3GAYA 4CUCA 3VXGA 5JBEA 4H7ZA 4GQGA 2CLKA 3APTA 4CQBA 4KWVA 4WSJA 4LBSA 3UGVA 1W2VA 3S4TA 1XIBA 2QCLA 4AZ6A 3BW3A 1KFBA 1SJBA 1XYZA 1FWIC 4WCJA 2D0GA 2P50A 5LSMA 2OX4A 3WH8A 1OX6A 3DFPA 4PODA 3VE7A 3QSRA 4UTTA 4FA3A 4F79A 5EGRA 3MQTA 2FKPA 1SZRA 9RUBA 5I3GA 1GUVA 3CV1A 3BG3A 3VNYA 1ZJAA 4G6CA 4AFYA 2DSZA 4M19A 5T26A 3E02A 4GUGA 2FJKA 3TC7A 3BW2A 2VOTA 1LYXA 3M43A 3KS6A 2CYGA 2FGZA 4DRHA 3AIUA 1L1PA 3KP0A 2VR5A 2A2IA 1C9WA 3F2CA 1PKMA 4V1XA 4YHEA 1G4EA 1YNQA 2NUYA 3GS6A 3O0FA 1BG9A 3UPBA 3K13A 2HVOA 4TV5A 3K8LA 4FNPA 1OFDA 1Z42A 1JPIA 3T2PA 4AYSA 1J10A 3FX4A 2A4AA 4ZTXA 2QDGA 2WKLA 3M0XA 1JFXA 2PN0A 4P8WA 5CZSA 2A6LA 4L6OA 4WF7A 3EY6A 3NTPA 1Q85A 3IIOA 1B31A 3CQ0A 2P3EA 1CEOA 4YCOA 3RGTA 3RDKA 4GI4A 2NLIA 1UR2A 4H6KA 1D3CA 2X0SA 1JZ4A 2QDEA 3P62A 5DX7A 1LJYA 1GKQA 3MP3A 2WSRA 4JFTA 3QC3A 1E0UA 1N82A 3B8WA 3JS3A 4UNLA 1OIFA 3SSZA 3WKZA 2V2HA 3W7KA 3C0SA 4INFA 5IM51 3L2IA 4A2SA 1U1UA 4FLQA 5FOOA 4IL2A 2KI3A 2DPEA 1X6LA 3ITLA 1W3KA 1IXQA 4FLRA 3W7HA 1BYAA 2V2DA 1POJA 2UWFA 3A9BA 3NWRA 4KT2A 1TPH1 4DRSA 3HPAA 2RDXA 4QLLA 2OLAA 1TIMA 4H9MA 3W1AA 4AIBA 1NOWA 1EUAA 1WUEA 3CIVA 1TO3A 3QZAA 3WDRA 4LVBA 1K1DA 1OABA 4JTDA 4YVVA 3F4NA 3FHAA 3UWVA 1UPPA 1XRVA 1UD2A 2ADAA 4KIEA 4WLCA 2Y5EA 3VMOA 1FAPA 4IOTA 5FJRA 1H7WA 3QN3A 3CZJA 2ZRWA 4Q8MA 3A4WA 3NPUA 3URQA 3LXAA 3WDPP 4PL1A 1F61A 1JCXA 3WK1A 5TD4A 2J9ZA 1M04A 2E5CA 3JRKA 4MIMA 1B4EA 1O5QA 2DIEA 3UWYA 1FTXA 1P0BA 1XH1A 3KTXA 1KM2A 1Q13A 2YPIA 1NWSA 3RRAA 2W63A 2GUYA 3UT0A 2DG4A 4F0MA 1A5AA 1XFCA 2IMRA 1M68A 3EOSA 2WB5A 2FKEA 3TYEA 4S3FA 1E0TA 1J4IA 2PDHA 2O9RA 2ZZ2A 5HWMA 3STGA 1T8XA 4QLJA 1UHVA 2QPUA 3E0IA 4QG8A 8RUCA 3PG8A 1W0MA 2I5IA 4P5UA 1C90A 1J2WA 2Z6IA 1WPCA 4QJ1A 1Z48A 2F7FA 4FF5A 2HSAA 2NVCA 2WO5A 3VM5A 2YZRA 3O7UA 1TMHA 2OZ3A 1F4AA 4XO6A 2QV5A 3I3DA 2CZ5A 3WLRA 3OLEA 5HK4A 2VDIA 4JL2A 1KR1A 4FOUA 3L23A 1UROA 3EBVA 3HF3A 5DIVA 2BB0A 4QG9A 3VNZA 3FK4A 4Q4OA 1RVKA 1GYNA 1SFTA 1QPFA 3XISA 2CLPA 2EULA 2PV2A 1KBKA 4XZMX 1XIFA 2PLMA 4GABA 1A80A 2D20A 1E4IA 4IXXA 5EKYA 1VF8A 1HQTA 1ONWA 2GOKA 2PMQA 3SY5A 3MSYA 2GZXA 4ADTA 1FFRA 2F2DA 1IZKA 4RL3A 4FIQA 5DIUA 2NWSA 3N13A 2JZVA 1O68A 2FIQA 4AZGA 2P0OA 3LG3A 5C70A 1G9HA 1I0DA 1Q7MA 2HROA 4GYFA 4O1FA 4GFIA 2DZAA 4MPKA 4DYJA 3LZ3A 3B03A 2GJNA 3LSBA 1EDGA 5L9FA 3S42A 1NU5A 1R0MA 3I6EA 1QVBA 1VFSA 1UKPA 4PL2A 3ZZ1A 4JTTA 2AQWA 2XP5A 3VAWA 1F8IA 4Q7BA 1OM0A 3G1YA 1OJXA 4DUWA 5CPMA 3WJWA 1A4LA 4YIWA 3RR1A 1HO1A 1P6BA 3E12A 2Q71A 2VGFA 2ISSA 3HG2A 1VP5A 4U85A 4DZ3A 4NP7A 2X2GA 3WBAA 1UWIA 3GBDA 2J75A 1MUWA 1B3ZA 4DAIA 2LJ4A 2WQDA 3VIJA 5LNVA 2EKGA 2JKAA 2WNWA 2FQIA 3D3AA 3P8IA 3PUDA 1NDVA 4FX8A 1E55A 3WBEA 4R5EA 2I16A 4BI6A 2XDFA 4MKSA 3ZS4A 5A6SA 2BGSA 3NVDA 1ALDA 3WYZA 3GNPA 4RLIA 5A8GA 3DYPA 4Q8WA 2D24A 1CNVA 4QS5A 1L0PA 1L6SA 1LCOA 1P1XA 3KOWA 4MWAB 4WUIA 1V03A 2GSJA 5AB3A 1TV3A 3O5LA 1J4EA 3GXFA 3VDAA 2NLYA 2VGIA 4XG1A 4MZYA 5CC5A 1AODA 4GI9A 4J3UA 1PZ0A 1TQJA 4UR9A 3NZPA 4KERA 1MUMA 4P7LA 1IR1A 4QR6A 1E4MM 4WK9A 1EJ7L 3DFYA 3DG6A 3THDA 2OYMA 4QE1A 3QV8A 3UXAA 4Q8NA 3T55A 5DELA 4XAZA 4JCMA 2OLSA 1ZP4A 5L6UA 2E7FA 2C18A 3ARTA 1OBAA 4RE4A 3VM7A 2XINA 1MSSA 3BLOA 4K1GA 2DT2A 1M7XA 4R27A 2QIIA 4UMBA 3VX0A 3EPMA 5CZJA 3GR8A 1ME7A 3WD0A 5EU9A 3IGSA 2ZXAA 1LP6A 4FNQA 3U57A 5D75A 3UZWA 2C13A 2A3EA 3V5FA 4HMCA 3W7EA 3GVGA 3MY9A 3CEPA 4XBJA 2BZNA 3BGAA 2X7VA 2HDJA 2AAAA 1MYRA 2DW7A 4ATLA 3R0UA 4V15A 1S46A 3K4WA 3EA3A 3MSRA 1Z32X 1QHPA 1QW8A 3VVGA 1J79A 3CWOX 3G3MA 9CGTA 3MJMA 4O0KA 1QNRA 4TQTA 5I3HA 2D73A 3L4UA 2E40A 1OYAA 3NL6A 5HWBA 4F8XA 5H8UA 1KLYA 4HHLA 3FXYA 3O3RA 5BU6A 4HYRA 1CB2A 1UOZA 3QQWA 3IARA 2DSWA 1K3UA 2NX3A 4GZJA 4IIEA 4WKHA 3KACA 3H2NA 2WC7A 1T99A 3FNDA 3EXSA 1EHAA 1W1VA 4H2CA 4K6AA 4LVDA 4QNWA 5I09A 1EXBA 1DWAM 1S3TC 3QF0A 4E2BA 2VFGA 4NF7A 1PZ2A 3FCPA 1SSGA 4LVGA 2ZRZA 4EPDC 4FR1A 4NG3A 1S2UA 1Z9AA 4L4OA 1ZS2A 3O8AA 4MADA 1TSIA 3ZJ6A 4LYRA 1EP2A 2BWGA 2VN1A 3VKBA 5ABHA 5HQLA 5ABFB 3WY1A 3CASA 4Q33A 4CN4A 3HGRA 4GGBA 1MXGA 3CGNA 2MNTA 2D22A 3UNTA 1UZ1A 2V67A 1A5MC 3H8AA 2J7GA 2OODA 3NDZA 1DJZA 3VDBA 2EJ1A 4DHGA 1EP1A 2C0HA 4AD4A 1ZBWA 3L4YA 4QZVB 4TW7A 1EGZA 3ZSSA 3KLLA 3ERPA 4AD0A 4AWUA 5HQMA 5BWAA 1B3YA 5E0FA 4MJ4A 5CBJA 1SW0A 2ZUUA 5EB8A 1CBGA 1WXJA 3DBPA 4B4FA 4N9DA 3GKAA 4FI4A 3M0JA 2R1MA 3FJ4A 1OFAA 1QW9A 4HOZA 4DPPA 1SFJA 5AC4A 1UBPC 4CQDA 4B15A 4O10A 3R43A 4G56A 2Y4SA 4I5XA 1B3VA 1X8CA 3STPA 2FB2A 1Q6CA 3O9NA 1UP2A 4UTHA 2Z00A 2F61A 3KVKA 1OYBA 2Q8ZA 4OBSA 1SZGA 4L4MA 4FLOA 3JR2A 2PURA 3ARVA 3COTA 3KW3A 4JNMA 1UJQA 3OLGA 4WR3A 4JTFA 2AKMA 1F2JA 1MW2A 1DJNA 3LEPA 4NAEA 2ALRA 4E8GA 4X61A 3AIBA 2WNQA 2VI0A 3WMBA 2UY5A 1M7PA 1TVLA 1KM1A 1IWPA 3LGGA 2Z1WA 3OBAA 4GKLA 3W7MA 4KCUA 4TUFA 3S5ZA 4IMEA 1MRQA 3TU9A 3G22A 1ZCCA 6REQB 4DRPA 3UR5A 2PLKA 2PGFA 4KGJA 1UWQA 3KL5A 2M2AA 2YL9A 4Q7NA 3OGSA 2ZADA 4MB3A 3W7QA 1EQPA 1UMLA 4PBFA 3U5YA 3TMLA 3N6QA 4O13A 1HL2A 4RDYA 1UUQA 4AISA 4KPLA 4MWAD 2CPUA 4UB9A 5LHEA 3AJ7A 1JPDX 4GISA 1GQIA 4D8ZA 3TQPA 1OFOA 1EWEA 2OQHA 1JD9A 1BQCA 1EOMA 2QCNA 4DM1A 4YPJA 3F7JA 1GKPA 1TELA 2R1KA 4CN6A 4CU6A 3ZWSA 3TJIA 3GU2A 4M80A 3MS8A 3URBA 4JFUA 1H3GA 3UW6A 4QJ5B 4HYVA 1OVDA 3IV8A 4XWUA 1QPNA 1PAMA 3V18A 4JIQA 4I90A 3R79A 5AFDA 2E1WA 1HG3A 2V3DA 4HPXA 4TIMA 4B16A 4AY7A 3M0LA 4IIFA 1BYCA 5LHFA 3K8MA 4GVGA 3UZZA 5D32A 2FGBA 1JNDA 2CWNA 2E09A 2YL5A 3V36A 4GCXA 2F4EA 3QHOA 1GRJA 5JBDA 3HV9A 2OT0A 3WNNA 4LJ3A 4O4WA 5I23A 1RCOB 4BFAA 3W2LA 1BTMA 4ZR8A 3KBWA 4Y8FA 3KZ7A 4JYEA 3ZLFA 4H6QA 3VGEA 3OVPA 4D6HA 1OFRA 1O1ZA 1Q5MA 3PZOA 2XPAA 5DY3A 1XGDA 1XGEA 5B80A 1JNTA 2O55A 4DRQA 3LBMA 1JDCA 4DLMA 1N8IA 2GVJA 3GTXA 1R3SA 2BTMA 4HQVA 4W7VA 3S3GA 3ITCA 3W7PA 1IXOA 2CHOA 1KKOA 4UTKA 3GE7A 4E5TA 4R53A 5REQB 1LWHA 2P10A 1S5NA 4UTWC 2BOGX 4L64A 3O5RA 2CHNA 1TZ9A 3RM8A 5EBUA 3EMQA 1EXPA 1NQ6A 3VIMA 1EYEA 4HTBA 3E5BA 4JTKA 2P5NA 3VNDA 4WJXA 1IGSA 4KMQA 3VABA 1P6WA 1B1YA 3M7WA 2VC7A 2GVEA 4WXYA 1NSGA 2DVTA 3ATZA 3JU2A 2O0TA 3QLDA 3UZYA 1LOLA 1E70M 1H49A 3LQGA 2Q3OA 1E15A 2QUNA 4US6A 1D3HA 3GIPA 3WLKX 4DBDA 1X38A 3VFLA 2JGYA 1FKRA 5LXXA 3HQ1A 2QDDA 3GH5A 4RUBA 2X0HA 1E6QM 5BMWA 1EC8A 2H9AA 4E2OA 5SWUA 5FL1A 1Y5WA 4E6MA 5FSEC 4W87A 3GH7A 3ES8A 1ITQA 1GNXA 4JQ3A 2DZVA 3GXTA 3ONCA 3WNKA 4GY0A 2FFIA 4PE8A 5M1TA 2WZIA 3NRKA 5HPOA 3TZFA 5CPQA 5CSRA 3PPCA 2UY4A 3GDTA 5A94A 4RDVA 1IX5A 4EPEC 4MLRA 4D8LA 1H7RA 3GVRA 1P1MA 1XD1A 4RX0A 3KXQA 1S2WA 2J9YA 3B05A 3VD4A 4GY1A 3UD6A 1YXCA 4MFDA 1Q6QA 3JZUA 4GC3A 1QW7A 4UBPC 3OBEA 2J8TA 1HXVA 4BKNA 4X60A 1VD6A 4RPPA 3HGSA 5BWFA 3F5JA 1QASA 4A2RA 1W54A 1VJZA 1UWUA 3PR2A 3N18A 2OSYA 4DH0A 4F0KA 4L3NA 1ISVA 2BY1A 3TAKA 5FA5A 1YXYA 2YW4A 3VNKA 5HMFA 1OFEA 4OUIA 3CT2A 1TYGA 1C29A 2D9FA 3NPXA 5HAOA 1KT0A 1VYPX 1X6NA 1R9ZA 3M7SA 1TG7A 2CLEA 2TYSA 3KP1A 3KAOA 1AJ0A 4GFSA 4RNHA 1FWJC 2PDXA 4HSHA 3TYBA 2VO5A 1RALA 1CGTA 3VX1A 1ZBVA 3S2CA 3KCEA 3FDKA 3O2LA 2PWEA 3LK6A 3GK0A 2NUWA 5KINA 1IR2A 1Q6OA 4MY1A 3WBWA 3WQWA 1EB3A 2I7GA 4Q8OA 2NW0A 4OZOA 1MRAA 4HHHA 3ABOA 4J4OA 3LUOA 1GVQA 2I56A 3T2QA 5DBTA 4BEUA 1JZ7A 4DM2A 4JTCA 4MNMA 4O52A 2UY3A 2HWGA 1EEXA 1PWLA 1UC4A 3DUGA 3LS9A 1WOBA 3LOTA 4FX7A 2Z1XA 3GXIA 3DKJA 1H51A 2GVGA 3AMKA 4GWEA 5BYWA 2XVGA 1YMYA 2ATMA 4X2RA 5A95A 5C9ZA 1AMKA 4ZSTA 2FZDA 5I24A 5HTGA 3WQFA 4WKAA 4AMAA 5DXYA 1EEPA 2GSEA 5HATA 1OG0A 4JZ5A 4JTHA 3OP2A 1VYRA 1BSLA 2GFTA 1XIMA 2RUSA 3TFXA 3AZRA 3W26A 2GK1B 3QHNA 2MANA 3OGRA 4HPGA 1SSDA 3GAKA 4B3KA 2QCHA 3SRDA 4LV9A 1FH7A 4C60A 4AHQA 3ARYA 1X1ZA 4TO8A 1SGJA 3CAKA 5GNXA 4QHRA 3HPZA 2Z24A 3ZFHA 3MO7A 4HTYA 4DRNA 4QRNA 3GC2A 3O07A 1GOOA 3UXDA 1I60A 4NASA 3WH7A 4DF1A 3LCFA 3RCMA 4UTUA 4I9TA 3LUTA 2JF6A 1E6SM 1GQKA 4QIBA 3NR0A 2V3EA 3IACA 3G1HA 1W9BM 2GQ3A 4H8NA 3BAJA 2P0IA 3ABQA 3NXLA 3N4EA 2CXEA 1CIUA 4KWSA 4WDXA 2G50A 3AXIA 1RPXA 3WEMA 4ICMA 4AVOA 3SADA 3NQBA 3MWAA 1R86A 2JIWA 4M0XA 2E67A 5HQEA 2Z1BA 4CNTA 1XBZA 4GGQA 1ZK6A 4HSOA 2UY2A 1OEPA 2DUZA 3MTWA 1P6CA 4H9XA 4MWAA 4JFLA 3S1WA 2X1TA 4POCA 3O5IA 3R89A 3T05A 1GOKA 1J5TA 4LF2A 2YOCA 1XPYA 4U31A 3ANVA 2F6XA 3M07A 4QT3A 3T42A 3VIGA 1Z3NA 4ODLA 2RGLA 3G8RA 2DY3A 1ADDA 3EPOA 4K39A 1BYBA 2OB3A 4KRTA 3SCTA 3IUDA 4B5UA 4OBRA 1GVIA 3NOEA 4PMNA 3UJFA 3MUCA 4JR5A 3L5AA 2PDFA 1QTWA 2YYTA 2XIJA 3VUPA 3W1TA 3PC0A 5T9CE 3CGTA 1Q8JA 1IZJA 2BV9A 5BW6A 2XVKA 4PCTA 3N3MA 5A8NA 2XUCA 3W53A 3WD3A 1UQYA 3F03K 4HPHA 4TW6A 3AXMA 4IQDA 1QR7A 3O16A 1LDCA 4L56A 3KVJA 2B31A 1QBBA 2Y24A 4C6IA 4L61A 4UTFA 1ONEA 4Q22A 1XDMA 1N7KA 1DP0A 2G41A 4AVNA 3TYZA 3MSDA 3UWZA 1PUDA 4IT6A 1OB0A 3BTNA 1S2VA 4L7ZA 2NV9A 1EC7A 4URIA 3HB9A 1H50A 2CLOA 5HUPA 3V0UA 3F5KA 1ZUAX 1OSEA 4AD5A 2ZUVA 1EJXC 4HK6A 2GGHA 4NVTA 2A6NA 4AWEA 8CGTA 4GG9A 2BHZA 1GGOA 4H01A 3RF9A 1JXJA 1R9YA 1IYXA 1DJIA 1FD9A 2C79A 1TB3A 1W3NA 3DC8A 3RG6A 4DIAA 1JULA 4XUYA 3L67A 5AYXA 1HP4A 2N87A 3GZ3A 2WZEA 1JRCA 1VBJA 3UG5A 5BZAA 4GVHA 1VJSA 2CCRA 2TAAA 2YDSA 1TQXA 1JCHB 1FP9A 4JTJA 1LORA 1P0EA 4LAZA 4BHYA 3W9ZA 1UD4A 5ABFA 3KBJA 2QCCA 3RU6A 4IQ2A 1W2PA 3SSJA 4OV9A 1MUCA 3B0VC 3RGCA 4UNKA 3CHFA 3ZM8A 3D0CA 1F3TA 3VPLA 5A6KA 5EY5A 3N6JA 1KM4A 3GRIA 3S6TA 3LU2A 3T6CA 1UC5A 4CD4A 2CLLA 4GYJA 1DPMA 2INEA 3TXVA 1NH6A 4R88A 4LS0A 5CJNA 2OYKA 3C2FA 1GONA 1G7UA 1YKWA 3OYXA 2I5QA 3D6NA 1DEDA 1CTNA 2OSWA 3T4WA 2Z27A 1XYLA 5HW8A 2ZYFA 4A3RA 3ARXA 1QNSA 3GW0A 4C1LA 3UU0A 1B30A 2BXYA 3PM6A 5GNYA 3L0NA 3M9YA 4TVUA 4YJ5A 2J7DA 2ZC8A 1DBTA 4D71A 4DQWA 3RK8A 2AL1A 3QOMA 3U9IA 2X1RA 5D8WA 3ME3A 1GEQA 1GOWA 1H62A 3MPGA 1XLMA 4K8HA 1KBLA 3A4JA 2XZ9A 1UMYA 1PE1A 1QHZA 4HA3A 1HJVA 1I45A 3BLDA 4FXRA 1LLOA 3QY7A 3GR7A 2WM0A 3LDVA 3WLQA 3J7HA 2YZ5A 3FAPA 4K68A 4LVFA 5JXQA 3SCSA 4XSMA 3IIVA 2BVDA 2PD9A 3HPFA 3WMCA 3GW3A 3CU2A 2FGLA 2WNNA 1W1B1 4I5UA 1G7VA 4BY3A 3MMTA 2GVLA 2DSUA 2Z7KA 3VNIA 6REQA 1CLXA 3O5FA 1DQUA 3ZVHB 5FD0A 1VFLA 5LIUX 3BAIA 4P8VA 1I1WA 3QV9A 4OBTA 1OADA 2OEKA 3TNBA 4A22A 3TP4A 3UQIA 2PAJA 1FCBA 3UJRA 1DOSA 4J4NA 1KA9F 2G3IA 2IF4A 4D1JA 3MKVA 2BOEX 3KABA 2BFGA 5AZ1A 2ZRXA 1CLVA 1Q6FA 2PI6A 3HO8A 3MUXA 1JDDA 3LHZA 1J4HA 2DT1A 3UZXA 4IGHA 4QP0A 2WLZA 3WNMA 3H54A 1NELA 3HJEA 2Q8XA 4FZIA 3S9ZA 2NVAA 5D09A 3UG4A 3WD4A 3CJPA 1S5TA 6ENLA 4Z2JA 3QM3A 1L6WA 3ANYA 1L6YA 4RJEA 5LKYA 1SO4A 3C52A 4PUKA 2ZWYA 3ORWA 2XVNA 2ONEA 4N0RA 4DWSB 1IEVA 5M3WA 4CEXC 2L5HA 2E8ZA 2GGIA 3GLCA 4O50A 2EPHA 1NWUA 4YXGA 2Q6ZA 1IT8A 4IIDA 3V5CA 3TN5A 2ANUA 2ZZ7A 3FSTA 1K03A 5DRIA 1TV8A 4L72B 1E56A 4FB7A 4NAFB 5KZEA 4G2PA 3KWSA 3S5OA 3HV8A 1B0IA 4HZ6A 1XF0A 4RDZA 5DMLA 4UZSA 3IKGA 3PVFA 1CDGA 1XPGA 2WSQA 1XJBA 1XYAA 3RNDA 2W67A 1VAHA 2AGTA 1M7JA 3ID7A 5HUAA 1ZAJA 1C92A 2VFHA 2VZSA 3TWAA 4E38A 3ARUA 2AL2B 2PDJA 1JDFA 2XIQA 1YE6A 2SFPA 3T78A 4GXPA 2BLEA 3OW1A 5EMJA 2X41A 3C61A 3MB9A 4Q32A 2VUYA 4C6QA 4JHOA 4LALA 2VFEA 4FOJA 2V2CA 1P4CA 2BASA 3TN3A 4IGNA 3LV6A 1WNOA 1Q4WA 2VWSA 4JEJA 3T4CA 4A8NA 4KIRA 4ZE4A 4KWOA 5REQA 4DNHA 1T8QA 1I6NA 5C5YA 4CU7A 1RH9A 2VNCA 4ENLA 5G1YA 1UJPA 1EIXA 3WF2A 2VZTA 3G3DA 3ODKA 2BG5A 2A7PA 3WD1A 3BARA 5F4SA 2B7NA 3WUBA 5M5DA 5FIPA 2PGEA 4PRWA 4YN5A 1UW9A 1Z89A 3P74A 1TWZA 3LA4A 4HT3A 2RJHA 3EB4A 3FY1A 1G69A 1CI1A 3DIPA 2EPMX 2ZQUA 4YTQA 3CGMA 3CB8A 2XIMA 4BF5A 3KHDA 3ZJKA 4AZCB 3UJ2A 2I17A 1J0JA 3A21A 2V5KA 3GH4A 4ERIA 5FI8A 3GB6A 2HRWA 2C19A 2IQ0A 1EOKA 4PFMA 2WJDA 3VOIA 1QPRA 2E4TA 5FESA 1TV4A 4XQ6A 1NMVA 1YIXA 1PPIA 3M6DA 3GDBA 3SIMA 3VKAA 2XH4A 4UTWA 4TTUA 4HNLA 3DXIA 3ABSA 1K7XA 4EXBA 3UGRA 2PPNA 3WLSA 2AAMA 1XIHA 5K7JA 3LBOA 2FZ9A 2XTKA 2BX7A 5HOSA 3DYMA 1N8WA 1EA0A 5JH8A 2HE5A 4DJDD 3LLDA 2INFA 3E1F1 1AUSL 5FF0A 1GJUA 1Y5XA 1YTEA 5I3JA 1QI3A 3RO6A 3CUHA 3H7VA 4I6VA 2DJLA 3P80A 1JZ2A 2XIBA 1EX1A 2QW5A 1A5CA 5AOUA 1T40A 4NSBA 1MEIA 1U1HA 1UD8A 2E9BA 3BAKA 1S3HA 4XTDA 5HT1A 3FHQA 4C6KA 3TE9A 4ZQCA 3RFAA 3AIEA 4OGZA 5IHSA 3T1GA 4PMUA 3W7GA 4YS1A 4GO9A 4NJHA 1Q3NA 1XRTA 2D3LA 4V2XA 4K36A 2WJEA 1NDWA 6XIAA 4QSFA 3W76A 2FAPA 4D9PA 5I07A 1V3LA 3SZ8A 3BW4A 4LXFA 3H23A 4LYPA 2VEGA 4H6RA 5A2CA 5BXRA 3AOFA 3LZ5A 4UTLA 1UZHA 2YR1A 1XM3A 1GVFA 3Q94A 4JIPA 4LUIA 3KOZA 4IF2A 1XV8A 4H41A 3A4XA 3TONA 3WNPA 4M6UA 2XHYA 1VJIA 2HZGA 5HNNA 1V02E 1PVNA 3N4FA 3KFTA 4NQ1A 4HVXA 7TAAA 1W5PA 2ZX7A 1EA9C 2VHLA 3R1ZA 1X6UA 3PAJA 3WF0A 2IUZA 3VGHA 3S2MA 6TIMA 2Z26A 4IT4A 4LH8A 5K3VA 3EWXA 4FO4A 1BHGA 4HJWA 5GJPA 2FVKA 2OGYA 1O12A 1K7EA 4ILSA 4U3AA 1TUXA 1HKJA 2ZR6A 4QM1A 4RW3A 1VB9A 1C8VA 4DAFA 1JQVA 1AH3A 1BSIA 4NI3A 3PZGA 4HOXA 1W56A 4ZOBA 4MDPA 3WK3A 1I2OA 1WZKA 2WQPA 5CC6A 3M5ZA 5CXPA 3AISA 4GJIA 4GZIA 4DRMA 3OZYA 4HZ8A 4DWSD 1PEZA 1JG9A 4DJEC 3SW6A 4YVXA 4FNUA 3LENA 4NX0A 3EOUA 1FH9A 5G4EA 1P5QA 4W9TA 3O5QA 3LBCA 4XAGA 4Z0SA 3Q58A 1KWKA 3CLMA 2RFGA 3I65A 2EG7A 1V08A 2BMBA 5BRBA 1R8LA 1LL7A 3C6CA 3WO8A 5JUVA 7ODCA 1PYMA 1F40A 2PDQA 3TAOA 2R94A 1QRQA 3PZNA 4YVPA 3FA5A 4BWLC 1F76A 1AL7A 4PMJA 5DANA 1OCNA 3CQKA 3V3WA 5D03A 2WCSA 1HFBA 1HVQA 3RO8A 2O7QA 1QDSA 2OZ8A 3QPYA 3SN4A 4C1NB 2YDRA 2E68A 2EF9A 2VL4A 4JHZA 1TWIA 1SZFA 4ZS6A 3CAQA 2HBVA 2Y0FA 4JFWA 2PDBA 2NQ5A 2XSBA 4GYPC 3N9SA 3QVQA 3BSMA 1J0ZA 2Q3RA 2V5JA 4TU1A 4JAWA 4PB3A 1CCWB 3CZGA 3PTDA 3RUBL 4HZMA 1R9XA 1KM6A 1M53A 2GLKA 4GO8A 3A3HA 4CQ8A 2DZWA 5A6AA 1ZBCA 1OGSA 1WDSA 2WMIB 2A3LA 1SJCA 2Y7EA 5ABEA 4LUTA 3W7JA 2OYLA 2Y2WA 3N25A 4PSPA 2PWUA 4ODRA 1LF1A 2C7FA 2XFWA 5C0QA 1XLDA 4UNIA 2OTDA 4CQAA 1EQ3A 3WLNA 1KBIA 3L4VA 1XLAA 2B7PA 1VFMA 2J6VA 3UERA 2OZ0A 2C14A 1JQXA 3N11A 3RFWA 2GL5A 2ZQVA 1HNYA 3VOJA 2FVLA 2VQTA 3CHCA 2KR7A 2V69A 3E3HA 2UZ9A 3EX2A 3O5MA 3W75A 4I7VA 4W84A 3A5VA 1XI3A 2P8CA 4ZBCA 4IMGA 4ZPWR 3EB2A 4JQ2A 2EG6A 2VEPA 1I2RA 3N2MA 1XIJA 5FJTA 3AYVA 4O12A 3DHDA 4L5ZA 3E96A 1GORA 3ZR5A 3NQVA 2VCBA 3VC5A 4YLWA 3LNPA 4B3LA 4D8AA 1VGAA 2PF8A 1B9BA 2EPKX 2W5FA 5F2IA 1UH3A 3QBUA 4MYAA 1E9ZB 2QULA 2X16A 2FTWA 4GQQA 3POCA 2QV4A 3DFHA 2BGQA 2QLYA 4M29A 3BJSA 1MDRA 2VCAA 1HJQA 3KL3A 4YTRA 2PLJA 4LV4A 3BLIA 3KAIA 2H3DA 3IAPA 4XSLA 1RSCA 1ZU8A 2IPGA 2WSPA 1PDYA 2NUXA 4DELA 4HNCA 3ZR4A 3TTEA 1GZ1A 4IP7A 4G5DA 3GHTA 1XH2A 1C91A 3VAVA 2C91A 1JF6A 3M0MA 4JKMA 4XBSA 1F3XA 4DBSA 3GDLA 4C6MA 4YTSA 2WVTA 4ODOA 4ZMGA 2CLIA 5BCAA 1HKMA 3AUJA 4R3UA 5CEWA 1KKRA 3R0KA 2XISA 2J74A 3H2MA 4C6DA 2KO7A 1E5JA 4GUJA 5TIMA 2H8ZA 1S5WA 1XR2A 3LGEA 4XIMA 3K4AA 3BL3A 1ZZMA 4AEFA 4JTEA 1EJSC 2VELA 1JPHA 3S6OA 3FVMA 3ZT7A 4NRSA 3L0GA 3N15A 1K9FA 2IKHA 4OU1A 1XD0A 2XU2A 2VGGA 4G50A 1U2YA 2IQTA 2OQYA 2XJ7A 2Q02A 2YJQA 2YW3A 1NWRA 3KBVA 3CHDA 4W88A 1TRDA 4WSHA 5JIPA 1MWOA 5D4YA 1BPLB 1V51A 3W7OA 5GPRA 4B5TA 3KBMA 2VDHA 3UG3A 2R1NA 1HGYA 1QPOA 4ERAA 5G4HC 4PBEA 4F9DA 3KL0A 3PF3A 3UPMA 2PPPA 1UIPA 4FK9A 4JIEA 4AYGA 3DDMA 3KOYA 4GKTA 3PRBA 4QLKA 2KX9A 1OCBA 1MZHA 1VFUA 1M7OA 1R6WA 2XFRA 3NSXA 4IHCA 3TLLA 3NM1A 4W9PA 4JY9A 1QFEA 5A3HA 3CUJA 5F1VA 1BD0A 5H6HA 2TMDA 3C2OA 5FAGA 4XBKA 2POTA 4Y9AA 4HCLA 1A53A 1K6WA 3P61A 3ALGA 1K02A 4KESA 4UCFA 3REQB 3B0UX 3O5OA 4XD4A 2EPLX 3L4XA 4ODNA 4MNKA 2W92A 3A4AA 2Y85A 4C6CA 1V7AA 2QJIA 3O5EA 3ZVHA 1KTCA 2A3BA 1L2QA 3HG4A 1LT8A 1ZCNA 4QCFA 1XYCA 2Y7FA 1A5BA 3PTQA 4JX4A 3WF4A 3BLLA 2ZZ5A 2V5BA 1HZYA 3H55A 3O5GA 4IX0A 3KCLA 2YA0A 4MPQA 4DXKA 2HCVA 4ZO9A 4REQB 3UESA 1WDQA 5D9NA 3SQMA 3UNDA 4F2BA 3UA4A 4S3CA 3NM3A 3WDQA 2AQVA 5FEPA 1GK8A 2OEMA 4Q4MA 3O05A 4PTXA 3ARQA 4P61A 4QIUA 1DIDA 4PMDA 1OY0A 1QHOA 1TIWA 4M81A 4ZL1A 4RV3A 3SEPA 2DZSA 2LGOA 2D0FA 4PUNA 1JEZA 4GQ0A 5FF3A 4JYSA 4L4PA 4NYYA 3OU8A 3PSVA 1YNPA 4ZOCA 5EYWA 3ZO9A 5HKGA 3IJLA 4IMAA 2C8NA 2R82A 2NT0A 2QF8A 2QVHA 1XSIA 4B3ZA 3M5YA 1LUCB 1S5VA 4PUDA 4WDUA 2HNEA 4LAUA 1UR4A 3VKCA 4H2HA 4HBKA 4NAFA 3LHVA 1EJVC 1RHCA 5PTDA 1YNYA 3RITA 2W6RA 1TKKA 2HBXA 1QJWA 4L1WA 1B6CA 1KBBA 3L5LA 1RLDA 4MF4A 3WNOA 3ZMRA 2F38A 5EMMA 3E38A 3N4AA 1FWNA 4RR4A 3N14A 2AL2A 5AN7A 1ZJBA 2AMGA 1R3YA 1DXFA 2CU0A 3GG0A 3IGXA 3QR1A 1E4LA 3AHZA 3W84A 3DH7A 1YQ2A 2YFOA 2DT3A 3IVTA 1W1A1 4N9BA 1F74A 4IJCA 4MYXA 3RX4A 4MWAE 4HCHA 4OECA 3R8GA 1JYNA 3CIWA 3WQCA 3B0XA 3UP8A 4O53A 1Y7VA 2B81A 3G6MA 1FBAA 2PB1A 1EBGA 1W26A 4HPNA 2E3ZA 4NRRA 2Y88A 4H6EA 1CW2A 4MTVA 4DVOA 1CT5A 1QO5A 4WVXA 4L1GA 3PUEA 1U5HA 1Y0OA 3N12A 3W4RA 3LNMA 3WEOA 2WZTA 4Z1BA 1QT1A 3S6DA 2I57A 1NJJA 3ITYA 4PMXA 1M03A 2NSXA 1QUMA 1P48A 4H7VA 2CZFA 4QEHA 4X0NA 3CBWA 4ZQMA 3IGUA 3M5VA 1YBQB 2DUAA 3SDOA 3R25A 1MEHA 2V3GA 1RCXB 4G1KA 2A7NA 2PDIA 3C86A 2NVDA 4C7GA 5LNSA 5TBOA 4V1YA 1WA3A 4PMYA 3EDDA 4IFOA 2OSXA 4AC7C 4AZCA 5CZKA 3D47A 3SGGA 4M7SA 5TF0A 1W31A 4MKNA 3MSGA 2VCDA 2NV1A 3SQSA 3ARSA 1GVRA 4GZ7A 3M41A 2VMFA 3ARWA 1U30A 4UDMA 1THFD 2RH9A 3MDUA 3EX1A 1IHIA 1M3UA 1FKXA 1QNPA 4AZBA 4KFOA 3AICA 4WHBA 1US0A 2OR2A 2P88A 3I6CA 4DF2A 4GNVA 3VA8A 4CNUA 2GJXB 3SCVA 3NZ1A 4JQ4A 4KQNA 2J13A 1O5RA 3DN5A 5CPSA 3VZYA 3PZIA 1BWVA 3ITOA 3SCQA 3OLDA 1UG6A 4JTLA 1EC9A 3RX3A 2RKXA 4GNKB 3PBGA 3GC4A 1VCVA 4P7QA 3ALFA 4I7WA 3RPMA 4XISA 3F2DA 1CXFA 4H8HA 2EEXA 3KM8A 2PF0A 4HMDA 4PFHA 3VZXA 2P4VA 3TCZA 2PTYA 4DB7A 4GIVA 2GUBA 3PZQA 4EVZA 2Y62A 1WE5A 3UVAA 4W7WA 3FGCB 1V3MA 2BHYA 4IPLA 3B7XA 1BTCA 4H4IA 5AECA 1TMQA 3I4EA 3HBLA 4UQEA 2AGKA 3EWZA 5GJMA 1KV8A 4EACA 2D3NA 3ZSTA 1Q6RA 1XSJA 4N4QA 1J0KA 5LNUA 3UCCA 3FS2A 5AHFA 3NQ8A 2PE4A 4UFKA 2PP1A 4CGTA 2PV1A 3S9YA 3FKKA 3W7RA 1VC4A 4ML4A 3E0LA 4LS2A 4CU8A 2YBVA 2BGNE 4LUJA 4PGLA 4DBUA 3CNYA 2VEMA 4MMWA 2JFEX 4R7OA 5A2BA 3LM3A 3PBMA 3GNRA 4DNMA 4FMVA 1F3EA 1OFBA 2V82A 3AALA 3AHXA 4MUZA 1EYWA 4LX4A 4D6IA 2J79A 1E1CB 3DYOA 2VENA 4B2DD 4HPJA 3UR7A 3RPTA 4KRUA 1UR3M 1MQPA 2RJGA 3E0FA 1GWJA 3NZGA 5ABTA 4GZEA 5G2HA 2XVPA 4EKJA 1LBLA 4O0ZA 1IF2A 3LD5A 1T6MA 2JEPA 4Q8PA 3QJAA 1E71M 1R47A 4EK7A 2WWCA 4B5SA 2J24A 2V30A 1YE4A 3IJ6A 3H7UA 3R10A 4O8AA 3F5LA 1EPXA 3SFWA 2WC3A 3OLIA 1UBSA 3G1AA 3WDJA 4UFHA 2OO6A 4HBOA 3B40A 3NL2A 1UR8A 3T40A 4KCTA 1UD3A 1GTEA 2BVWA 2PUZA 4RXFA 3SUVA 1VPYA 5I7GA 1XC4A 4C90A 2VWTA 3P82A 2ZZ6A 4NNRA 4JTUA 3W1LA 5LXEA 5CBIA 2NV2A 2EGZA 4XZNX 5HR6A 2YCLB 2R24A 3PJXA 2V8ZA 2HPIA 4GXWA 1SJDA 2Z1KA 4OTKA 2BBFA 2WMFA 3ZQ9A 2JEQA 5LA2A 3PZMA 4JBRA 3BANA 5I06A 4C1NA 1TJ0A 5GJNA 1JL8A 4L6HA 2OFNA 4DYKA 1R87A 4RZBA 2EJAA 3HQOA 4AVFA 1KFWA 3ZJ7A 6PTDA 3Q67A 4XB3A 2AKZA 3QEZA 1EWDA 3IGHX 3LI1A 4V33A 1T96A 5CKSA 4F3HA 2FVMA 1BXNA 1WDRA 4GA8A 1MW0A 3TOYA 3KDNA 1IEIA 1WDPA 2QKFA 5I3IA 1AH0A 5D2VA 3MMUA 4H9YA 3B06A 1W3TA 3OHMB 1PIFA 4N6EA 4IQJA 4MAVA 4EF8A 3I7RA 1I2PA 1UP3A 2VOMA 3BZGA 1YDOA 4GINA 4F0SA 4PC8A 3A64A 4O1AA 3T7VA 2WVSA 4FNRA 3PUOA 5D2WA 4WGXA 4WOQA 4DBWA 3A13A 3VC6A 4BWLA 3WQ5A 2IKIA 3THAA 4JFVA 4NYUA 5FEWA 1SW7A 4V28A 5BOFA 4FXJA 1WP6A 4EPBC 3MHFA 3EOOA 4IG2B 1NF7A 5J04A 1SO5A 3NQ7A 5HJXA 4JTAA 3NCOA 3GX9A 2WANA 5HMEA 3LTPA 1VQTA 2GQAA 3TN6A 3HMJG 1ONRA 3VFCA 3VTRA 4GD0A 3EPNA 4M6QA 1NTHA 5D8ZA 3KVMA 1CGXA 4GYPA 2A3HA 4UWMA 2PDLA 2VEIA 3UVIA 4P8UA 2WK2A 3W0KA 4TNSA 3W86A 3EB3A 1XIGA 3TC6A 3TDFA 1CYGA 3A22A 1QI0A 1CXIA 1V6TA 4AZ7A 2FHCA 1XDLA 3PN8A 4DUXA 2RUCA 3MUZ1 3RN6A 1G5AA 4LPCA 1Z41A 4M6PA 3TX9A 1PKLA 5BMXA 3MI6A 3MCNA 3PZ9A 1DJWA 4GCAA 3R13A 3FYOA 5HBFA 3DKLA 4JPGA 3V35A 2VEKA 1H0IA 2PDYA 1J12A 2QS8A 2ZUWA 3BWWA 3P8JA 5IDZA 3PS7A 4XKYB 3FAWA 3G1XA 2HS6A 3BLFA 3H21A 5H1WA 3BMBA 5LIXX 2PLCA 4JHMA 3KS5A 3W7DA 3FJ6A 4GIYA 3V1PA 3GFYA 3GXMA 3PJTA 2XYLA 1NSJA 1NFPA 4NX5A 1X97A 3FKRA 3PWGA 5BOOA 4NT0A 4ML9A 5DCDA 2G3MA 1ZB5A 1OQFA 4B90A 3WEZA 4PUJA 3HG5A 2YXOA 2ISDA 3E2QA 4D6CA 4U4MA 1YYAA 2OU4A 4WZHA 5KETA 4TW8A 4UTMA 3QLLA 5C54A 2FZNA 1E9LA 4E0CA 2GVYA 5A6MA 5G1MA 1REQB 4S3KA 1G01A 3UZJA 2YB4A 1H1ZA 5F1UA 3W87A 3GG7A 3F2BA 4JN7A 4D72A 3CV2A 3MWCA 2IW0A 2B0MA 4S2BA 3A3XA 3W74A 1KRBC 2WKJA 4IFKB 3UWEA 2DGAA 2HE8A 5CC7A 1H61A 1RBAA 4Z1DA 4O0QA 2FDSA 5T8GA 2PDNA 2ZXBA 3DHPA 2Z1VA 1ZJIA 8TIMA 3TDBA 3UQAA 3M4HA 4GY7A 4LFYA 1MMFA 3TYAA 1BF2A 5EFDA 1W5QA 4IWWA 1E4NA 1F73A 2BOFX 2J27A 2J7BA 3C2VA 3CQJA 1XC6A 2V5LA 1O5XA 1JCMP 2F21A 2RUDA 2NXGA 4K37A 1JF5A 3GNDA 2CWXA 2DQXA 5HULA 3TEVA 1LZOA 1XH0A 1LWIA 2YDAA 1FOBA 3LXBA 1V0LA 4ONVA 5LZLA 2FPYA 3U6WA 2FJUB 4XZWA 2H9AB 3IPWA 5CBBA 3WF3A 3W3OA 2D2OA 2AMXA 2P53A 2YCEA 2GJRA 4NILA 1EO5A 5I3DA 4G7FA 4XZ9A 4HKPA 1AA1B 4AUBA 4Q4RA 1KBJA 2GJPA 3FFSA 1RQHA 4CNOA 1XLKA 3TTYA 1DHKA 1U5JA 3H53A 4LS1A 4GJJA 1Q6DA 3WL1A 1K70A 1PS9A 2YDQA 2GPTA 1CLKA 1TV2A 4JTQA 1V8EA 4K1WA 3CZLA 4ACYA 4I9AA 1B4KA 3REQA 4EP8C 1AD1A 3IWPA 2PV3A 3FJNA 5HWNA 4LBRA 3QTPA 2GDUA 3QV6A 4HNOA 1JFHA 2E0PA 2BY2A 3EMCA 3CPGA 1C8XA 3PTMA 4R0XA 1FH8A 1NWTA 1HO4A 3DERA 2M08A 1WOAA 4DLFA 2P76A 5LIWX 2OXNA 2MNRA 4WD0A 3IK8A 2DIJA 3QGVA 2K8IA 3GXPA 4REQA 5HNTA 1T0OA 3O5KA 5A8OA 3RR4A 2WV8A 4K2SA 3N1AA 1YTKA 4B2DA 1QMLA 2B7QA 3R5EA 2VRQA 5H8MA 3NFUA 1WDDA 3KRUA 1J6PA 1V6WA 4NZ5A 4TMCA 2WOQA 2B4GA 4R9OA 2POZA 3GNOA 3MW7A 2ZXQA 3TWBA 3R2GA 2ZRYA 2Z6JA 4ZO7A 3TUUA 2BVTA 3DI0A 3II1A 3S46A 3WUEA 2YCJA 1XLJA 3SY8A 3P84A 3TQVA 3KAHA 4V27A 3H2FA 4NZCA 3GNNA 1CENA 1SM9A 2WW5A 3AS1A 4NJKA 1JZ3A 3BGGA 3CK5A 3M16A 1LUCA 2KZHA 5ENLA 3THUA 3W07A 1H2JA 3KX6A 4HA0A 4LAMA 2XPBA 1PYFA 2O7SA 3EGJA 1UOKA 3H2EA 2L2SA 3H22A 1E9IA 1FKWA 3O06A 4UFIA 3W23A 2A3CA 3ABXA 4UCGA 3VINA 3MHGA 1U33A 4Q4SA 4TMBA 4S1FA 3K30A 3WQVA 3CL7A 2DSVA 1DV7A 2G97A 2GQ8A 3KEHA 4WY0F 1AW2A 4ZOEA 2ZDRA 3C0JA 3IJQA 2IPFA 3BOLA 3OBKA 4PMQA 1VEPA 4EWJA 1ZBKA 5I98A 3DFOA 3K46A 3K2GA 3NEHA 4MOZA 3AS2A 1GYLA 1FXPA 2O9TA 2PDCA 4DJFC 1AW1A 2PZ0A 1E3ZA 4C6NA 2A3AA 3FA3A 1K8XA 4CD5A 1VIZA 3PP7A 2ODOA 3QY8A 4EIVA 3W29A 1U5VA 2DJXA 3H70A 4C91A 1FDYA 2MPHA 1BG4A 2PFHA 2TPSA 3AXXA 3GXDA 1MDLA 1FWGC 2FB3A 5GNZA 4CD7A 2Z28A 3DC0A 4X0VA 1G0CA 5HWCA 4BA0A 4E8CA 2VX6A 1IE7C 1XHGA 3OIHA 1YBQA 1XIDA 3I10A 2WLYA 1CECA 2E9LA 2C1HA 2UZ5A 1W91A 5J8LA 1JVWA 3VOFA 1VIWA 3SECA 3ES7A 1OG6A 4F66A 1A5OC 3SQLA 2Y7GA 2V5CA 2A7RA 5KTLA 3QGKC 3RLVA 1UR0A 1EF2A 1H7NA 3SN0A 3O5JA 3B8SA 1SZEA 3ANUA 2ZRUA 2WMGA 4JQ1A 2R91A 2WPGA 1JNEA 4MNJA 3CIXA 4AXKA 3W1PA 4S3AA 2XH7A 2JE8A 1QAPA 1FWWA 3AS0A 4B9YA 1IGWA 3T0AA 3WG6A 1RD6A 4M6VA 1P0DA 3MMWA 3EKZA 3M1ZA 4HHPA 4A29A 3H24A 4OVXA 2ZUTA 5LIKX 2QJGA 3APGA 4GIRA 4YTTA 3JZEA 3L12A 2DZPA 2BS9A 3SBFA 3CMJA 5FF2A 2GJXA 1HGWA 3BVJA 3HQPA 2C1GA 1KGXA 1ME8A 1X7IA 3NI6A 3CMGA 4DIPA 3G1VA 1AJZA 1RD5A 2YSWA 4IM4A 4U2ZA 1W9PA 5FKYA 3S2NA 1VBUA 3WDHA 4KEVA 1XKYA 4RZ4A 3JYJA 4LYKA 4XD3A 1G67A 1D8CA 5C8BB 2QYGA 1KRCC 1C8YA 3FXGA 3LSCA 2MLZA 3FGCA 3SJNA 2XGZA 1W3JA 1DQXA 1G4PA 4DO6A 4MZ1A 1X96A 3IKDA 5E70A 3BCFA 1D7IA 3AI0A 3ARPA 2DORA 2VURA 4K38A 1SQ7A 5DN1A 3S0CA 4KEUA 2XN0A 5LYRA 3GTNA 3NQAA 5C7HA 1IT0A 4ORIA 5EMUA 3ISIX 3GTIA 2Z29A 4E4PA 2RUQA 4IJRA 3QV7A 3DFQA 2ZTJA 3I68A 1I75A 2YFNA 1HXJA 3U2OA 4NHVA 2VYOA 1RQEA 2OLHA 1E1CA 1U1JA 2R1LA 3SRHA 2Y61A 4JX5A 2VVSA 1B3OA 1XLFA 5J6EA 4RV8A 1LG1A 3RLUA 1GVOA 4PYSA 3U48A 1FRBA 2PTXA 2J8FA 4GC4A 4AIUA 4QJ4B 3VDCA 5JU6A 2X1IA 3GFZA 4DRKA 3LCHA 4KEMA 5CSYA 4FF7A 1TUFA 5A8QA 3H9RB 1JGIA 2ZXDA 2XSAA 4JD4A 4LRTA 2CZDA 3CZKA 5IFTA 1H4PA 1FHVA 1J18A 1E3XA 4F2UA 5FL0A 5DMYA 3OJGA 3UFYA 3GIQA 2YIHA 2A21A 3TK7A 2ISVA 4GI8A 4HA1A 3M64A 1ME9A 3SUWA 3ITGA 8A3HA 5EMKA 4J5NA 4LAYA 1V93A 4Q8VA 1N2VA 5HW6A 2QIWA 3ZT6A 1VEMA 1R85A 4FHAA 2OEJA 3CYJA 2O4MA 1VRXA 3MANA 1HKWA 2XN2A 2YCLA 3QW3A 3UCQA 1QBAA 1H5YA 5J5DA 2WCGA 2C6QA 2PBGA 3W7IA 4IPNB 2QJHA 1OD8A 4AHOA 5DRCA 3P67A 3PB2A 4U28A 2CESA 2FTPA 4RNJA 4ORMA 3LCXA 1WB0A 4MGGA 1ICQA 2GJLA 1OK4A 3BZJA 7TIMA 3T0DA 4Q4KA 2X42A 1EJTC 4FOKA 5CG7A 2ZBTA 4YWSA 3CHVA 4XV0A 2ACQA 3O63A 1NEYA 4ZO6A 4LWWA 2KGJA 5D30A 1ECQA 3EWBX 4ZQNA 3EXTA 5BU9A 1TTJA 1OFPA 2WHMA 2PWVA 1WCGA 1RA0A 3L65A 4JYFA 2YXXA 3NQDA 3UG8A 1XLGA 3P5ZA 4I9JA 3W70A 2XP6A 4TVDA 1VFFA 3W1MA 5FEXA 2M1IA 5BXTA 2ZZ4A 2CBUA 1W32A 2ABAA 1WX0A 4IH3A 3KZSA 1M65A 3QR3A 2OX1A 3CO4A 2ZR4A 4J1OA 1OK6A 4DRIA 2NX1A 1C9DA 5C2XA 1D7KA 1IZCA 4IG2A 1DJGA 3E5PA 4BQ2A 1BVZA 4GMEA 2Q8LA 1RPKA 1X7FA 2VRJA 3PNZA 3R0DA 4HP5A 2VC9A 3BCJA 4DXXA 4IP5A 2OPJA 3NPWA 1FKSA 1V6VA 4M1RA 3STFA 4ZQOA 1OIMA 4ACZB 5HANA 2ZQTA 2PDKA 1AMYA 2FHBA 2YL8A 3LQLA 3LPFA 2C3ZA 1B90A 3FYPA 1NM9A 4H9UA 4Z2LA 3EEZA 1QI4A 2WSKA 4UQCA 2CLHA 5IFPA 3MI3A 4IL0A 3FOKA 5U7SA 3BAXA 3H12A 5AVNA 4LNYA 1JDAA 3NURA 3N04A 4GIEA 4HHMA 6TAAA 5DFAA 2NZLA 3CV6A 5K9CA 1C7SA 1H7XA 3MC5A 1PWMA 4WY0B 1F8AB 3WMSA 1ZTVA 3NOYA 1YTDA 2XFYA 2JBMA 2XG9A 1G94A 3QOKA 4P8XA 4JTGA 4XKYA 1QPLA 3LB0A 4JFSA 1W8GA 5KMYA 4EAMA 1RQBA 3LHWA 3BG5A 3BPWA 3W2UA 1VFHA 3AHTA 4KFPA 5K4ZA 2VZUA 4DO5A 1K8YA 1G1YA 5A6LA 3WLMA 4C6OA 2BODX 5FF7A 4XIAA 4YYCA 1UKTA 4IUOA 2WJFA 1CXLA 3TN4A 3VOCA 1RVGA 3R4IA 1BF6A 4LCRA 1R7OA 3S5YA 1O95A 3IANA 4IPXA 4Y6GA 1AQHA 3QMRA 1E43A 4E4UA 4O2TA 4O18A 1A5LC 2ON3A 1AG1O 4N19A 2CZEA 2YX0A 1REQA 1RV8A 2I14A 3HPSA 3TC3A 4MJMA 1J5SA 1VLWA 7REQB 3P5YA 3AROA 3NSNA 4AWTA 4ERGA 4PSRA 3SGUA 1LRTA 2QDHA 4S2CA 3IUIA 1F3WA 3U4AA 1IEQA 4AZHA 2Q09A 3WFZA 3IRSA 3HZ3A 3GDRA 3WCZA 4IFKA 4Z42C 4TVCA 1XCFA 3KLKA 4DI9A 3E9AA 4HMNA 3URNA 3PHAA 2Q5AA 1E44A 4PZVA 2GWNA 5AVHA 3NXFA 1VHCA 3T08A 2E5DA 1Q2SA 3LHYA 4K3ZA 5FSDC 2WZHA 4TV6A 1DJYA 1RXOB 3TYCA 1FWFC 1XBXA 1ECEA 4ASTA 5FJUA 5IHRA 1DIEA 1K9TA 6CGTA 3DI1A 1VHNA 4S3DA 1GZJA 4DROA 3FEMA 3PZTA 2CNCA 4EANA 3O6CA 3ENLA 1FKLA 4JFJA 3HFYA 1XUZA 4J28A 4ES4A 4LAWA 1YDYA 3W2MA 2XP4A 2CHRA 1W3LA 4NJJA 1IIHA 2G3FA 1Q66A 1WO2A 3CS2A 3Q45A 3F4WA 2D69A 3N17A 3TFCA 1XIEA 1NOUA 4MB1A 2Z0IA 4MSPA 3GIYA 1S1PA 1W8SA 4YTUA 3AAMA 5HA7A 3MVTA 2E1DA 5CJ5A 3NO3A 4B5WA 2QUTA 4ZFMA 1W5MA 5BXSA 3SUUA 4GRSA 4HA4A 3VE9A 3PBVA 2CEQA 1UCWA 2BY0A 1KLZA 1RJPA 3TYDA 4NY2A 2E6YA 2UV8G 2VZVA 1M41A 1LL4A 1ROTA 2PP0A 4I3GA 3ABZA 1YRRA 1ZY9A 1KXHA 2WJZA 3VMNA 1FCUA 2OWXA 4U5KA 4ZB5A 4EWND 3FYYA 1JXKA 2HK0A 4PN2A 1JZ5A 1GHSA 4DUOA 1SO3A 2RHGA 3GSMA 1MQQA 4AHPA 1A3HA 1JUBA 2BSLA 1HX0A 2PDUA 3UWQA 4HU4A 4DZHA 2PWDA 5LGZA 1NY1A 3IK4A 4CCZA 3LLXA 4RDWA 4W9QA 2BY3A 2VDGA 4ICCX 3C4UA 1PZ1A 3OIXA 4NJIA 1OF8A 1FJDA 5DY2A 1R30A 2H6RA 1E6XM 1S2CA 4WX2A 4PUUA 3S1GA 3S1UA 2W0UA 2PC8A 1SO6A 1E1EA 2YLLA 3WLLA 1VKFA 1ITUA 2FZBA 2XIOA 3RLGA 1HW6A 3VGBA 2HISA 1R9HA 1Z69A 4N6FA 3KRSA 5CCZA 1QZ2A 3NQ2A 1YADA 1FWBC 1XKJA 2QXWA 3CUGA 3TXZA 3UBPC 3GKFA 1TE1A 4ADUA 3KAFA 3NYZA 3BSGA 4UQDA 2OO0A 3I4KA 1OC5A 5ABGA 2HVMA 4MKVA 4QQUA 1PIGA 2ZC1A 4LSBA 2OG9A 4KCWA 4C6LA 3E0VA 3A5FA 1V77A 3VKDA 3PSWA 1GVEA 2Z1SA 1W37A 1BYDA 3AYRA 5F2MA 2QEZA 2B7OA 4A6GA 1EZWA 4XKMA 4JIIX 5I78A 2A5HA 1W9DM 2I9EA 1YEYA 3EDEA 5A6BA 2G95A 4R33A 2YCIX 5I03A 1ADOA 3NGFA 1QNQA 4A8LA 1GG1A 3HIJA 5C7VA 1ZALA 4ZEPA 4IQLA 3DECA 3PANA 3N2OA 2XM2A 4RNFA 1A47A 4WDTA 1EGMA 2ACSA 4CD6A 4MZ8A 3WLPA 5HNUA 3SCPA 3SO7A 2QCGA 4A35A 5LNWA 3UR2A 3G18A 3OQ8A 4K7VA 1M6JA 3S1VA 3CT7A 3CYVA 5D02A 3QPEA 3ATYA 4IJBA 4E2DA 3VDHA 3OQEA 3A9IA 4E8DA 4QTGA 2B5UB 4W8BA 1BFNA 1GYMA 2Y63A 1Y5VA 3ZYZA 3AZTA 4OWGA 1L6FA 4BCEA 1ROUA 3M0ZA 4LVAA 2ZVIA 2HMCA 1KFLA 3IS4A 4H9ZA 1WKFA 2KFWA 1UIOA 1WBJA 3GFXA 4F40A 4MNLA 2WMKA 4HBEA 1TPWA 1OF6A 1F6PA 3CTTA 2TODA 1V4YA 4DO7A 4J3WA 5MHBA 3TCEA 4C02B 3ZT5A 1HJWA 5CQ1A 4BF8A 4IFRA 1LQ2A 2CETA 4CN1A 3Q37A 3SCUA 2HV5A 3A23A 3NDOA 3AIQA 4XVEA 3MV01 3BO9A 3LCLA 1GPFA 1MFVA 3M0IA 1UASA 1WXZA 3TV8A 2E9MA 3C56A 5F4WA 5CJMA 3G5EA 2CBIA 2QUMA 2P8BA 3CB3A 4RNIA 3DHUA 4XUGA 4BQ3A 3LV5A 1BXBA 2J47A 1NMWA 4PA8A 3LCWA 3MYPA 4XAFA 4Y7EA 2ICSA 3QR0A 4S3GA 4QJ3B 1EDTA 1R46A 4DJFA 4HU8A 1JZ8A 1OINA 1F6KA 2F8QA 3IIPA 3M44A 4ROPA 4G2DA 5G1TA 3VILA 1TJ1A 2RAGA 4LUTB 2FZMA 1UKSA 4UMAA 3QKEA 5D9PA 1PZ3A 3BUVA 3EKGA 4ZFCA 3AHYA 3MHUA 3BE7A 5IOBA 3TOPA 1JAEA 4B92A 1OX5A 2W9MA 1R3QA 3NQGA 3PRAA 4IPIA 2YBTA 1J6YA 1TTQA 4W5UA 3EWDA 3QC0A 3SRFA 5HR7A 3PTKA 3H6OA 2V0TA 1EPVA 1ODZA 4IIGA 1R3VA 3TLQA 3AFBA 2FLIA 3NIYA 1EX5A 3R8HA 1YX1A 2BXVA 3NZQA 4A8IA 4ODQA 2ASHA 3MP5A 3S9IA 5CZ0A 3GBEA 4Q6JA 3MVIA 4U10A 3VD3A 2P3ZA 4O1DA 2HJPA 3EZ4A 2RDUA 5DO8A 4HJFA 2C71A 3CPRA 1NP2A 4TX6A