2ESEA

Structure of the sam domain of vts1p in complex with rna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
MPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-R(*GP*GP*AP*GP*AP*GP*GP*CP*UP*CP*UP*GP*GP*CP*AP*GP*CP*UP*
publication title Shape-specific recognition in the structure of the Vts1p SAM domain with RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein/rna complex
total genus 27
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2eseA00
2YTUA 3TADA 1X40A 2KMDA 4NL9C 1JI7A 2KG5A 1LKYA 1F0MA 1V85A 2LMRA 1COKA 1Z1VA 2Y9UA 3TACB 4NJ8A 4IS7A 1UQVA 1WWUA 2K60A 2F3NA 2B6GA 1SGGA 2KSOA 1B0XA 2QARA 1SXEA 2LPEA 2KIVA 2QKQA 1SV0A 2QB0A 1V38A 2L5YA 2Y9TA 3SENA 2DKXA 3HILA 3BQ7A 5J8YC 1PK1A 4MHVA 1LKYB 3H8MA 5KNIA 3KKAA 2EAMA 2K4PA 3IDWA 2E8MA 3SEIA 4PZNA 2DKZA 4NL9A 5F3XB 2ESEA 3K1RB 2F8KA 2KSOB 5L1MA 2JV3A 2QARB 4RQMA 1SV4A 5JU5A 2EAPA 1UCVA 1X9XA 2QB0B 2F44A 1PK1B 3TADC 1X66A 3BS5A 2E8NA 2E8OA 5J8YA 1KW4A 2ES6A 1DXSA 2E8PA 1B4FA 1OW5A 2FE9A 2D8CA 1WWVA 2D3DA 2KE7A 2EAOA 2DL0A 1SV0C 2EANA 2QB1A 2GLEA 4RQNA 1OXJA 1RG6A 5JRTA 4PZOA 3BS7A 3KKAC 3BS5B 1PK3A 5JTIA 1SXDA
chains in the Genus database with same CATH superfamily
2EZZA 4C4TA 4IR9A 1QSYA 4QWEA 3Q8RB 3GFKB 1CRXA 1QSLA 4WJ3B 4JWMA 3N7PD 5KTQA 1RYUA 3LWLA 1ZQEA 4OD0A 2W7PA 4R8UB 3K75D 1NNLA 5DDMA 4BXOB 2CN1A 5ALOA 2G06A 1PUZA 1SXEA 5IIJA 2W8LA 3ISBA 4QJFB 3RAQA 1S77D 4JK1A 9ICSA 4Q45A 4EBCA 1PK1A 3PO5A 5AM4A 4DSLA 1BNOA 1Q3VA 4QIWF 3CW2C 4PH5A 4U6PA 3RBEA 3M1YA 3GIJA 5KFHA 1SZHA 4ELVA 1A6SA 4QW9A 3EWAA 5ALWA 2FDRA 4F71A 1VDVA 4O5KA 1SIJA 2JH1A 3F5EA 5AK5A 2Q0ZX 2ZIXB 1RM6C 3KBBA 3PW4A 4E0DA 1TV9A 2JGAA 5ALDA 5DKWA 2HHQA 4M47A 1QQ7A 4OJPA 8ICPA 5CP2A 4PL2A 1WWVA 2NRTA 2V4QA 2MU2A 3KOOA 4UB2A 9ICQA 2ZTDA 3BZCA 5KT5A 4I2CA 4P4OA 4Y2RA 2ZIUB 5AKEA 5IIMA 3BS5B 3QU9A 3HT3A 5JUMA 3KHLA 3H4DA 4UB5A 4FZLA 2KKVA 4O3PA 4U7CA 2J6UA 2DWQA 4QZ9A 5ALYA 2FMPA 3RFAA 1SL2A 2Y9UA 3WK4A 1A0PA 3SAFA 1TK0A 1KSPA 3Q8QB 2R8HA 4I27A 4B9NA 3PX6A 2WTFA 1YZ6A 4YR3A 4I2HA 5ALEA 4CF4A 2NO4A 2MUTB 1KKXA 3C1YA 4Y2QA 1U49A 2KFZA 5KFQA 4I2IA 2C2DA 2ZTCA 4M9LA 4XA5A 2DKXA 4DLEA 3BQ7A 2F1JA 1IG6A 3PNCA 2OCEA 3HKZC 4EX6A 1ZQCA 4DLGA 3NVYA 5J0UA 2ATLA 3JPQA 4UB8U 3N4MB 1XO0A 5L1KA 4UASA 2KEYA 2B21A 3SQIA 8ICIA 1XSPA 1SWVA 4B9TA 1WG8A 1SKWA 2CRXA 4NLZA 2G0AA 5ALGA 1SKSA 1HJPA 1B22A 3OGUA 1S9FA 3IP4B 5DG9A 2KHQA 4UAUA 5L1IA 1ZETA 2KTQA 1L7OA 9ICJA 3QUCA 2DL0A 2HOQA 2KVCA 1KFTA 5ALQA 3RH4A 5AKGA 1X9WA 9ICEA 1QCKA 4ECVA 2ZIVA 1OXJA 4UW9A 5JRTA 4BWMA 1SXDA 2XI9A 1PVPA 1RYRA 5C5JA 2XY7A 4M6WA 1LKYA 2UVVA 4I29A 5KG2A 4FS1A 3D2QA 1NZBA 3UMBA 1JALA 5ALPA 2K60A 2B6GA 3QXGA 5AKKA 5HHIA 3MR3A 1NKEA 4OO1J 4RT2A 4EYHB 4J9QA 3V7LA 1C20A 1XO1A 5ALXA 3WK8A 5CB1A 2HOFA 5J0WA 3KKAA 5ALJA 4P0QA 3IN5A 3PVXA 3QNMA 4LZGA 5CRXA 3T79A 3LVWA 4NV0A 2F1IA 4QWCA 2VA2A 4O3RA 3ZI4A 3C2MA 2KSOB 2BCSA 1SZPA 2P66A 2DPIA 8ICXA 5KFVA 3H8JA 4YVZA 3H0RB 1O03A 4QWAA 1L7PA 2G5HB 1GO3F 1K5OA 5EE0A 5EE9A 2FPLA 3NS1A 3M8SA 3H8SA 4CF5A 5KFFA 5DB6A 1DGSA 7ICPA 5KG5A 2OWOA 5AM0A 2JEGA 2RP5A 4AYBF 3CNHA 2D8CA 4PHEA 2D6FC 2D3DA 4F4ZA 2G08A 3HW8A 1NK8A 1ZQRA 5KFZA 4GLXA 3THVA 4R65A 9ICOA 4DOCA 1DRGA 2IBKA 4MFFA 4ED3A 2JH7A 3QZ8A 2P6UA 2K4HA 2F2AB 4F4XA 2JHDA 2ZIVB 3TFRA 3BZKA 1JXEA 5E79U 1T7PA 2GO7A 1FFUA 3EZ5A 2YTUA 4J9KA 2NRWA 5AI9A 5KAFU 2O6KA 4YMOA 4R66A 5ALRA 3PX4A 3TFSA 3TACB 3PSTA 8ICVA 3D2NA 4ED0A 3ISCA 5KT6A 4C8LA 2MA1A 2GOLA 4RNMA 3E58A 2XGQA 3EYZA 4ED6A 1Q3UA 2KIVA 2VANA 1QQ5A 4AYBC 1BPXA 2RQ5A 1ZQDA 2BDPA 4Y2UA 1DK2A 4EYIB 1UA1A 3PR5B 2G5IB 2H3ZA 3SZ2A 3HP6A 4OJOA 3GV7B 1SL0A 3UQ2A 3UPQA 3K4GA 4I2AA 4ICAA 3GV5B 2HBLA 1ECWA 4RQMA 1Y88A 1WYGA 5EWFA 1L3UA 1Z19A 4DL2A 3KZIU 4DWIA 2M9NA 4GC7A 3AQEA 4UB4A 4IQWA 2PMZC 4KLIA 1L8OA 1XWLA 5KFAA 5KT3A 7ICQA 3F2CA 2XGPA 4PHPA 4CNQA 4GXJA 5IILA 1RYSA 5KFWA 4QZHA 3T5HA 3FC4A 5J0YA 1ZQWA 3RJGA 2FI1A 3QE9Y 5AKHA 1ZQNA 1P7DA 4I2GA 4ECSA 3DEEA 3PR4A 2A19A 3ZDBA 3WK5A 4UB3A 2CPRA 3BS7A 2Y1IA 8ICRA 2BZFA 2DQNB 4YQWA 2I1QA 1K1SA 2HHVA 4TUSA 5J2DA 2K4IA 2FLPA 2XIDA 1N56A 3RB0A 2OH2A 2LM4A 4A8EA 4OJLA 4DEZA 2HI0A 4Q43A 2PFNA 3D6JA 1JRPA 1UT5A 5DGAA 5J0QA 2ISOA 1S5LU 3GQCA 1N2XA 4EZ9A 2KFNA 3I76A 7ICHA 3PSPA 4C8MA 1N60A 3LDAA 1JN3A 2K8AA 3HILA 3RH5A 4RT3A 3V6HA 3LVVA 5D4BA 4Y2XA 2NV3A 4I2FA 5AI4A 8ICKA 2IA6A 3PZPA 1ZQVA 2ZXIA 2C28A 3OPXA 5F3XB 4M9JA 2WF8A 4HYKA 4DSEA 3H8WA 3AUOA 3MGVA 2AXTU 2EH9A 4UBCA 3C2KA 2QARB 4KTQA 4UARA 4ECTA 1MSWD 1Z00B 1UCVA 4DOAA 5KFXA 2F44A 4Q44A 2BQUA 5D49A 9ICVA 1HIWA 2OEHA 3PW0A 3QU4A 4RQ3A 4US9A 3Q8LA 2VIXA 3QU5A 1QH9A 1FIQA 5ALHA 4NWIA 3VCBA 2AGQA 1MN8A 2W9MA 1ZQJA 1OW5A 2P6RA 4QZBA 4C0ZA 2VJ5A 1L3SA 4OJ6A 2JZBB 3TANA 5G5GA 3BQ1A 8ICUA 5DGBA 4CCHA 3F53A 4F5NA 5KG4A 4UAVA 5DG8A 1S76D 4GC6A 3SYZA 5IINA 1S0OA 3ALRA 4P0PA 3EUB2 5CHGA 4F91B 2A3VA 8ICMA 1H38A 2JEJA 2BDUA 1ZQMA 7ICMA 3KD3A 2HHUA 3MR2A 3TI0A 2C2RA 3PSFA 4MFCA 1WUDA 4K4HA 2HW3A 3AMZA 3QU2A 1TAQA 4Q8FA 4PHDA 3AL0B 1V97A 4KLFA 2P35A 4YMNA 7ICUA 3M9MB 4J9OA 4F4YA 4TQRA 1UT8A 3FM9A 2FLLA 7ICVA 3B0XA 3MFIA 3AM9A 4O3OA 1SV0A 3KZXA 3OSNA 3TAPA 7ICGA 8ICYA 5CA7A 5J2HA 4O3NA 4Z6FA 5DQGA 3LWMA 5AK3A 1XSNA 5KFDA 5HNKA 3GU3A 4Y2VA 2A1AA 2HVIA 7ICOA 5KFJA 2ZXHA 4DFKA 2KKPA 2LM1A 5EE1A 2QB0B 4M9GA 5DDYA 3ZD9A 5BPCA 2V4RA 5ALNA 3NTUA 3NVVA 1WCNA 3B0YA 4NY8A 3Q8SB 2VKQA 4BX9C 8ICTA 3ISDA 2F8LA 5KT2A 4J9PA 1U48A 4DQRA 3F2DA 3TQ1A 1YZ7A 2KE7A 3QX7A 2EAOA 1ZQBA 4Y2YA 5DBAA 4GXKA 3IG8A 1QLNA 2JRZA 2J6TA 4RPYA 4DS4A 4JUZA 4GIBA 2ZJ5A 4Q8EA 4FS2A 5FP0A 4B6JA 1L3VA 4IQVA 2FPKA 3TADA 2KMDA 3NASA 3PW2A 2LHTA 5KG0A 5HMLA 4DOBA 4RUCA 3Q8KA 3RTVA 2BGWA 5AIAA 2DBYA 2HMXA 5DLFA 3RBDA 2W55A 4QZGA 2JMGA 4KLDA 4P4MA 5J2IA 4QZFA 1ZQGA 1COOA 5DBCA 1NOMA 4JV0A 1Z1BA 4QIWC 5AIBA 5AKIA 4O3SA 3SENA 1RXWA 2XY6A 2AU0A 2KJ9A 1HEKA 3HRDD 2J6SA 3I1YA 3GIKA 3T5KA 1N5XA 2ESEA 2GWSA 4MF8A 4KLJA 3VC8A 2HHXA 2KJ8A 3G6VA 2YMMA 5KG7A 2Y1JA 1NK4A 4P2HA 1C7YA 2YQEA 1NJXA 1JX4A 2IHMA 4GXIA 5H2FU 1SB3C 4IRDA 1PK1B 2FPMA 1ZXIA 4RQ6A 3SI8A 3RB4A 4IR1A 1RZTA 1ZQFA 5KG1A 2FJ6A 2E8OA 5J8YA 1KW4A 3N7RC 5KFPA 1PVRA 3TAQA 2F1HA 3NUQA 2BCUA 4FE3A 1XU4A 1X42A 1JMSA 1BGXT 4RZRA 3J81j 1BPBA 1NZPA 3CP8A 4I2EA 2C22A 2YMLA 1NJZA 1WCLA 1L5UA 4RU9A 2PFOA 4YXJA 2W9BA 3KFUF 2ZUBA 4KMUA 1L7NA 1VLBA 5KAIU 3AN1A 1ED1A 3MR6A 2PI5A 3QZ7A 2EZYA 2LBOA 1ZQKA 1COKA 4DSIA 1JROA 2VA8A 5AKZA 5EOZA 3OHBA 4K4GA 3WKEA 8ICGA 3EPIA 1T94A 4ED8A 3UM9A 3HWTA 1U47A 3ORYA 3N97B 1X2IA 5KFGA 5KFLA 3HPOA 4TQSA 2XVTA 5CJ7A 4KMOB 3RB3A 2H5XA 2DPJA 3C28A 4US8A 4MHVA 3H8MA 3T5JA 2W03A 3MC1A 9ICNA 3RR8A 4JV1A 1KDHA 1M6YA 3ZDEA 2BPFA 4NL9A 2LYHA 7ICJA 1ZQQA 1TE2A 4CRXA 4YG2A 1MC8A 5JU5A 1ZD4A 4GFJA 2EAPA 3Q8PB 3RB6A 3ETLA 5J0SA 3JPSA 1F5SA 2W43A 4M04A 4KITB 3Q8MA 2ZJ8A 9ICIA 3OHAA 2YMPA 2HBJA 3UXPA 2NRXA 5ALLA 2W11A 4ECWA 4XRHA 5J29A 4F4KA 1UPHA 4HAIA 1NK0A 3RRGA 2RHFA 3PV8A 2FLNA 2AGPA 1KRPA 1XNSA 2KICA 9ICMA 4F5QA 3SV4A 2A1JA 2OXOA 2E1EA 2KIWA 1RQLA 3F5AA 4PZOA 1X9MA 3GIIA 4I28A 1TKDA 4DSKA 3A0BU 2MAXA 1NJYA 1HUOA 2R8IA 1TK8A 1QQ6A 2NYVA 3L4PA 4QZEA 5J0RA 3M7DA 4ECRA 1U9LA 1K1QA 4J9LA 4DL5A 4QWBA 3BDPA 1V9PA 3ZD8A 2WFAA 1UQVA 2Y0SF 2HSZA 4ECUA 3TKAA 4M9HA 1CI4A 4NM2A 1S8OA 4EBEA 1SWWA 2LPEA 8ICHA 1D9DA 4RQ7A 2I6XA 3RJFA 4C4RA 4M6WB 1LKYB 3QUBA 3IDWA 2KZZA 3BQTA 1FEZA 2E8MA 2YMQA 3MABA 4NLCA 2BHNA 3B9JA 2AH5A 1SL1A 3O0FA 3SR6A 1KFSA 4K4IA 5B5EU 8ICOA 2HVHA 4G9BA 5AI0A 1T3NA 2W9CA 5J2EA 4J9SA 1BPEA 2ZIWA 4RNNA 2HOIA 9ICPA 4P0QB 1T4GA 4F72A 2E8NA 3IRUA 3RF9A 5EWEA 3M8RA 3M6KA 1ZQ1C 1ZQYA 5L1LA 4NLNA 7ICIA 2E8PA 2Y0SC 1BVSA 2NO5A 3R9KA 8ICBA 1ZQZA 3NVZA 4F93B 3UXOA 2FMQA 2IOFK 5DB9A 4I2DA 4YD1A 4C80A 4C7ZA 4B9SA 3RAXA 2VJ4A 4PGQA 1X6JA 5F9LA 2QLTA 1NKCA 5DB8A 3KKAC 2M0NA 2DUYA 2ZUDA 2IHNA 2N1RA 3V72A 3AU2A 1NKBA 2KV2A 4CE6A 1MQ3A 1S0NA 4EELA 5ALIA 5AKLA 9ICCA 3AEVA 7ICSA 9ICHA 1JXLA 4NJ8A 4FO6A 1Q8KA 5AKJA 4IQTA 3WKAA 3QEAZ 1N5WA 1TAMA 3UQ0A 2F3NA 1RDFA 1B0XA 4DCCA 9ICWA 4B9LA 5DBBA 4EENA 1AROP 3WKDA 2KZMA 1J2NA 2IMWP 2CXYA 1URJA 1Z3EB 3SAGA 3GV8B 1ZQTA 1ZQOA 5AICA 1ZQAA 3OTQA 5CR0A 2XC9A 2W8KA 1ZRMA 5HHHA 1RPLA 3MGIA 1CEZA 4DF8A 3G6YA 1NK9A 5AK4A 3UMCA 1BPDA 2NRZA 1KTQA 3LYSA 1IV8A 2DGZA 1X9XA 1VJ5A 4ACOA 2MSNA 4F3OA 2JR5A 2XCAA 2ZJAA 5J2AA 4XQ8A 5F9NA 5IIIA 5HP4A 3JPOA 4C8NA 1RXVA 4YR2A 1CUKA 2BQRA 5L1JA 2Q4TA 1TAUA 5KG3A 8ICQA 2DF4B 1ZD3A 2XCPA 4IC9A 2XICA 2H3FA 9ICLA 4UATA 5J0TA 4KLLA 1N62A 1L8LA 1RQNA 5KT4A 3CRXA 1TVAA 5JTIA 3AU6A 1NK7A 5IIOA 4EBDA 3ZDCA 4IS7A 2XO7A 5ALSA 4DL7A 1WWUA 4F92B 4MFAA 3OJUA 4NM1A 9ICFA 3HJEA 2WF9A 5KG6A 1KLNA 1L7MA 3WU2U 1D8BA 1J2MA 2R8GA 4JMUA 4KLMA 9ICGA 5J2JA 4ECYA 3V6KA 4CF3A 1KEJA 5HMMA 1L6NA 3H7IA 3FYHA 1O08A 4F5OA 2LYAA 2ZIXA 2V9WA 5KFNA 2DKZA 4KN4A 1S0MA 4LJXA 4DFMA 4NLKA 4O3QA 3K1RB 2E5SA 5KFRA 1S0VA 4RQ4A 2KP7A 2RRDA 2KNJA 1SKRA 3WKCA 2BR0A 7ICLA 7ICFA 3C2LA 4YP3A 2ZIUA 4DSJA 5HR6A 3QU7A 4X5VA 3BS5A 2WB1F 4F5RA 4UAZA 4BWJA 2ES6A 1DXSA 5BOLA 1ZQHA 4PPXA 4FZNA 2FE9A 3KHRA 4DL3A 1F44A 8ICZA 3E2EA 3T3FA 1NJWA 3L5KA 5AKXA 4F2RA 3C21A 2GLEA 4DF4A 3JPNA 1AQ6A 1BNPA 2MUTA 5L9XA 1DK3A 4NLGA 1PK3A 3PSIA 2I9GA 4F2SA 1JUDA 4TUQA 1X40A 3EPGA 5KFEA 5GTIU 1ZJMA 4FBTA 5EE3A 1F0MA 5KFMA 4YD2A 4F4WA 1MQ2A 3PMNA 3V7JA 3U26A 2YX8A 2H3IA 1UA0A 1KQQA 4YFKA 2C2EA 5BOMA 4KLUA 4C8KA 5AI8A 2OYYA 2NRVA 4KLHA 4P0PB 2WF6A 2HBMA 1Z4NA 5GTHU 3T5LA 4AP9A 3N7SC 4PGXA 3H40A 2WB1C 3PW5A 4RQ0A 5TISU 4NXZA 3F2BA 1ZQLA 4UAWA 2F76X 2BPCA 2UVRA 5KFCA 2K4PA 3IHQB 1S10A 4PZNA 4Y2PA 4B9UA 4F5PA 1IM4A 4I2JA 3FDSA 3OJSA 4BJQA 2LYBA 4Y2SA 2JV3A 3H0LB 4UAYA 1IIPA 3WK7A 5ALMA 3RRHA 4C7YA 3HKZF 2WHEA 4YN4A 3E0FA 3UMGA 2RLTA 5A0LA 1X66A 3KTQA 3PX0A 1XSLA 4QZDA 4FFDA 4YXMA 1B4FA 3EW9A 1ZRNA 2EZXA 3KHHA 4JV2A 5J0PA 4FBUA 1NK5A 5HR7A 3MGHA 4EZ6A 4DO9A 4MF2A 1SV0C 5ALTA 4DQQA 2WF7A 4O3MA 2ZUCA 5T14A 2OM6A 2EDUA 5ALUA 1ZJNA 3MFHA 2AQ0A 2ASLA 5DLGA 1IXRA 5IIKA 1V85A 1X6IA 2HBKA 2LMRA 1Z1VA 1ZYQA 2AGOA 2K8BB 2RDJA 8ICCA 1SGGA 2KSOA 4ED7A 2W7OA 3ZDDA 2QKQA 1HUZA 3QYPA 1NI3A 8ICAA 2G07A 4QZ8A 5J0XA 4O9MA 5ALKA 3WK9A 9ICTA 2KJ5A 5KFBA 2BCQA 4J9MA 3C1ZA 1J97A 1TK5A 4CDGA 1UHUA 4J9NA 1ZOLA 1ZD5A 3AQFA 4IRCA 5J2FA 4PJ0U 2ISPA 3SV3A 3GZFA 3TADC 1XS9D 3C5GA 3GILA 4RQ8A 5AI5A 2HDOA 4C8OA 8ICWA 5KL1B 4KLSA 4BDPA 2HHWA 3RJHA 4DQSA 2AQ4A 1NK6A 4ELUA 3JPPA 5AM1A 1U45A 2K89A 2ZG6A 2AHOB 2K8CB 3QEBZ 1KBUA 2PXIA 4LVSA 1QSSA 5KFIA 9ICBA 5KFTA 2QB1A 8ICJA 1D8YA 3BJYA 2YB1A 5DQIA 2W3SA 1A76A 5B66U 2JEFA 4ZOHC 5AKYA 4RPXA 3C23A 5ALFA 2KN7A 4M2YA 4M9NA 3DDHA 4G3IA 1LB2B 4QZAA 4KLGA 7ICNA 2PI4A 1A77A 3TARA 2R8KA 4YR0A 3WKBA 2W9AA 2IOFA 9ICUA 1PVQA 3M9NB 4XUSA 2UVUA 2K4EA 2W9BB 2IOHA 4UB6U 2KZ3A 2PKEA 4JB3A 3HX0A 5KFYA 5AM5A 2L5YA 5CWRA 4TUPA 3BQ0A 5J8YC 1N48A 1U4BA 5DG7A 2EAMA 5AK6A 3KHGA 5K4LA 4DFPA 4ECXA 5CEHA 1TFRA 4Z6DA 1PZNA 2F8KA 2AJQA 4IL6U 4EX7A 3ICXA 2E3TA 3SD7A 3H4BA 4DL4A 5J0OA 3QUQA 5J2CA 1ZQSA 1SV4A 3ED5A 2E1FA 4ECZA 8ICFA 2PFQA 1N61A 5G5HA 4DFDA 4UQGA 4UB1A 2F77X 1DGJA 4IRKA 4FZMA 4RQ5A 5KFSA 4Z6EA 2HHSA 2KOBA 5AHXA 5KFUA 4F8RA 2YY6A 9ICRA 4LZDA 4JWNA 1ZQPA 4QNLA 1BPZA 4IQUA 4ELTA 2VA3A 4TURA 4O5EA 1T3QA 4M0AA 5KFOA 3NGDA 4EEKA 3RH6A 3WK6A 4MEXA 2PMZF 2EANA 4RQ1A 4KLEA 4RUAA 4R64A 3ZDAA 1RG6A 3V6JA 3CYMA 2YN4A 3RJJA 1MA7A 5D46A 3SMVA 2ODGA 4NL9C 2KG5A 2H3VA 4KN7A 3JPTA 1YT3A 4R63A 4KLOA 3PY8A 4PGYA 4O5CA 3RJKA 2BPGA 5KL8B 2MRLA 1JIHA 1QTMA 1Z4OA 2QARA 2A1JB 3MDAA 1Q46A 9ICKA 5DB7A 1Z00A 2WAQF 1DOQA 3ETRA 4OCZA 2Y9TA 1ZQIA 5KFKA 3SAHA 7ICTA 4I2BA 2DFLA 4B9MA 1FFVA 5KNIA 1D9FA 2FMSA 2R18A 3NRZA 4KLTA 3S6JA 3SEIA 5J2KA 3H0MB 1D8LA 1BPYA 4RPZA 3V7KA 3ONNA 3I28A 2GH1A 5J2BA 5L1MA 2JZBA 4ED2A 9ICAA 4BGDA 5J2GA 2LI6A 3G6XA 3RJIA 4O0IA 1FO4A 4OJ5A 3LK9A 4KX5A 4YMMA 7ICEA 1ZQUA 1EXNA 1T8EA 4QW8A 1KL9A 2HCFA 3D2SA 4UBBA 2ASJA 4QZCA 3PW7A 4EEYA 2LKYA 2WAQC 2ASDA 3C5FA 4RNOA 2W3RA 3RR7A 2W9CB 2PFPA 4DS5A 3PMLA 2W04A 3QUTA 2ZIWB 2ALZA 5C0YA 4DSFA 4USAA 3IG5A 2BCRA 2JEIA 3UXNA 4RQ2A 2UVWA 2RDIA 4KLQA 3GIMA 4ED1A 2XY5A 3IV6A 1JI7A 4J03A 4PHAA 1ZD2P 8ICNA 4Y2JA 1ZQXA 3GDXA 3IM1A 3BQ2A 4DFJA 3OSPA 1XC9A 3DV9A 2BCVA 4Z6CA 3NRWA 2BKEA 4F50A 4QWDA 4R8UA 2H3QA 8ICSA 4NLBA 4BXOA 2HHTA 9ICXA 5DQHA 3MBYA 1X9SA 5EWGA 3FAHA 2QB0A 1V38A 5AM2A 8ICLA 2B0CA 4KX3A 8ICEA 4J9RA 2KK0A 4ECQA 2KVSA 5ALVA 2ZTEA 2BQ3A 1N63A 1LVHA 3NVWA 3K1ZA 3MDCA 3PO4A 3M9OB 2R8JA 7ICRA 1B43A 7ICKA 4Y2TA 3A0HU 4P4PA 2JXJA 4DQPA 4CGZA 2WF5A 3C29A 3MR5A 4C4SA 2KD1A 4BUGA 4ZH4A 5TZVA 3M6ZA 4DL6A 3N28A 1S97A 1OUQA 3RJEA 2I5HA 4B9VA 5KT7A 2KHVA 2W54A 5ALZA 4QZIA 4MEYA 2EQYA 4DQIA 5AI6A 2OHFA 1KN5A 2Z7JA 3L3FX 4RQNA 3JPRA 1L3TA 2YB4A 1KFDA 4YCXA 2G09A 4PL1A 1LV5A 5AM3A
chains in the Genus database with same CATH topology
2YTUA 3TADA 1X40A 2KMDA 4NL9C 1JI7A 2KG5A 1LKYA 1F0MA 1V85A 2LMRA 1COKA 1Z1VA 2Y9UA 3TACB 4NJ8A 4IS7A 1UQVA 1WWUA 2K60A 2F3NA 2B6GA 1SGGA 2KSOA 1B0XA 2QARA 1SXEA 2LPEA 2KIVA 2QKQA 1SV0A 2QB0A 1V38A 2L5YA 2Y9TA 3SENA 2DKXA 3HILA 3BQ7A 5J8YC 1PK1A 4MHVA 1LKYB 3H8MA 5KNIA 3KKAA 2EAMA 2K4PA 3IDWA 2E8MA 3SEIA 4PZNA 2DKZA 4NL9A 5F3XB 2ESEA 3K1RB 2F8KA 2KSOB 5L1MA 2JV3A 2QARB 4RQMA 1SV4A 5JU5A 2EAPA 1UCVA 1X9XA 2QB0B 2F44A 1PK1B 3TADC 1X66A 3BS5A 2E8NA 2E8OA 5J8YA 1KW4A 2ES6A 1DXSA 2E8PA 1B4FA 1OW5A 2FE9A 2D8CA 1WWVA 2D3DA 2KE7A 2EAOA 2DL0A 1SV0C 2EANA 2QB1A 2GLEA 4RQNA 1OXJA 1RG6A 5JRTA 4PZOA 3BS7A 3KKAC 3BS5B 1PK3A 5JTIA 1SXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTU A;  3TAD A;  1X40 A;  2KMD A;  4NL9 C;  1JI7 A;  2KG5 A;  1LKY A;  1F0M A;  1V85 A;  2LMR A;  1COK A;  1Z1V A;  2Y9U A;  3TAC B;  4NJ8 A;  4IS7 A;  1UQV A;  1WWU A;  2K60 A;  2F3N A;  2B6G A;  1SGG A;  2KSO A;  1B0X A;  2QAR A;  1SXE A;  2LPE A;  2KIV A;  2QKQ A;  1SV0 A;  2QB0 A;  1V38 A;  2L5Y A;  2Y9T A;  3SEN A;  2DKX A;  3HIL A;  3BQ7 A;  5J8Y C;  1PK1 A;  4MHV A;  1LKY B;  3H8M A;  5KNI A;  3KKA A;  2EAM A;  2K4P A;  3IDW A;  2E8M A;  3SEI A;  4PZN A;  2DKZ A;  4NL9 A;  5F3X B;  2ESE A;  3K1R B;  2F8K A;  2KSO B;  5L1M A;  2JV3 A;  2QAR B;  4RQM A;  1SV4 A;  5JU5 A;  2EAP A;  1UCV A;  1X9X A;  2QB0 B;  2F44 A;  1PK1 B;  3TAD C;  1X66 A;  3BS5 A;  2E8N A;  2E8O A;  5J8Y A;  1KW4 A;  2ES6 A;  1DXS A;  2E8P A;  1B4F A;  1OW5 A;  2FE9 A;  2D8C A;  1WWV A;  2D3D A;  2KE7 A;  2EAO A;  2DL0 A;  1SV0 C;  2EAN A;  2QB1 A;  2GLE A;  4RQN A;  1OXJ A;  1RG6 A;  5JRT A;  4PZO A;  3BS7 A;  3KKA C;  3BS5 B;  1PK3 A;  5JTI A;  1SXD A; 
#chains in the Genus database with same CATH topology
 2EZZ A;  4C4T A;  4IR9 A;  1QSY A;  4QWE A;  3Q8R B;  3GFK B;  1CRX A;  1QSL A;  4WJ3 B;  4JWM A;  3N7P D;  5KTQ A;  1RYU A;  3LWL A;  1ZQE A;  4OD0 A;  2W7P A;  4R8U B;  3K75 D;  1NNL A;  5DDM A;  4BXO B;  2CN1 A;  5ALO A;  2G06 A;  1PUZ A;  1SXE A;  5IIJ A;  2W8L A;  3ISB A;  4QJF B;  3RAQ A;  1S77 D;  4JK1 A;  9ICS A;  4Q45 A;  4EBC A;  1PK1 A;  3PO5 A;  5AM4 A;  4DSL A;  1BNO A;  1Q3V A;  4QIW F;  3CW2 C;  4PH5 A;  4U6P A;  3RBE A;  3M1Y A;  3GIJ A;  5KFH A;  1SZH A;  4ELV A;  1A6S A;  4QW9 A;  3EWA A;  5ALW A;  2FDR A;  4F71 A;  1VDV A;  4O5K A;  1SIJ A;  2JH1 A;  3F5E A;  5AK5 A;  2Q0Z X;  2ZIX B;  1RM6 C;  3KBB A;  3PW4 A;  4E0D A;  1TV9 A;  2JGA A;  5ALD A;  5DKW A;  2HHQ A;  4M47 A;  1QQ7 A;  4OJP A;  8ICP A;  5CP2 A;  4PL2 A;  1WWV A;  2NRT A;  2V4Q A;  2MU2 A;  3KOO A;  4UB2 A;  9ICQ A;  2ZTD A;  3BZC A;  5KT5 A;  4I2C A;  4P4O A;  4Y2R A;  2ZIU B;  5AKE A;  5IIM A;  3BS5 B;  3QU9 A;  3HT3 A;  5JUM A;  3KHL A;  3H4D A;  4UB5 A;  4FZL A;  2KKV A;  4O3P A;  4U7C A;  2J6U A;  2DWQ A;  4QZ9 A;  5ALY A;  2FMP A;  3RFA A;  1SL2 A;  2Y9U A;  3WK4 A;  1A0P A;  3SAF A;  1TK0 A;  1KSP A;  3Q8Q B;  2R8H A;  4I27 A;  4B9N A;  3PX6 A;  2WTF A;  1YZ6 A;  4YR3 A;  4I2H A;  5ALE A;  4CF4 A;  2NO4 A;  2MUT B;  1KKX A;  3C1Y A;  4Y2Q A;  1U49 A;  2KFZ A;  5KFQ A;  4I2I A;  2C2D A;  2ZTC A;  4M9L A;  4XA5 A;  2DKX A;  4DLE A;  3BQ7 A;  2F1J A;  1IG6 A;  3PNC A;  2OCE A;  3HKZ C;  4EX6 A;  1ZQC A;  4DLG A;  3NVY A;  5J0U A;  2ATL A;  3JPQ A;  4UB8 U;  3N4M B;  1XO0 A;  5L1K A;  4UAS A;  2KEY A;  2B21 A;  3SQI A;  8ICI A;  1XSP A;  1SWV A;  4B9T A;  1WG8 A;  1SKW A;  2CRX A;  4NLZ A;  2G0A A;  5ALG A;  1SKS A;  1HJP A;  1B22 A;  3OGU A;  1S9F A;  3IP4 B;  5DG9 A;  2KHQ A;  4UAU A;  5L1I A;  1ZET A;  2KTQ A;  1L7O A;  9ICJ A;  3QUC A;  2DL0 A;  2HOQ A;  2KVC A;  1KFT A;  5ALQ A;  3RH4 A;  5AKG A;  1X9W A;  9ICE A;  1QCK A;  4ECV A;  2ZIV A;  1OXJ A;  4UW9 A;  5JRT A;  4BWM A;  1SXD A;  2XI9 A;  1PVP A;  1RYR A;  5C5J A;  2XY7 A;  4M6W A;  1LKY A;  2UVV A;  4I29 A;  5KG2 A;  4FS1 A;  3D2Q A;  1NZB A;  3UMB A;  1JAL A;  5ALP A;  2K60 A;  2B6G A;  3QXG A;  5AKK A;  5HHI A;  3MR3 A;  1NKE A;  4OO1 J;  4RT2 A;  4EYH B;  4J9Q A;  3V7L A;  1C20 A;  1XO1 A;  5ALX A;  3WK8 A;  5CB1 A;  2HOF A;  5J0W A;  3KKA A;  5ALJ A;  4P0Q A;  3IN5 A;  3PVX A;  3QNM A;  4LZG A;  5CRX A;  3T79 A;  3LVW A;  4NV0 A;  2F1I A;  4QWC A;  2VA2 A;  4O3R A;  3ZI4 A;  3C2M A;  2KSO B;  2BCS A;  1SZP A;  2P66 A;  2DPI A;  8ICX A;  5KFV A;  3H8J A;  4YVZ A;  3H0R B;  1O03 A;  4QWA A;  1L7P A;  2G5H B;  1GO3 F;  1K5O A;  5EE0 A;  5EE9 A;  2FPL A;  3NS1 A;  3M8S A;  3H8S A;  4CF5 A;  5KFF A;  5DB6 A;  1DGS A;  7ICP A;  5KG5 A;  2OWO A;  5AM0 A;  2JEG A;  2RP5 A;  4AYB F;  3CNH A;  2D8C A;  4PHE A;  2D6F C;  2D3D A;  4F4Z A;  2G08 A;  3HW8 A;  1NK8 A;  1ZQR A;  5KFZ A;  4GLX A;  3THV A;  4R65 A;  9ICO A;  4DOC A;  1DRG A;  2IBK A;  4MFF A;  4ED3 A;  2JH7 A;  3QZ8 A;  2P6U A;  2K4H A;  2F2A B;  4F4X A;  2JHD A;  2ZIV B;  3TFR A;  3BZK A;  1JXE A;  5E79 U;  1T7P A;  2GO7 A;  1FFU A;  3EZ5 A;  2YTU A;  4J9K A;  2NRW A;  5AI9 A;  5KAF U;  2O6K A;  4YMO A;  4R66 A;  5ALR A;  3PX4 A;  3TFS A;  3TAC B;  3PST A;  8ICV A;  3D2N A;  4ED0 A;  3ISC A;  5KT6 A;  4C8L A;  2MA1 A;  2GOL A;  4RNM A;  3E58 A;  2XGQ A;  3EYZ A;  4ED6 A;  1Q3U A;  2KIV A;  2VAN A;  1QQ5 A;  4AYB C;  1BPX A;  2RQ5 A;  1ZQD A;  2BDP A;  4Y2U A;  1DK2 A;  4EYI B;  1UA1 A;  3PR5 B;  2G5I B;  2H3Z A;  3SZ2 A;  3HP6 A;  4OJO A;  3GV7 B;  1SL0 A;  3UQ2 A;  3UPQ A;  3K4G A;  4I2A A;  4ICA A;  3GV5 B;  2HBL A;  1ECW A;  4RQM A;  1Y88 A;  1WYG A;  5EWF A;  1L3U A;  1Z19 A;  4DL2 A;  3KZI U;  4DWI A;  2M9N A;  4GC7 A;  3AQE A;  4UB4 A;  4IQW A;  2PMZ C;  4KLI A;  1L8O A;  1XWL A;  5KFA A;  5KT3 A;  7ICQ A;  3F2C A;  2XGP A;  4PHP A;  4CNQ A;  4GXJ A;  5IIL A;  1RYS A;  5KFW A;  4QZH A;  3T5H A;  3FC4 A;  5J0Y A;  1ZQW A;  3RJG A;  2FI1 A;  3QE9 Y;  5AKH A;  1ZQN A;  1P7D A;  4I2G A;  4ECS A;  3DEE A;  3PR4 A;  2A19 A;  3ZDB A;  3WK5 A;  4UB3 A;  2CPR A;  3BS7 A;  2Y1I A;  8ICR A;  2BZF A;  2DQN B;  4YQW A;  2I1Q A;  1K1S A;  2HHV A;  4TUS A;  5J2D A;  2K4I A;  2FLP A;  2XID A;  1N56 A;  3RB0 A;  2OH2 A;  2LM4 A;  4A8E A;  4OJL A;  4DEZ A;  2HI0 A;  4Q43 A;  2PFN A;  3D6J A;  1JRP A;  1UT5 A;  5DGA A;  5J0Q A;  2ISO A;  1S5L U;  3GQC A;  1N2X A;  4EZ9 A;  2KFN A;  3I76 A;  7ICH A;  3PSP A;  4C8M A;  1N60 A;  3LDA A;  1JN3 A;  2K8A A;  3HIL A;  3RH5 A;  4RT3 A;  3V6H A;  3LVV A;  5D4B A;  4Y2X A;  2NV3 A;  4I2F A;  5AI4 A;  8ICK A;  2IA6 A;  3PZP A;  1ZQV A;  2ZXI A;  2C28 A;  3OPX A;  5F3X B;  4M9J A;  2WF8 A;  4HYK A;  4DSE A;  3H8W A;  3AUO A;  3MGV A;  2AXT U;  2EH9 A;  4UBC A;  3C2K A;  2QAR B;  4KTQ A;  4UAR A;  4ECT A;  1MSW D;  1Z00 B;  1UCV A;  4DOA A;  5KFX A;  2F44 A;  4Q44 A;  2BQU A;  5D49 A;  9ICV A;  1HIW A;  2OEH A;  3PW0 A;  3QU4 A;  4RQ3 A;  4US9 A;  3Q8L A;  2VIX A;  3QU5 A;  1QH9 A;  1FIQ A;  5ALH A;  4NWI A;  3VCB A;  2AGQ A;  1MN8 A;  2W9M A;  1ZQJ A;  1OW5 A;  2P6R A;  4QZB A;  4C0Z A;  2VJ5 A;  1L3S A;  4OJ6 A;  2JZB B;  3TAN A;  5G5G A;  3BQ1 A;  8ICU A;  5DGB A;  4CCH A;  3F53 A;  4F5N A;  5KG4 A;  4UAV A;  5DG8 A;  1S76 D;  4GC6 A;  3SYZ A;  5IIN A;  1S0O A;  3ALR A;  4P0P A;  3EUB 2;  5CHG A;  4F91 B;  2A3V A;  8ICM A;  1H38 A;  2JEJ A;  2BDU A;  1ZQM A;  7ICM A;  3KD3 A;  2HHU A;  3MR2 A;  3TI0 A;  2C2R A;  3PSF A;  4MFC A;  1WUD A;  4K4H A;  2HW3 A;  3AMZ A;  3QU2 A;  1TAQ A;  4Q8F A;  4PHD A;  3AL0 B;  1V97 A;  4KLF A;  2P35 A;  4YMN A;  7ICU A;  3M9M B;  4J9O A;  4F4Y A;  4TQR A;  1UT8 A;  3FM9 A;  2FLL A;  7ICV A;  3B0X A;  3MFI A;  3AM9 A;  4O3O A;  1SV0 A;  3KZX A;  3OSN A;  3TAP A;  7ICG A;  8ICY A;  5CA7 A;  5J2H A;  4O3N A;  4Z6F A;  5DQG A;  3LWM A;  5AK3 A;  1XSN A;  5KFD A;  5HNK A;  3GU3 A;  4Y2V A;  2A1A A;  2HVI A;  7ICO A;  5KFJ A;  2ZXH A;  4DFK A;  2KKP A;  2LM1 A;  5EE1 A;  2QB0 B;  4M9G A;  5DDY A;  3ZD9 A;  5BPC A;  2V4R A;  5ALN A;  3NTU A;  3NVV A;  1WCN A;  3B0Y A;  4NY8 A;  3Q8S B;  2VKQ A;  4BX9 C;  8ICT A;  3ISD A;  2F8L A;  5KT2 A;  4J9P A;  1U48 A;  4DQR A;  3F2D A;  3TQ1 A;  1YZ7 A;  2KE7 A;  3QX7 A;  2EAO A;  1ZQB A;  4Y2Y A;  5DBA A;  4GXK A;  3IG8 A;  1QLN A;  2JRZ A;  2J6T A;  4RPY A;  4DS4 A;  4JUZ A;  4GIB A;  2ZJ5 A;  4Q8E A;  4FS2 A;  5FP0 A;  4B6J A;  1L3V A;  4IQV A;  2FPK A;  3TAD A;  2KMD A;  3NAS A;  3PW2 A;  2LHT A;  5KG0 A;  5HML A;  4DOB A;  4RUC A;  3Q8K A;  3RTV A;  2BGW A;  5AIA A;  2DBY A;  2HMX A;  5DLF A;  3RBD A;  2W55 A;  4QZG A;  2JMG A;  4KLD A;  4P4M A;  5J2I A;  4QZF A;  1ZQG A;  1COO A;  5DBC A;  1NOM A;  4JV0 A;  1Z1B A;  4QIW C;  5AIB A;  5AKI A;  4O3S A;  3SEN A;  1RXW A;  2XY6 A;  2AU0 A;  2KJ9 A;  1HEK A;  3HRD D;  2J6S A;  3I1Y A;  3GIK A;  3T5K A;  1N5X A;  2ESE A;  2GWS A;  4MF8 A;  4KLJ A;  3VC8 A;  2HHX A;  2KJ8 A;  3G6V A;  2YMM A;  5KG7 A;  2Y1J A;  1NK4 A;  4P2H A;  1C7Y A;  2YQE A;  1NJX A;  1JX4 A;  2IHM A;  4GXI A;  5H2F U;  1SB3 C;  4IRD A;  1PK1 B;  2FPM A;  1ZXI A;  4RQ6 A;  3SI8 A;  3RB4 A;  4IR1 A;  1RZT A;  1ZQF A;  5KG1 A;  2FJ6 A;  2E8O A;  5J8Y A;  1KW4 A;  3N7R C;  5KFP A;  1PVR A;  3TAQ A;  2F1H A;  3NUQ A;  2BCU A;  4FE3 A;  1XU4 A;  1X42 A;  1JMS A;  1BGX T;  4RZR A;  3J81 j;  1BPB A;  1NZP A;  3CP8 A;  4I2E A;  2C22 A;  2YML A;  1NJZ A;  1WCL A;  1L5U A;  4RU9 A;  2PFO A;  4YXJ A;  2W9B A;  3KFU F;  2ZUB A;  4KMU A;  1L7N A;  1VLB A;  5KAI U;  3AN1 A;  1ED1 A;  3MR6 A;  2PI5 A;  3QZ7 A;  2EZY A;  2LBO A;  1ZQK A;  1COK A;  4DSI A;  1JRO A;  2VA8 A;  5AKZ A;  5EOZ A;  3OHB A;  4K4G A;  3WKE A;  8ICG A;  3EPI A;  1T94 A;  4ED8 A;  3UM9 A;  3HWT A;  1U47 A;  3ORY A;  3N97 B;  1X2I A;  5KFG A;  5KFL A;  3HPO A;  4TQS A;  2XVT A;  5CJ7 A;  4KMO B;  3RB3 A;  2H5X A;  2DPJ A;  3C28 A;  4US8 A;  4MHV A;  3H8M A;  3T5J A;  2W03 A;  3MC1 A;  9ICN A;  3RR8 A;  4JV1 A;  1KDH A;  1M6Y A;  3ZDE A;  2BPF A;  4NL9 A;  2LYH A;  7ICJ A;  1ZQQ A;  1TE2 A;  4CRX A;  4YG2 A;  1MC8 A;  5JU5 A;  1ZD4 A;  4GFJ A;  2EAP A;  3Q8P B;  3RB6 A;  3ETL A;  5J0S A;  3JPS A;  1F5S A;  2W43 A;  4M04 A;  4KIT B;  3Q8M A;  2ZJ8 A;  9ICI A;  3OHA A;  2YMP A;  2HBJ A;  3UXP A;  2NRX A;  5ALL A;  2W11 A;  4ECW A;  4XRH A;  5J29 A;  4F4K A;  1UPH A;  4HAI A;  1NK0 A;  3RRG A;  2RHF A;  3PV8 A;  2FLN A;  2AGP A;  1KRP A;  1XNS A;  2KIC A;  9ICM A;  4F5Q A;  3SV4 A;  2A1J A;  2OXO A;  2E1E A;  2KIW A;  1RQL A;  3F5A A;  4PZO A;  1X9M A;  3GII A;  4I28 A;  1TKD A;  4DSK A;  3A0B U;  2MAX A;  1NJY A;  1HUO A;  2R8I A;  1TK8 A;  1QQ6 A;  2NYV A;  3L4P A;  4QZE A;  5J0R A;  3M7D A;  4ECR A;  1U9L A;  1K1Q A;  4J9L A;  4DL5 A;  4QWB A;  3BDP A;  1V9P A;  3ZD8 A;  2WFA A;  1UQV A;  2Y0S F;  2HSZ A;  4ECU A;  3TKA A;  4M9H A;  1CI4 A;  4NM2 A;  1S8O A;  4EBE A;  1SWW A;  2LPE A;  8ICH A;  1D9D A;  4RQ7 A;  2I6X A;  3RJF A;  4C4R A;  4M6W B;  1LKY B;  3QUB A;  3IDW A;  2KZZ A;  3BQT A;  1FEZ A;  2E8M A;  2YMQ A;  3MAB A;  4NLC A;  2BHN A;  3B9J A;  2AH5 A;  1SL1 A;  3O0F A;  3SR6 A;  1KFS A;  4K4I A;  5B5E U;  8ICO A;  2HVH A;  4G9B A;  5AI0 A;  1T3N A;  2W9C A;  5J2E A;  4J9S A;  1BPE A;  2ZIW A;  4RNN A;  2HOI A;  9ICP A;  4P0Q B;  1T4G A;  4F72 A;  2E8N A;  3IRU A;  3RF9 A;  5EWE A;  3M8R A;  3M6K A;  1ZQ1 C;  1ZQY A;  5L1L A;  4NLN A;  7ICI A;  2E8P A;  2Y0S C;  1BVS A;  2NO5 A;  3R9K A;  8ICB A;  1ZQZ A;  3NVZ A;  4F93 B;  3UXO A;  2FMQ A;  2IOF K;  5DB9 A;  4I2D A;  4YD1 A;  4C80 A;  4C7Z A;  4B9S A;  3RAX A;  2VJ4 A;  4PGQ A;  1X6J A;  5F9L A;  2QLT A;  1NKC A;  5DB8 A;  3KKA C;  2M0N A;  2DUY A;  2ZUD A;  2IHN A;  2N1R A;  3V72 A;  3AU2 A;  1NKB A;  2KV2 A;  4CE6 A;  1MQ3 A;  1S0N A;  4EEL A;  5ALI A;  5AKL A;  9ICC A;  3AEV A;  7ICS A;  9ICH A;  1JXL A;  4NJ8 A;  4FO6 A;  1Q8K A;  5AKJ A;  4IQT A;  3WKA A;  3QEA Z;  1N5W A;  1TAM A;  3UQ0 A;  2F3N A;  1RDF A;  1B0X A;  4DCC A;  9ICW A;  4B9L A;  5DBB A;  4EEN A;  1ARO P;  3WKD A;  2KZM A;  1J2N A;  2IMW P;  2CXY A;  1URJ A;  1Z3E B;  3SAG A;  3GV8 B;  1ZQT A;  1ZQO A;  5AIC A;  1ZQA A;  3OTQ A;  5CR0 A;  2XC9 A;  2W8K A;  1ZRM A;  5HHH A;  1RPL A;  3MGI A;  1CEZ A;  4DF8 A;  3G6Y A;  1NK9 A;  5AK4 A;  3UMC A;  1BPD A;  2NRZ A;  1KTQ A;  3LYS A;  1IV8 A;  2DGZ A;  1X9X A;  1VJ5 A;  4ACO A;  2MSN A;  4F3O A;  2JR5 A;  2XCA A;  2ZJA A;  5J2A A;  4XQ8 A;  5F9N A;  5III A;  5HP4 A;  3JPO A;  4C8N A;  1RXV A;  4YR2 A;  1CUK A;  2BQR A;  5L1J A;  2Q4T A;  1TAU A;  5KG3 A;  8ICQ A;  2DF4 B;  1ZD3 A;  2XCP A;  4IC9 A;  2XIC A;  2H3F A;  9ICL A;  4UAT A;  5J0T A;  4KLL A;  1N62 A;  1L8L A;  1RQN A;  5KT4 A;  3CRX A;  1TVA A;  5JTI A;  3AU6 A;  1NK7 A;  5IIO A;  4EBD A;  3ZDC A;  4IS7 A;  2XO7 A;  5ALS A;  4DL7 A;  1WWU A;  4F92 B;  4MFA A;  3OJU A;  4NM1 A;  9ICF A;  3HJE A;  2WF9 A;  5KG6 A;  1KLN A;  1L7M A;  3WU2 U;  1D8B A;  1J2M A;  2R8G A;  4JMU A;  4KLM A;  9ICG A;  5J2J A;  4ECY A;  3V6K A;  4CF3 A;  1KEJ A;  5HMM A;  1L6N A;  3H7I A;  3FYH A;  1O08 A;  4F5O A;  2LYA A;  2ZIX A;  2V9W A;  5KFN A;  2DKZ A;  4KN4 A;  1S0M A;  4LJX A;  4DFM A;  4NLK A;  4O3Q A;  3K1R B;  2E5S A;  5KFR A;  1S0V A;  4RQ4 A;  2KP7 A;  2RRD A;  2KNJ A;  1SKR A;  3WKC A;  2BR0 A;  7ICL A;  7ICF A;  3C2L A;  4YP3 A;  2ZIU A;  4DSJ A;  5HR6 A;  3QU7 A;  4X5V A;  3BS5 A;  2WB1 F;  4F5R A;  4UAZ A;  4BWJ A;  2ES6 A;  1DXS A;  5BOL A;  1ZQH A;  4PPX A;  4FZN A;  2FE9 A;  3KHR A;  4DL3 A;  1F44 A;  8ICZ A;  3E2E A;  3T3F A;  1NJW A;  3L5K A;  5AKX A;  4F2R A;  3C21 A;  2GLE A;  4DF4 A;  3JPN A;  1AQ6 A;  1BNP A;  2MUT A;  5L9X A;  1DK3 A;  4NLG A;  1PK3 A;  3PSI A;  2I9G A;  4F2S A;  1JUD A;  4TUQ A;  1X40 A;  3EPG A;  5KFE A;  5GTI U;  1ZJM A;  4FBT A;  5EE3 A;  1F0M A;  5KFM A;  4YD2 A;  4F4W A;  1MQ2 A;  3PMN A;  3V7J A;  3U26 A;  2YX8 A;  2H3I A;  1UA0 A;  1KQQ A;  4YFK A;  2C2E A;  5BOM A;  4KLU A;  4C8K A;  5AI8 A;  2OYY A;  2NRV A;  4KLH A;  4P0P B;  2WF6 A;  2HBM A;  1Z4N A;  5GTH U;  3T5L A;  4AP9 A;  3N7S C;  4PGX A;  3H40 A;  2WB1 C;  3PW5 A;  4RQ0 A;  5TIS U;  4NXZ A;  3F2B A;  1ZQL A;  4UAW A;  2F76 X;  2BPC A;  2UVR A;  5KFC A;  2K4P A;  3IHQ B;  1S10 A;  4PZN A;  4Y2P A;  4B9U A;  4F5P A;  1IM4 A;  4I2J A;  3FDS A;  3OJS A;  4BJQ A;  2LYB A;  4Y2S A;  2JV3 A;  3H0L B;  4UAY A;  1IIP A;  3WK7 A;  5ALM A;  3RRH A;  4C7Y A;  3HKZ F;  2WHE A;  4YN4 A;  3E0F A;  3UMG A;  2RLT A;  5A0L A;  1X66 A;  3KTQ A;  3PX0 A;  1XSL A;  4QZD A;  4FFD A;  4YXM A;  1B4F A;  3EW9 A;  1ZRN A;  2EZX A;  3KHH A;  4JV2 A;  5J0P A;  4FBU A;  1NK5 A;  5HR7 A;  3MGH A;  4EZ6 A;  4DO9 A;  4MF2 A;  1SV0 C;  5ALT A;  4DQQ A;  2WF7 A;  4O3M A;  2ZUC A;  5T14 A;  2OM6 A;  2EDU A;  5ALU A;  1ZJN A;  3MFH A;  2AQ0 A;  2ASL A;  5DLG A;  1IXR A;  5IIK A;  1V85 A;  1X6I A;  2HBK A;  2LMR A;  1Z1V A;  1ZYQ A;  2AGO A;  2K8B B;  2RDJ A;  8ICC A;  1SGG A;  2KSO A;  4ED7 A;  2W7O A;  3ZDD A;  2QKQ A;  1HUZ A;  3QYP A;  1NI3 A;  8ICA A;  2G07 A;  4QZ8 A;  5J0X A;  4O9M A;  5ALK A;  3WK9 A;  9ICT A;  2KJ5 A;  5KFB A;  2BCQ A;  4J9M A;  3C1Z A;  1J97 A;  1TK5 A;  4CDG A;  1UHU A;  4J9N A;  1ZOL A;  1ZD5 A;  3AQF A;  4IRC A;  5J2F A;  4PJ0 U;  2ISP A;  3SV3 A;  3GZF A;  3TAD C;  1XS9 D;  3C5G A;  3GIL A;  4RQ8 A;  5AI5 A;  2HDO A;  4C8O A;  8ICW A;  5KL1 B;  4KLS A;  4BDP A;  2HHW A;  3RJH A;  4DQS A;  2AQ4 A;  1NK6 A;  4ELU A;  3JPP A;  5AM1 A;  1U45 A;  2K89 A;  2ZG6 A;  2AHO B;  2K8C B;  3QEB Z;  1KBU A;  2PXI A;  4LVS A;  1QSS A;  5KFI A;  9ICB A;  5KFT A;  2QB1 A;  8ICJ A;  1D8Y A;  3BJY A;  2YB1 A;  5DQI A;  2W3S A;  1A76 A;  5B66 U;  2JEF A;  4ZOH C;  5AKY A;  4RPX A;  3C23 A;  5ALF A;  2KN7 A;  4M2Y A;  4M9N A;  3DDH A;  4G3I A;  1LB2 B;  4QZA A;  4KLG A;  7ICN A;  2PI4 A;  1A77 A;  3TAR A;  2R8K A;  4YR0 A;  3WKB A;  2W9A A;  2IOF A;  9ICU A;  1PVQ A;  3M9N B;  4XUS A;  2UVU A;  2K4E A;  2W9B B;  2IOH A;  4UB6 U;  2KZ3 A;  2PKE A;  4JB3 A;  3HX0 A;  5KFY A;  5AM5 A;  2L5Y A;  5CWR A;  4TUP A;  3BQ0 A;  5J8Y C;  1N48 A;  1U4B A;  5DG7 A;  2EAM A;  5AK6 A;  3KHG A;  5K4L A;  4DFP A;  4ECX A;  5CEH A;  1TFR A;  4Z6D A;  1PZN A;  2F8K A;  2AJQ A;  4IL6 U;  4EX7 A;  3ICX A;  2E3T A;  3SD7 A;  3H4B A;  4DL4 A;  5J0O A;  3QUQ A;  5J2C A;  1ZQS A;  1SV4 A;  3ED5 A;  2E1F A;  4ECZ A;  8ICF A;  2PFQ A;  1N61 A;  5G5H A;  4DFD A;  4UQG A;  4UB1 A;  2F77 X;  1DGJ A;  4IRK A;  4FZM A;  4RQ5 A;  5KFS A;  4Z6E A;  2HHS A;  2KOB A;  5AHX A;  5KFU A;  4F8R A;  2YY6 A;  9ICR A;  4LZD A;  4JWN A;  1ZQP A;  4QNL A;  1BPZ A;  4IQU A;  4ELT A;  2VA3 A;  4TUR A;  4O5E A;  1T3Q A;  4M0A A;  5KFO A;  3NGD A;  4EEK A;  3RH6 A;  3WK6 A;  4MEX A;  2PMZ F;  2EAN A;  4RQ1 A;  4KLE A;  4RUA A;  4R64 A;  3ZDA A;  1RG6 A;  3V6J A;  3CYM A;  2YN4 A;  3RJJ A;  1MA7 A;  5D46 A;  3SMV A;  2ODG A;  4NL9 C;  2KG5 A;  2H3V A;  4KN7 A;  3JPT A;  1YT3 A;  4R63 A;  4KLO A;  3PY8 A;  4PGY A;  4O5C A;  3RJK A;  2BPG A;  5KL8 B;  2MRL A;  1JIH A;  1QTM A;  1Z4O A;  2QAR A;  2A1J B;  3MDA A;  1Q46 A;  9ICK A;  5DB7 A;  1Z00 A;  2WAQ F;  1DOQ A;  3ETR A;  4OCZ A;  2Y9T A;  1ZQI A;  5KFK A;  3SAH A;  7ICT A;  4I2B A;  2DFL A;  4B9M A;  1FFV A;  5KNI A;  1D9F A;  2FMS A;  2R18 A;  3NRZ A;  4KLT A;  3S6J A;  3SEI A;  5J2K A;  3H0M B;  1D8L A;  1BPY A;  4RPZ A;  3V7K A;  3ONN A;  3I28 A;  2GH1 A;  5J2B A;  5L1M A;  2JZB A;  4ED2 A;  9ICA A;  4BGD A;  5J2G A;  2LI6 A;  3G6X A;  3RJI A;  4O0I A;  1FO4 A;  4OJ5 A;  3LK9 A;  4KX5 A;  4YMM A;  7ICE A;  1ZQU A;  1EXN A;  1T8E A;  4QW8 A;  1KL9 A;  2HCF A;  3D2S A;  4UBB A;  2ASJ A;  4QZC A;  3PW7 A;  4EEY A;  2LKY A;  2WAQ C;  2ASD A;  3C5F A;  4RNO A;  2W3R A;  3RR7 A;  2W9C B;  2PFP A;  4DS5 A;  3PML A;  2W04 A;  3QUT A;  2ZIW B;  2ALZ A;  5C0Y A;  4DSF A;  4USA A;  3IG5 A;  2BCR A;  2JEI A;  3UXN A;  4RQ2 A;  2UVW A;  2RDI A;  4KLQ A;  3GIM A;  4ED1 A;  2XY5 A;  3IV6 A;  1JI7 A;  4J03 A;  4PHA A;  1ZD2 P;  8ICN A;  4Y2J A;  1ZQX A;  3GDX A;  3IM1 A;  3BQ2 A;  4DFJ A;  3OSP A;  1XC9 A;  3DV9 A;  2BCV A;  4Z6C A;  3NRW A;  2BKE A;  4F50 A;  4QWD A;  4R8U A;  2H3Q A;  8ICS A;  4NLB A;  4BXO A;  2HHT A;  9ICX A;  5DQH A;  3MBY A;  1X9S A;  5EWG A;  3FAH A;  2QB0 A;  1V38 A;  5AM2 A;  8ICL A;  2B0C A;  4KX3 A;  8ICE A;  4J9R A;  2KK0 A;  4ECQ A;  2KVS A;  5ALV A;  2ZTE A;  2BQ3 A;  1N63 A;  1LVH A;  3NVW A;  3K1Z A;  3MDC A;  3PO4 A;  3M9O B;  2R8J A;  7ICR A;  1B43 A;  7ICK A;  4Y2T A;  3A0H U;  4P4P A;  2JXJ A;  4DQP A;  4CGZ A;  2WF5 A;  3C29 A;  3MR5 A;  4C4S A;  2KD1 A;  4BUG A;  4ZH4 A;  5TZV A;  3M6Z A;  4DL6 A;  3N28 A;  1S97 A;  1OUQ A;  3RJE A;  2I5H A;  4B9V A;  5KT7 A;  2KHV A;  2W54 A;  5ALZ A;  4QZI A;  4MEY A;  2EQY A;  4DQI A;  5AI6 A;  2OHF A;  1KN5 A;  2Z7J A;  3L3F X;  4RQN A;  3JPR A;  1L3T A;  2YB4 A;  1KFD A;  4YCX A;  2G09 A;  4PL1 A;  1LV5 A;  5AM3 A; 
#chains in the Genus database with same CATH homology
 2YTU A;  3TAD A;  1X40 A;  2KMD A;  4NL9 C;  1JI7 A;  2KG5 A;  1LKY A;  1F0M A;  1V85 A;  2LMR A;  1COK A;  1Z1V A;  2Y9U A;  3TAC B;  4NJ8 A;  4IS7 A;  1UQV A;  1WWU A;  2K60 A;  2F3N A;  2B6G A;  1SGG A;  2KSO A;  1B0X A;  2QAR A;  1SXE A;  2LPE A;  2KIV A;  2QKQ A;  1SV0 A;  2QB0 A;  1V38 A;  2L5Y A;  2Y9T A;  3SEN A;  2DKX A;  3HIL A;  3BQ7 A;  5J8Y C;  1PK1 A;  4MHV A;  1LKY B;  3H8M A;  5KNI A;  3KKA A;  2EAM A;  2K4P A;  3IDW A;  2E8M A;  3SEI A;  4PZN A;  2DKZ A;  4NL9 A;  5F3X B;  2ESE A;  3K1R B;  2F8K A;  2KSO B;  5L1M A;  2JV3 A;  2QAR B;  4RQM A;  1SV4 A;  5JU5 A;  2EAP A;  1UCV A;  1X9X A;  2QB0 B;  2F44 A;  1PK1 B;  3TAD C;  1X66 A;  3BS5 A;  2E8N A;  2E8O A;  5J8Y A;  1KW4 A;  2ES6 A;  1DXS A;  2E8P A;  1B4F A;  1OW5 A;  2FE9 A;  2D8C A;  1WWV A;  2D3D A;  2KE7 A;  2EAO A;  2DL0 A;  1SV0 C;  2EAN A;  2QB1 A;  2GLE A;  4RQN A;  1OXJ A;  1RG6 A;  5JRT A;  4PZO A;  3BS7 A;  3KKA C;  3BS5 B;  1PK3 A;  5JTI A;  1SXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...