2ESEA

Structure of the sam domain of vts1p in complex with rna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
MPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-R(*GP*GP*AP*GP*AP*GP*GP*CP*UP*CP*UP*GP*GP*CP*AP*GP*CP*UP*
publication title Shape-specific recognition in the structure of the Vts1p SAM domain with RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein/rna complex
total genus 27
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2eseA00
1SXDA 2Y9TA 1X66A 5JU5A 4RQNA 3TADA 1B0XA 3KKAA 1SGGA 2E8PA 2EAOA 4PZOA 1V38A 1UQVA 1OW5A 1UCVA 5J8YA 1RG6A 2K4PA 5KNIA 3BS5B 2QB0B 1SV0A 2E8OA 4NL9A 2QARB 5F3XB 3H8MA 2KG5A 2EANA 4MHVA 1WWUA 4IS7A 1PK1A 1JI7A 2EAMA 2B6GA 2DKXA 3TADC 1PK3A 3KKAC 5JTIA 3BQ7A 2KE7A 1X40A 2D8CA 2KMDA 4NJ8A 5J8YC 2DKZA 1X9XA 1Z1VA 3SEIA 2EAPA 3TACB 3IDWA 1SXEA 4PZNA 1F0MA 2E8MA 2FE9A 1OXJA 3BS5A 1SV0C 4RQMA 2QB0A 4NL9C 2ESEA 2LPEA 3SENA 1LKYA 5L1MA 3HILA 5JRTA 1V85A 2F3NA 2KSOB 2QKQA 2E8NA 2ES6A 2F8KA 1COKA 2D3DA 2DL0A 1SV4A 2JV3A 2K60A 2QARA 2GLEA 3BS7A 2F44A 2YTUA 3K1RB 2QB1A 1B4FA 1KW4A 2KIVA 2KSOA 1DXSA 2Y9UA 2LMRA 1WWVA 1LKYB 1PK1B 2L5YA
chains in the Genus database with same CATH superfamily
4Y2QA 4F93B 5KAFU 4DWIA 3TQ1A 4BUGA 2BPCA 1ZQPA 2WTFA 4I2FA 4UAUA 2BR0A 2KZ3A 5DBAA 9ICPA 3WKAA 5KFJA 5IIIA 4NWIA 4OO1J 3WKCA 5CHGA 5B5EU 4DQSA 4UAWA 2IBKA 2NRWA 4CE6A 2FPKA 2FPLA 5D49A 3T5KA 4MHVA 5J0XA 4JWNA 1ZXIA 4YXMA 4Y2XA 1J2MA 1WCNA 3G6VA 4XUSA 1YZ7A 7ICJA 7ICVA 3IDWA 3BZKA 4YFKA 2LBOA 5IIMA 1BPBA 1X2IA 3E0FA 4YG2A 4M47A 4K4HA 3SENA 2W8LA 5KG0A 1NKBA 3HILA 3QXGA 1LVHA 4UAYA 2KTQA 4J9LA 3BJYA 3EZ5A 5KTQA 2XGPA 2W9CB 4R64A 4YP3A 5HHIA 2VJ4A 3KHRA 4KN4A 3QNMA 1XSPA 5J2DA 4YR2A 1QTMA 2BCVA 1KFSA 1PVQA 3JPOA 4QZ8A 2Q0ZX 3OJSA 4B9TA 4MF8A 2ZXHA 3JPRA 4UB6U 4C8KA 2F76X 4TQRA 3V6HA 3V72A 1XU4A 2Y9UA 3TAPA 2NRXA 4O0IA 2UVUA 2KJ8A 5HR6A 1DGJA 4J9RA 3GV8B 4K4IA 2Y1JA 1FO4A 5JU5A 1HJPA 4KLOA 5ALTA 2E8PA 4I2CA 4B9NA 4C7ZA 5L1JA 1Z4OA 4M9JA 2FLNA 2YX8A 1ZQVA 3IHQB 2W9BB 4IRKA 1JUDA 2HDOA 2W7OA 2AQ4A 3TI0A 3GQCA 9ICEA 2KKPA 3RJIA 2EH9A 1SL0A 5J2BA 7ICRA 2WAQF 3ICXA 7ICIA 3A0BU 3KFUF 4EBCA 2E1EA 2LYAA 3MR5A 4NLGA 1NJWA 5AI0A 5B66U 2E3TA 2F77X 2H3VA 4LJXA 4QZFA 1TK0A 1SXEA 3S6JA 1TK5A 3HRDD 2BGWA 2OWOA 1WUDA 1T4GA 1BVSA 9ICUA 1LKYA 5JRTA 4IRDA 2XICA 7ICPA 5BOMA 2BPGA 5ALSA 1ZQKA 3N4MB 2W9AA 1L3VA 4Z6EA 1XSNA 4F5NA 2BQ3A 4IQTA 1RM6C 5AKIA 4PGXA 8ICYA 5KG4A 1MN8A 2YB4A 4I2IA 5ALLA 3KHLA 4C8LA 2QARA 5C0YA 3ED5A 4QNLA 3K1RB 3L4PA 3WK6A 1ZD3A 5AKLA 4ED6A 3M8RA 4KLUA 4KN7A 2DPJA 1NNLA 2BCRA 7ICGA 5CEHA 4M6WB 2W9CA 5HR7A 1NKEA 4X5VA 4R8UA 1DK2A 1FEZA 4ED7A 2WB1F 3DDHA 2PMZF 2ZIUB 4JB3A 1O08A 4UBCA 4EYHB 5KL8B 3CYMA 5DLFA 5KG1A 9ICIA 1SV0A 2BQRA 5EWFA 3NVZA 5KFKA 1BPZA 4ECXA 4UASA 1N61A 2JEJA 3Q8KA 2FLPA 3MFHA 4XA5A 4IS7A 1RQLA 3Q8LA 1FFVA 4M9GA 2ZIXA 5L1KA 4ED0A 3TADC 2EDUA 5DLGA 2K4IA 2JRZA 1ZQWA 1ZETA 7ICHA 1EXNA 1Z1VA 3C1YA 5ALMA 5DG9A 3TACB 5KG2A 3RJEA 4DL7A 5KT7A 4RQMA 5DDMA 1B22A 1TK8A 2KK0A 3SAFA 3T5HA 8ICFA 4DF4A 5L9XA 2CN1A 3PR4A 4KLLA 3AN1A 1MSWD 3C5GA 5DB6A 4UARA 5DG8A 5ALOA 2HSZA 3I28A 1Q3UA 2BKEA 1N5WA 3AEVA 1JRPA 2HHTA 1ZQIA 1ZJNA 4QZDA 5G5HA 2W3SA 3RBEA 1ZQFA 3H7IA 2DGZA 2W3RA 1Z3EB 5D4BA 2KIVA 4I2BA 5HP4A 4QJFB 4UQGA 2NYVA 3IV6A 4USAA 4ECTA 4Q43A 4JUZA 3KKAA 4XQ8A 1NZBA 3R9KA 1A76A 1V38A 4PHPA 5KFMA 3O0FA 3NRZA 1UCVA 2JXJA 5T14A 2XIDA 4J9SA 3WKDA 3PW5A 4KX3A 4UB4A 1CUKA 1ZQGA 3SQIA 4ZH4A 5A0LA 1K5OA 2IOFK 3ALRA 4M9NA 3HKZC 4MF2A 3RJJA 2EANA 5AIAA 4RNOA 4OJPA 2HI0A 2W43A 4M6WA 4C8NA 2W9MA 3KZXA 4EEKA 2HCFA 4PL1A 4G9BA 2XGQA 4DOCA 4O5CA 4F4WA 2A1AA 4RQ1A 3ZD8A 4KLTA 1XO1A 2I6XA 2IOHA 2XC9A 3HT3A 3N7RC 3D6JA 2WF5A 3OSNA 4DSFA 3FYHA 4NL9C 3TKAA 1ZD4A 4RQ2A 4DL4A 4IR1A 5ALEA 5E79U 2F3NA 3GV7B 2FMPA 3RR7A 4O5KA 3QE9Y 2ISPA 5GTHU 3G6YA 2JEIA 3D2SA 4WJ3B 3A0HU 5KFRA 2BDUA 1YZ6A 4DLGA 3KOOA 4UW9A 3F53A 2P66A 2A1JB 5AIBA 4ELVA 2HVHA 1URJA 3NUQA 4XRHA 2C2EA 3M1YA 5AK3A 3RRHA 2NRZA 1ZQCA 4OCZA 4GXKA 2V4RA 8ICEA 3UXOA 1RZTA 4B9SA 5AM5A 4B6JA 2PKEA 5TISU 3NVYA 8ICGA 2ZTEA 2ZJ8A 2FMQA 4UAVA 2IMWP 4F8RA 5ALQA 4YXJA 2K4PA 3WKBA 3CRXA 4FO6A 1V9PA 3ETRA 4J9QA 2VIXA 7ICUA 5D46A 2BQUA 4DS4A 1WWUA 1L8LA 1DGSA 2JR5A 3N7PD 2ALZA 5JTIA 4KLDA 5KT5A 4C4TA 2ZTDA 4OD0A 1S0VA 2AXTU 5L1LA 2W8KA 1NK0A 2HOIA 1KQQA 4DL3A 5CA7A 3QU5A 4DL5A 3AQFA 3M6ZA 1SKSA 4NXZA 1SL2A 3LYSA 2K89A 3LWLA 4I29A 1NK8A 3RJFA 4ECYA 2F8KA 1ZRMA 4GFJA 5ALRA 4OJ6A 5J2CA 4EELA 3MR2A 5AKKA 2C2RA 1AROP 1TAMA 5GTIU 4ED2A 4ED1A 2Y0SF 1L7PA 1N48A 4QZAA 3M7DA 2JGAA 2F2AB 1ZQNA 3BS7A 3UQ0A 1QSYA 5IIKA 3L5KA 1VDVA 3B0YA 4I2EA 3RJKA 2JEFA 3RFAA 2OHFA 2KVCA 8ICKA 9ICVA 2LYBA 2PFPA 5AKGA 4Q8FA 5J29A 2XY6A 8ICMA 4RPZA 1KBUA 4US8A 2C22A 3GFKB 3WK9A 1K1SA 2EAOA 2KNJA 3QU2A 2A1JA 3PX4A 5KFFA 1JXLA 3G6XA 2FI1A 3PMNA 2P35A 2FDRA 4BWJA 5KG6A 1PVRA 3PSPA 4OJLA 2E8OA 5KFBA 4FS2A 1ZQZA 4YCXA 3AM9A 2OYYA 3MGIA 1YT3A 1D9FA 2N1RA 3BQ7A 1C20A 9ICBA 2XCPA 4OJ5A 3WK5A 1X9XA 5AKYA 2RP5A 4B9VA 3JPSA 2MAXA 2AQ0A 4P2HA 1JALA 5C5JA 4KMOB 9ICCA 2G09A 9ICWA 5J0QA 1P7DA 4QZIA 4MFFA 2M0NA 2VJ5A 3AU6A 4DL2A 3TANA 5DG7A 5J2IA 3WK8A 2ES6A 3AU2A 4ACOA 1S10A 1RYUA 7ICNA 4O3NA 1C7YA 4O3PA 4J9KA 1U45A 5KFIA 3BZCA 2K60A 3SZ2A 4KLMA 3HKZF 2O6KA 3NS1A 1OUQA 3PMLA 4IR9A 2EZXA 3RAQA 1XO0A 1ZQMA 4ECQA 1DXSA 4PL2A 2EQYA 1Z4NA 4GXIA 1PK1B 2QLTA 4QWCA 3HX0A 2L5YA 3K75D 4DS5A 2XY7A 4TURA 1NK4A 4KLIA 3OHAA 2DFLA 1CRXA 3H4BA 3E58A 8ICXA 4F50A 5IIOA 4PJ0U 4F2RA 3C29A 4Z6CA 3FC4A 1ZQJA 2GO7A 2RRDA 2F1IA 2K8AA 2DF4B 2KICA 5J2GA 4R65A 4DEZA 3EPGA 5J0TA 2G06A 3I1YA 3ZDCA 2KJ5A 2IHNA 3HW8A 1JI7A 4I27A 2H3QA 2IOFA 3SR6A 8ICIA 4M9HA 2K4HA 4QWBA 2W03A 2ZIVB 1H38A 4UB1A 5DB7A 4P4OA 2G08A 5J8YC 4C4RA 2B0CA 4BXOB 2EAPA 3H40A 2R8GA 1F0MA 2R8IA 3M9MB 5AI8A 1WCLA 5KFHA 2ESEA 2ZJ5A 5KT2A 4P0PB 5KFSA 3QZ8A 8ICSA 5KFDA 3MFIA 1T94A 9ICFA 1D8BA 1QSSA 3PW0A 5DGAA 3SAHA 2YQEA 4KX5A 9ICLA 9ICKA 2FPMA 1SV4A 4QW9A 1U48A 2KN7A 1S0NA 3GDXA 1ZQTA 5ALXA 1RXWA 5ALZA 4BGDA 3UMCA 4NM1A 2ASJA 4I2AA 2C28A 5DKWA 2NO5A 2W04A 1TVAA 3TFRA 3J81j 4DSJA 4ELUA 3AL0B 2MUTB 3OTQA 5AKHA 1XWLA 2PFNA 5J0OA 4M9LA 4J9NA 4RQNA 1ZQBA 4PHAA 4ECVA 3QU4A 1UQVA 5ALUA 4O9MA 3MC1A 4Y2YA 4QZCA 4UB8U 1V97A 3PX0A 1ZD5A 4ECUA 4RQ8A 4DSKA 4FBTA 5G5GA 3F5EA 4J03A 4Y2PA 4RPYA 8ICWA 3E2EA 3ZDAA 4ECSA 2KG5A 3N97B 3T3FA 4FZMA 1PK1A 1D8LA 1L7OA 1MQ2A 4F3OA 3V7KA 4NJ8A 4F91B 5ALYA 3FM9A 3H4DA 7ICSA 2BCSA 2W7PA 2G5HB 5AK5A 3Q8MA 2R8KA 2Z7JA 1N5XA 2Y0SC 2VA3A 1BPEA 3SI8A 3C23A 3RJGA 9ICAA 1RYSA 2GH1A 1KRPA 4ICAA 2KSOB 4RQ3A 4A8EA 5KT3A 3UMGA 4F5PA 4MEXA 3MDAA 2HBKA 5KT4A 5KG5A 4TUSA 4DSEA 4BXOA 1N60A 2W9BA 3F2DA 1IM4A 3B0XA 3MGVA 8ICUA 4JV0A 4O3QA 4P0PA 3C2LA 3SAGA 8ICQA 1CEZA 2ISOA 2JMGA 2K8CB 2LMRA 1AQ6A 4CNQA 1UHUA 1T7PA 4CGZA 4CF3A 3K1ZA 1IIPA 2LYHA 4LVSA 1J97A 2KHVA 1A6SA 3TAQA 2KP7A 2PI5A 4JV2A 4EBDA 3NTUA 1HUOA 2R8JA 2V4QA 3DEEA 4TQSA 1KN5A 3UQ2A 5EWEA 2QB0B 5AKJA 4DQPA 2HHUA 5ALKA 3QU7A 4DQQA 3KTQA 4EX7A 1N62A 1QCKA 2PI4A 4FBUA 1NI3A 4P4PA 3QZ7A 2FJ6A 1U9LA 4RQ7A 2EAMA 4QWEA 2FMSA 4NLNA 1KSPA 4I2DA 3SV3A 3Q8PB 1Q8KA 5L1IA 2H3ZA 1X40A 5DQHA 2BHNA 1T8EA 4DFKA 4P4MA 8ICBA 1NJYA 5HMMA 3F2BA 1U4BA 1NK7A 2FE9A 1OXJA 2YY6A 3KHGA 4FZNA 2G07A 4IC9A 5AI5A 1ZQOA 4FFDA 4J9MA 3C5FA 4RU9A 2OEHA 1SZPA 3UPQA 1BPXA 3QUCA 1L3TA 1ZQAA 4FZLA 4QZEA 2D3DA 1D8YA 5HNKA 1WYGA 2ZIUA 1ZJMA 3AUOA 2LKYA 4IQUA 1RXVA 3K4GA 3OJUA 1K1QA 1SKRA 1KL9A 1UA0A 1S97A 4C4SA 2YMMA 2C2DA 3TFSA 3BQ0A 1S5LU 1XC9A 2MRLA 4U6PA 3D2QA 2VANA 2ZG6A 4PGYA 3PSIA 2RQ5A 5AI6A 4M2YA 3U26A 3WK4A 2KSOA 4QZBA 4BWMA 4MFCA 2HHVA 3QYPA 3H8JA 2WF6A 1X9SA 4DLEA 4AP9A 3TADA 2BDPA 4KLEA 1QH9A 1B0XA 5ALNA 2GWSA 4RUCA 4E0DA 2NRTA 1OW5A 2KD1A 2AJQA 4C80A 4MFAA 8ICVA 4KLHA 4YMNA 4Y2TA 1GO3F 1X9MA 1RDFA 1ZRNA 1U47A 2VA2A 4GC6A 2PFQA 2YMQA 2PFOA 5EOZA 4YMOA 5DB9A 7ICOA 5KFXA 5KFVA 5KFTA 5J2KA 5EE0A 7ICFA 1FIQA 5CR0A 3JPPA 5KFNA 5EWGA 2HW3A 4Y2JA 5HHHA 1L5UA 4Z6DA 1F5SA 1MC8A 2QB0A 2HHWA 1SKWA 4KLGA 2K4EA 1UT8A 4AYBC 2KFZA 1X6IA 3GU3A 1V85A 2KHQA 2OH2A 5EE3A 1PVPA 2HBJA 2E1FA 3JPQA 2UVVA 5J2FA 2OCEA 4R66A 4BJQA 2DBYA 2DL0A 4TUQA 9ICQA 3F2CA 1TAUA 3GIKA 2A3VA 2GLEA 5JUMA 1Y88A 3MDCA 1M6YA 2XY5A 1JMSA 3ZDEA 5DGBA 1KW4A 4CDGA 2CXYA 3OPXA 8ICTA 2MU2A 1VJ5A 2YB1A 5H2FU 3D2NA 3AQEA 2JHDA 4US9A 5CP2A 1ZD2P 3GIJA 1L3SA 4O3RA 3GZFA 5J0RA 1N56A 4CRXA 1L7NA 4DQIA 4CF4A 5KNIA 4Y2RA 3C28A 1JN3A 3Q8RB 3NVVA 4NL9A 1KKXA 5F3XB 4IL6U 2F1HA 4F2SA 2ZXIA 4KLSA 3MABA 3RB3A 2YMPA 2HVIA 3MGHA 3FAHA 3M9NB 3H0MB 1XSLA 5IILA 8ICOA 2V9WA 2I1QA 4JMUA 2KMDA 5AK4A 1L8OA 4O5EA 2RDJA 3AMZA 5ALDA 4F4YA 5KFUA 4UAZA 7ICEA 2WF7A 3ORYA 3KHHA 2J6SA 4Q44A 4HYKA 2EZYA 2BCUA 3OGUA 3RH6A 1X6JA 1S76D 5ALJA 2ZJAA 3PNCA 3DV9A 4F92B 1JIHA 5CRXA 2B21A 4ED8A 3GILA 1KTQA 4KTQA 1N63A 2AHOB 4OJOA 3PX6A 4YD1A 2G5IB 2M9NA 2AGQA 7ICMA 8ICLA 4J9PA 3RB6A 1DK3A 4JK1A 3RTVA 2DQNB 5J2HA 8ICNA 4C8OA 4IQWA 3UXPA 4KLFA 4F4KA 2I5HA 2PXIA 4I2GA 2W54A 4DCCA 3UMBA 4DO9A 1TE2A 2QB1A 5AKEA 3WU2U 1S0MA 1QQ7A 4DQRA 2HBMA 5FP0A 5KG3A 3CP8A 1TKDA 5ALFA 1S8OA 1LKYB 2P6RA 1SXDA 1A0PA 2WF9A 2Y9TA 3PSTA 1X66A 3SMVA 2FLLA 1SGGA 4UBBA 3WKEA 2XI9A 1ZOLA 2NO4A 9ICOA 3H0RB 2H5XA 1RG6A 1Q46A 4NM2A 2D6FC 3BS5B 1QLNA 5AI9A 5KFQA 3JPNA 2HHSA 9ICRA 3KZIU 4IQVA 1IXRA 1S0OA 2QARB 2DWQA 5ALWA 2HMXA 5AI4A 2B6GA 1T3NA 2DKXA 2HOFA 1PUZA 5TZVA 2KZZA 2KE7A 2GOLA 1L7MA 3EUB2 4M0AA 4O3MA 3V6KA 5DB8A 1LB2B 5EE1A 3GV5B 4QWAA 2JZBB 4R8UB 2ODGA 1SV0C 4PH5A 1NJZA 7ICKA 3TARA 3RR8A 4KMUA 3V7LA 5L1MA 2RDIA 4CCHA 3EW9A 1ZQEA 3ISDA 1KLNA 4JWMA 4KITB 2XCAA 2JEGA 4NLBA 3RH5A 3BQ1A 4QW8A 2R18A 3C21A 3N7SC 5J0YA 1NK5A 1JROA 1BNPA 2ATLA 2ZIXB 4TUPA 1SL1A 4J9OA 4MEYA 3PV8A 1TAQA 4CF5A 4IRCA 4FS1A 1XS9D 2AGOA 2P6UA 3LDAA 3QEAZ 3UM9A 3EWAA 2ZUDA 2YMLA 5J2AA 3C2MA 3KD3A 3PY8A 5DQGA 4KLJA 4DOAA 1RPLA 3QU9A 5J0WA 4DFPA 2H3IA 4QIWC 2VKQA 2HHXA 9ICGA 3UXNA 4YN4A 3PZPA 1JXEA 1DRGA 1CI4A 4Q45A 4DFDA 4B9LA 8ICHA 1ZQXA 1MA7A 1Z00B 3PSFA 1T3QA 3MBYA 5AKZA 5DBCA 9ICTA 3Q8SB 1BNOA 2K8BB 3M9OB 4AYBF 3V7JA 2DUYA 5KFCA 2MSNA 4F5QA 3RJHA 2WHEA 3H8MA 9ICHA 2KV2A 2LI6A 2ZUCA 3KKAC 3WK7A 2Y1IA 4NLKA 3LVWA 5ALHA 9ICXA 4Y2UA 1NK9A 5F9NA 3JPTA 2KIWA 1LV5A 4PGQA 3BS5A 5AICA 5J2JA 4RT2A 2G0AA 3VC8A 5KFGA 3PW2A 1UPHA 2AU0A 5CB1A 3M8SA 3RF9A 2QKQA 9ICJA 3L3FX 2CRXA 4U7CA 3QEBZ 2KFNA 5HMLA 4RNMA 5IIJA 7ICQA 5IINA 2JZBA 5KL1B 4DSIA 1ED1A 1A77A 4ECZA 4K4GA 2W55A 4NLCA 1BPDA 4DOBA 8ICJA 4P0QB 2MA1A 3H8WA 1RQNA 4RQ0A 4RUAA 2ZIVA 1MQ3A 3PO5A 1Q3VA 3RB4A 4DSLA 4YMMA 1QSLA 5J8YA 3C2KA 2KVSA 3B9JA 3T79A 5AHXA 4I28A 3T5JA 1KFTA 1ZQDA 4EZ9A 4LZGA 4Y2VA 1U49A 2E5SA 9ICMA 3MR3A 3KBBA 4RQ6A 2ZIWB 3ONNA 7ICTA 8ICCA 5ALIA 2UVRA 3IP4B 3RBDA 1PK3A 3LVVA 4Y2SA 1ZQ1C 1NJXA 1Z00A 3SYZA 5K4LA 3SEIA 4JV1A 1ZQUA 4PZNA 1ZQRA 4QZ9A 3IG5A 3VCBA 1ZQQA 5KFEA 3H8SA 4UB2A 2MUTA 1IG6A 8ICZA 5BOLA 1HUZA 2JH7A 1NK6A 4KLQA 1TFRA 4GLXA 4QWDA 3IM1A 1S9FA 3THVA 1UA1A 5KFOA 2HBLA 3NGDA 1NKCA 5ALGA 4YQWA 8ICAA 1ZQHA 4O3OA 3QUBA 3IN5A 4YD2A 4QZGA 2BCQA 5AM0A 1KDHA 1X9WA 2IHMA 4EZ6A 5AKXA 4RT3A 1SIJA 5KFWA 3CNHA 4ELTA 5KAIU 4RQ4A 5AM4A 1Z1BA 1XNSA 4QZHA 2YTUA 2ASDA 2CPRA 1B4FA 4F4XA 4DFMA 1O03A 3PR5B 3ISCA 3HJEA 3HP6A 1ECWA 4ED3A 3BQ2A 4DL6A 3BQTA 4I2JA 2KOBA 2W11A 4RNNA 2IA6A 1L6NA 1NZPA 4GC7A 2ZTCA 1SB3C 1ZQLA 2KEYA 1QQ6A 1BPYA 3PO4A 3IRUA 2XVTA 5DDYA 4P0QA 4GIBA 3ZD9A 2RLTA 2AH5A 4NV0A 4EENA 2H3FA 3N28A 3F5AA 2DPIA 2NRVA 3M6KA 5KFLA 2BPFA 2J6UA 2WF8A 1FFUA 4YR0A 3FDSA 5KFPA 1KFDA 2OXOA 2YN4A 2LHTA 5DQIA 5ALPA 2E8MA 2F1JA 5KFYA 2ASLA 4QIWF 2OM6A 4EYIB 2JH1A 8ICRA 4ECRA 4F72A 3NVWA 5J2EA 4YR3A 3RAXA 3QX7A 1COOA 4ZOHC 2LM1A 2ZIWA 4R63A 1QQ5A 1SWVA 5ALVA 3EYZA 4NY8A 9ICSA 2XO7A 3EPIA 1DOQA 3GIIA 2WAQC 3RH4A 5KG7A 1TV9A 4UB3A 5KFAA 4C7YA 4EEYA 3ETLA 4YVZA 4FE3A 4G3IA 3HWTA 3ISBA 4HAIA 5AK6A 3SV4A 1Z19A 2LM4A 3CW2C 3SD7A 4LZDA 4F5RA 4PHEA 1RYRA 1VLBA 4F4ZA 1WWVA 4ECWA 3Q8QB 1SZHA 2R8HA 3QUTA 3NRWA 5CWRA 5AM2A 4EBEA 1PZNA 3T5LA 3RRGA 2BZFA 1UT5A 5J0UA 2VA8A 4Q8EA 4PZOA 5DBBA 3I76A 4UB5A 2UVWA 3ZDBA 3QUQA 1JX4A 3LWMA 4RZRA 3H0LB 1NOMA 5J0SA 1KEJA 3PW7A 5F9LA 1D9DA 2EZZA 2F8LA 4PHDA 3C1ZA 4Z6FA 3MR6A 4B9UA 3IG8A 2AGPA 3BDPA 5EE9A 4C8MA 1ZQYA 4RQ5A 4BX9C 2A19A 3NASA 2D8CA 1N2XA 1HIWA 5J0PA 4M04A 2DKZA 5KFZA 2NV3A 3PW4A 3RB0A 3GIMA 5AM1A 4RPXA 2WB1C 1J2NA 2PMZC 4C0ZA 1BGXT 2HOQA 2LPEA 4DFJA 4PPXA 5AM3A 1ZQSA 8ICPA 2RHFA 1F44A 4I2HA 2ZUBA 2E8NA 3OHBA 4NLZA 2Q4TA 3V6JA 4O3SA 2WFAA 2KJ9A 1COKA 1X42A 1B43A 7ICLA 2J6TA 2I9GA 3LK9A 5KT6A 5CJ7A 3ZDDA 1ZYQA 1SWWA 1WG8A 4B9MA 4F5OA 4UATA 2JV3A 4EX6A 3ZI4A 5BPCA 2KZMA 1HEKA 4GXJA 2F44A 2HHQA 3OSPA 1L3UA 1IV8A 9ICNA 1S77D 2KKVA 4F71A 4DF8A 3PVXA 3HPOA 4BDPA
chains in the Genus database with same CATH topology
1SXDA 2Y9TA 1X66A 5JU5A 4RQNA 3TADA 1B0XA 3KKAA 1SGGA 2E8PA 2EAOA 4PZOA 1V38A 1UQVA 1OW5A 1UCVA 5J8YA 1RG6A 2K4PA 5KNIA 3BS5B 2QB0B 1SV0A 2E8OA 4NL9A 2QARB 5F3XB 3H8MA 2KG5A 2EANA 4MHVA 1WWUA 4IS7A 1PK1A 1JI7A 2EAMA 2B6GA 2DKXA 3TADC 1PK3A 3KKAC 5JTIA 3BQ7A 2KE7A 1X40A 2D8CA 2KMDA 4NJ8A 5J8YC 2DKZA 1X9XA 1Z1VA 3SEIA 2EAPA 3TACB 3IDWA 1SXEA 4PZNA 1F0MA 2E8MA 2FE9A 1OXJA 3BS5A 1SV0C 4RQMA 2QB0A 4NL9C 2ESEA 2LPEA 3SENA 1LKYA 5L1MA 3HILA 5JRTA 1V85A 2F3NA 2KSOB 2QKQA 2E8NA 2ES6A 2F8KA 1COKA 2D3DA 2DL0A 1SV4A 2JV3A 2K60A 2QARA 2GLEA 3BS7A 2F44A 2YTUA 3K1RB 2QB1A 1B4FA 1KW4A 2KIVA 2KSOA 1DXSA 2Y9UA 2LMRA 1WWVA 1LKYB 1PK1B 2L5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SXD A;  2Y9T A;  1X66 A;  5JU5 A;  4RQN A;  3TAD A;  1B0X A;  3KKA A;  1SGG A;  2E8P A;  2EAO A;  4PZO A;  1V38 A;  1UQV A;  1OW5 A;  1UCV A;  5J8Y A;  1RG6 A;  2K4P A;  5KNI A;  3BS5 B;  2QB0 B;  1SV0 A;  2E8O A;  4NL9 A;  2QAR B;  5F3X B;  3H8M A;  2KG5 A;  2EAN A;  4MHV A;  1WWU A;  4IS7 A;  1PK1 A;  1JI7 A;  2EAM A;  2B6G A;  2DKX A;  3TAD C;  1PK3 A;  3KKA C;  5JTI A;  3BQ7 A;  2KE7 A;  1X40 A;  2D8C A;  2KMD A;  4NJ8 A;  5J8Y C;  2DKZ A;  1X9X A;  1Z1V A;  3SEI A;  2EAP A;  3TAC B;  3IDW A;  1SXE A;  4PZN A;  1F0M A;  2E8M A;  2FE9 A;  1OXJ A;  3BS5 A;  1SV0 C;  4RQM A;  2QB0 A;  4NL9 C;  2ESE A;  2LPE A;  3SEN A;  1LKY A;  5L1M A;  3HIL A;  5JRT A;  1V85 A;  2F3N A;  2KSO B;  2QKQ A;  2E8N A;  2ES6 A;  2F8K A;  1COK A;  2D3D A;  2DL0 A;  1SV4 A;  2JV3 A;  2K60 A;  2QAR A;  2GLE A;  3BS7 A;  2F44 A;  2YTU A;  3K1R B;  2QB1 A;  1B4F A;  1KW4 A;  2KIV A;  2KSO A;  1DXS A;  2Y9U A;  2LMR A;  1WWV A;  1LKY B;  1PK1 B;  2L5Y A; 
#chains in the Genus database with same CATH topology
 4Y2Q A;  4F93 B;  5KAF U;  4DWI A;  3TQ1 A;  4BUG A;  2BPC A;  1ZQP A;  2WTF A;  4I2F A;  4UAU A;  2BR0 A;  2KZ3 A;  5DBA A;  9ICP A;  3WKA A;  5KFJ A;  5III A;  4NWI A;  4OO1 J;  3WKC A;  5CHG A;  5B5E U;  4DQS A;  4UAW A;  2IBK A;  2NRW A;  4CE6 A;  2FPK A;  2FPL A;  5D49 A;  3T5K A;  4MHV A;  5J0X A;  4JWN A;  1ZXI A;  4YXM A;  4Y2X A;  1J2M A;  1WCN A;  3G6V A;  4XUS A;  1YZ7 A;  7ICJ A;  7ICV A;  3IDW A;  3BZK A;  4YFK A;  2LBO A;  5IIM A;  1BPB A;  1X2I A;  3E0F A;  4YG2 A;  4M47 A;  4K4H A;  3SEN A;  2W8L A;  5KG0 A;  1NKB A;  3HIL A;  3QXG A;  1LVH A;  4UAY A;  2KTQ A;  4J9L A;  3BJY A;  3EZ5 A;  5KTQ A;  2XGP A;  2W9C B;  4R64 A;  4YP3 A;  5HHI A;  2VJ4 A;  3KHR A;  4KN4 A;  3QNM A;  1XSP A;  5J2D A;  4YR2 A;  1QTM A;  2BCV A;  1KFS A;  1PVQ A;  3JPO A;  4QZ8 A;  2Q0Z X;  3OJS A;  4B9T A;  4MF8 A;  2ZXH A;  3JPR A;  4UB6 U;  4C8K A;  2F76 X;  4TQR A;  3V6H A;  3V72 A;  1XU4 A;  2Y9U A;  3TAP A;  2NRX A;  4O0I A;  2UVU A;  2KJ8 A;  5HR6 A;  1DGJ A;  4J9R A;  3GV8 B;  4K4I A;  2Y1J A;  1FO4 A;  5JU5 A;  1HJP A;  4KLO A;  5ALT A;  2E8P A;  4I2C A;  4B9N A;  4C7Z A;  5L1J A;  1Z4O A;  4M9J A;  2FLN A;  2YX8 A;  1ZQV A;  3IHQ B;  2W9B B;  4IRK A;  1JUD A;  2HDO A;  2W7O A;  2AQ4 A;  3TI0 A;  3GQC A;  9ICE A;  2KKP A;  3RJI A;  2EH9 A;  1SL0 A;  5J2B A;  7ICR A;  2WAQ F;  3ICX A;  7ICI A;  3A0B U;  3KFU F;  4EBC A;  2E1E A;  2LYA A;  3MR5 A;  4NLG A;  1NJW A;  5AI0 A;  5B66 U;  2E3T A;  2F77 X;  2H3V A;  4LJX A;  4QZF A;  1TK0 A;  1SXE A;  3S6J A;  1TK5 A;  3HRD D;  2BGW A;  2OWO A;  1WUD A;  1T4G A;  1BVS A;  9ICU A;  1LKY A;  5JRT A;  4IRD A;  2XIC A;  7ICP A;  5BOM A;  2BPG A;  5ALS A;  1ZQK A;  3N4M B;  2W9A A;  1L3V A;  4Z6E A;  1XSN A;  4F5N A;  2BQ3 A;  4IQT A;  1RM6 C;  5AKI A;  4PGX A;  8ICY A;  5KG4 A;  1MN8 A;  2YB4 A;  4I2I A;  5ALL A;  3KHL A;  4C8L A;  2QAR A;  5C0Y A;  3ED5 A;  4QNL A;  3K1R B;  3L4P A;  3WK6 A;  1ZD3 A;  5AKL A;  4ED6 A;  3M8R A;  4KLU A;  4KN7 A;  2DPJ A;  1NNL A;  2BCR A;  7ICG A;  5CEH A;  4M6W B;  2W9C A;  5HR7 A;  1NKE A;  4X5V A;  4R8U A;  1DK2 A;  1FEZ A;  4ED7 A;  2WB1 F;  3DDH A;  2PMZ F;  2ZIU B;  4JB3 A;  1O08 A;  4UBC A;  4EYH B;  5KL8 B;  3CYM A;  5DLF A;  5KG1 A;  9ICI A;  1SV0 A;  2BQR A;  5EWF A;  3NVZ A;  5KFK A;  1BPZ A;  4ECX A;  4UAS A;  1N61 A;  2JEJ A;  3Q8K A;  2FLP A;  3MFH A;  4XA5 A;  4IS7 A;  1RQL A;  3Q8L A;  1FFV A;  4M9G A;  2ZIX A;  5L1K A;  4ED0 A;  3TAD C;  2EDU A;  5DLG A;  2K4I A;  2JRZ A;  1ZQW A;  1ZET A;  7ICH A;  1EXN A;  1Z1V A;  3C1Y A;  5ALM A;  5DG9 A;  3TAC B;  5KG2 A;  3RJE A;  4DL7 A;  5KT7 A;  4RQM A;  5DDM A;  1B22 A;  1TK8 A;  2KK0 A;  3SAF A;  3T5H A;  8ICF A;  4DF4 A;  5L9X A;  2CN1 A;  3PR4 A;  4KLL A;  3AN1 A;  1MSW D;  3C5G A;  5DB6 A;  4UAR A;  5DG8 A;  5ALO A;  2HSZ A;  3I28 A;  1Q3U A;  2BKE A;  1N5W A;  3AEV A;  1JRP A;  2HHT A;  1ZQI A;  1ZJN A;  4QZD A;  5G5H A;  2W3S A;  3RBE A;  1ZQF A;  3H7I A;  2DGZ A;  2W3R A;  1Z3E B;  5D4B A;  2KIV A;  4I2B A;  5HP4 A;  4QJF B;  4UQG A;  2NYV A;  3IV6 A;  4USA A;  4ECT A;  4Q43 A;  4JUZ A;  3KKA A;  4XQ8 A;  1NZB A;  3R9K A;  1A76 A;  1V38 A;  4PHP A;  5KFM A;  3O0F A;  3NRZ A;  1UCV A;  2JXJ A;  5T14 A;  2XID A;  4J9S A;  3WKD A;  3PW5 A;  4KX3 A;  4UB4 A;  1CUK A;  1ZQG A;  3SQI A;  4ZH4 A;  5A0L A;  1K5O A;  2IOF K;  3ALR A;  4M9N A;  3HKZ C;  4MF2 A;  3RJJ A;  2EAN A;  5AIA A;  4RNO A;  4OJP A;  2HI0 A;  2W43 A;  4M6W A;  4C8N A;  2W9M A;  3KZX A;  4EEK A;  2HCF A;  4PL1 A;  4G9B A;  2XGQ A;  4DOC A;  4O5C A;  4F4W A;  2A1A A;  4RQ1 A;  3ZD8 A;  4KLT A;  1XO1 A;  2I6X A;  2IOH A;  2XC9 A;  3HT3 A;  3N7R C;  3D6J A;  2WF5 A;  3OSN A;  4DSF A;  3FYH A;  4NL9 C;  3TKA A;  1ZD4 A;  4RQ2 A;  4DL4 A;  4IR1 A;  5ALE A;  5E79 U;  2F3N A;  3GV7 B;  2FMP A;  3RR7 A;  4O5K A;  3QE9 Y;  2ISP A;  5GTH U;  3G6Y A;  2JEI A;  3D2S A;  4WJ3 B;  3A0H U;  5KFR A;  2BDU A;  1YZ6 A;  4DLG A;  3KOO A;  4UW9 A;  3F53 A;  2P66 A;  2A1J B;  5AIB A;  4ELV A;  2HVH A;  1URJ A;  3NUQ A;  4XRH A;  2C2E A;  3M1Y A;  5AK3 A;  3RRH A;  2NRZ A;  1ZQC A;  4OCZ A;  4GXK A;  2V4R A;  8ICE A;  3UXO A;  1RZT A;  4B9S A;  5AM5 A;  4B6J A;  2PKE A;  5TIS U;  3NVY A;  8ICG A;  2ZTE A;  2ZJ8 A;  2FMQ A;  4UAV A;  2IMW P;  4F8R A;  5ALQ A;  4YXJ A;  2K4P A;  3WKB A;  3CRX A;  4FO6 A;  1V9P A;  3ETR A;  4J9Q A;  2VIX A;  7ICU A;  5D46 A;  2BQU A;  4DS4 A;  1WWU A;  1L8L A;  1DGS A;  2JR5 A;  3N7P D;  2ALZ A;  5JTI A;  4KLD A;  5KT5 A;  4C4T A;  2ZTD A;  4OD0 A;  1S0V A;  2AXT U;  5L1L A;  2W8K A;  1NK0 A;  2HOI A;  1KQQ A;  4DL3 A;  5CA7 A;  3QU5 A;  4DL5 A;  3AQF A;  3M6Z A;  1SKS A;  4NXZ A;  1SL2 A;  3LYS A;  2K89 A;  3LWL A;  4I29 A;  1NK8 A;  3RJF A;  4ECY A;  2F8K A;  1ZRM A;  4GFJ A;  5ALR A;  4OJ6 A;  5J2C A;  4EEL A;  3MR2 A;  5AKK A;  2C2R A;  1ARO P;  1TAM A;  5GTI U;  4ED2 A;  4ED1 A;  2Y0S F;  1L7P A;  1N48 A;  4QZA A;  3M7D A;  2JGA A;  2F2A B;  1ZQN A;  3BS7 A;  3UQ0 A;  1QSY A;  5IIK A;  3L5K A;  1VDV A;  3B0Y A;  4I2E A;  3RJK A;  2JEF A;  3RFA A;  2OHF A;  2KVC A;  8ICK A;  9ICV A;  2LYB A;  2PFP A;  5AKG A;  4Q8F A;  5J29 A;  2XY6 A;  8ICM A;  4RPZ A;  1KBU A;  4US8 A;  2C22 A;  3GFK B;  3WK9 A;  1K1S A;  2EAO A;  2KNJ A;  3QU2 A;  2A1J A;  3PX4 A;  5KFF A;  1JXL A;  3G6X A;  2FI1 A;  3PMN A;  2P35 A;  2FDR A;  4BWJ A;  5KG6 A;  1PVR A;  3PSP A;  4OJL A;  2E8O A;  5KFB A;  4FS2 A;  1ZQZ A;  4YCX A;  3AM9 A;  2OYY A;  3MGI A;  1YT3 A;  1D9F A;  2N1R A;  3BQ7 A;  1C20 A;  9ICB A;  2XCP A;  4OJ5 A;  3WK5 A;  1X9X A;  5AKY A;  2RP5 A;  4B9V A;  3JPS A;  2MAX A;  2AQ0 A;  4P2H A;  1JAL A;  5C5J A;  4KMO B;  9ICC A;  2G09 A;  9ICW A;  5J0Q A;  1P7D A;  4QZI A;  4MFF A;  2M0N A;  2VJ5 A;  3AU6 A;  4DL2 A;  3TAN A;  5DG7 A;  5J2I A;  3WK8 A;  2ES6 A;  3AU2 A;  4ACO A;  1S10 A;  1RYU A;  7ICN A;  4O3N A;  1C7Y A;  4O3P A;  4J9K A;  1U45 A;  5KFI A;  3BZC A;  2K60 A;  3SZ2 A;  4KLM A;  3HKZ F;  2O6K A;  3NS1 A;  1OUQ A;  3PML A;  4IR9 A;  2EZX A;  3RAQ A;  1XO0 A;  1ZQM A;  4ECQ A;  1DXS A;  4PL2 A;  2EQY A;  1Z4N A;  4GXI A;  1PK1 B;  2QLT A;  4QWC A;  3HX0 A;  2L5Y A;  3K75 D;  4DS5 A;  2XY7 A;  4TUR A;  1NK4 A;  4KLI A;  3OHA A;  2DFL A;  1CRX A;  3H4B A;  3E58 A;  8ICX A;  4F50 A;  5IIO A;  4PJ0 U;  4F2R A;  3C29 A;  4Z6C A;  3FC4 A;  1ZQJ A;  2GO7 A;  2RRD A;  2F1I A;  2K8A A;  2DF4 B;  2KIC A;  5J2G A;  4R65 A;  4DEZ A;  3EPG A;  5J0T A;  2G06 A;  3I1Y A;  3ZDC A;  2KJ5 A;  2IHN A;  3HW8 A;  1JI7 A;  4I27 A;  2H3Q A;  2IOF A;  3SR6 A;  8ICI A;  4M9H A;  2K4H A;  4QWB A;  2W03 A;  2ZIV B;  1H38 A;  4UB1 A;  5DB7 A;  4P4O A;  2G08 A;  5J8Y C;  4C4R A;  2B0C A;  4BXO B;  2EAP A;  3H40 A;  2R8G A;  1F0M A;  2R8I A;  3M9M B;  5AI8 A;  1WCL A;  5KFH A;  2ESE A;  2ZJ5 A;  5KT2 A;  4P0P B;  5KFS A;  3QZ8 A;  8ICS A;  5KFD A;  3MFI A;  1T94 A;  9ICF A;  1D8B A;  1QSS A;  3PW0 A;  5DGA A;  3SAH A;  2YQE A;  4KX5 A;  9ICL A;  9ICK A;  2FPM A;  1SV4 A;  4QW9 A;  1U48 A;  2KN7 A;  1S0N A;  3GDX A;  1ZQT A;  5ALX A;  1RXW A;  5ALZ A;  4BGD A;  3UMC A;  4NM1 A;  2ASJ A;  4I2A A;  2C28 A;  5DKW A;  2NO5 A;  2W04 A;  1TVA A;  3TFR A;  3J81 j;  4DSJ A;  4ELU A;  3AL0 B;  2MUT B;  3OTQ A;  5AKH A;  1XWL A;  2PFN A;  5J0O A;  4M9L A;  4J9N A;  4RQN A;  1ZQB A;  4PHA A;  4ECV A;  3QU4 A;  1UQV A;  5ALU A;  4O9M A;  3MC1 A;  4Y2Y A;  4QZC A;  4UB8 U;  1V97 A;  3PX0 A;  1ZD5 A;  4ECU A;  4RQ8 A;  4DSK A;  4FBT A;  5G5G A;  3F5E A;  4J03 A;  4Y2P A;  4RPY A;  8ICW A;  3E2E A;  3ZDA A;  4ECS A;  2KG5 A;  3N97 B;  3T3F A;  4FZM A;  1PK1 A;  1D8L A;  1L7O A;  1MQ2 A;  4F3O A;  3V7K A;  4NJ8 A;  4F91 B;  5ALY A;  3FM9 A;  3H4D A;  7ICS A;  2BCS A;  2W7P A;  2G5H B;  5AK5 A;  3Q8M A;  2R8K A;  2Z7J A;  1N5X A;  2Y0S C;  2VA3 A;  1BPE A;  3SI8 A;  3C23 A;  3RJG A;  9ICA A;  1RYS A;  2GH1 A;  1KRP A;  4ICA A;  2KSO B;  4RQ3 A;  4A8E A;  5KT3 A;  3UMG A;  4F5P A;  4MEX A;  3MDA A;  2HBK A;  5KT4 A;  5KG5 A;  4TUS A;  4DSE A;  4BXO A;  1N60 A;  2W9B A;  3F2D A;  1IM4 A;  3B0X A;  3MGV A;  8ICU A;  4JV0 A;  4O3Q A;  4P0P A;  3C2L A;  3SAG A;  8ICQ A;  1CEZ A;  2ISO A;  2JMG A;  2K8C B;  2LMR A;  1AQ6 A;  4CNQ A;  1UHU A;  1T7P A;  4CGZ A;  4CF3 A;  3K1Z A;  1IIP A;  2LYH A;  4LVS A;  1J97 A;  2KHV A;  1A6S A;  3TAQ A;  2KP7 A;  2PI5 A;  4JV2 A;  4EBD A;  3NTU A;  1HUO A;  2R8J A;  2V4Q A;  3DEE A;  4TQS A;  1KN5 A;  3UQ2 A;  5EWE A;  2QB0 B;  5AKJ A;  4DQP A;  2HHU A;  5ALK A;  3QU7 A;  4DQQ A;  3KTQ A;  4EX7 A;  1N62 A;  1QCK A;  2PI4 A;  4FBU A;  1NI3 A;  4P4P A;  3QZ7 A;  2FJ6 A;  1U9L A;  4RQ7 A;  2EAM A;  4QWE A;  2FMS A;  4NLN A;  1KSP A;  4I2D A;  3SV3 A;  3Q8P B;  1Q8K A;  5L1I A;  2H3Z A;  1X40 A;  5DQH A;  2BHN A;  1T8E A;  4DFK A;  4P4M A;  8ICB A;  1NJY A;  5HMM A;  3F2B A;  1U4B A;  1NK7 A;  2FE9 A;  1OXJ A;  2YY6 A;  3KHG A;  4FZN A;  2G07 A;  4IC9 A;  5AI5 A;  1ZQO A;  4FFD A;  4J9M A;  3C5F A;  4RU9 A;  2OEH A;  1SZP A;  3UPQ A;  1BPX A;  3QUC A;  1L3T A;  1ZQA A;  4FZL A;  4QZE A;  2D3D A;  1D8Y A;  5HNK A;  1WYG A;  2ZIU A;  1ZJM A;  3AUO A;  2LKY A;  4IQU A;  1RXV A;  3K4G A;  3OJU A;  1K1Q A;  1SKR A;  1KL9 A;  1UA0 A;  1S97 A;  4C4S A;  2YMM A;  2C2D A;  3TFS A;  3BQ0 A;  1S5L U;  1XC9 A;  2MRL A;  4U6P A;  3D2Q A;  2VAN A;  2ZG6 A;  4PGY A;  3PSI A;  2RQ5 A;  5AI6 A;  4M2Y A;  3U26 A;  3WK4 A;  2KSO A;  4QZB A;  4BWM A;  4MFC A;  2HHV A;  3QYP A;  3H8J A;  2WF6 A;  1X9S A;  4DLE A;  4AP9 A;  3TAD A;  2BDP A;  4KLE A;  1QH9 A;  1B0X A;  5ALN A;  2GWS A;  4RUC A;  4E0D A;  2NRT A;  1OW5 A;  2KD1 A;  2AJQ A;  4C80 A;  4MFA A;  8ICV A;  4KLH A;  4YMN A;  4Y2T A;  1GO3 F;  1X9M A;  1RDF A;  1ZRN A;  1U47 A;  2VA2 A;  4GC6 A;  2PFQ A;  2YMQ A;  2PFO A;  5EOZ A;  4YMO A;  5DB9 A;  7ICO A;  5KFX A;  5KFV A;  5KFT A;  5J2K A;  5EE0 A;  7ICF A;  1FIQ A;  5CR0 A;  3JPP A;  5KFN A;  5EWG A;  2HW3 A;  4Y2J A;  5HHH A;  1L5U A;  4Z6D A;  1F5S A;  1MC8 A;  2QB0 A;  2HHW A;  1SKW A;  4KLG A;  2K4E A;  1UT8 A;  4AYB C;  2KFZ A;  1X6I A;  3GU3 A;  1V85 A;  2KHQ A;  2OH2 A;  5EE3 A;  1PVP A;  2HBJ A;  2E1F A;  3JPQ A;  2UVV A;  5J2F A;  2OCE A;  4R66 A;  4BJQ A;  2DBY A;  2DL0 A;  4TUQ A;  9ICQ A;  3F2C A;  1TAU A;  3GIK A;  2A3V A;  2GLE A;  5JUM A;  1Y88 A;  3MDC A;  1M6Y A;  2XY5 A;  1JMS A;  3ZDE A;  5DGB A;  1KW4 A;  4CDG A;  2CXY A;  3OPX A;  8ICT A;  2MU2 A;  1VJ5 A;  2YB1 A;  5H2F U;  3D2N A;  3AQE A;  2JHD A;  4US9 A;  5CP2 A;  1ZD2 P;  3GIJ A;  1L3S A;  4O3R A;  3GZF A;  5J0R A;  1N56 A;  4CRX A;  1L7N A;  4DQI A;  4CF4 A;  5KNI A;  4Y2R A;  3C28 A;  1JN3 A;  3Q8R B;  3NVV A;  4NL9 A;  1KKX A;  5F3X B;  4IL6 U;  2F1H A;  4F2S A;  2ZXI A;  4KLS A;  3MAB A;  3RB3 A;  2YMP A;  2HVI A;  3MGH A;  3FAH A;  3M9N B;  3H0M B;  1XSL A;  5IIL A;  8ICO A;  2V9W A;  2I1Q A;  4JMU A;  2KMD A;  5AK4 A;  1L8O A;  4O5E A;  2RDJ A;  3AMZ A;  5ALD A;  4F4Y A;  5KFU A;  4UAZ A;  7ICE A;  2WF7 A;  3ORY A;  3KHH A;  2J6S A;  4Q44 A;  4HYK A;  2EZY A;  2BCU A;  3OGU A;  3RH6 A;  1X6J A;  1S76 D;  5ALJ A;  2ZJA A;  3PNC A;  3DV9 A;  4F92 B;  1JIH A;  5CRX A;  2B21 A;  4ED8 A;  3GIL A;  1KTQ A;  4KTQ A;  1N63 A;  2AHO B;  4OJO A;  3PX6 A;  4YD1 A;  2G5I B;  2M9N A;  2AGQ A;  7ICM A;  8ICL A;  4J9P A;  3RB6 A;  1DK3 A;  4JK1 A;  3RTV A;  2DQN B;  5J2H A;  8ICN A;  4C8O A;  4IQW A;  3UXP A;  4KLF A;  4F4K A;  2I5H A;  2PXI A;  4I2G A;  2W54 A;  4DCC A;  3UMB A;  4DO9 A;  1TE2 A;  2QB1 A;  5AKE A;  3WU2 U;  1S0M A;  1QQ7 A;  4DQR A;  2HBM A;  5FP0 A;  5KG3 A;  3CP8 A;  1TKD A;  5ALF A;  1S8O A;  1LKY B;  2P6R A;  1SXD A;  1A0P A;  2WF9 A;  2Y9T A;  3PST A;  1X66 A;  3SMV A;  2FLL A;  1SGG A;  4UBB A;  3WKE A;  2XI9 A;  1ZOL A;  2NO4 A;  9ICO A;  3H0R B;  2H5X A;  1RG6 A;  1Q46 A;  4NM2 A;  2D6F C;  3BS5 B;  1QLN A;  5AI9 A;  5KFQ A;  3JPN A;  2HHS A;  9ICR A;  3KZI U;  4IQV A;  1IXR A;  1S0O A;  2QAR B;  2DWQ A;  5ALW A;  2HMX A;  5AI4 A;  2B6G A;  1T3N A;  2DKX A;  2HOF A;  1PUZ A;  5TZV A;  2KZZ A;  2KE7 A;  2GOL A;  1L7M A;  3EUB 2;  4M0A A;  4O3M A;  3V6K A;  5DB8 A;  1LB2 B;  5EE1 A;  3GV5 B;  4QWA A;  2JZB B;  4R8U B;  2ODG A;  1SV0 C;  4PH5 A;  1NJZ A;  7ICK A;  3TAR A;  3RR8 A;  4KMU A;  3V7L A;  5L1M A;  2RDI A;  4CCH A;  3EW9 A;  1ZQE A;  3ISD A;  1KLN A;  4JWM A;  4KIT B;  2XCA A;  2JEG A;  4NLB A;  3RH5 A;  3BQ1 A;  4QW8 A;  2R18 A;  3C21 A;  3N7S C;  5J0Y A;  1NK5 A;  1JRO A;  1BNP A;  2ATL A;  2ZIX B;  4TUP A;  1SL1 A;  4J9O A;  4MEY A;  3PV8 A;  1TAQ A;  4CF5 A;  4IRC A;  4FS1 A;  1XS9 D;  2AGO A;  2P6U A;  3LDA A;  3QEA Z;  3UM9 A;  3EWA A;  2ZUD A;  2YML A;  5J2A A;  3C2M A;  3KD3 A;  3PY8 A;  5DQG A;  4KLJ A;  4DOA A;  1RPL A;  3QU9 A;  5J0W A;  4DFP A;  2H3I A;  4QIW C;  2VKQ A;  2HHX A;  9ICG A;  3UXN A;  4YN4 A;  3PZP A;  1JXE A;  1DRG A;  1CI4 A;  4Q45 A;  4DFD A;  4B9L A;  8ICH A;  1ZQX A;  1MA7 A;  1Z00 B;  3PSF A;  1T3Q A;  3MBY A;  5AKZ A;  5DBC A;  9ICT A;  3Q8S B;  1BNO A;  2K8B B;  3M9O B;  4AYB F;  3V7J A;  2DUY A;  5KFC A;  2MSN A;  4F5Q A;  3RJH A;  2WHE A;  3H8M A;  9ICH A;  2KV2 A;  2LI6 A;  2ZUC A;  3KKA C;  3WK7 A;  2Y1I A;  4NLK A;  3LVW A;  5ALH A;  9ICX A;  4Y2U A;  1NK9 A;  5F9N A;  3JPT A;  2KIW A;  1LV5 A;  4PGQ A;  3BS5 A;  5AIC A;  5J2J A;  4RT2 A;  2G0A A;  3VC8 A;  5KFG A;  3PW2 A;  1UPH A;  2AU0 A;  5CB1 A;  3M8S A;  3RF9 A;  2QKQ A;  9ICJ A;  3L3F X;  2CRX A;  4U7C A;  3QEB Z;  2KFN A;  5HML A;  4RNM A;  5IIJ A;  7ICQ A;  5IIN A;  2JZB A;  5KL1 B;  4DSI A;  1ED1 A;  1A77 A;  4ECZ A;  4K4G A;  2W55 A;  4NLC A;  1BPD A;  4DOB A;  8ICJ A;  4P0Q B;  2MA1 A;  3H8W A;  1RQN A;  4RQ0 A;  4RUA A;  2ZIV A;  1MQ3 A;  3PO5 A;  1Q3V A;  3RB4 A;  4DSL A;  4YMM A;  1QSL A;  5J8Y A;  3C2K A;  2KVS A;  3B9J A;  3T79 A;  5AHX A;  4I28 A;  3T5J A;  1KFT A;  1ZQD A;  4EZ9 A;  4LZG A;  4Y2V A;  1U49 A;  2E5S A;  9ICM A;  3MR3 A;  3KBB A;  4RQ6 A;  2ZIW B;  3ONN A;  7ICT A;  8ICC A;  5ALI A;  2UVR A;  3IP4 B;  3RBD A;  1PK3 A;  3LVV A;  4Y2S A;  1ZQ1 C;  1NJX A;  1Z00 A;  3SYZ A;  5K4L A;  3SEI A;  4JV1 A;  1ZQU A;  4PZN A;  1ZQR A;  4QZ9 A;  3IG5 A;  3VCB A;  1ZQQ A;  5KFE A;  3H8S A;  4UB2 A;  2MUT A;  1IG6 A;  8ICZ A;  5BOL A;  1HUZ A;  2JH7 A;  1NK6 A;  4KLQ A;  1TFR A;  4GLX A;  4QWD A;  3IM1 A;  1S9F A;  3THV A;  1UA1 A;  5KFO A;  2HBL A;  3NGD A;  1NKC A;  5ALG A;  4YQW A;  8ICA A;  1ZQH A;  4O3O A;  3QUB A;  3IN5 A;  4YD2 A;  4QZG A;  2BCQ A;  5AM0 A;  1KDH A;  1X9W A;  2IHM A;  4EZ6 A;  5AKX A;  4RT3 A;  1SIJ A;  5KFW A;  3CNH A;  4ELT A;  5KAI U;  4RQ4 A;  5AM4 A;  1Z1B A;  1XNS A;  4QZH A;  2YTU A;  2ASD A;  2CPR A;  1B4F A;  4F4X A;  4DFM A;  1O03 A;  3PR5 B;  3ISC A;  3HJE A;  3HP6 A;  1ECW A;  4ED3 A;  3BQ2 A;  4DL6 A;  3BQT A;  4I2J A;  2KOB A;  2W11 A;  4RNN A;  2IA6 A;  1L6N A;  1NZP A;  4GC7 A;  2ZTC A;  1SB3 C;  1ZQL A;  2KEY A;  1QQ6 A;  1BPY A;  3PO4 A;  3IRU A;  2XVT A;  5DDY A;  4P0Q A;  4GIB A;  3ZD9 A;  2RLT A;  2AH5 A;  4NV0 A;  4EEN A;  2H3F A;  3N28 A;  3F5A A;  2DPI A;  2NRV A;  3M6K A;  5KFL A;  2BPF A;  2J6U A;  2WF8 A;  1FFU A;  4YR0 A;  3FDS A;  5KFP A;  1KFD A;  2OXO A;  2YN4 A;  2LHT A;  5DQI A;  5ALP A;  2E8M A;  2F1J A;  5KFY A;  2ASL A;  4QIW F;  2OM6 A;  4EYI B;  2JH1 A;  8ICR A;  4ECR A;  4F72 A;  3NVW A;  5J2E A;  4YR3 A;  3RAX A;  3QX7 A;  1COO A;  4ZOH C;  2LM1 A;  2ZIW A;  4R63 A;  1QQ5 A;  1SWV A;  5ALV A;  3EYZ A;  4NY8 A;  9ICS A;  2XO7 A;  3EPI A;  1DOQ A;  3GII A;  2WAQ C;  3RH4 A;  5KG7 A;  1TV9 A;  4UB3 A;  5KFA A;  4C7Y A;  4EEY A;  3ETL A;  4YVZ A;  4FE3 A;  4G3I A;  3HWT A;  3ISB A;  4HAI A;  5AK6 A;  3SV4 A;  1Z19 A;  2LM4 A;  3CW2 C;  3SD7 A;  4LZD A;  4F5R A;  4PHE A;  1RYR A;  1VLB A;  4F4Z A;  1WWV A;  4ECW A;  3Q8Q B;  1SZH A;  2R8H A;  3QUT A;  3NRW A;  5CWR A;  5AM2 A;  4EBE A;  1PZN A;  3T5L A;  3RRG A;  2BZF A;  1UT5 A;  5J0U A;  2VA8 A;  4Q8E A;  4PZO A;  5DBB A;  3I76 A;  4UB5 A;  2UVW A;  3ZDB A;  3QUQ A;  1JX4 A;  3LWM A;  4RZR A;  3H0L B;  1NOM A;  5J0S A;  1KEJ A;  3PW7 A;  5F9L A;  1D9D A;  2EZZ A;  2F8L A;  4PHD A;  3C1Z A;  4Z6F A;  3MR6 A;  4B9U A;  3IG8 A;  2AGP A;  3BDP A;  5EE9 A;  4C8M A;  1ZQY A;  4RQ5 A;  4BX9 C;  2A19 A;  3NAS A;  2D8C A;  1N2X A;  1HIW A;  5J0P A;  4M04 A;  2DKZ A;  5KFZ A;  2NV3 A;  3PW4 A;  3RB0 A;  3GIM A;  5AM1 A;  4RPX A;  2WB1 C;  1J2N A;  2PMZ C;  4C0Z A;  1BGX T;  2HOQ A;  2LPE A;  4DFJ A;  4PPX A;  5AM3 A;  1ZQS A;  8ICP A;  2RHF A;  1F44 A;  4I2H A;  2ZUB A;  2E8N A;  3OHB A;  4NLZ A;  2Q4T A;  3V6J A;  4O3S A;  2WFA A;  2KJ9 A;  1COK A;  1X42 A;  1B43 A;  7ICL A;  2J6T A;  2I9G A;  3LK9 A;  5KT6 A;  5CJ7 A;  3ZDD A;  1ZYQ A;  1SWW A;  1WG8 A;  4B9M A;  4F5O A;  4UAT A;  2JV3 A;  4EX6 A;  3ZI4 A;  5BPC A;  2KZM A;  1HEK A;  4GXJ A;  2F44 A;  2HHQ A;  3OSP A;  1L3U A;  1IV8 A;  9ICN A;  1S77 D;  2KKV A;  4F71 A;  4DF8 A;  3PVX A;  3HPO A;  4BDP A; 
#chains in the Genus database with same CATH homology
 1SXD A;  2Y9T A;  1X66 A;  5JU5 A;  4RQN A;  3TAD A;  1B0X A;  3KKA A;  1SGG A;  2E8P A;  2EAO A;  4PZO A;  1V38 A;  1UQV A;  1OW5 A;  1UCV A;  5J8Y A;  1RG6 A;  2K4P A;  5KNI A;  3BS5 B;  2QB0 B;  1SV0 A;  2E8O A;  4NL9 A;  2QAR B;  5F3X B;  3H8M A;  2KG5 A;  2EAN A;  4MHV A;  1WWU A;  4IS7 A;  1PK1 A;  1JI7 A;  2EAM A;  2B6G A;  2DKX A;  3TAD C;  1PK3 A;  3KKA C;  5JTI A;  3BQ7 A;  2KE7 A;  1X40 A;  2D8C A;  2KMD A;  4NJ8 A;  5J8Y C;  2DKZ A;  1X9X A;  1Z1V A;  3SEI A;  2EAP A;  3TAC B;  3IDW A;  1SXE A;  4PZN A;  1F0M A;  2E8M A;  2FE9 A;  1OXJ A;  3BS5 A;  1SV0 C;  4RQM A;  2QB0 A;  4NL9 C;  2ESE A;  2LPE A;  3SEN A;  1LKY A;  5L1M A;  3HIL A;  5JRT A;  1V85 A;  2F3N A;  2KSO B;  2QKQ A;  2E8N A;  2ES6 A;  2F8K A;  1COK A;  2D3D A;  2DL0 A;  1SV4 A;  2JV3 A;  2K60 A;  2QAR A;  2GLE A;  3BS7 A;  2F44 A;  2YTU A;  3K1R B;  2QB1 A;  1B4F A;  1KW4 A;  2KIV A;  2KSO A;  1DXS A;  2Y9U A;  2LMR A;  1WWV A;  1LKY B;  1PK1 B;  2L5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...