2ESVA

Structure of the hla-e-vmaprtlil/kk50.4 tcr complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
275
structure length
268
Chain Sequence
b'SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, alpha chain E
molecule tags Immune system
source organism Homo sapiens
publication title Structural basis for a major histocompatibility complex class Ib-restricted T cell response
pubmed doi rcsb
total genus 67
structure length 268
sequence length 275
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2esvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2esvA01
1CFQB 2Z35A 4YDIL 25C8L 3RWGA 3CFCH 1KENL 5BRZD 3AROA 3SBWA 2XTJB 3GSQB 5TE7L 5E8PA 3BAEH 4OF6A 4TRPL 5KSAA 3PWLA 1UA6L 4CU7A 1BBDH 1HH6A 2A1WL 4YHOH 1DR9A 2EDEA 5IBUG 1NGQL 3I2CH 1WFUA 3CLFH 1C5DA 4MJ2A 5D7IB 1FFOA 4JRXA 1BIIA 5EC1A 2DYPB 3PHOB 3TBSA 5EORL 3QT2A 2R56L 3UTTA 3T08A 1P1ZA 2IQAA 4C56B 1MAML 3FKUS 1IM3B 3ARED 2BOCA 3IDMB 4Y5YB 1PBYA 4B5EA 4Y16D 4MJ4A 3CXHK 4HFWB 4JO2L 3QA3B 3SCMD 3L1OH 3S3PA 3BDYL 1VFAA 4BM7A 1X5KA 1CL7H 4X6FB 3B2UD 3QPQD 4BSJA 5FHBH 2X4OB 1GH7A 1FORL 2J7LA 1N6QH 2IFFH 4G3YL 2XKSA 4HAGA 4ZFOB 4IDLA 3C9NA 2NNAB 1RUAH 1RZIB 2E6PA 4P5TC 3ZE2F 1MVUB 1YY9D 2H2SC 5HHQA 5C8JB 5GS2D 2GYSA 4EQ2A 3I75B 3UTOA 4WUUB 1JYVA 3STZA 1KXQE 1XF2A 3VMPA 1KPVA 1BBJB 3MNZA 1MHCB 2XFXA 3GSUB 5GJTH 3KDMA 3JBG7 1G0DA 5INCA 2EO1A 4UNTA 1CQYA 5FKPB 4DUVA 3B9DA 5KVDH 1ZHNA 3OAZH 4KQ4H 5I0DA 2GI7A 4X6CF 2F5AL 4Y19B 4XCFL 2G5RA 4ESKA 5E94A 4AIZA 4Z5RA 1BBJA 2EKSA 2KL6A 1TITA 4K8RL 2DQGL 2DB8A 4XB7A 4G8FB 5F96L 3B5TA 2IFGA 1ND0A 3LIZL 4IRZL 4KI5F 1JZ6A 5KVEL 4LLVB 4D9LL 3MLUL 4LLYA 5FOBA 5C0RH 1TZHB 4HEME 1Z3GL 3MRBB 3QAZB 1TCRB 2EH7H 4DKDC 5FEBA 3TYFA 1X7QA 4HIHA 5GGQH 5ID1A 4LFHD 4WI2A 5C9JA 5IIEB 1XGRB 3T2NH 4M7ZB 5I1LA 1NKRA 2CKBB 2F54A 1FYHB 5DFTA 4Y16A 3LKPA 4L4VD 1P1ZB 3JWDC 4G6FD 4C56A 5JOFA 4RMSA 1WITA 1RUPL 3GSVB 1A6TB 3FFCE 3G5ZB 2JLLA 5HHXH 3T0ED 3UTZA 4YPGA 3NMEA 4OD3L 4M3KB 3GMRA 3WIIH 4N0YH 4WWKB 4PTUB 3MOAH 4PJHA 1WIPA 2E8YA 2MWCA 4R26H 3TF7C 5DRNA 1CFNA 2DQHL 2G75B 4HG4J 4GMTL 4YDVA 1OT1A 3PP3H 3BH9A 5DJXA 2R9HD 3WDJA 1V3MA 3TIDA 2AXJA 1RZ8A 4JFQB 3LEVL 1JPTH 2R0ZH 3MCLH 4E42B 3CC5A 3WUWA 4FFVC 1FO0B 5CZXD 4LQ1A 2IH1A 1QRNA 3F7PC 2HG5A 3MRNB 1AHWB 1OWRM 1OGAA 3E6FB 1Y6NR 5FYKL 1G1CA 1EMTL 3L3JA 4Y4HA 1BOGA 3EDJA 2OTWA 2B39A 5F44A 3O3BA 3EHBC 4P9ML 4G6ML 4G9DB 4JR9H 4QGYA 2GFBA 3MRRA 3WO3B 2YK1L 1JFMA 3QWQB 4MA7H 4PJCA 1FL3B 1X5ZA 2J88H 1QNZH 2DBJA 1NAKH 4O2EA 4TN9A 2AJYH 3ARGC 4ZQKB 1FG2B 2ADGB 2ZJSH 1D9KA 2FSEA 3M1BA 4PJDF 2SEBA 4MDIB 4KH2A 1I7RA 2ITCA 1YY8A 1J5OL 3BIBX 5LQBL 4ZTPL 4AEHH 5HVGB 5L7XH 3HFMH 4HGKC 1JNJA 5F7YC 3QEUB 2CUIA 1DQJA 3U7WL 4KI5D 1IEHA 2UZIH 3OTTA 1NBVL 3O6LL 4LARL 1SYVB 1RIUL 2DICA 4ZFFB 4I48A 5EIQA 1MCEA 2MSPA 4WHYG 2DQUL 2EZ0C 2OS7A 4U1LA 4PJIA 5D7JD 3HFML 5IB5A 4RNRA 2CQVA 4J3WA 2H1PL 5E00A 1KLGB 5T3ZD 2P7TA 5IVZA 2R1XA 1HXYA 2P1YA 4MXQD 2UV3A 2C1PA 4HJJH 4NQDA 4P2QD 3FQNA 4YJZL 1RUQL 1X5FA 1KJMB 3G9VA 1T5XB 1U8QB 1FC1A 3LRGA 3GJEA 4KVNH 1W72H 3ETBF 2AJZB 4OQTA 3TYGL 1IC5H 1UFUA 3RI5K 1INDH 5TH2A 5IWLA 1F42A 5CJOL 4DFHA 1AGEA 4TVPH 3GSNL 2FWOB 4HT1L 4DGYH 1HXYB 5D7KE 4PUBL 1G7PA 3LS5L 2CRIA 5D7IE 1OPGL 4Y1AE 1KLGA 4KKBD 4M02A 5F89A 3W11D 1KB5L 2CJUL 4WI9A 5IB2B 1A0QH 2Z31D 4X6DA 1CFTB 5I71B 5IJVA 4PRBA 5I1IH 2HRPH 3UBXB 4WUKL 4RRPG 4EXPX 4RGNC 2H8PA 1TMCA 3TA3D 2YPVH 3C5JA 4KU1A 3PF2A 4NN6B 1A64A 4HDIB 3EFFA 5BS0B 4LASH 4DCQA 5GIRB 1TVDA 1CXHA 4UUJA 5D1ZB 4FMKA 1U8IB 2CK0H 4LOUD 5MEQB 2SEBB 5C0BE 2OMBA 1NGXB 4M7JH 3WLBB 4ISVA 1V7ML 3DRQB 4Z76B 2Z8VC 4CRPA 3B2UC 1D5MA 3N1FC 5FM5M 1HQRB 2DJ4A 3HC3H 1GGIL 3KHQA 1M7XA 4PJ8D 4ISVB 2FJFA 5JPNA 3HG1A 3VDAA 2MFNA 2KBGA 5T33L 1Q9KB 3CGTA 4NKDA 4JVPA 5EC2B 3C5ZB 4WI8A 3IU4L 2P8MB 4X9BA 1T66D 3NZ8B 3GJFK 1X5GA 1XR8A 1AGDB 2IGFH 2CGRH 2FJFB 4TNWK 4S1RH 2IQ9H 2JJSA 4J3TA 3O6KL 5LBSH 1LEIA 3RWFB 1OF2A 2NTFA 3GMMB 3QCVH 2DLEA 3CFBB 4PS4L 2PW1B 3PV6A 5DRNB 2ARJB 1V7NL 1MCHA 3BIAX 5TE6L 3S5LB 4YHNB 1ZT4A 2C3HA 4CMMB 3VWJA 5C0BB 2PCPB 5IWLC 1S5HB 1EPFA 3AU1B 4GKNB 1L7TH 5DJAB 5MP6L 3DMMC 4L9LA 3NCFB 4KHTH 2DLGA 2GJJA 5HI3D 3BP6B 4YIQA 1QQDB 5KSBA 1MCOH 1TMCB 4OFVA 1Z9SA 4BSWB 5GJTL 3ISWA 3TIEA 3V6OE 5J89A 4F15C 1PG7H 5DQDH 5EU6D 4JO1L 5DRZB 2BNRA 3RIAF 2W9DL 3MV7A 5IROC 2R1XB 3I6GA 4LHJB 5JW3H 2DKUA 1WWAX 1QFWH 2GTZA 3D3VB 3WNLA 4OZHB 4LCWE 2GITB 5MERA 3P3YA 1HHKA 4NQCD 3QDMD 4U1NA 1RJCA 6FABL 1RMFL 1XFPA 1W8OA 1BVZA 3ROOA 4HIEB 2ICWJ 2ED8A 3K2MC 4CVUA 1RK1B 3QXDA 4G7YH 4F2MB 4N0UE 4I3RH 2AJVL 1UCTA 4OZFH 3P11L 5E4EB 5DD0L 2VR5A 4NQUA 2A73B 3X12B 3CFDA 2EDYA 2VH5H 4XVSH 4HV8A 3MPCA 3ULUH 3DSNA 1TZGH 4RAVB 3V4VH 3RVWC 3WFDH 5IB5B 5FB8A 2GAZB 3RL2A 4U2ZA 1JYWA 3F12A 5ALCH 1MWAA 1EFXA 2Q3ZA 1G7IA 3QJHB 3ULVL 1AGCB 4JFEB 4WFFE 1U3ZA 1T1XB 3WN5B 5L8LB 3PP4L 1F4WL 2APXA 3WIFB 5A2JH 3AM8A 1PQZA 1R3IL 2ZOLA 2FGWH 4MJIE 5T1LD 2X1WL 3RY5A 3UYPA 2FD6L 4TOYH 4ZUSB 1R0AL 4M00A 1OLLA 2EE9A 2DMCA 3JV0A 3QZWG 4PJ9C 5FUCC 3S4SA 3D5OF 4X83A 1WTLA 4Q2ZA 1OP5H 1FP5A 1P4IH 5F1NB 1Q9OA 5GRZA 4HXAH 4EI6A 1JFQH 3LVEA 3DECA 2WBJD 4FNLL 5I30H 4NPYB 2L7UA 1UEYA 2EICA 1B4RA 2GUOA 4AEIH 1CLYH 3RGVD 2XWTA 2QSVA 3MRMA 4ZG1A 4WCYL 4ZUSA 4Q0XL 3HE6B 4KQ3H 4OZIF 1AI1H 5K9KA 3MLWL 5HHNA 5DFVC 3HI5H 4J4PA 2ZPKH 3MLRH 3HI6L 5T1MA 4M9PA 1QRNB 3CVHL 2QQNH 3JV4B 2VDLL 1YZZA 3CMOL 2A6DA 1ZLWK 1KIPB 5DMKA 4PJ7B 1BAFH 1FL5B 1NLDH 2Q8AH 5T3XL 1Z0NA 4GS7C 4EUPH 2W9DH 2D4FA 2VQTA 3UDWC 1D5ZB 4JO1H 4F8QA 5J9PA 5IB3A 1BZ9B 5D1XA 4EIZC 1KBGH 3B6SB 3BEWA 1LEKB 4P9HL 1RQ5A 1MCOL 4Y4HC 1YEFL 4G7VH 5FKAA 4XWOD 1KIQA 4P5MA 5KS9E 1NCNA 3SGKA 3ULUE 1TVBB 1NCWL 1VHPA 5F7EH 1ND0B 5C2BH 5TE6H 5HGBB 4NBXB 4M7KH 2ARWA 2NY1C 4M1CC 4WU7A 2YKLL 2DI7A 4FQXD 3TZVC 4GG6F 4HUMB 4KZDL 1G6RB 1L0XA 2YA2A 1K4CA 2YPLB 2JCCE 4BK5A 5ITBH 3NTCL 5EU7C 2OQJA 1DSFH 3FT4A 2WBJB 5C07E 3VRIB 3PL6B 2QJDA 4YXLH 4Y1AD 5KG9B 3V6ZB 1DQQA 3VDBA 1ZA3B 1DANT 5J8OA 1QFWI 2X9YA 4LSSH 2HT3C 5E99H 1DUZA 2VAAA 5E8DL 5B8CB 3C9NB 4PLKC 5E2VH 3PV6B 3S6CA 5BXFA 1BJ8A 1S7SB 3BP5A 1UM4H 1QD0A 4XZUA 3OJDA 4XAKE 4H1LB 3LQAC 4OD1H 5CBAA 5CLWA 2VAJA 4J3UA 4XPFL 1V7MH 3CFKB 5CJQH 5D5ME 1KELH 3DI2B 3OR6B 1ZHKB 2JE8A 2VLRD 3L3KA 4MA1C 4BJLA 3BIKA 1ZTXL 4P5TA 3SJVD 5JOPD 2A74A 2XTLA 4PJDB 2D0FA 1YYMH 4FZ8H 3NIFF 1XAUA 4J12A 4MAYC 5F72S 3V8OA 5DUBA 2NYYC 4GG6A 3S96A 3MJ8A 4BSVB 3MNZB 4D2NA 3QIUC 4LLUB 2YPVL 3QUKA 1AC6A 5DK3A 2CKNA 2X5PA 3MUGB 5F6IB 1T0NA 2YHGA 3FO1A 5AZEH 5E9DB 1QFOA 4WUKH 5CKAA 5DJ2B 2NNAA 2BJML 1T2JA 1MFDL 3ZYIA 5EU5B 2BC4A 1MCCA 3ZTNL 4FQCL 1FZOB 4OCMC 4HH9A 4G8EA 4LDEB 4Q6YA 3S88H 2V7HB 1CN4A 1RSFA 4X7SH 3DV6B 1A6ZB 3WD5L 1AR1C 3PWLB 3CD4A 1IJ9A 1B6DA 3QO0B 3WHE0 4NBZB 4F3FA 3KXFA 4PJBB 1AE6H 3N9GL 1CK0L 3MBEA 2WIIA 1NC2D 4Z18A 5E9DE 2Y9RT 4PJ5A 4Y4FC 1I7UA 3RVVC 5BS0A 5KSAC 4XP9H 3O4LD 3O2DA 1HNFA 1Q72L 5DYOB 5FYJE 5EBLA 1UWXK 3U9UA 1LQSR 2C4FU 2Z92A 1S9YB 1R3LA 1KIPA 3OX8B 4JG1L 32C2B 2K9UA 3RA7H 4HPYH 3TZVA 1BREA 4M1GH 3ZDXF 3D6GA 3F58L 4MCZA 3RNKA 4Q9RH 3SKOB 4QRRE 2EDNA 3DMMB 4EXKA 5EBWA 3UTPE 3MBXL 3CZFA 4HJ0D 2BVQB 3W9EA 1FGNL 4GS7B 4DGVL 1QP1A 5JHDD 3MRMB 5MENE 1I85A 3FHAA 2AVGA 4MSWB 3VFOA 5FDWA 3ILQD 2IG2H 3GJEB 1MI5B 4JKWA 3PGDB 1K2DA 4F7CA 3T0BA 4XPAL 2J12B 2R1WA 3LQMA 4I4WA 4HIJA 2UY6A 3MR9B 3IGAB 4UOJA 4PRIE 1EXUA 3EO0A 1RZGB 1EEZA 1KCSH 1HKLH 1FLTX 5IVXF 2ZUTA 1A1OB 4PYGA 2F58L 1NCBL 1INQB 3VH8G 1GJIA 2AAVA 3BQUA 4PLKD 2OSLA 4KDTA 1VA9A 2DLTA 1AGCA 5HPOA 4UILL 4DOHB 1I8MB 4JR9L 4GBXB 5FDYA 2WSKA 1JN6A 1HYRC 5SWSE 3SDXE 5HYJE 4L3EA 4PRNB 4PV9B 1JK8B 4U05A 4UIMB 4JFYA 1WZ1L 1R5VB 1EMTH 3VXPB 5KS9A 1ZANH 3QQ4A 4WI5A 3R8BB 4F80A 2B1AH 1CDGA 1F2XK 3CXDL 3MOQA 5CEXB 1CE6A 4RGMC 4LCWB 3MXWH 4YBLC 4DKEL 1C08A 3MNVA 1IQDB 5BMFL 4I4WB 4JY4A 4Z7UA 4M7LT 4G5ZH 3JWOH 3UYRH 1MCPH 2Y5TA 5C0AE 5E2TL 1F3RB 4KJPC 3WS6C 5HDQH 5I8KL 4JZNA 3PJSA 1T5WA 4KJQC 3RZCA 4JEGB 1TZIB 1G7QA 4NWTL 2BVQA 4WW2F 5CMAB 1U8MB 3MOAL 3TFKA 3I6GB 4N90D 3OAYH 4K7FA 4Z0XA 5E5MB 3QHZL 1HCVA 2E5EA 1NL0L 5D2LB 5ICXA 3LN4B 3GFUA 4ALAL 3QNYA 4E42A 1NBZB 5C0GB 3C8KA 4BSWA 4HIJB 3NFPA 4EDXA 4ONHB 3AY4C 3LH2H 3GK8H 3ZT6A 3RJDA 2B1HH 1WZLA 2FX7H 4HMDA 1I3UA 3RKDC 3VWJB 1MFBH 4KK6C 2R4RL 1FAIL 5CGYC 3KXFB 4PJBA 2WUCH 4G6FB 5DHVA 3GSNB 3MOBL 4OCRH 1AXSA 4YZFF 1A8JH 1HN1A 2EE3A 4P49A 1MLBB 4ZUTB 4UAOC 1XF5B 2CDEA 2EYTB 3KNBA 4GRMA 3OKLA 1S78D 3O41B 4OF0A 5KVEH 3GSVA 1MJJA 5LXGL 4M5ZL 3U9UB 2BNQA 3U0TA 3QH3A 1KT2B 2R2CA 4JO4L 5SWSD 1BVKA 3QUKB 2DL9A 4JVWA 5D2LA 1OL0A 4MX7B 1WBYB 4RDQF 4H5SA 3S37L 1RZKC 4JPIB 1FC2D 3FAWA 3EYFA 5HVHC 2MOVA 4ZO7A 1KB9J 5HGAA 5E1AA 2F53E 2NY4B 5CBAB 1EZVX 5CD5D 5L2KE 5C0JB 4TQEL 5DD5L 5SWZA 4XCNB 3L3HB 4G80B 2J8HA 1TQCC 4OCYL 4PB9H 4S2SB 1U8HB 4OCNC 3TBYA 3R1GH 4JPVL 5ICYB 1U91B 1KSRA 4PJEB 3RRQA 1BMGA 3S96B 4FN0A 2VR4A 3D85A 3LKSB 2VO5A 1ZEAL 3JTTA 2FX9H 4PJEE 2VKXA 2VERN 3MYJA 1ZS8B 2OBGA 3QUXC 4DN4H 2J1KA 3CK0H 2CKBH 3BP5B 5IHUH 5B8CA 4FXLA 1NBQA 5ID0A 3DGCR 3K46A 4UMGA 1RURL 4QTIL 4MQ7A 4J23A 2HP4A 1AGEB 2FEDC 4XNXH 4YBQC 2OP4L 4L3CB 3U48A 3AS2A 1YMME 2B7DT 4UT6L 1Q9WB 3TPUB 4YHZH 1WUNT 1S78C 1EX0A 3FQUB 3V79C 5T1LB 1EIBA 1CYGA 1KENH 5H37H 4Z78B 5DHXB 5DS8A 5JQHC 5HJ3A 5SWQA 5JHDA 5MEPA 4WI7A 3KYMB 4X5LA 1ETZA 4W4OC 3VFVA 1UWGH 2P7TB 2V17H 4QRPE 4H0GA 5D7JA 4XH2B 5H35B 5I15L 1A1NB 1NJ9A 3H8NA 2DYPA 4OCXH 3L3GA 1U3JA 4N8CH 2Y7QA 2LU7A 1A6PA 3TT3H 4NCC1 2YWZA 5I74B 5E8NA 4MNHB 5F88B 1MNUH 4YDJA 1CXLA 4K94L 2ESVA 1EJOH 1U8KA 4P2QA 5I2IB 3GSQA 3B6SA 3BEWB 4UT7H 4JQIH 4OB5L 3ZKMD 1BZ9A 1PD6A 1XEDA 1IGTB 4KTEL 1LVEA 4ZAKB 1E4KA 4H8WL 2XY1A 3N06B 3WJLA 5IOPA 3EYUH 1FSKB 3HNVL 4H26A 4RMRA 4CADA 1FL3A 3AS0A 1HYSC 4TYUA 1E27B 4V1DD 4JGMA 5CZXC 5EU5A 3WXVL 2RFXA 4RFNB 5A40E 5EA0L 5T1KD 2A6JA 2X70A 4LKXA 1NAMH 2HFGH 1YPZB 1FVCA 3CH1A 3L5WA 2IBZX 2WY3A 4NJ9L 4XXDB 3RPIA 4XC3L 4KRPD 5DD1H 5IG7B 1LO2H 3U2SA 4KROD 3UROR 4C55A 4UU9B 1U8JB 2FJHB 4LK4A 4OZIA 3ULVE 5GGVL 4NDMA 2NZ9C 2QADD 1CLOH 4P23C 4YBQD 3U83A 5IMLA 2OLDA 4EOWH 3AUVA 3OR6A 4OCXL 1JNHB 2P5EE 3FOMA 4AYFA 4D0DB 4OV5B 4IRSA 5EBGA 1CD9B 3L5XH 4YNYA 1FIGH 1I8IB 4GOSA 2O5ZL 4RISH 4IOFC 3OKDA 1ACZA 2D7MA 5D1ZC 1S7VA 4OF7A 2VZOA 5ADPH 2CK2A 1F13A 4R2GB 3STBA 4XAWL 3MRPA 2Q8BH 2NCMA 1R3HA 3V6ZA 1I8KA 4G43B 2Z93B 1KGCD 3U82B 1ZV5A 3NBNA 1HHGA 4X98B 5CSZA 5EUOB 1HSBA 3PQYD 2DYPD 1H3GA 3JWDL 3PDGA 4KKLD 1A7RL 5I19H 4ZD3L 3IFNL 4PJXF 5H35A 4ZDHB 4Y16B 3T3PF 4HV8B 5ACZA 1S9WB 3UJTL 3VW3L 1T3FA 1F90H 3D0VA 3WHXA 4FABH 1S9WA 5MEPB 3BD5A 2VDOL 5JHDB 5SWQB 4LPWA 1QBLH 3LQAL 4WHTB 3BP6A 4JJ5A 4UDTA 5J12B 1IMHC 4ZXBC 1IC1A 5FYLL 4GW1B 1Q9WA 4LPYA 3MA9L 3PWNB 2WV3A 1IZKA 5D5MB 4UNVA 2HVJA 5I8CA 5AYUL 1GC1C 5ESAA 2BSRA 4MZ2A 4X7TB 4DZ8A 1CLZH 4JFZH 3HCVB 3SKJL 2GITA 5MERB 1ZVHA 1S7VB 3RY4A 2ARJA 3IS1X 3WV0A 2NW3A 5I16A 1ACYH 5EU7E 2AJXL 3SE3C 4I0PD 3RWFA 4WUUE 4Y19A 3B9KA 4GJTB 1OAUH 4RFEA 3ZKQD 3QNXA 4OSUL 4IRSB 1CWVA 1OCWL 3NPZB 5AD0A 4RGND 4UTBL 1I9JL 4Y4FA 5L8JB 5I8EA 2A6DB 4XPTL 4YGVA 1CFBA 2G2RA 4KKAC 1JGLL 4YIQB 1CF8H 1QSFE 1CL7I 4JLRA 1FRGH 1RZJC 2R0KH 2JCCB 3AU1A 5JW4R 3SE9L 5IB4B 2K1MA 3HZMB 1DBJH 4DTGH 3QBTB 3D1MC 5JPNB 2IH3A 1R5IA 5B4MC 4Y2DD 2HMIC 5EPMB 3PWJA 1FPTH 3NZHL 1EGJL 5DZLA 2BNQE 3O3UN 5D96B 1OSPH 4PJFA 1NANI 2IEPA 3QULA 1OTUC 3NACH 3F62A 3UTQB 4GKSA 5DR5L 4GRWB 4GAJL 3D39D 3GHEH 4IBLT 1TJHL 2DLFH 2HT4C 2AQ1A 4NZRH 4MQSB 3C5ZA 4IJ3C 2EIEA 5EOQL 1WZMA 3SDCB 4O51A 2Z9TA 1N3NB 5EOTA 4PG9B 1MEXL 3P0YL 3SDDB 5E8NB 3VMOA 3V8CA 1GC1L 4HK3N 3ARBA 5DD5H 3F12B 4BUHA 5IHBA 2ZG3A 3L3GB 3PL6D 4R0LC 3QDHA 2L4OA 3QNZA 2X4NB 4G6AD 2QR0B 2YWYA 5INDB 3RL1B 3VRLE 4ELKA 5A43C 4GAGL 4PJGB 3FQRA 1M7IB 3OAYK 5I8KH 5E8OB 5HDQL 2VITB 4HMCA 1OWWA 3W39A 1JYNA 5JZ7D 1MCPL 3TO4C 1MELA 2AXHA 3RVWD 1KC5L 2E7LE 3C2AH 2PYFB 2X4RA 4Z8FL 4XBGA 1BLNA 1DL7L 4M5ZH 2NY2B 4D0BB 4KRPB 2ZUUA 2XKNA 3QRGL 3ILPA 4YXHH 2H9GB 3C6LD 2XWJB 5LAXA 2LAGB 1UG9A 4MD0A 1I1YA 2UWEA 3VD4A 1IAIL 3BHBA 2OL3H 1S5IL 4PFEA 1A3RH 5T3ZL 3DRTA 4LSQH 3MCG1 5CMAA 4K3HA 4YDLB 2EO9A 5JW5B 1LE9B 5D71L 2NR6C 4E0RB 1MFBL 2VR9A 5K9OB 1ZLUH 2BK8A 1NCUA 3ZL4L 3SGDH 4I48B 5T1KA 3B9VA 3T4YB 2GKIA 3GK8L 4WFED 1DBMH 1JNNL 3ARDB 4TTDD 2V2XA 4PGEA 2H26A 5EIVA 4JHWH 2F8XC 1Q0XH 1HH9B 1IM9A 4B0MM 4OGYL 1YN7B 3FQNB 3IAQA 4HJGA 3JVGA 3LPFA 4POZD 5KAQF 4ALAH 3TBYB 2Z4QA 4CJ1A 4QHMA 1N6VA 3FHQA 5J12C 5TPWH 4WTWA 5IVZB 5SWZE 1RZ7H 1F02I 3QDMB 4WGVB 4CNIB 4NO3B 1K4DB 4LCCC 1IAOB 1IKFL 2VXSH 3QI9A 3LSOB 3HUJF 4NRXA 4LEXH 4O4YL 5C08A 5BMFH 5J3HD 2G9HB 2B2XH 3LKRA 2Q7NA 4D8PB 4P46D 2ZZUT 2ATKB 4NN5B 4F7MB 3V9FA 3RA7L 5I73C 3WUWB 1I1FA 4IRJA 3QH3B 4FTVB 1LQVA 3UPAA 4M48L 1A3QA 1YC8A 4HX1B 1A7OH 1IGCL 3MLTA 4YHLH 4EDWH 3GIZH 1C5BH 3KNBB 5GQBA 3QUML 1OTTC 3VE0B 2QHRL 1GYAA 4HUWB 4N1EA 4M43L 4PRPA 4UILH 5HHMB 3ZSTA 2NXZC 2NY0B 3BGFB 2EDBA 1FRGL 3RWHA 3W9EB 4OF5A 4ZTOH 3RBSA 3HN3A 5E2JA 4Y4HB 3MLZL 2ZSVB 2E27L 1CE1L 2R23B 4HWBA 1GGCH 4QXUL 5GS0C 5JLZA 1GGTA 1KJVA 1A4KA 2MQCA 2P24A 1K8IA 4NQCE 3TBWA 5ISZB 5BVPL 1KIRA 4JFQA 1T7ZA 5CEZL 1OTSC 1S9YA 1M6OA 4OZFG 5HHME 5DYOA 5D7SH 1K8DA 2IG2L 4I0PA 4D9RD 1MHHA 4NZTH 1I7UB 2G75A 3BKCH 3R06B 3IJSB 4HHAA 3LCYA 5B3JF 4NZDA 3QUXA 5C9JB 1G6VK 1IAII 4KK8C 3MA9H 3ZKNC 5L88H 2GCYA 1HILB 5IR1B 3F5WA 3MODL 4WWKA 4PV8A 2HVJB 1U8NB 2H45A 1EBAA 4WVRA 1NGPH 2J8OA 3FO0H 3PWVA 3O3AA 3SGJC 2NX5E 4PB0L 3MJ9A 4R7DB 2DL2A 1EFXD 4XBEL 1KJMA 4TUOB 2HVKB 3CFEB 5C86A 3O2DH 4H8WC 4A2LA 1Q72H 1P4LA 5KVFH 4JDVA 3TBVB 4QWWC 3SE4A 1HCFX 1IEBB 5BRZA 1AJ7H 2W0PA 1DLHA 5HPMA 2G60L 1CICC 1RU9H 4M8VA 1AE6L 3BIKB 4XPBH 3TVMB 4JKPH 2R0KL 4MJ5B 2HRLA 5K59E 2BOBB 1JTTA 3P2TA 1A5FL 3IU3A 1MFCL 3DROA 4OF8A 1I8MA 4KZDH 1JGLH 4XNYH 1J86A 4YEFA 4PP1C 1I9JH 1C7SA 4W81A 3CSYB 1F4XH 3REWB 3U79A 1P9MA 4G43A 1I8KB 2XFXB 1TZHA 1S7SA 2ESVD 3GSUA 3H9YA 4M7KL 3WHXB 4YHKH 3IETA 4GG8B 3A6CH 1GGUA 1WZKA 1XGTB 3W0WA 4EBQH 4L4JA 2CO6B 3FT2B 2EXYC 1ZVYA 2BSED 3U30C 3PL6A 1G9NH 4GSDL 4JM2B 4JKLA 3M45A 4O58H 3TA3C 1IGIL 1J9CT 1JNHA 1JI1A 4X6DE 5D6DC 5DFWH 2W0KA 4PRAB 4OKVB 1MCKA 1J0KA 3UJIH 1U8JA 2FJHA 1NAML 2HFGL 3IJYB 1UM4L 3O8XA 1P69B 4MAYA 1MHCA 4D0CB 4BZ1L 1BOGB 4DOHE 4PJFE 3E2HC 1SMOA 3V7AG 1J1XH 1FQ9C 4MA8H 3HRZA 4XP4H 1A6WL 1W2KT 2QSQA 1TVHB 3U46A 3LOWA 4UOW0 4GFTB 3B4NA 3T0EB 4RQQB 2A0LD 1YEJH 4QXTB 1KCUH 2V7NB 4KTEH 3V6OC 4U0RC 1N64H 5IOPB 2DIAA 3QEHA 3BVNB 1FO0H 1TQCB 3DETD 3QAZC 1JWSA 1JGDA 4OB5H 1X4XA 4MQXD 1BQHG 4XVJL 4BZ1H 2NX5D 3RKDD 5BS0E 3C6LB 4KGLA 3FFCA 3BMWA 2YRLA 3VFRB 3QQ3B 4AEIL 5KANI 4EJ1C 1OAYL 1YNTB 3DI3B 4UDUB 3BPCA 2O26U 3OKOB 3FO9A 3ZDZF 4O58L 4QOKE 1IM3A 2BSTA 3BWAB 4YR6A 4MNHA 1GZQA 3ARGD 2NXZB 1KTDB 3GSRB 3GM0A 4KFZC 5I1EH 5FGBA 1XF1A 3WEXB 2C7UA 4OV6F 2IAND 4JFPB 1KNOA 3WN5C 4NQEE 4XNZB 3VFVB 5HYJB 2V9RA 4KC3B 4QXGH 1W0VB 2O5XL 1JGUL 4TSAH 1FNGA 4N68A 1NDGA 3QEHB 4OF3A 3V7MA 1AY1H 1A5FH 4Y4KB 3P40A 4H0IA 4OJFL 3RWJB 1AD0B 1TZGL 4YC2B 3VD5A 4NQSB 5E7BA 2JELL 2X7LA 2WLYA 2P47B 3HLAA 4ODTH 2AV7B 5ITFA 4WEBL 1OSZA 3S4SG 1HIML 3PXHA 4MXQC 1F6AB 1DUZB 2EC8A 3MLWH 1MIMH 4PLJD 1RD6A 4N9GB 1AI1L 1BQHA 5F21B 2HTLD 2C4FT 5TF0A 4Z5RB 2HT2C 4PRPD 4OLWH 2BX5A 3X14B 2HLFD 2WM0A 1ZEAH 1BGXL 1S7TA 4JPWH 4NM4L 4OKDA 5IW1B 5CD3A 1YJDL 3QPXL 3T8XB 4L4VB 4NT6B 4K9EH 5F1IB 3FQXA 4XNQB 1BJMA 4PJ5E 3EO9H 3LKSA 4QRRB 1P4IL 3MX0A 4OCYH 1WAAA 5JIHA 1ZXQA 2QQQA 3N85L 3L7EA 3RX7A 2WMPA 3LS4H 1ZS8A 4OGXH 1F4WH 4RCAA 2FBJL 3ROOB 4P23D 1H9VA 4BFBD 1L7TL 4XNYL 4LU5H 3MLZH 4DN3L 2JJUA 2X10A 5JQ6L 2AXGA 4JRYE 3RGVC 3WKNA 4HXBL 5JNYA 1NSNH 3KPLA 1D5BB 4MHHG 1RHHB 2OP4H 3OXSB 5FECA 1U9KA 5EUOE 5T3XE 3DUUB 4P3DA 1DN2A 1FYTB 2F5BL 3GMPB 5D2NA 4TUOA 5LXGH 4IDJH 4J3OC 3MRFA 3IDMA 5F7DB 3O6KH 1A7OL 5E24E 4F9PC 3TIEB 4JFXA 2Y07L 5IHUL 2P8PA 2APFA 3CK0L 2FHFA 3DX7B 3D87B 1B0RA 1LK2B 4R97C 3HMXL 4O02H 3KPSD 1TTUA 4OBSA 3IDGA 4MJ6A 4NM8H 1HH6B 4APQA 3P9MB 2E7LA 1QSFD 3EJYC 5JA8B 1TTGA 4J4PC 3Q6FA 5IBTL 2QKIB 1N2RB 3RUGB 3BJ91 5FO8B 4J3SA 3U0TB 5DK2B 3QIWC 4R2GD 4LF3A 1AXIB 1MH5A 1FZKB 1T83C 4LMQI 1ITCA 1IC7L 1FZKA 1WTGT 2PNDA 3MV9E 2X40A 3SO3B 1WF5A 4EUPG 3T65B 3O45A 2RJMA 5DHVB 5F7UA 2P5EA 1Q1JL 1W8NA 1X5JA 4D8PA 2JK5A 2VDRL 4KV5F 3QIUD 3NCMA 1Y6MR 4PLJC 1MFAL 1EK3A 1MCFA 3ZL4H 1P4BL 4F7TB 4M43H 1K4DA 2DQJH 4WV1C 1NQBA 4MA1B 5A16B 1E4XI 4FFZL 3BJLA 5KOMC 1UZ6F 4XRCB 1AP2B 3TJEH 4LSQL 3MV8D 5B38B 4X9HA 4S1RL 1YEEH 3PHQA 3X11A 3QR2A 3GMPA 5D6DA 1T1YB 2IPUK 4P2RD 3WE6B 4NRXB 5GSVB 1WZ1H 2R15A 5IM7A 1CICB 1LO3L 3UTSA 1BX2A 4KAQH 4M03A 2VQUA 1CBVH 3MGAA 4LEXL 4O4YH 1JZ8A 1ONQB 4XBPB 3GMNB 5IFAH 1XF3A 4ONGL 1WBXA 1ONQA 4LHQB 2XN9B 4K3GA 4LSVL 1GGIH 4XHJD 3FFCD 1H8OA 3GSOB 4WO4B 4RGMB 4LCWA 5IM7B 4Q74A 2GTZB 1TCMA 5KSUA 1YN7A 3QQ9D 2PKDA 1HH9A 4OFYD 4XVUC 1DE4A 3C5ZD 1A02N 4MXVF 1EEZB 1R5VA 2FEDD 3WXWH 2R0LL 3MFGB 2QSTA 4JRXD 3UXFA 3MMEA 3RKPA 2YOCA 1RIUH 2NY5C 1JNNH 1F2QA 1P6AB 3EKCA 4KKNA 4GW5A 2OI9C 3RNQB 1BZ7A 3B3IA 4DGVH 3FRPA 5FOJA 1I9IH 1FGNH 2DI9A 1TJHH 5I1DB 5CS7A 2JF1A 1T21A 2W9LA 1CBVL 3SJVB 1AD9B 4X7EC 2LVEA 5IQ9B 4NCC2 1RZGA 2QR0A 4ZFZA 1R6VA 5C6WH 2CLVA 3LS5H 4X0KA 4RBPK 3TNMB 1P6FA 2J88L 3P77A 5D1QA 3N1GC 3TZVB 4TVPL 4LSRL 1QZ1A 5KVGL 2FO1A 2PXYC 1INDL 2Q6WB 3RZWA 2XTJE 2AEQH 5SWZD 4IDJL 5JIKA 4KVNL 5D7LE 3C2AL 1KC5H 5FYKH 3ZTJH 4LCYA 1DQJB 4ZOCA 1HNGA 1E6OH 3OKMA 4JN2A 3B5GA 3H0TA 2B4CC 2VDMH 4APQB 4YBHA 5DQ9B 4X7SL 2XACC 4I5BB 3FN0H 1OGAE 3WEXA 1VPOL 5DT1H 4P57B 4DKAA 1JPST 5JXEA 1KTDA 5DMGD 4JFHD 5ANMA 2I60L 2RHEA 1QYGH 4EUPB 3ARWA 1EAPB 4FXKA 3TFKC 1KN2H 4N0UB 2A6IB 3EOBA 1FNAA 5EIIB 5D2NB 1IAMA 3GSWB 1ED3A 1WIUA 4Q6IA 2OTPA 2UZIL 2CDGB 1K3IA 4LBEB 5AYUH 3KPLB 4L3AA 4NKMB 4LDLB 4LHUB 1A6AB 2FJGB 5E03A 3QULB 5LQBH 4P2YA 1I7ZB 3VXMA 4NM4H 1RUML 4ZPTA 2FZ3B 4KMTH 1FVEB 1U8PB 1BM3L 4KJWC 2VUYA 3GGWA 4DK6A 3BFOA 5KAQG 1AC0A 2DS4A 5GGVY 4KZEL 5D2NE 2OYPA 3FO2B 4P2OA 4ODBD 5ISZE 2OZ4A 4IOFD 2DOCA 4NNYA 3KYOB 3SDXA 1G1YA 4U3XA 2NXYB 4YPJA 4X5WB 3E3QA 2F5BH 4Y89A 5D70L 2FWOA 4D9QE 3TNNA 1N8ZB 1T0MB 2VABB 4QO1A 4P4KD 5ESAB 4YGVB 4V1DE 5ITBL 2AEIT 3BESR 1EHNA 3G5ZA 4D9LH 1FLRL 4LU5L 4XPGL 1F4YL 4Z7WA 4QXGL 1AR1D 3EDFA 3MRDB 3GIVB 5I76A 5F9DC 1YQ2A 3S37X 2DQCL 3C60B 5DJ8A 3SGJA 2BCKA 1NDMB 4W4NA 2VDNL 3SDAC 1ORSB 4ODUB 1JF6A 3HG1E 2DBLL 1YMMD 3D39B 4I3SL 3QB7C 4QGTA 3KJ4B 5I1CH 1CLZL 4P9HH 3GUTB 5DRXB 3WIHL 2V2WA 1KELL 1A3LL 2VN7A 5F1OB 4A2MA 4POYA 1LO2L 3OG4B 1T1ZB 1RVFL 3UAJC 5BRZB 1NDMA 2D7QA 2KZ1B 4OLWL 4LEOA 4Y2OA 1FCCA 2DQIL 2ERJC 3I6KA 4XVJH 4Z77A 4G3YH 3TN0A 5HGHA 2C1OB 1NLDL 1BAFL 2Q7YA 1C16A 2DDQH 1LNUB 5B8CC 2UWEF 3QIWD 3NIDE 5BOZG 3QDGD 1V5JA 1FG2A 2ADGA 1LD9B 1EV2E 2I25N 2JELH 4LP4A 3BISA 4EI5B 4WFGD 2CLZB 1HILA 3NTCH 5IR1A 3PL6C 4Y5YC 3FO9B 4PJBF 3BEVB 4KQ3L 3KLDA 5SWSA 2X4TB 2Q8BL 4PJCF 4K94H 3D69B 4JJHA 5EG6C 5I74C 2Z31A 2F9BT 2O5XH 2R56H 3BKYH 1FVCB 3CH1B 3L5WB 5FXCH 4K8RH 1O0VA 4XPHL 2XWTB 2ICES 4FFWD 1E27A 3FCTB 1CGVA 1TIUA 1KIRB 3ZE0E 4KVCL 4P5KA 3D25A 3VGFA 4YHPA 5IW6A 3TIDB 1LMKA 2V17L 1WK0A 4H20L 3D3VD 3DX8A 3S36X 3ZHKA 1BFOB 3SPVA 4YDKH 1A9EA 3TO4A 3FONB 4HWZB 2P48B 3MXVL 4NKIL 2HJKB 5E70A 4CADB 1JI2A 3Q2CA 4TTGA 3MLPA 3K8KA 4JM2A 1N4XL 4HG4K 3UTZB 5D93C 3UO1L 2ID5A 2HN7A 3EUUA 5IW6B 1N64L 3E6HA 3ARFB 1OP3K 4B7IA 2GAZA 1KCUL 5IMKA 4S1SL 1XIWC 1HE7A 2FEEL 5GGRA 1A1NA 1NJ9B 2A77H 4GXUN 3P11H 4XP1L 1KF9B 3UPRA 1QSEA 2XZQH 1G7HA 1NMCC 3BDYH 2CPCA 3BYTA 3EOAB 3NCCB 4MA8L 4XP4L 4XBEH 1CFSB 1G6RL 4R4FL 4FP8L 2A6KB 1SY6H 5F1SA 5ANME 1GXEA 4KTYA 5DFVD 5H2BB 4JQIL 3G6JF 1OHQA 3V0AC 1AKJD 5E08L 5D1QB 3ZMRA 4FNLH 4PTTB 4RA0C 4B41A 5FHAL 4RAVA 4HPOH 4JPVH 3VWKA 4U6TA 5IQ9A 1HHKB 3EDDA 4MQXC 4WFGE 2D31B 1NCTA 1H15A 1GAFH 2PYEA 3QEQA 1UWGL 1GOHA 1YPZF 2MHAA 4L9DA 4HS8H 1O7VA 1MY5A 2E9IA 1YN6B 2YMXL 5MP6H 1GGCL 2K7QA 2X89D 2ADFL 3SGDI 4M62L 1MOEA 3RDTB 1DN0A 5FYLD 4DVBA 4YHZL 5A2FA 4JFFD 1K9TA 3U7AA 4K23L 1CU4H 3WFDL 5C6PB 4JKPL 4G8GD 5I6XB 4BELD 4CN4A 2OTUB 2V5RA 3QRFM 1MAKA 3ZKMC 5I1AB 2OL3A 1QBBA 2FL5B 1PSKL 4J7RA 3O9WC 3RIFK 2EE2A 1OOAA 5C2UB 3NABL 1Z2KA 4G7YL 4WEMB 4XB8A 3FT3A 3TBTA 4C58B 1J0ZA 4GMSH 4QYOB 4AMKH 4ZPTB 3IF1A 3VG9C 3PG2A 4HKZA 3FN9A 5FO9A 3QXAB 1RMFH 1KCRL 5AEAA 2B2XL 4WTXA 4Y19E 2R2BA 4F7PA 1IM9D 1JHKL 4HD9A 4AM0A 5J11B 5DDHB 3RL1A 1JNLH 4TULL 2GTWA 3VXSB 2VN4A 3KJ6L 4LHUG 1IT9H 1M71A 1IILE 2AJSH 2X4QB 2HTLC 3GMMA 2O61A 2BNQB 2ICEB 4EKXA 1BD2B 2D7PA 3OAZK 1WQVT 4NYLB 2OK0L 4JANB 3Q5YA 1NL0H 5DQJA 1GOGA 2M8XA 5CGMA 2C9AA 5BVPH 2BMKB 1UJ3A 12E8H 3PGFH 4JN2B 5E5UB 1G9MH 4Z7QE 1PG7W 3BRFA 2G9HA 3MUY1 5DI8B 4LBEA 4NRYA 3O45B 2EC9T 3QG6A 1FL6B 1G7MB 3V52L 1AXTL 1BECA 1ED3B 4HKXA 2YUXA 4ZTOL 4NO0B 1NEZB 4HKZB 1BPVA 2E9BA 1K5NA 1LO4L 4DAGH 2F19H 3C5JB 4X6BB 4JO4H 5ILTH 2EYTA 3P77B 1JZ5A 5IMMB 1RIVL 3GRWA 4QRQB 5EPMA 5C0GA 4BKLA 2P45B 5CWSA 3CXDH 5BZWB 2IADB 3IVKB 1AXSB 3RHWF 4MDJB 1NUGA 2JTDA 5D1XC 5FYLE 3VFGL 4WDIA 4UUJB 3CNKA 3D2UD 1UCBH 1H8NA 5HYQA 4WHYH 4M7ZC 1DTUA 3EYSH 3IDGB 4MJ6B 1FNEB 1IC5L 4OZGA 4UI2A 4HDIA 3O6FD 3RDTA 2BDNH 1BQUA 1E0OB 4DVBB 2I24N 2LQRA 2VLKD 5TH2B 2YD1A 3MRJB 5T33H 3UX9B 4OZHF 3C8KB 2WZPD 2VXSL 5CUSL 1QSVA 5K9OA 1N0LA 5FYJU 2WQRA 5IVXB 1GOFA 1YEGL 1F5WA 3OR7B 5IFHH 3P4NA 4OZIE 3FZUD 3DRTB 4G6JH 2NXYD 1RHHA 4OCSL 2V9QA 4QT5B 4GO6B 4UQ2A 3S36L 2DQEL 3PP3K 5ADOL 3TWCH 5I1DA 4OGYH 1B2WL 2W0LA 1H5BB 4LASL 1FFNA 1SVZA 4JHWL 4U6VH 2AJZA 4HSQA 4QTHB 2XIDA 3MJ6A 3MUZ1 5EOQH 2MPAL 4WHTA 3S3SA 4A6YL 1Y0LB 2J8UB 3RWCB 5B39G 4U7KA 5E2TH 1IQDA 5J6HA 5FIEA 2A6KA 4F15B 1INQA 1EBPA 4G6AC 4NN7C 3U36B 1UYWH 3NFSL 5ACZB 3KPPA 3DUSA 4OD2A 1QRND 4M1GL 5E00B 3NCJL 3SQOL 3HR5A 4L29B 5C0FA 1EXUB 4XRCA 1A6UH 3PNWB 3VXRD 2OCFD 3P73A 5IROA 4L4VA 5CP7B 2PR4H 3AAZA 3QRGH 1ZMYA 4YXHL 4G6MH 4ZFFA 1HHHB 3DYOA 3WSQL 4PJGF 3TPUE 4QY8B 4GXUM 1A6UL 4PJ7E 4QT5A 5FYKU 1CICA 1TDQA 4CKVX 4ZS7H 5TF1H 1G7JB 5EN2A 5D8JH 2R0ZL 3MCLL 4XPTH 1UYWL 3SKOA 4N90E 4HC1A 3EZJB 5HXMA 3JV6A 1KCSL 4WY7H 3VD9A 4ZUUB 1FBIL 4MNQA 2NY4C 4P46B 2Z8WC 3VWJC 5LVEA 4X4YA 3ZYZA 4GLRH 5FDWB 1KJ2B 5F9JB 5D7JC 5EO0B 1I4FB 3VXRB 4KKLC 2OI9B 1B2WH 1MEXH 5ENWA 4P23A 5BV7B 3T77B 3UJJH 4GRWF 2YD7A 3U7WH 2AEPH 1YPZA 3ARZA 4OD3H 4MWFA 5L7XL 2DLFL 2ZCLL 4OCSH 3GHEL 4P2OC 4AEHL 1VESA 3PV7A 1FAKT 1LK2A 2PYEE 1VFUA 3C6SA 5FYJH 1DEEA 1T89C 1IAIM 3DX7A 1P7QB 5ETUA 3I50H 4LHUD 1YEGH 4G8EB 3EDEA 1WIOA 4PR5B 2PUQT 3I84A 1FZMB 4X5XB 3W2DH 1CT8A 1F90L 5FGBC 5TDOA 1KG0A 1QNZL 3LV3A 1FPTL 3DBXA 3K4ZA 3WJLC 3RUGA 3QI9D 1U42A 1MCQA 4FQXC 1YMMB 1DBJL 2X4PA 4NQCB 4PRHB 1DQDH 1AQKL 1HDMB 2FCBA 4LPTA 1A2YB 1CK0H 4EZMA 1A6ZA 2MNUA 3DVIA 3VFGH 3L5IA 3QO1A 4MAUH 4JJ5B 4UDTB 1DEDA 1I7TB 1B0GB 1NCAL 4N1HB 2GJZB 1RIVH 2CRYA 5EZLA 2ICEA 3TA3A 4FQCH 5IKCB 2HFFB 1CGSL 3GNMH 5J56B 2QEJA 3BOVA 2Q20A 3O4LE 5HYEA 3O8XB 5DUBB 4GG6B 3AREB 1EO8L 2DRUA 3F7VB 1JWUB 4NWUH 3VCLA 2QHLA 2XPGB 3ZE2E 1ZA3A 4JGJA 3T1FA 1G0YR 2P5WA 1G9ML 3FQUA 5GJSH 5E1HB 2AEWA 2EDTA 4F58L 4G7VL 4XNUH 1JZ2A 1GL4B 4HS6B 2D9CA 3GB7B 3FT2A 4FQPA 4WWKC 5HHXL 1KBGL 2H6PB 2X4SB 4Z7VF 1K4CB 4M6AA 2I26N 4R8WH 1CDBA 1DQLL 1RUPH 3V6BR 3KDMB 5JW4N 1NC4D 5TDNB 2FL5A 2NY0C 4L8SA 1DQML 2UYLB 3CUPA 3ESUF 4KPHL 5EZOH 4P2OB 5C0CB 1QFPA 3STLB 5C8JA 3HNVH 3RJQB 4MQTB 4NQSA 5DD6B 4ZFOA 3IFNH 3I9GL 4N5EA 5C71A 1D9KD 1A7RH 4NQTA 3VU2A 3UZVB 5L0QC 4NT6A 4HS6A 3VXMB 4WW1A 1OP3H 4GMSL 2JCCF 5INCB 3KGRA 2CSPA 4WU7B 3INUH 1EJOL 5H94B 1UKSA 3O81A 3QUZB 5BVJB 4UB0H 1CLYL 3UZEA 3QEQB 4XCYA 2Y5EA 5ADPL 1JIBA 3CFEA 5F96H 2BNUA 4PJXE 1T20A 4L5FL 5IESL 5DRWA 1FSKC 1JPFA 1IEAA 4K23H 1P9MC 3ESVF 5EZLB 1H5BC 5EC1B 1KIQB 1DEEB 4OFYA 4P57A 4YO0B 2IBGA 4HCRH 3PWUA 2F5AH 1EEYB 1PDKA 2FGWL 1YDPB 2PETA 2W9EH 5L2KD 1YEFH 4G42B 2J8UE 3H3BC 3V95A 1MHEB 4P23B 1P5UA 1KCVH 3DURB 1U6AL 3I6LE 1CFQA 4R97B 1ZHBA 1OM3L 2BNRD 1SEBB 3DHJA 4MJIA 4UT6H 5J4MA 3BGMB 4PGBB 1JGEB 4QRTA 4XNXL 3KJ4C 5JO5A 5T3XH 4HPOL 4KTDH 4NRZA 2CDEB 5FM8A 2R29H 2J6EL 4K3JL 4WFHE 5HDBE 4M6OH 1LO5A 2VDLH 1K6QL 2YC1A 5C0EA 5K9KB 1L7IH 1CL7L 3WMSA 4P4KB 1NUDA 4XP6L 1F8TH 1XR9B 1KIUA 4FQ2L 5TGBA 4HWZA 2ZPKL 3RWGB 1F58H 3MTRA 3VFRA 1PQZB 2ADJB 3ZKND 5MENB 1T66C 1G6RH 4FQXA 3SCMC 3MV9A 5ENWB 5HD8D 4NPYA 2FX9L 4GAYB 4DUWA 2XNAB 3LB6C 1BZ7B 4X7FC 1QRKA 5EUKA 4UQ3B 1Q9OB 2NQCA 4XP5L 4PRID 5EORH 4S1SH 5HYSG 5FB8B 3IRPX 3ALPA 1EDQA 5BJTB 3LEYL 4KTDL 5JW3L 5DEZA 5DD6A 1TVHA 3DUSB 4P0DA 3U6RB 1ADQL 3Q5TA 3G5YA 4XX1E 4GRLA 1WLHA 2NY0D 3WIFA 3BH8A 5DF0A 5SWSB 2N7BA 5EOCJ 3MV7E 5JOEA 2W9EL 3KLAB 4NC1C 2VIRA 5HYJD 2IF7A 3U1SL 3W5NA 2IALB 4HCRL 3GB7A 4U1HA 4ELMB 4OIBA 2FATL 5ALCL 1FH5H 3R0MA 2EEDA 2AI0L 5C0FB 2Q7YB 3V4VL 4NQXB 3KPSA 5IBLC 1T6VN 2APWA 5I1GH 1TQBB 4WJ5A 1IM9B 4PJAB 4GKZB 5K9JH 4ZNEE 4UB0L 1QHPA 5J6HB 4JY6B 1ADQA 4RAHA 2X42A 4Y4KC 5DMGC 3NIGE 1M05B 3DROB 4HZLB 4ODSH 1YEDB 1A1MB 1EHLL 4JM4L 3BKML 4OLZH 4M93B 5DJCA 4PY8I 2R4RH 1S5HA 4GKNA 5HBBA 4ODUA 2W60A 4OAWB 1HZHH 2DDQL 3QIUA 5TE4H 1GHFL 1MHHB 1RJZB 2XXCB 2GY5A 1KCKA 4IIQA 4M7LL 4PLOB 4OLYL 4KPHH 5T1DL 4NSKB 3IGAA 3E8UL 4KRNA 5HY9B 5FA4A 1WICA 3QIBC 4KKCC 3NCEB 3ZT7A 3AVEA 2EDRA 3E1F1 3MBEC 2J6EA 4LF3B 3MRJA 2IPUG 3WIHH 3KPRB 1DBKL 4YHIA 5DJAA 2ZSVA 4LVOC 4F58H 2RGSA 3CXHJ 2F15A 4JM2C 4RZCA 5F97E 3DPBA 4LLDA 4ENED 2BRRH 5ACLA 4I8DA 2R8SH 2E3VA 3I3EA 1HWGB 3HTLX 3J7HA 4HHAB 5I66A 2EXWD 3S37H 2W0FB 5GS0D 1N5YL 4LP5A 3ZE1F 4HUKB 2HRPL 2CIKB 4Y5VA 3JWOL 3UYRL 5EO0A 3EIFA 1BD2A 3RQ3A 4PGCA 2CMRH 3PWPE 2OMNA 3HPJA 4X8JB 2XZAH 5EBLB 3PQYA 5J1SC 1F11B 4X6BA 1KJVB 2KPNA 3BN9D 3QUYD 1S7WA 2IQ9L 2XT1B 5DC4B 1UXSB 5E5MA 1NBYA 2WW8A 3HA0A 3L9RA 5EU4B 1AKJB 2R2BB 3MOBH 4OCRL 3VFSA 4F7PB 3GSWA 1FN4B 1DFBL 1FAIH 5HHMA 1SM3H 1UKQA 4Y2DC 2HMID 3R4DA 1F11A 4ZXBD 1Q9LB 1O5DT 1Y18A 4KZEH 3HPJB 4X8JA 3O6FB 4Y4KD 4FG6D 3SBWC 5IJVB 4ZODA 1NAMB 4I18B 3A6OA 2WLZA 5HGDA 3WFZA 2E7LC 4WI3A 2VTFA 3HAEA 1T0NB 1U3HD 4U7SA 3LQZB 1RUMH 4YX2L 5BCAA 5GXBB 3FAXA 2ZCLH 1FE8H 4GRLC 3LKRB 3T09A 2W65B 4LCYB 4QRRA 2HT2D 4P4KC 2PTUA 4I77L 4JG0H 5I8EB 1U92A 3H9HB 3O8XD 3IFLH 15C8L 3GBNH 4O2FB 1AGFA 4HH8A 2BVEA 2R39A 3WLWD 4RAUA 1DANU 1XZ0B 1H5BA 3CPLB 3CDYA 3I02B 2I60H 5I75C 1K85A 2Y06L 4ZTPH 4FZEH 4PJXA 3DV4B 3RVTC 4WY7L 1VPOH 1G7PB 2W92A 4PYHA 4UV7H 2XXMB 1S7QB 1I1YB 5E7FA 3EHBD 4XNMB 5TF1L 3VWKB 1DDHA 4TSBL 2CRZA 1W0WB 5I8CB 1QO3A 4JG1H 4BQCA 4MNQD 5D72L 5JHLL 1ZANL 4Y4HD 1VGEH 4GW1A 1OGAD 1MI5A 1AD0A 3P4MA 4MXWH 4OM0L 4Z7OE 4N0CA 2VZ1A 5IQ7L 3GMLA 1SY6A 1ERNA 1SJVA 5E8OA 3KR3H 1T80A 1W0VA 2EDXA 3N50A 5CZVH 3EJYD 3C5SB 4BFGA 4NOBA 3DMMA 4L9LC 1WC7A 5IB1B 3SKMA 5F93C 3MNWA 1PX4A 2XWJA 3MV11 3EW3B 4YE4H 1TVBA 1QRNE 5MI0C 3T3MF 1I9IL 3ES6A 2Z93A 2DQHH 3RY6A 4XBPA 5BRZE 4FG6C 1C5CH 2P42B 4X9IA 2YD6A 4U6VL 5K59F 3IFLL 2IMMA 1YYML 4IOIB 4POZC 3A67H 4ZAKC 3SPVB 1T1YA 3ECBB 4HF5L 1NBYB 2ORBH 1N59A 1KCGC 1XH3A 2BXZA 1D6EA 1UB6B 2AK1L 4JFHE 3ARYA 2Y23A 2NZ9D 2QADC 2E7MA 4LSPL 4JKMA 4GAFB 2X1XR 2OJZL 4XXCC 4PJ9A 3BZEB 4Q9RL 5D5MF 3ARUA 2B8OT 1WISA 5CUSH 1NAKL 5HYIA 1S9KC 2WINA 3L6FA 3IYLW 2HJKA 2YK1H 3MV8B 3D69A 3ME0A 3VI4E 4XP9L 2AXFB 5GGQL 1FVDA 3WNPA 1PKOA 1QLRA 1ROWA 2A6JB 3EYSL 4I2XA 4LNRA 4G8GB 4FQQB 5JDSB 1DSFL 3MJGX 3KS0J 1ZHKA 3L3KB 1FFPB 2XTJC 1JGVL 4UOW1 3RDTD 1E4WH 3B9KB 4PJFB 2QADB 2AK4B 3IJHA 4IM8A 1JRHI 5J6GB 4NJAL 2CMRL 1YECL 2DMBA 1CFNB 4L8DB 5GS0L 5HHMD 2IH3B 1KJ2L 3RZCD 4CUCA 4WWID 3LPGA 2I07A 1MFAH 2PN5A 1F3JA 2X4TA 1NCWH 5CLTA 4R26L 3PWNA 1Q1JH 3FB5A 4YFDB 5D5MA 3TN0C 5DMIL 2V2WB 5ERWA 1KUMA 1G7IB 4P59L 2CRMA 4HUXB 3KPQA 5KVDL 2CUMA 3VXSD 5EULV 1IVLA 3AY4A 4S0UC 4R3SB 3L3DA 1YA5A 1UACH 5FOBB 4IEFB 4GQ9L 4X6CE 4DKFL 1OAXH 5CGYD 1MLCA 3KJ6H 5D2LE 2Q8AL 5IBTH 1ZVSA 3RWIB 4LEOB 3QXVA 5E99L 3GEWB 4BH8A 1J0JA 1ZHLA 5EWIL 4U1GC 1PKQA 3OZ9H 1EHLH 3MLRL 4XWGL 3VXTB 1OB1A 2ED7A 1Z3GH 1N6UA 5CFHA 1JF1B 4PPTA 2RAMA 1W0YT 5F8QC 4Q0XH 4X4XA 4FXGB 1OAKL 2RIKA 3NABH 5IUSA 1F00I 1MLCB 5HVWA 3NPSB 1SEQL 3FO2A 5I30L 3JVGC 4KXZH 3C60A 3S8WA 3L3OB 4U0RB 4HEPG 1RPQA 1VACA 3ZT5A 2V5SA 4OFPA 1T03H 2AI0H 1HK6A 3MRQB 1FVEA 1QQDA 3V6FB 5EOCH 1Q0YH 4OBRA 1A7QL 2FATH 5IGXL 3ERYA 4MMZC 5MENA 3HUJA 3DX6B 4H25B 3CLEL 1V3JA 2K3TA 1F6AA 5HYSA 3ULVH 4N0UA 3MV8A 5C9KA 43C9A 2KDGA 5GRYA 3VE0A 2NTFB 2YBRA 1ADQH 3MLTB 1MCRA 1JRHH 3VI3E 4I2XE 5EO9B 4L3ED 4HQQL 1S7RA 4W6WB 3C87A 3C08L 4PJ9B 3HS0A 3LEXB 5A3ID 3C60C 2B0SH 5IVXE 1GGBL 4OZIB 3AREC 2ATKA 3OKMB 3TVMD 5BOPA 4ZSOE 3OGOE 3U2SB 5DUML 4Y5XB 4U1SA 5T5FH 1SY6L 2BOCB 3HNSH 4JO2H 4FP8H 1N7MH 2VSCA 3BT2L 5T5FL 3NCYP 3ZKSD 5GRVL 1KG0B 4YWGL 1F8TL 4K07A 4WCYH 3S97C 1BIIB 3HE6C 2A77L 1MAMH 1MCDA 1QFUL 2Q86A 3IFPB 2MCPH 5ETUB 4WENB 3SJVE 5JOPE 5BV7L 1HI6B 3IRZA 5F6HJ 5D7JB 4NC1E 4ZFZB 1I1AA 3X3FH 1N4XH 5MEQA 2EEAA 3P9LB 2ADIB 4MWFB 3LKNA 2A1WH 1O7SA 1J11A 3E3QC 5E4EC 3RVUD 1KLUA 1UA6H 5EU6A 5KW9H 3BAEL 4S0TD 3EYQC 1U6AH 2IPKB 1EJ6A 4LKCA 1JWMA 3CFCL 2IWGA 1JGDB 4UV4H 4K7PH 4ZXBB 2AQ2A 2NLJB 5IHLB 3DTXB 4R4BB 1XGYH 4RX4A 1A7QH 4MYWB 1OTTD 5EOCL 5ICXB 1DE4B 4GBXD 43CAA 1W0WA 1VFBA 3D9AL 3FB6B 4L5FH 4XPHH 1CGYA 4FHBD 4NO5A 4XVUD 5JORA 3SJVA 4D0CA 5J9PB 4MD0B 1INEH 1QSFA 2E9JA 2R4SL 4R0LA 5LAXB 4OKVA 3TN0D 2NW2B 5DJ6A 5L8KB 4K9EC 2AJVH 4Z95H 5GGUB 4RIRA 1KLFA 1XZ0A 1LP9F 3JTTB 1Z9OA 4L8BB 1X3DA 3T1WA 5JMOC 4HIIB 3ARGB 1A6VH 1INEL 1YEJL 1U92B 3IU4H 3UTSB 2J2ZA 1U91A 4L29A 5C0BA 4FQLH 3BSZH 4FQ1L 1M7IA 5IVNA 4XNMA 3KPOB 1A6WH 4WNQB 3F7VA 3ZDXE 1IFHL 1J1XL 3OJ2C 3O6MH 4JHAH 3LKQA 4M6NL 3JSSA 3CFBA 1XGYL 3U9PL 4QNPF 4X4MA 1JN6B 2R0WL 3X13A 1MRCL 1B90A 4KY1H 4E9LA 2GW5A 3EBAA 5IJKC 2WP3T 2VLJA 4K3EL 4JKKA 4LPVA 5DXWA 1Q9LA 1LEGA 3EYFB 2Q3AA 2OSLB 4O9HL 3EO1A 4X99A 4P59H 4UQ2B 3NZ8A 4PRHA 2NY7L 3G6JA 1KJ3L 3REVB 1I8LA 2HYMA 3FQWA 4KUZH 5BO1L 4NWUL 1OLZA 3B9AA 4Z7VA 3MR9A 2YPLE 4G80A 1S7WB 2UUDH 5B21A 4RA3A 3RAJH 4YBLB 1QKZL 1ZK9A 4UBDC 1BVLB 1CCZA 1FLRH 3G6AB 5FO8A 5ALBH 1E4WL 4M1DH 1FN4A 3WL9A 3HZMA 1NMAL 2HT3D 2BVOB 1OGTA 4DW2L 4Z7NE 4Z6AT 3SE8H 3EYVA 2EDFA 4KK8D 1AHWA 4WV1B 9CGTA 4WDIB 4BZYA 3RBGA 1VFMA 5B4MD 3TCLA 1FDLH 1C7TA 1BVLA 3P4OB 3AM8C 3BXNA 4R7NA 1MRFL 3QHFH 4O5LL 5MHSE 3Q3GA 4RFEB 3PABA 3FO0L 5B39B 5JLZB 2B5IC 1NEZA 3B5HA 2W0FA 4L4TE 4KRMB 2QKIA 4M7JL 2GSGA 3GM8A 3WL9B 2DIBA 4QY8A 1YYLH 4PJHE 4JZNB 1QFHA 3HC0A 3KPRA 4NZTL 3VGDA 3CX5J 1T03L 4LCIL 4J8RA 1C5CL 1UJ3C 2MKWA 5EU6E 3VFTB 3H3KA 1A4JA 5CP7A 5AWNL 4JFDE 3WFCL 4GH7B 1FNHA 4ZOBA 4NN6C 5TQ2L 3FO1B 4D94A 2VLKB 5MEOA 4NSKA 5CP3A 4NKOA 1IQWL 3TEUA 2WUBH 1X5YA 3EYOA 3U7YH 3FQWB 1OAKH 1MREH 2VLJE 3MLVL 4XX1G 4AG4H 3QIWA 4QXUH 4K7FB 4Z0XB 3SDAD 5FECB 1EH9A 4AENB 2ZJSL 4JFYB 3AFLA 1D5BA 1OD9A 3F6IA 1LEGB 4PV9A 4UIMA 2X2YA 5T3XD 1T5WB 2NY1B 5FO9B 4KK5D 5IF0A 4PY7B 1M05A 4HZLA 4HIIA 1NH6A 3GMNA 4OZGE 2IALA 5E2UL 4ZSOA 2AEQL 4EDWL 3SY0B 4RIRB 4YHLL 1NCDH 4MXWL 4OM0H 2PR4L 2VIRB 1J87A 1KFAL 4YGAB 5CHNA 1WAAF 4OZFA 4WNQA 2PO6B 3L7EB 1NFDE 2LV4A 1N26A 1WCBA 3BH8B 3O3EB 4JZOB 2OTUA 1F45A 3NFSH 1VFBB 2FX8L 5KG9A 5EFIB 3Q48A 4MGXA 3UEZA 4KJYB 5DTFB 1PW3A 2R1WB 3VRIA 2A9ML 4JE4B 4ZQKA 4XNQA 4V2CB 4U1HB 4ELMA 5J57B 4Y2DB 3RGVA 3EFDH 4Y4KA 1MWAH 3VFOB 3L3IA 1YC7A 4QCIA 4RFOH 1E4KC 3HE7C 4PGDB 5CKGA 1HINL 1J88A 3N1PC 1F3DJ 2ZP0T 2VDKL 3HPLA 4ZXBA 1FZJB 3OAUH 4C56E 5A3IC 5SX4I 1PJ9A 2EYRB 3EGSB 1RZ7L 5HYJA 2MHAB 4LSUL 4X80H 4WUUA 1RZJH 1ZT1B 3MA7B 5IMOA 3WIIL 2P5EB 2D31A 4TSCH 2ERJB 2Q1EA 2VDQH 4HS3A 4JRYA 1I3RA 1UVQB 4QRQA 5GS1C 3KPMA 1NGWA 3VXOA 5LJYH 1JGVH 4QHLA 4XMKH 3UC0L 4ZYKB 3PGDA 2PYFA 1KEML 5L6YH 1PYWA 4YDVB 4FQXB 4OIIL 5DA4A 4MA7L 4MJIB 5D1XD 1NDGB 4MNGA 5AUMA 2E6JA 5I17B 5D71H 4PJGA 4QOKD 2BVPB 1VENA 3C09B 3FQTA 4HUVB 4G42A 4XCCH 1AR2A 1UCBL 1HI6A 1IC4L 2HTKD 1KNOB 3RVXD 3DV6A 5K33A 5AZ2H 1SHMA 3ROLB 1UWXH 3DUHA 3WNOA 4ZFOL 2VDQL 3Q6GL 3NCBB 4QRSA 4JANA 4QF1A 5C0BD 4UBDD 1A14H 1HHIB 1P53A 4PGBA 3LEVH 4JHBA 4FA8A 1QA9A 4XH2A 2XV6B 3LKPB 4LVNB 2DQJL 4HLJA 1NKOA 2VZ3A 4ELME 1IGML 3U4AA 4S1DD 1RZKL 2M1KA 4GKOA 4HK0A 5C0ND 5HI5C 5HJ3B 4MNGB 3DX6A 4H25A 3ZSSA 4XTRC 2BRRL 2DQDH 3TYFB 4NHUA 5DVOA 2YSSB 4EN3B 1TNNA 5E6YA 2NY4D 5F1NA 3ILQC 4U0QB 1I3RB 3KXFE 4N5ED 1Q8MA 1R5WA 3W9DB 5DJ2A 3DSFH 4QHUA 4ZUVA 3STLA 1TPXC 3MA7A 5IMOB 4XI5C 5T1DH 4WIQA 5I1AA 3GBML 5KZCB 1JNLL 3V0VA 3DOSA 3T2NL 1T1XA 5DJZB 1E4XL 3U4EB 5GISH 4U1MA 4WW1B 3V4UL 1P7QD 2J3SA 4NM8L 3D2UA 5D72H 3CVIH 2EH7L 4MJ5A 5CBEB 4UTAL 3HHRB 2XYCA 4ODSL 3MFFA 3QUZC 3BRDA 3U4EA 1XT5A 5D7LB 3RTQA 5IFJA 3T1FB 3PWPA 1JPGB 4ODXB 5C0CA 4AG4L 4CW1B 3VRLF 4Q97A 2Z0BA 1WCBB 1YEKL 4S2SA 3GJFH 1H15B 3O0RL 4B53A 1KB9K 2X9XA 3AREA 1PSKH 3B8YA 4HUUA 3MRKB 4MD4B 3I6LD 4EI5C 1CGUA 2ICCA 4JO3H 5HHVH 4L8CA 4YHOL 4I77H 4NQVA 4LCWD 4X6FA 4P48A 3ULVF 3KYKH 4ETYA 3V5HA 1OCWH 2YPKA 3RWIA 4Q9QL 2FBJH 4YDIH 5HPMB 3QCUH 5L2JB 1HDMA 3MLYH 4HS8L 1CFVL 5M94B 2ITDA 4ZDHA 1GAFL 4E41E 1MJJB 3MRLA 3O4OB 2W07A 3A6BL 2OR9H 1X5AA 5ESVA 2IFFL 4K9EL 2VRAA 3DYPA 2VOTA 3TV3H 1YJDH 3QPXH 1T0MA 3SE8L 5E9DD 4NQCA 1YMMA 1AIFA 1X5HA 5LGHL 1JPSL 1YNTA 1SQ2N 4NC2B 4F9LA 1II4E 1V05A 5IB3B 1MI5E 1VADB 2Q76A 3VFNB 2F74A 2DLIA 1J8HE 3VW3H 1ZLSL 1JWSB 5JIPA 1L7IL 4HBCL 3G6DH 4M5YH 2GT9A 3MGTB 4M6OL 1C1EL 1PG7X 3Q3GB 1IGYB 2ENYA 4D0DA 4OV5A 3C09C 1FFPA 8CGTA 2FR4A 4Y1AB 2A38A 3GKWL 2R8SL 2X89A 1A6AA 1YEHL 1XH3B 2HH0L 1N59B 1GGYA 1OM3H 3ZDYF 1JGUH 4TSAL 4O9HH 3D39E 2NR6D 1L0YA 3HG1B 2XN9D 4PBWD 3GBLA 4H0HB 4FFWC 1KJ2A 2EDDA 2L7JA 1FIGL 3B9EA 1E6JH 1HWHB 1G9MC 3MGOA 4EI6B 1CXIA 4Z7UF 3RY6C 1V3LA 2AERT 1D5IH 3QDAA 3MV01 3ARBC 3ZKXC 4CGTA 4M7LH 3QDJB 4KVCH 1GHFH 4AL8H 2I27N 3V5KB 4WTZG 4I5BA 1HZHL 1EUTA 1IGTA 3SEPA 5HGHB 5IESH 4FQ1H 2CR3A 4HJGB 5F8RC 4JHZA 3LHPL 2JIXA 1MPAL 4ZPVB 1U8KB 4RRPA 5C0AB 5EO1B 1L9NA 1OAQH 1OT2A 4TUKH 2AJ3A 3SDXF 3BMVA 3REWA 3HB3D 1Z5LA 3PHSA 4Z95L 2Q6WA 3GO1H 4ZUWB 3RUGE 2EDOA 4J6RL 5IF0B 2R4SH 1FFNB 5JW5A 3BGAA 3VDCA 1P2CA 1ZGLA 1CD0A 5J1AA 4OZ4A 2VDPL 3CDCA 3M8OH 3ZKXB 1AO7D 4AL8L 2VLRB 5DRZA 5I0ZA 4H88H 4EN3D 5EZOL 4QRUA 3GRWL 3EO0B 4ZFGH 2HWZL 1A7BA 3GZKA 2QQLH 1ZT7A 1IARB 1E6JL 4OLXL 5F9WC 3ZZ1A 3MROA 2J8UA 4RAUB 2X4RB 4KWUA 1DZBA 2XQBL 1F6FB 1MNUL 5C0DA 3H9SD 2JKXA 4PJ8B 4XXCA 5ISZD 3LRSB 4NHUE 1MCWW 1G9NL 4GSDH 2VITA 3GHBL 2PCPA 4NO2A 4IMKA 1QSFB 3UBXG 1KEGL 1J12A 2HH0H 2HJFB 3S5LA 5DEFA 2DBLH 1UZ8A 3CJJA 2E7CA 2VDNH 4G8GE 3P4NB 2C3WA 1CR9L 4IRSD 2UWEB 5KJRH 3IXTA 1CDUA 3IDXL 3PABB 4ZOEA 2XTJD 3H9SB 2EXYD 2XN9A 1GZPB 3KPTA 1EERB 1LDPH 1M7DB 3WS3A 3TBWB 2VXUH 2XKUA 1KN4H 3H3PL 1VGKB 2BFVH 2Z91B 3D0LB 1NLBH 3D85B 1JPSH 1YEIH 4PJ5B 3X3GL 1RU9L 4Y19D 3L9RB 3IXAB 4U33A 3PUCA 2IPTL 2R29L 1MUJB 1LP9A 2A6IA 5B38A 3PWPD 2OR9L 3GKZA 2ZUXA 1AP2A 3A6BH 3DVFA 3UTTE 3TO2B 4N8VB 4PJAE 1LEIB 4PB0H 3ARXA 5ANMB 1R5IB 2YA0A 1CFVH 3C60D 5IK3B 5T5NG 1KCVL 3N0PB 3VFSB 2G5BB 1ZOXA 5DJ0B 2XI9A 3BUYB 2JK5B 2E9WA 2VXQL 2VZSA 4RZCB 2IH1B 5JPMB 3LSOA 1L0QA 2G2RB 5F70A 4AIOA 4UIKH 3WS3B 4NFDA 4JO3L 4XWOC 5HHVL 3QNXB 3KYAA 5D7SL 1BWWA 1XCQA 3ZTJG 3BH9B 5DJXB 1Q38A 2YBRB 3O2VH 1UB5A 4X9GA 5DSCB 1MLBA 2NW3B 5DMYA 4OI8A 5I66B 5I18H 4QOKA 3WLBA 2JJVA 4MB5A 4NN7B 4WFEE 2J4WH 3FN0L 3VFMA 4K2UL 2E27H 3EJZC 3KPOA 4OT1H 3ET9F 2NY1D 3HUJB 3S7GA 1E6OL 4K8RC 3CSBA 2V2XB 4PGEB 4S1QH 3ZE0F 1FGVH 3I9GH 1PAMA 2YXMA 1YEDA 2GJ6D 1N5AB 1C12A 5JHDE 2LTQB 2P8PB 3K80A 3VA6A 2ZWLT 1T7XA 1G6RA 2VNCA 2J8UF 3PXJA 3SDYL 1QBMH 5I16B 1T3FB 1DQLH 2VMFA 4JFDB 3J8F7 3DSFL 3HG1D 4X4XB 1P2CB 1EVTC 4IRSC 2DLHA 4RNRB 4PJIB 1GCFA 2AXGB 1V3KA 4LLWA 1WFNA 2COQA 4X8XA 4BK4A 2B1HL 2FX7L 1YN6A 3OL2A 1EO7A 5C0DB 3BWUC 4D9RE 1J18A 3WFEL 3GSXB 4WU5B 4HUUB 4MD4A 4EEEA 1LEKA 3W0WE 4G8FA 5H2BA 5C7XL 3QFJD 4P9HC 4U1KB 3GMOB 5F7WC 1KLUB 1G7LB 3S36H 5DEGB 4CU8A 3LKNB 2DQTH 5IFJB 5INDA 3SCMB 2WAHA 4G6JL 3VXSE 5KS9B 1H3PH 2NMSA 1B4JL 2WANA 4PJ7A 4MAUL 4PG2A 5AZ2L 5F3HA 3ARFA 1QUNA 1IC4H 1DBML 4GBXA 4HULB 4NHCL 1IAKB 4O2CB 3FRUA 5IFAL 5DZOA 1R3HB 1CZ8L 1BQHB 3BPLB 1JZ7A 2Q87A 3SN6N 5LWYH 3VXNB 4F57H 1G7HB 2P43B 4ZUVB 3U6RA 4XHQA 3D18B 2YD9A 1UQSB 3DXAD 2NY6D 3CSGA 4NHCH 3CC5B 3HAEG 2FR4B 2XG4A 1B6UA 1YEEL 1D6VH 1UWEL 4JFFE 5FYJL 3RU8L 2AK1H 4Y5XC 4EN3A 3D25B 2DQFA 3QUMA 4TSCL 4JN1L 3OKKA 2AEPL 5ILTL 1DBBL 3FTGA 2H3NB 3G5XA 4YXKL 1R3JB 3QA3A 3A67L 3NIDF 5F6HI 1FVDB 3IDYB 2OR7A 3QP3A 5DMJB 1A9EB 2ESVB 3QQ9C 3TO4B 5I1JL 1AXTH 2MCG1 5C0EB 1UC6A 3DGGB 5KS9F 1BFOA 1NCBH 5DGQA 3WIHA 1NFIA 3DX8B 1P7KB 4CVXB 2YZ1A 3HZVB 1IAKA 4HZAA 4JFEA 4O2CA 3DHMA 3PGFL 3DJ9A 2CLZA 4QF1B 1CGXA 5EU3B 2YUVA 2VLRE 4EI5A 2JIXD 4P2RB 2JJSC 4CU6A 2FX8H 1U41A 4X4ME 1VACB 5M7QA 4HUVA 1FG9C 1R24B 3KG5A 1ETZB 3MRFB 1E4JA 3OKOA 4KI5E 3BPCB 2EH8H 3EZ8A 2IAMD 3SDYH 3KAAA 2Z35B 1ZLVH 5L2JA 4ORGA 1WCQA 3QUZA 1HXMB 2BZDA 1AIFB 5ID1B 5E2UH 3C6LA 4LPUA 3IAPA 1T1ZA 2DF3A 4YDJB 2IC2A 1VGEL 2FEEI 4JAMB 2CXGA 4I9WE 1IEAB 1PKQB 3HMXH 3JWOC 4UAOB 3WUZA 5E8EB 2D03L 2CH8A 3VG0L 1RK0A 1A6TA 1C16B 3QHTC 2NY2D 3QDJE 4AY0A 1FNSL 2FO4A 2ITDB 1UH4A 1JYXA 3KYNA 4FZEL 5CZKA 3F7YA 4CW1A 4G9FD 3KYMA 4ODXA 3ZE1E 1VB9A 4PJDA 3DMMD 3L3DB 2A74B 5DS8B 1KTRL 2GK0B 4F9LC 2NY5H 2YPKB 1X7QB 4HIHB 5FF6A 4Z7WB 3CFKA 3KPQB 1TENA 1UEMA 2IANE 4M62H 5EUOA 5ERWB 1HKFA 4BQ8A 4POUB 5EFIA 3WBDA 3ORJA 4OIAA 3BE1L 4PJEA 2VABA 4N9GA 3D48R 1IE5A 1MFDH 4DGIL 1S7QA 4LIQH 4OZFB 4P2CG 5E6ZA 4QOKB 2VC2H 5BS0D 4YH6A 1REIA 5F7NC 2IBZY 5SWZB 5I76B 4CN1A 4ZSOB 3TA3B 1CS6A 1SM3L 4JGUA 1I75A 4PG2C 3QUXD 3QO1B 2JB6B 4LVNC 1T1WA 3IDJB 4Y0GA 4PY8J 5CJQL 5E08H 4NQDE 3U0PA 3P0GB 2GQHA 4BQ6A 4I2XB 1QBLL 3NN8B 3S35X 1RFDL 1I1AD 1ES0B 2X4PB 4RMVA 5DURD 4Z0BH 5GGTH 3LMJH 1KPVB 3GI9L 2FO4B 4PRPE 5I9QB 4FABL 4OLEA 2OJEA 4X6CA 3BKJH 2W59A 4LKXB 1QKZH 1MJ7H 1RZIA 1HIMH 1BFSA 2BVTA 5DJDA 1ZSDB 1X5XA 4UT9H 4ODTL 2XY2A 4YXLL 1EUUA 4FQHA 4HLZH 3BN9C 4OI9A 2C3VB 1QBAA 2BY0A 3DARA 3AS3A 1LP9B 5LCVH 1T4KA 1JMZA 2KQMA 1U8IA 2NY7H 3IXAA 1JHLL 1KEGH 1RUKH 3RTQD 3QXWA 4NKIH 3QDJD 4XAWH 4ZO6A 3RWEB 5C07A 5AUMB 1J7VR 1WSST 1MF2L 3K74B 2YKLH 4LSDA 2O5ZH 4RISL 4ZYKA 2OK0H 3LKOA 3UBXA 1M6OB 2I9LB 4U1GB 1X4YA 4D3CL 3E8UH 4X4YB 1R3KA 1IT9L 2Z8SA 1DUYB 2QQLL 4U3HA 3TCLB 4QRSB 1C5DB 4XHJC 4P46A 4GRMB 4OLYH 5D7IA 4JVUA 4PJGE 1XGQA 2N4IA 5IB2A 4NNPL 5T1MB 4ODWA 2ZSWB 1CLOL 5EBMA 1EFQA 2EIBA 1E28A 2VISB 4P4RA 1WBZB 2XOTA 4V1DB 2X44D 5CINL 2J5LB 5E8PB 2BVPA 2HJFA 4YEEA 1A6VL 4MCYA 2ICWA 4WI6A 1OAYH 3BW9B 5FO7A 3RI5F 2ED9A 4BFIB 1I4FA 3SGEI 4QCIB 5GZND 3LRSA 3OKKB 4LFHG 4XAKD 1SJXA 3WLWC 3TPUA 3MROB 1PLGL 3OKEB 1U8LA 2YUWA 1SYSA 1U93B 2JJTA 2K7PA 1CDJA 4KDVA 4TPRL 3VGBA 4H8WH 1MQKH 1NCCH 1RULH 4GRWE 3D9AH 2X05A 1CU4L 3G6JB 3SE4C 3HI6H 2EDHA 4PRHD 3WS6A 3QWRA 1ZGLB 2YS4A 4EVNB 3O11A 2FIRT 3I02A 4CDHA 1D5XA 3O4LB 2UVFA 3BP7B 1K3ZA 1F4HA 1IAOA 3FOLA 2R2HA 4JQXA 1W72B 4MS8C 4G9FA 2DD8L 4GRWH 4JY5L 2W65A 2CXKA 3MRCA 3Q1SL 4NUJA 4JFED 4PD4J 4V2BA 5GSVA 5I71C 4NQXA 3QDGB 1J1OL 2PO6A 5I6XC 2MCPL 1LE5A 3BPOC 3H7BA 1R3IH 4ERSH 2DQCH 4WFFD 3ULSA 3VXUA 3NH7L 4HIEA 1JBJA 3O6FA 1L9MA 5GRUL 3SY0A 1IBGH 1WT5C 1UH2A 5D9SB 3UBXI 5CJ5A 4YHML 5T1KB 1F4XL 5FYJD 1F4YH 3TT1L 4MJID 4UNUA 2H2PD 3CDGA 1FYTD 4X4ZA 3F5WB 3MCKA 5HSFA 2UZXB 3HMWH 1KACB 1AJ7L 3W82A 2PW2B 3G5YB 43CAB 4JFDA 2NZIA 4MCZB 3RNKB 5HD8C 2WK2A 3T04D 2X1PA 4PJEF 2KZWA 1BFVH 4CDGC 3BZFB 4LVOB 2W38A 3OKEA 5EZJB 4DN4L 4UQ3A 5D1QC 3VFTA 3WDIA 4I0CC 1UJTA 4A6YA 3BDBA 2QQKL 1XCTA 4U6HB 2IMNA 4WV1A 4APQC 5EU6B 1IZJA 3EYVB 5C07B 3HZYB 1PZ5B 3QXTA 1S7XB 5L88L 4XI5D 3QEGL 4K71C 1T4KB 2PYED 5E6IA 2PTTB 3WFBL 3R1GL 4B7LA 3AXLA 4G59A 2DM4A 4BKLB 1XIWB 1PG7L 3K2UL 1J0YA 1X9QA 5D2NC 3K1DA 2BC4B 3U4BH 3P9WB 1JGEA 4QRTB 4RMTA 4TQEH 3MRLB 2VL5A 4HKXB 4O51B 4YFLF 3T0DA 3LN4A 4G6KL 5EDXA 3MJ8B 5CJXC 3T3ME 3INUL 1MHEA 1WGOA 2IAMB 3FFDA 5DDHA 5C0NC 5DLMH 3DUUA 3P30L 4Y4FD 3RVVD 4AM0B 5JW4M 5HI4C 3CVHB 4Z7WF 1UJ3B 1QR1A 1U8MA 4I9WD 1J8KA 2DM3A 3FMGL 2BVOA 5I1KL 3BGFC 1G7QB 2LTQC 4YO0A 3UTQA 4OM1L 1MFNA 4XVTH 4R4ND 3B2VL 3SDDC 2V7HA 4Z7VE 1BFTA 1E4XH 1HQRA 3NA9L 5IT2L 1PY9A 4TNVK 1JPFB 3FT3B 3TBTB 5BQ7B 3GIZL 1IGCH 1JUFB 3MRKA 3H7BB 2F8OA 2DQIH 4M93C 5HHOB 1IRAY 5GHWH 5FM4A 5GGSY 3VRJB 4HJ0C 1MCLA 5D1ZA 3JV5A 4R8WL 1UACL 3OXSA 3TM6A 4LLQB 4BSVA 1WEJL 5AYQA 3PE9A 4HKBB 3OSKA 3KVQA 4P5TB 1DN0B 1VGKA 2UUDK 1RI8A 4D9QD 5I1CL 3H42H 4F7EA 4L3EB 1S9XB 4PRNA 5KTEH 1L6XA 1CD1A 3LH2L 4ZNCD 2C4XA 4MVBC 4QEGA 2MJWA 2OR8A 3X14A 2CIIA 4E5XA 5E95B 5JORB 3T4AB 3FB6A 1CGSH 1FHGA 3GNML 1YQVH 2PTVA 3TESA 2CLRB 2D7TH 2CK0L 1PX3A 2IJ0C 1DVFC 2OX5A 2BSRB 4X7TA 3FQXB 2NY6B 4FRWA 1Q0XL 4JAMA 1SBSL 1T83A 3T8XA 1BLNB 1D7FA 3O3DB 3F7RA 1AQKH 1U8OA 2YSSA 2DM7A 5I1IL 1TJGH 3VXUE 3K4DA 1S9VA 3RVTD 3ZDYE 2O5YL 2HLAB 1EVUA 4OIIH 5TGBB 2VLRA 4DKEH 4ELKB 2AGJL 4TNVF 1FNFA 1E28B 2VISA 8FABA 2OL3L 1BM3H 1MCIA 4J3XA 5GGRB 5TFSH 3PHOA 3TBSB 3PQYE 1GPOL 4P2RA 1UM5L 2EDKA 4KMTL 1VEOA 1N0XH 5I1HL 4LSPH 5EU3A 4HUXA 5HI3C 4JQVA 3ROLA 1FJ1B 3JWNC 4CVZA 3ARTA 3QCTH 1RIHH 5EO1A 1X4ZA 1BWMA 1H3UA 3HE6A 4FQJH 3UPRB 4ORGB 1ZKAA 1HINH 3C8HA 1A9BA 3IDNB 3HS0B 1QYGL 1JHTA 1I8IA 2C7UB 2QSCL 5DVLA 3WNMA 1T7WA 3IJHB 2XA3A 4J1UA 5AAMA 3MZGB 4LQFL 3T0WA 2GJ6B 3FOMB 4QXTA 4OUOA 1NPUA 2J5LC 2DQUH 4HS3B 3TH2T 3RWDB 4RWHA 5HYSB 2AP2A 3LN9A 2LVCA 5E9DA 4L4VE 1KFAH 3DGGA 3MC0A 2Z31B 3OKYA 4YFLI 4XXDA 5J06A 3QWOB 3DVNB