2ESVA

Structure of the hla-e-vmaprtlil/kk50.4 tcr complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
275
structure length
268
Chain Sequence
SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, alpha chain E
publication title Structural basis for a major histocompatibility complex class Ib-restricted T cell response
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 67
structure length 268
sequence length 275
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2esvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2esvA01
1G6RB 4D0DA 3UC0H 4QWWD 4XP6L 5ITFB 4YDVB 2Q6WB 2FYYB 5E6ZA 4WDIA 1EVTC 4JPVL 3FN0H 2IQ9H 4P5MA 4LKCA 3CFDA 4XVUC 1S9WA 1QD0A 4LPCA 2YD8A 2XFXA 3OJDA 4OFIA 3ZKMD 4H25B 2PO6A 3AXLA 4AG4L 2V7NA 4Q6YA 4NQDA 2MCPL 4ZFFB 1YECH 2AJXH 5LJYH 4FZEL 3ARBC 4M9OA 3WE6A 1T1WA 2DJ4A 2WP3T 3QEUB 5JW3L 5T3ZE 1BVZA 4LVOB 3DX8B 1YMHB 3RTQD 4DN4L 3SKMB 4EXKA 3KPSB 5C0NC 4FXKB 3QDGB 1H0DB 3KPTA 2YUXA 4M5ZH 3IFLL 3DHMA 4E5XB 2XQBL 2QHRL 2FR4A 4FOMA 4DVBB 1GAFH 2XQYG 1ZWIB 1EFQA 4U1LB 1HKLH 4ZUWA 3G6JF 2Z4QB 3C5ZA 1PW3A 1R5VB 3RWCA 3CCHA 3MRPA 4Z7VF 5GRVL 5C92A 3LKPA 1EERB 4GW5B 4OLUH 2OI9C 32C2B 2X1OA 1XGYH 1EEQA 1U8LB 3I6GA 5KAQG 1TPXC 3VWKD 5FA4B 2P24B 4AMKL 3LS5L 5ALBL 4X0KA 3JWDL 4O9HL 3WHE0 2AABH 1NBVH 5D7KD 1OAQH 1JFMA 4RQQB 2HMIC 4FQXD 1A6VH 1HN1A 3ARGC 3MV8E 5C0GB 1QVOB 5IW1B 4JHBA 3V5HB 4U6YA 4UQ2B 4NZJA 1HNGA 2NY0C 4WUUE 1DN0A 2A0LD 2B1AL 1RJLA 5E1AB 3DROB 4BUGA 3MLPA 5F96L 4KPHH 1IGMH 5TH2A 4K7PY 2WUCH 2Y6SD 3TWCH 3LEVL 1KB5L 2RFXA 4L29B 4JO3H 4OB5H 4V1DD 5IROC 2X09A 4NZUH 3QNXB 4E41D 2XTJE 5J11C 3PIQB 1IGTB 4PRHA 4D9RD 3RJQB 1QHPA 3IDJA 1PKQE 4XWOD 4H20L 5LWYH 2GK2A 3MLTA 4I13B 3VRLF 4OJFL 3ARFC 1I1YA 1MCQA 4LCWD 1D5ZA 1A7OL 5IMMA 1GZQA 4PRAB 4MCZA 5FV1L 3ME0A 5IMLA 4P9MH 3WXVH 1VFBB 1MFAL 1HQ4A 5CWSA 4CN1A 1FH5L 4IHOA 3WLWC 5GGQL 1F45A 1XH3B 4IMKA 3R1GH 1XGPA 3L3KA 5KVEL 4MDIB 3GMQB 4PY8J 3U46B 1ZGLP 1Y18B 1YEIH 4ZMAT 3G5VA 4APQD 3DOSA 5IKCB 1KCGC 4O2EA 2P5EB 5KS9E 2HT2C 3QDJA 1QTYT 3ARWA 5DJXA 3H7BA 4PGDB 3LPGA 4P4RB 1WGOA 1I9EA 4J3UA 1C08B 3O45A 3OKLA 3BEWB 3T04D 2HH0L 4NZTH 5HD8D 3QQ3B 3DGCR 4P3DB 1UKQA 1FFPA 3HE6D 3BPCB 2XWTA 2AERT 4F15C 5GGSA 3G5ZA 5HYFA 1YEKH 4MJ6B 4X7DC 1MJUL 5H94B 1HI6A 1PJ9A 1MNUH 3MLZL 5CIPH 1LEIB 4KROD 3OKEA 1A9EA 3NPSC 2ZUXA 1NGXA 5MERB 2A6IA 4R4FH 3EYVB 2QKIA 1CXEA 1F2QA 4N9OB 4M5YH 5DZOA 3WFDL 3WIFA 3GNML 2PW1B 3V2AR 4LHUA 1FFOA 4F57H 4GXUN 1UM6H 2X4SA 4UNTA 2WWMD 3P0YL 2EZ0D 3QNZA 3QHZL 3BPLC 5ACZB 1H3GA 1KTRL 5JHDA 3JTSA 2R2BA 1KEMH 3EKCA 2F54A 3C5SB 5I16B 4G9DA 3MO1B 1I9JH 4C57C 5A40E 3T0ED 2DQTL 4LMQE 1CD8A 3KPPB 3TBWB 3BEVB 2HTLC 1JYVA 2ATPB 4YDKH 4PJ5A 4U3CA 3L9RA 5CJQH 5FUOL 5BVPH 1U58B 1TZHB 3VFSA 5D7LE 1R3KA 2ZCHH 4G9FB 2DQUH 4AEEA 5DMIL 3TIEA 2ERJC 4TVPL 3ZTNL 2DMCA 4LSSH 2NLJB 4MB4A 1T20A 1BBJB 1J7VR 4MVBA 3BP6B 3ZSSA 3W82A 2XG4A 2WBJD 1CWVA 4DK3A 5C08B 4IRJC 4IOFC 2ADGB 1H3WM 1UWEH 1S7WA 5D5MF 1RJYB 3IDXL 4LEXH 4WEBL 4BKLB 4GAJL 2Z93B 1XIWA 3P4NB 1J87A 2FX7L 5JIHA 5M7QA 3NZ8B 4TVPD 1J8KA 1AHWC 3D85B 3X3FH 5HHOD 2LAGB 1MCBA 5L6YL 4GAGL 4KVCL 2F8XC 4NSKA 1HYSD 1A8JH 4YR6A 5TE6L 1F3DJ 5EBGA 4Y4HC 4YWGL 5J57B 4L4TB 1EO8L 4LK4A 4PJCF 1J5OL 1NAMB 4NKOB 4JGJA 1VKXA 4R4BB 4JFDD 1HOCB 3TBSB 4ZTPH 4WW2F 4I77H 2V6HA 3TVMD 1E4WL 3SCMC 1RHHB 1KCUH 1Q9KB 4P2QD 4CDHA 4HQQL 2H2PC 5E5RB 1VGKA 5D72L 2B7DT 1B3JA 4X7TB 5E7FA 3VGBA 2BVQA 3P4MB 5IVNA 3WL9A 2AEWA 1J0IA 1NEZA 5D7KE 5JQ6H 3BO8B 3RL2A 5BV7L 5FO8B 3UPAA 2VDNH 4OSUH 2OJEB 4K23L 4RWYH 1AQDB 1L0QA 4JO2L 1IKNA 3QDGE 5J7CC 3IDNA 3CU7A 2QR0B 1IFHH 3W5MA 2NW3A 4PRIB 3BP4B 5L2KA 3C6LB 3FRUA 3AU1B 2OR7A 5DWUH 1TVBA 3PGDA 1BD2A 2F5BH 1CGWA 1X5JA 3W0WA 2VC2H 4RFNB 5KVDH 4XAWL 2DD8H 5GGUB 2D03L 3HRPA 1NCDL 4GH7B 2J5LC 4MNGE 4E41E 3UZVB 4PRPB 5I18L 3U7WL 2X4RA 4WV1B 1JF5A 4YDLC 1IE5A 1TVHB 2YKLH 1AXSB 3QUYC 3UJIL 3MJ9A 1CK0H 3RDTC 1GGCH 1NC4B 1OSPL 5FK9A 4Z9KB 3NCYP 1FZKB 5HDLA 5B8CB 1A1OB 2H26A 4HG4K 2Y36L 4HS6B 4KKBC 1QRNA 4IIQA 2G9HA 1D5IL 3FL7A 3C08L 2DIJA 4UU9A 5F3BA 5EU6B 2MPAH 2HT3D 5L9DH 3LDBC 3JZ7A 1IGFH 1CFVH 3DBXA 1RZIB 4KI1A 4HLZH 1DQML 3TT1H 4JPKH 1DN2A 1OAYH 2GFBB 1QR1B 2D7TH 4ONGH 5D7JD 1AE6H 2W60A 3UBXB 1A6UL 2DLTA 2VDRL 4HKZA 1YNLH 3BP7A 4QOKA 2EDFA 3HZKA 2BNRD 3CDFA 4DW2L 3NPZB 4ALAH 4LKXB 4Q6IA 1N64H 4I9WD 1YMMA 4PJ7F 4OGXL 1NMBH 3EAKA 1I7RB 3K3QA 3GSRB 1KEGL 1OTUD 1XAUA 4LIQL 4WU5B 4XP1L 3LD8B 3VXUA 4QHNB 2VERN 2NTFB 1I3GL 2IAND 1L9MA 3ULUL 1S7RA 3HC0B 3K2UH 4NO0D 4Y4KB 4P4KC 4QRPA 3DVGA 3PXHA 3UXFA 5FO7B 1FO0A 4LPWA 2A6DB 3ALPA 2JB5H 1UACL 2F74A 2HFGH 4EJ1C 5DUMH 1MCJA 1LP9B 4RGOL 4QXUH 4GAFB 1KCSH 5GS2H 2P5EE 3UBXI 3OB0H 3WUWA 2HKFL 4TSAL 4X6FA 1XF4B 2D7QA 1UYWH 3DX6B 3PJSA 5AYQA 3VDCA 1WQVT 3SKOA 1JN6B 2NY1B 5ADOL 3ULUD 1MHPH 2WIMA 3VG9B 4R96A 5JXEA 4HJJH 2DI7A 4ODUA 4OT1L 1KIRA 5C6TH 4Z7WB 4IOSD 4YFEA 2CKBB 1MFDH 2IPKB 3DXAB 4U1MA 2QSTA 5FCUH 4F7TA 1LO3H 2Z35A 4KDTC 1BZ9A 1ZLUK 4XXCC 5F9JA 1R5IB 4YBLC 5DMKA 3L95B 5GGVY 1JNNL 2VAJA 3IT8D 5EBMA 1CL7L 3QJHB 2G60L 3V5DB 2P46B 3CMOL 4Z76A 4LP5A 3KHOA 3LV3B 4OIIH 2EDLA 1IAII 3GBML 4PPTA 3ARBB 1SHMA 4J4PD 4G6JH 4I8DA 4Q9CA 3HUJB 3LSOA 4J1UB 3MCLH 5GGRB 5INDA 4LEOB 1M71A 1JUFA 3HLAB 1BVKA 4RFEA 3MRIB 3KNBB 4W6WB 1P6FA 1RIHH 1Z0MA 1CN4A 1MPAL 4NQEA 3VCLB 3B2UD 3H42L 1D3CA 2A6JB 3BFOA 4L1HA 5FM5O 2DF3A 43CAA 5MEQA 4PS4L 2VTFA 2OI9B 3A6CH 4UUJB 4IEFB 3V5KB 3KPMA 2ZSVB 4D2NA 5D4QA 3GDBA 4OD1L 1TPXB 4YPGA 4MX7A 5I17A 4GRWE 2YD9A 4DCQA 3MRRB 4HAFA 3VXRD 5F7EH 3SGKA 4A6YB 3TF7C 4PJEB 3V95A 3CH1A 3FMGH 3V8OA 3HA0A 4HH8A 2ITDA 3ARGB 3VE0A 3WS6A 5LGHH 3X13A 1WK0A 5CINH 4NO2B 1AKJB 2DMKA 1MCHA 3PWJB 3TFKA 2NY0B 1CLOH 1I3RA 1MY7A 2CIKA 4URTB 3QEHA 5FECB 5TDOA 4FG6C 1ZHLA 4KKAC 5F6HJ 3VXOA 2JCCB 4Z77B 4UINH 4HUWA 3BKMH 2BSSA 4ODTL 4FFEX 5AG8A 4QTHA 3QEGH 3LPWA 5DT1L 3LEXA 4QRRB 1ED3B 4PJ8C 3TA3A 5ICXA 2GCYB 4HWEL 5J11B 4X6DA 3LQZA 4YDIH 3QFJB 3GM8A 1A1NA 1U8PB 2R56H 5TPWL 3VFOA 3H0TA 2Y5EA 1D5MA 2E9WA 1VFOA 3BH9A 3MACH 3ARFB 4BH8B 1QSFD 1CLYH 4JJ5B 3N9GL 4J23A 3GJEA 5GRXG 1N26A 3U36B 5ETUB 1ES0A 4PJBF 4JO4H 2Q8AH 4M7LH 3F7RA 1F3RB 3MLXL 4C83A 3VFVB 3CSPA 4G80A 1A14L 5GZOD 3PUCA 4NJ9H 5CJXA 2XY2A 3TV3H 1LWRA 2JELH 1HHGA 5IB3B 2CXGA 5GRUL 2FIRT 3QG7L 1OP3K 3EDJA 3RAJH 4K9EH 5DRZB 4NNXB 5KSBA 2GT9B 1DL7L 2VAAB 4L3AA 2HT4C 4JFOB 1IT9L 1FLRL 2SEBA 3CFBB 3ISWA 4IS6A 5I1AB 4QT5A 2VXTL 4F15B 3NIDF 4FQHB 2BDNL 4PV9B 5IHZA 3VGDA 3S37X 4WW2C 2OTUA 3MJ9H 5CBEB 1BZQK 1BFVH 2QQLH 3OG4B 5DJ6A 4G8IB 4R2GC 1X5FA 3V6ZB 1XCQB 2MTPA 4K3DH 3WN5C 4WW1A 4MXVE 3NPSB 1P7KA 4LCUB 2C9AA 3S36X 3CX5K 2W0FB 4BYHA 1LK3L 1V3KA 2VLRB 5DFWH 2J2ZA 1F4HA 3L3HB 3C60B 4LGRB 3RWJB 2FRGP 3FN9A 4QHMA 5HPMB 1UH3A 4M02A 3SKUD 1WEJH 4PLJD 3GBLA 4X9BA 3MRKB 4EDXB 5FF6A 3VXMA 3MRNA 1HCVA 1YY9C 5I8OL 2CO6B 4KUCD 2VXUH 5EU6E 1KLGB 2NXYC 3O4OC 5GGTL 4V2CB 3RX8A 3MV7B 3QG6A 1T4KB 1NCCL 3GGWB 3P4OA 4PV8A 4MSWA 1U8NB 3QXDB 2M1KA 1V7MH 3TZVD 5INCA 2F15A 3N1MC 4PJAA 4WO4C 3MJ6A 3QUML 1S7VB 4D3CH 4HUUB 3RNQB 2YPKB 1JHTA 4OF5A 3ULUE 4YJZL 4BQBA 1LVEA 1C5BH 3VXSE 5D7IF 5FHBL 4G3YH 3TO4D 1HXYB 4M8VA 2NY7L 3LHPH 1C5DB 2UWEA 5I2IB 2ERJB 1GXEA 1GIGL 3MZTA 2QBWA 3FCTB 3MFFA 5EZJA 4CN6A 1CS6A 1S9VA 1J8HB 4HKXB 5ESQA 5CZXD 1L6ZA 4O51A 4DZBA 3S37L 2DIBA 3ZHKA 1VEOA 4PFEA 5BQ7B 4MS8A 4TUJA 3TT3H 2BY0A 4IRJB 1FO0H 3WNMA 5IEKA 3LQAC 2ZCKH 3L3JB 3IU4H 3S36L 4ZPTA 4D9LH 2BY1A 5D1XB 5E94B 3BKCL 1PFCA 3FFDB 1NGZA 1D9KA 4GKNB 2YD3A 2EDWA 3NFSL 2H2SC 3N1QC 4I4WB 4PR5A 2BNQB 4MXWL 5MEND 1WAAA 1HHIA 1YEJL 4R7NB 4U1JB 1AHWB 3QHFL 2VXQL 2AEPL 4Q9QL 4Y1AD 2O61A 4EI5D 5EA0H 1FZMA 5FDWA 1ACZA 5DJ8B 2EH7L 3D18B 1BPVA 4Y4HB 2J4WH 4HH9B 1OY3B 4KK5D 5IJVA 4KZEH 1IM3B 4HPYH 4Z7WE 1PY9A 3TN0C 4HPOL 2BVYA 2I9TA 5IQ9A 4UZGA 1FGNL 4XNQA 3DXAE 3SCMB 1CGSH 2GY7B 3TH4T 2ED9A 5I8KH 4TTDD 4MAYA 4OZFB 2X89A 4FP8L 3J7HA 3PL6A 4EOWL 1TJIH 2JF1A 1UWGH 2NYYD 1OTSC 1I7UB 4P5TA 5KANI 3X12B 4H88L 3IDYC 2OK0H 1UFUA 3FQUB 2B0SL 4AEIL 2G5RA 4EI6A 4OLVH 3T0BA 4HBCL 3MRLA 1RZ8B 4N8CH 1CE6A 3AAZB 4GAYB 3V8CA 5CSZA 2IH3B 4MD4B 1GHFH 3MLRL 4DFIA 2GSGA 4AIXA 1UKSA 1F4XL 3KR3H 3QI9A 2VJXA 4NPYA 1LO0H 3H3PH 4KJWD 4RAUB 4ZFOB 2CUIA 2ORBH 4O2FA 4Y89A 2KH2B 1S7TB 4P48A 4XH2B 1BEYH 2UYLA 3QPXH 2J5LB 5D1QD 2OQJB 3G08B 4Y2OA 4FQLL 4YDLB 1T21B 2JJWA 4WFGD 3BQUC 1DBJL 2M26A 1UVQA 2DTMH 1U3HA 2COQA 5T1MB 3ZKSD 1BVLB 4XMLL 3RDTB 4ESKA 4GMSL 1W0YT 1T1YA 5EN2B 4HIEB 4PJEE 1FVDA 3S5LA 4L4VA 3I84A 1CXFA 3RWIA 1SYSA 2BP3A 5JIPA 4UT7H 1EK3A 5E9DA 2EE6A 4MA8L 4F9PA 3VFGH 4ENEC 1KPRB 3KLHC 3PXJA 4NBXB 3IFNH 5CSGA 4L5FL 1HKFA 2Y25A 2Q7YB 1N6QL 4OUUA 4OV5A 4OGAD 4DGVH 1IC5H 1Q9LA 3LDBB 1R5WB 3ZTJH 1T0NA 5FYLH 1ZEAH 1R6VA 4CVXA 5ANMB 3CVIL 5FB8B 3ARED 5C0BB 1PYWA 2WBKA 2Z31A 3MPCA 4N9GB 3DRTA 5A16A 1Q1JL 4JG0L 3O2DA 3G6JB 1LK2B 5IBTL 2CD0A 2R0ZL 1CR9L 2IPTL 4X80H 4I3SH 4YEEA 1OL0A 3QFJE 5FKAB 4D8PA 5JO5A 2HRPL 3HC3H 3V4PH 2HVJB 3BVNB 2J12B 1FNSH 3MLSH 4X4MA 2VB5A 3E2HC 2R0WL 2IAMD 4Z5RB 1FDLL 1LEGA 3C9NB 4RWHA 1LE5B 3P9MB 3KJ6L 4P4KB 5IJKA 3IGAA 3MRBA 1S78C 5IW3A 3MV9B 4P49A 4H5SA 3TM6A 5E0QA 3FB7A 1XGUB 1G7LA 4M62H 2BERA 5BVJB 4OF3A 2A9NH 2ZCLH 5CJOH 5HYJA 3BGAA 1NGQL 2FO4A 2J8UE 3TO2B 5IR1A 3MFGB 5E1HB 1MH5B 5I1CL 1OQXA 1TLKA 3CSGA 3QQNA 2VWEE 3WHE1 4ZFGL 1NGPL 2E9IA 4Z18A 3IU3B 4ELKB 5HVGB 5E8EB 1SYVA 1LO2L 4OGYH 5A43C 1S3KL 5EU7C 2QQQA 4JM4H 4EDWH 4XCCL 4CMHC 4NQVB 2A77L 2XZAH 3VRJA 5E5MB 4JFPA 3FB6A 1EPFA 3W39B 1YYLH 4N5UA 5F3HA 4M7ZC 1BJ1J 4LSRH 3AFLA 4YBLB 1QFWH 3RZCC 5JW4R 4OIAA 1NSNL 1SM3L 1T03H 3MJGX 4D0BB 4DOHE 1JZ3A 3HNTH 4BFIA 3MV7E 3OKMB 5C0CA 3UO1L 1G0DA 1QLEL 1JHLH 1EZVX 2IBZY 4JFFD 2GAZA 5AZEH 3SDXA 1CICC 4U7SA 5C07B 4L8BA 3REVA 3QIBA 4X6BA 4FFWC 5F97E 4WHYG 1T7YA 3X14B 1W72B 5FA3B 5F1OB 3U79A 3OKNA 3BN9C 4N0CA 4F7PB 1ZA6B 1RK0B 3CDGB 3ETBF 3IXTB 3KYMB 3L3IB 3FO0L 4HIJA 2BK8A 3DETC 1DEDA 4TSCL 1CE1L 4NZRH 3RA7H 2HFEA 3MGOA 3VD3A 4JVUA 3QBTB 2R69L 4C4KO 4M48L 3HI5L 4M9PA 3VA6A 4JM2A 2XZQL 1B9ZA 1I7ZB 4PTTB 3V52H 4NQSA 1TJGL 4U7MA 5TQ0H 3D2UD 1QO3A 3QEQD 1UT9A 1OLLA 4PGJA 35C8L 3U2SA 3HN3A 3HMWH 2WUBL 1U3ZA 1J12A 4M61B 4G8GB 3SE4A 2EIZA 2Z9TA 1FVCA 4O58H 3TC9A 5HYSA 4N0YH 1ZLSH 1P2CA 3NN8A 1P84K 5EUOA 2CLZB 1T7XA 3MNVA 4TYUA 3CFJB 3BW9A 3NH7L 3DWTA 2E6PA 3K8LA 4BFGA 3QA3A 3LY6A 1A02N 3E0GA 4L9LC 1NL0H 4G7VL 3CIQA 4PJ8B 1CFSA 5CSBA 2CDFB 5F7FA 1L8JA 2ZUTA 1BOGA 4U1NB 3P77A 3C8KB 4JEGB 1OGTA 2PYEA 3VWJD 4FABH 1MAMH 4GW1B 1BWMA 1UZ6E 5CBAA 1ZHNA 3I02B 2EE3A 2X4PA 4RRPG 1J1XH 1P6AB 3WDJA 4KRMB 4C56A 3LKRB 3U6RB 1KELH 3SDAA 4FS0A 3C5JB 5D5MB 1KN4H 5SV4A 4AQOA 1IC4L 4M1GL 2LU4A 5J3HC 4R26L 1BGXL 3CFEA 4WU7B 2R9HC 5CD3A 3IDUA 4Y4FD 2IBGA 4LCYA 1JPGB 3LMJH 3HNVL 3KPNA 4LFHD 5AAMA 5IVZA 3T4AA 2V5RA 2AQ3A 4JY6A 3KJ4C 4OZGE 5HY9A 1FSKC 1NFIB 3KLAB 4J6RH 3SGJA 5E00B 2VLJD 4H0HB 4PJCB 1OAKL 4P2OD 4XVSH 1DZBA 3QFDA 4KY1H 5I8EB 1E0OB 3C5ZC 5F89B 5A1AA 3EO0B 4WW2B 1G6RL 2B4CL 3B2VL 1LNUB 4NYLA 4R2GB 3OJ2C 1MRCH 3NABH 3B5GA 1VCAA 3TIDB 4MJIB 2QL1A 2NXZC 3JWOC 4JZNA 1EAPA 1DFBH 3EHBC 2IJ0C 2FCBA 5GISL 3GMPB 1ND0B 1D6EB 2NX5D 1KF9B 1A7NH 5EFIB 3UTQB 4MZ2A 4E0RA 1DVFD 4QRTA 5K33A 5IB5A 1BQHG 4WFHD 2Y7QA 3O0RH 3VFNB 3F58L 2NXYB 4U6XB 1MRFL 4LGPB 3KLSA 4PGZA 3EYUL 3G6DH 2CK2A 4NP4H 5I1HH 3TP4A 4LLDA 5MHSE 4UB0H 2XYCA 1EGJA 3QCVH 2FJHA 3OTTA 5DJAA 4AZ8A 4WO4B 5ALCH 4GRMB 3O2DH 4PJIB 2GUOB 3HG1D 4FQQA 3G6JE 4FTVB 2P8LA 1RPQA 3T0XA 1TETH 5I15H 1MHHA 4Z7VE 4CKVX 1OF2B 3RPIA 4MXQC 3V6OE 1JHKH 4ZUVA 4PLKD 3KPSD 4XCFH 2A2QT 2HKHL 5IGXL 4WIQA 1UJTA 4LPXA 2HLAB 2AJZA 4G42A 1T89A 2HVKB 3X3GL 2AGJL 3PV6A 1AGFA 2Y06H 2HTKD 4PTUB 5SWSD 1FZOA 2EIEA 3STZA 1OP5H 4N0UE 5F8QC 1XGTB 2HFTA 3GO1L 4UTAL 3D87B 2QSCL 5HDOA 5B3JF 3WFEL 5IIEB 2YC1B 3T0WA 1ROWA 2NY3D 1E27B 1OVZA 3CFIC 3BWAA 5DK0B 4MA3B 1OGAD 1J1OH 4P3CH 2PUQT 1WUNT 3FQNA 1UA6L 4H0IA 4OKVA 3QIUD 5FYKE 1SBBA 3VFPA 1T1ZB 1KACB 2NZ9D 3W5NA 3RTQA 1BHGA 4JKPL 4H1LB 1S5IL 3GM0A 3MLUL 2BJML 3MCG1 4MWFA 5IW6A 1R3HA 3SY0A 2GIYA 5EIIB 3GZKA 4WUKL 4XNMA 3TN0B 4KV5E 1MJ7L 1ORQB 3UJTH 4OCXH 3VG0L 3SPVA 1O7SA 5CS7A 2AV1A 5FGCE 5J1AA 4JQXC 5EO1A 2EDRA 4ZXBA 1Q94A 4PJ7B 5ECJE 3GSWA 1EJ6A 2A83A 3BHBA 3T65B 5K9QI 3QRGL 1UEYA 1A0QL 1NCBH 2Y07L 1FNGB 3QSKB 2D9QB 3MCKB 1YQ2A 4F7MA 4HJGA 2E7LA 1IAOA 3KPRA 5A2KH 5AG9A 1A7RL 3QWRD 1F4WH 3OXSB 2VR5A 4HFWA 4LNRB 3IDYB 3RWDA 4LPYA 3TBYA 1CFNA 4JHWL 2VLMD 5D1ZC 4GMTH 1NBQA 4L8DB 1FFQA 1N5AA 1CFQB 1FAKT 3LRHA 2BOBA 1OAUL 3UJJL 3S9DB 4HZLB 3UC0L 3RKDD 1MREL 1KYOJ 1IAKA 3P11L 1W2KT 1AO7D 3H9YA 3EOTH 4X99B 3S96B 1NLBH 4I3RL 3O4LD 1BF8A 2IQ9L 3HPJB 3DI3B 3VFTB 3CFCL 3DURB 3GJFK 4NNPL 1YECL 4K8RL 4X6DF 1GGUA 2CLVA 3BQUB 4X4ZA 4XAKE 4LLUA 1K9TA 2A6KA 4PUBH 4JFED 5DS8B 3UEZA 1A1MA 3ARDA 5J9PB 1PAMA 4MVBC 2QV2A 4JFQA 1ZLVH 3V0VB 4HKJA 5BW7A 2C26A 4LCWA 1WZKA 43C9A 1GAFL 3SO3C 4JO1H 1WFUA 3E6HA 3SKJH 2C7UB 1ODAA 1TMCB 3IAGC 3Q6GH 3HFML 1AQKH 4G8GE 4HMCA 3B3IA 1AGCA 4KQ3H 4YH6A 2DWEB 3VXPB 4GKSB 5D6CA 4K8RD 5DMYA 3WEXB 2ZOKB 3OF6D 4KAQH 4F8QA 5DJZA 3U30C 3P4LA 5C0DB 1E28B 1F2XK 3PDGA 2Z8RA 2QADD 4X4XB 3QP3A 5KSBF 1DQLH 1JRHH 4LNVA 4APQA 4OLXH 5CKAA 3BAEL 4K55A 1GGYA 2D7NA 4O4YH 1K8IB 2LAAA 3EOAB 1WV7T 3LRSA 2BRRH 3HRZA 5E2WL 4XPTH 1NDGB 2P48B 3HE6A 2UZXB 3VGFA 4F58H 4Z7UA 3E2HB 5C9JB 2ZNXA 2GQHA 5L0QC 5EIVA 2YBRA 2PYFA 5JOPE 4U1SA 2OX5A 2CDGA 4NWUL 4NNYA 3FQRB 5D5ME 4QEGA 1J0KA 1OTTC 1CFBA 3T3MF 1EEYA 4IMLA 4JO3L 2VXSL 1MI5B 5AYUL 1G9NH 2DN7A 2AW2A 2X4QB 4BQ6A 4XBEH 4RISL 4UBDD 4WWKB 2APXA 4RZCA 4F9LA 5K9JL 1F90L 2BNUB 2D7MA 5ESVA 5LWYL 5DEGB 5C2BL 4MCYA 2W65A 4TUKH 1PSKH 4XCNB 5AUMA 4Z78B 4J8RB 2V5TA 4PJAF 1A6WL 3GJFB 5C08D 2ZKHL 4PJCE 1A4JA 1NAML 4XPHH 3T0EA 4YBHA 2Y9RT 3L3DA 3W2DH 3QIWC 4P9ML 3WXVL 4CMHB 1ZE3C 5CEZL 4UV7L 2R39A 1GH7A 4MB3A 5K93A 1JPFA 2X4OA 5HI5D 1SVCP 1NCAH 2UWEF 4X4YB 1N59B 3R1GL 2BHZA 3D85D 4M7ZB 4MJIE 3GSOA 1IEBB 4EN3D 2GJ6E 1AGDA 4DQOL 5SWZA 3KPLB 2DLFH 4QY8A 3UTTE 3CPLA 5JPNB 25C8H 2R2CA 3MXWH 4YGVA 1I8IB 1NKRA 4PJBB 4L4TD 1XGRA 4RIRA 3WKML 4IM8A 1DSFL 3FFCD 4Q9RL 1EGJH 4L3CA 5CEZD 1R3JB 4ODXA 4IIQC 1CICB 2A9MH 3L3OB 1LDSA 5DFTA 1MFNA 3BZFB 4N68A 1FQ9C 1WAAF 1QLRB 1WCQA 4TSBH 2NR6D 3IDGB 4U1KA 3U0PA 1QBAA 5DUBA 5HHOA 4FTVE 2W1NA 4J12A 3THML 2ICEA 4OD3H 1KIPA 5JXAH 4HUXA 3ROLA 4QYOB 1MOEA 7FABL 5K59F 5JLZB 3LH2H 3OR7A 4GUPA 4KTDH 1GYAA 4PJDB 1UM6L 4JFDA 4LF3A 2ESVB 4FQCH 4X6EA 4Z0XA 4GG8A 3TVMA 3MJ8A 3FAWA 3VI4E 3P40A 5ERWB 3OJVC 5F72S 2M8XA 3U82B 4P2QA 4BA8A 5IV2A 1I9JL 1S7UA 4X9FA 4AT6A 4LDEB 3OGCB 4K94H 4Y19D 2Q1EA 3G5XB 4UNVA 3RWHB 1U8MB 1FRGH 2X2YA 5EU3A 2ARJQ 2EDKA 4G7YH 4AK1A 4JRXA 5BVPL 2MJWA 5KG9A 2NNAB 1JNLH 4Y2DB 5GGSY 3G5YB 1KOAA 4IOIA 1EHAA 5HHME 1EEZB 2FX8H 2LTQC 2PXYB 5IF0B 1KJMA 4XMPH 1Q9WB 5TGBA 4LSSL 4KJPD 2X1XR 4XP6H 3MNZA 1NC4D 1AO7E 4P9HC 2CUHA 1IQDB 4L9LB 4JPVH 3VFMA 3O4LE 4J3XA 3RY4A 1K4DA 3RWFB 4FXGB 1CTOA 5D7IB 2ADFL 4MNQD 4AG4H 5JXEC 2MCPH 4PJ7E 3DIFA 5EC1B 4PP2B 2Q76A 1NC2B 3HR6A 5DJCA 2JJUA 4D0DB 4DN4H 4XRCA 3HPLA 4FQJL 4ZOAA 3SKNA 1EEUA 2OTWA 1YPZB 3DI2B 1TTGA 2FL5A 3NFNA 4LKCB 3WNLA 1HDMB 4TVSa 2MFNA 3LKOA 3O3EB 3OJDB 1SJEA 1C12B 1UJ3A 3BWUC 2OBGA 4YIQA 4Q7DA 3DX9A 1WC7A 3ULVH 4ZDHA 3O6LH 3ET9F 3JV0A 2XN9A 4N8VA 3VD4A 3KJ4B 3OAZK 2WAHA 4AMKH 5J6HA 5T1LD 3LS5H 4QHKI 1R3LB 5CLTA 1JGUH 3JWDH 2FR4B 3NFPA 1ZA3A 2UV3A 1FG9C 4DZ8A 2HFFA 2VN7A 5JQ6L 2KKQA 2CKBL 1BJMA 3C5ZB 3HKFA 2MQ0A 3OB0K 5I1EL 4NKMA 1OARL 3N0PB 2BNRA 3QO1B 4F37F 2B1AH 1KULA 2NXZB 5F96H 5CFHA 2G2RB 3AY4A 5IM7A 2NW2A 2OZ4A 2NY1D 3O3BB 1SEBB 5DWUL 5KZCB 2VLKB 2Q3ZA 3TCLB 5I71C 4LRIC 3V6FA 2NY6C 1CXHA 2YRLA 2IANA 4ZNEA 1E6JL 2VC2L 4L1DA 4KVNL 4NC1E 4QRUA 4U33A 4UQ3A 3MA7A 3WFHB 3AVEA 5DR5L 5IMOB 1U42A 3WNOA 5E99L 4NN5C 3TFKC 3O2VL 4R0LA 5JQHC 4BFBD 4JKMA 1VA9A 3D3VB 3I6LE 4QF1A 1ZLWH 1IBGL 1A7OH 3W11C 1KENH 4JRYB 3T8XA 1QSEB 1U8HB 2JJTC 1EAJA 3PQYB 3QUZB 3ARBD 1MFAH 1RZKC 1IEAA 1FH5H 3INUH 5GGQH 1V3MA 4PRHB 3RVUC 1H3VA 5KVEH 1OWRM 5DJ0B 1NMCC 3DUSB 1IGFL 2Q3AA 5KJRL 2JLLA 4N5EA 3TT1L 1OAYL 3PWPB 4F7CB 5IBLD 2OR8A 1VENA 2CRMA 4X8JA 4ONGL 4JFYA 1AE6L 1LMKA 1MI5E 5C7XL 1ETZA 2HH0H 2ZPKH 3D6GA 4KK9D 4LDLB 5CWSB 4HZAA 5C8JA 2GITA 5E6IC 3RRQA 4ALAL 3I85A 4J3TA 3SDXF 1MJUH 3L3KB 2ZSWA 1BLNB 4X98B 1XF2A 4DKEL 3F8UB 3MLZH 1O7VA 3IFOB 6FABH 3AGVA 3H7BB 4WRLA 2ICWA 5D93C 3WJLA 5EU7E 1I8MA 1J0ZA 3OKLB 1I8LC 3SN6N 1AKJD 1P5UA 5IB1B 1WWBX 3Q5YA 2HYMA 5IWLC 2D31A 5J6GB 5B38A 1OHQA 2BHYA 3IVKA 2NY0D 2YUZA 3OHXB 5GGSB 4OLWL 4X9HA 3VGHA 5DUML 3LKSA 3P0YH 1BQLH 4ZUUB 1ZK9A 1KCSL 4JM2F 1X4ZA 1URLA 3DMMC 1WVZA 3OKEB 4LRNH 4KI5D 5ICZA 4ZSOB 4PJBE 5JNYB 3RP1A 3VXRA 1C16B 5C0IA 4HUVA 5BZWA 4I2XA 4YPJA 3W9EA 2J7LA 3NCCB 3GMRA 3R0NA 5D1ZB 5FUOH 3MRDB 3HCVB 3DO3A 2CDEB 2P8PA 1S7SB 1G7QA 5DMIH 5HTSA 5FO9A 4NM4L 3VH8B 4TVPH 5GJSH 3ZTNH 5JHDB 1F11B 5EUOF 3ZYIA 2VXVL 1CDJA 3ARSA 4HIHB 5BRZA 2LVCA 3MJ7B 5FGRA 2R0LL 1KJVB 3RVXC 1H5BA 1X5GA 3WLWD 4TTGA 4Y5XA 3NIDE 3OR6B 1R3KB 3IDXH 3MRMA 3IXAA 4WCYL 4GAJH 3NMEA 4JJHA 2FX7H 3QJFA 4MDJB 4HV8B 4F33A 1JCKA 3U48A 2C1PB 5L6YH 4GAGH 4K2UL 4N1CA 4P23C 1U95A 2UUDK 3GSQA 4WI2A 3RU8L 1CDBA 1QSFA 3HZYA 4KVCH 2VISB 4JZJC 3UBXG 4MS8C 5DQ9A 2BX5A 3SO3B 4F7EA 1TZIA 5TE6H 2FX9L 4TPRH 4X6CA 4YWGH 4X5XA 4AENB 1EO8H 4LHUD 3L7FB 1NGWB 1P4BL 1J5OH 2I26N 1MRDL 3AM8C 1MCEA 2R1YA 2BC4B 2GTZB 3EYSL 1E4WH 2C3XA 1J05B 4NFCA 1FN4A 4Z8FL 5D72H 2FJFB 2VLRD 3C60D 4PJ5D 5D7IE 2LV4A 5BV7H 4DVRH 2L7UA 2YUVA 4P2RB 5C09B 1DQTA 1J10A 2EYTA 4UMGA 3ZDZF 5LGHL 2IPUK 3NA9L 4W6XB 1QA9A 4K23H 1CLOL 4JO2H 1R24A 3M1BB 3FB8B 3F62A 5L0QB 2BVQB 2ZJSL 4B7LA 3G9AB 2CR3A 4E9LA 2P7TB 5C1MB 3CLFL 1BX2B 5D2LA 4LLYA 2FSEA 2F5AH 5JA9A 4I18A 5EOCL 1WT5C 3RL2B 4OLZL 2YUWA 2ATKA 4NQDE 1PQZB 4QCIB 2D03H 1T5WA 1NCDH 3O11B 3HAEA 5ITBH 5CJ8A 1U36A 4YDIL 5I18H 5JPMA 1DLHB 3U7WH 2R56L 4L3EB 1A47A 1M4KA 5EZLA 3MACL 1U8JA 2AP2A 4G6KH 4NCC1 4W68A 3WSQL 3UJIH 5HI4C 3WLBB 5B39B 4MD0B 5GSVA 1OSPH 5L2KB 3BDXA 4IOFD 4KJQD 5F71A 2Q8BH 1G7HA 3QIWB 4XBPB 5D1XD 1EDQA 3ALWA 3QO0B 3ORJA 3V4UL 5D2NB 4YHPA 2DWDB 4NRXA 3C08H 4NJ9L 5HYQA 2X4RB 3TV3L 1LEKA 1NBZA 1RMFL 2OZ4H 5LAXB 4HUMB 3OG6B 5GGTA 1U3HC 1Z0NA 2X44D 1MCKA 1SY6A 4PJGB 1JF1A 4K9EL 5HGDB 1AFVL 3MOBL 1M6OA 5FK9B 1JL8A 3EYOB 3Q6FA 2H26B 4UOW0 1A6UH 2VDRH 4XWGL 4RAVA 3QUMA 3WMSA 4F9PC 3MRFB 4POZC 3KYNA 4ELMB 3Q1SH 4DW2H 3SCMD 4PJFA 1A9BA 4UU9B 1NFDA 1C5CH 5KN5A 5GS0C 3KGRA 4OGXH 3Q5OA 2JB6A 3LAFA 3B9KC 1KEGH 5MENA 4CVZA 3P73A 4ZFOL 5DQJA 4JRYE 5EDXA 3HR5B 3HE7C 1BD2D 4XP1H 2DLIA 4M4PA 3I75A 4Y1AA 4GO6B 1KXQE 2QSVA 2V5SA 5DD1L 3JVGC 5SX5K 1A6AA 3MQIA 3CZFB 1WF5A 4KRPC 4NRYB 4NRZB 2D0FA 4HMEA 4NIKB 4PRHE 1FFNB 2BMKA 3BMVA 5IFJB 3J8F7 3RY5A 2C3VA 2IQAA 1MLBA 3OKDA 1FL3B 4RGOH 3EYQD 5CMAB 5HGAB 3T4YB 1T7WA 4U49A 1LILA 5JOFA 3UTSD 3GMNA 5KW9H 2QHLA 2HKFH 4KI5E 1MVUB 3VXUB 3CDYA 1PZ5A 2IBBA 3ZHDA 5ADOH 2QSQA 1XR9B 5GSRA 4AIZA 1C5BL 3K81A 4OQTL 4OT1H 1FO0B 4HLJA 2V2XA 1CLZL 2VABB 4IRZL 1RQ5A 1X5HA 2VSCA 3SBWC 2VQ1A 5KSVA 3RDTD 2UZIL 3FOLA 2W92A 3QDJE 4OLYH 3EJZD 4DKAA 3IF1B 1BP3B 3BPNB 5JDJA 2PW2A 3TH3T 1FZJA 4AM0A 2GJZB 2NY2B 1V3JA 3TT3L 4HX1A 1CL7H 2G60H 1WIUA 4GKOA 3CMOH 4K3EL 1KTLB 3SDDC 1G7IA 1HILB 5TDPB 5IG7B 4ZO6A 3RFZC 3GBMH 5GZND 5C6PB 2AXGA 4FNLL 4AIOA 5DVLA 3GMOB 4GG6B 4QGYA 1GOHA 5LQBL 4XGZB 5A3IC 3IJYA 4CVWA 3GSVA 3PABB 3NCBB 1LE9B 5IQ7L 4ZNCD 5F9JB 2EYSB 1ADQL 1TCMA 1YEHL 4JQVC 4P57B 4QRPD 2VRAA 1XF5A 3FZUD 5DGRA 4Z76B 3D0VA 1A4KA 1ZSDB 1MPAH 2CJUL 1TITA 1JGDB 4OF7A 2WMPA 1SMAA 3L3GA 4XPFL 1N0LA 3GSUB 4PS4H 5GRYA 5JHDE 1H3UA 3D25A 4ZUSA 2LQRA 1CGSL 2F54E 5DQDL 2X70A 1YN7A 1JUFB 3QIBC 1WBXB 4P4KD 3GFUA 3CFKB 1JK8B 4PJ5E 1UWGL 2EXYC 2R29L 5IVXA 1T3FA 4P46C 1HHHB 4S1QL 2RGSA 2EIBA 2P1YA 3NACL 1L0YA 2EEDA 4YQXL 4CADB 3EDKA 3U9UB 4X9GA 2VDOL 5DHYB 4YPGB 3O8XD 4JM2C 5I17B 2C3GA 1GHFL 4DCQB 3B9AA 1DQJB 1VACA 2JK5A 3EFFA 1AR1D 2EEAA 4ODTH 4CJ1A 5DRWB 2IAMA 1IRAY 2KUTA 1HXMB 5I71B 2NY6B 2O93L 3KPQA 3CH8A 4UTBL 2XA8L 5DT1H 1RY7B 3MYJB 1BQHA 3MUJA 15C8H 1DP0A 2FLBT 4NN5B 3QPQC 3MR9B 5TDOB 4AH2B 1SJHA 2ZNWA 3KLDA 4QLRA 3MRJB 5EO0B 1P69B 1W72L 4LCCA 4KK8C 3GB7B 3N9GH 3ABZA 3HZVA 3P3YA 3U7YH 2GYSA 4NQED 3DV4B 5C09E 5CHNA 2R4RL 3U0TA 5LGJB 2X1QA 5ICXB 4L8CA 2QQNL 4OGZA 4I5BB 1KBGL 2EE2A 3CGTA 3IFNL 4X6DB 1A14H 1BFOB 1A1NB 1OB1B 2YEZB 5I1KL 5DDHB 5C0AB 4F3FA 4R7DA 3OJMB 5C07D 1NMCB 4C4KT 2XTJC 5FYLL 1ZEAL 3QXAA 2KZ1B 5GRUH 1IAMA 1QEWB 5EBWB 5I8CA 3I2CL 3ARXA 1DL7H 3BN3B 2F53B 5B3NA 1F3JA 4YE4H 3UTZB 1ES0B 1RJCA 3HAEH 2ILLA 4RFOL 4KHXH 3QHTC 2Q86A 3TBTA 1KLFA 2I07A 5E6IB 3WJJA 5E24E 4C83B 2VXTH 2XG5A 3O6KH 2BDNH 4N8PA 3HC3L 3NGBB 2W9EL 4U6TA 4OZFG 4NQXB 5FYLD 5L2KE 4CDGC 5D93B 2W07A 1WTGT 2XICA 1LK3H 3MRCA 3OKKA 3W0WE 4HK0A 4QTIL 2DQCL 2HWZH 4JDZB 4XZUA 4YK4C 5K9KB 2OSLA 1HCFX 3OAUL 2D9CA 5I8OH 4NN6C 1ZT7A 3RUGA 5ENWA 3CDCA 5GGTH 5I30L 3H9SB 1NCCH 3JUYA 4KHTH 1SY6H 4XXDA 1TZGL 2ZCLL 4PREB 3DMMB 1AGBA 4WW1B 1P7KB 4YDJA 4GKZA 3BZEA 1E4KA 5EC2A 1A6TA 1CG9A 5MEOA 3QUMH 5E8PA 1T2XA 3GBNL 3OBAA 4WEMB 3QEQA 3IFPA 3LOWA 5KOVC 3C87A 5IFAH 4OGYL 3JTTB 1V5JA 3R0MA 1IL1A 1QRNE 4JM4L 5T5NG 4EDWL 2R0KL 1IILE 2NY7H 1T1XB 3KAAA 4Z7OF 1GIGH 1MLCA 4PV8B 1YYLL 2FEEI 4JPWL 1EFXD 4KMQA 1U92A 4X7SH 2FH8A 4WHYH 1AJ7L 3RNKA 4YXKL 1X4XA 4PJAB 3WFBL 1P9MA 4QOKE 4BK5A 1OSZB 5I6XC 1K4CA 5DMGC 3S36H 4KMTL 4DWHA 4R4NC 4NQCB 5CAYB 2A38A 2R4SL 4YXLL 1YMME 5FKPA 5AZEL 4MXWH 2R2HB 3VWJA 1Z3GL 4IDJL 4BSVA 1NJ9B 5EZJB 4P23B 2AEPH 1QFWI 4Q9QH 3VXUE 4ZYKA 1T6WA 5CEXB 1FV1A 4KKCD 4U6VH 5MI0C 4JZJB 4TUJB 3O3AB 4QWWC 5CZVL 3T2NL 5EB9A 2EH7H 4QRPE 5DSCB 1HIMH 3VXMD 4R3SA 2APVA 4D9QD 4PGCA 4D94A 2XA3A 1AP2A 1HH9A 4CL7A 3O6ML 4HPOH 3EOBB 1QP1A 1BQUA 3QCTL 1FGNH 1FORL 3GSXB 1EO5A 3ZKMC 4PJ9C 1IGYA 3WO4C 3BYYA 4Y4FA 1AIFB 2VZ1A 1L7TL 2H8PA 3ECBB 3V52L 2F58H 3WFZA 4G6FB 1FZMB 5FDWB 4FP8H 2YPLB 4UIMA 3FO9A 4H88H 4MGXA 3WS3A 5JMRA 3ZO0A 3M07A 2VLJA 2B0SH 1Z5LB 2YS4A 2V5YA 2D7OA 4O58L 2DQHL 3QQ4B 4QHLB 4HBCH 1P4IL 4S2SB 3MREA 4X5WA 3LN5A 3MLRH 3VFUB 2XNAA 3FN3A 2P5WA 1F4XH 1G7MA 4F37K 2EKSB 3KS0J 4JY4A 4X83A 3KVQA 2E7LC 1WCBA 3VWKC 5B3JE 1FAIL 4PJXA 2I27N 2NX5A 2V9TA 3RY6C 1D9KD 1U93B 1MUJA 1IAIM 3MMEB 4HF5L 1FPTL 3MLVH 4CNIB 1B0GB 4FQLH 4FQXC 4FABL 1T04A 3U1SL 1DBJH 1I85A 1OP5K 2FZ3A 3E3QA 2VITA 1G6RA 4XMLH 5ITFA 3SQOL 1OM3H 1ZGLM 4XTRD 2A0LC 4YDVA 2Q6WA 1WISA 1V05A 4NKDB 2F8OA 1R0AH 3HG1A 3QXWA 4MA8H 3ILQD 2UYLB 3WD5H 3ULUF 3JWDC 3S6CA 4L5FH 4L4JA 1KJ3L 5M95B 4ZFFA 1CQYA 1KNOA 2J8HA 3A67L 1N6QH 5GS1A 4U31A 3QEUA 1N8ZB 1GPOL 4M43L 1U3HB 3V4VL 2X89D 3DX8A 1YMHA 3SKMA 3KPSA 3PL6D 4XWOC 4FXKA 1PZUB 4NWTH 4P5TD 4L4VB 4J6RL 1VFUA 4E5XA 2EICA 1FYTB 5E9DB 4DVBA 3EGSA 1Q1JH 4JG0H 2P49B 1ZWIA 3OZ9L 4KY1L 5E4EC 4S0UC 2RAMA 2PNDA 1R5VA 2BVOB 4KRNA 2W0LA 2HRPH 3L5JA 2BVPA 3E8UH 2V2WB 4OUUB 5HHQB 1Q9LB 4GW5A 5DJYB 3B9KB 1T0NB 5TQ2H 4CVXB 2AJUL 32C2A 1MRCL 5LXGL 1U8LA 3HE7B 4LBEB 3W81A 2NY4D 4G5ZH 1FNFA 1PYWB 4GXVL 1FDLH 1DFBL 1ZAGA 4Z7NF 5FA4A 2P24A 3CX5J 4U3XA 1CT8B 1YNTA 1BBDL 3MBXL 4KRPB 4RQQA 4X6DE 5BS0B 4OFDA 3DVNB 1YEDB 2DLHA 4RGMC 3L5WA 5C0GA 1QVOA 6CGTA 5IW1A 4NHCH 5HD8C 4LPUA 3V5HA 3BZ4B 4UQ2A 5LKNA 1NGQH 3QCVL 5E1AA 5ISZB 3DROA 2BRQA 3VJ6B 2XKSA 5I1CH 3WHXB 2RCSL 3QUXB 3K46A 4ZFGH 2FJGB 1NGPH 4YHLH 4KROC 2X4UB 1LO2H 1TETL 3QWRA 5I15L 4L29A 4XCCH 3DO7B 1I9IL 4H5SB 3FB7B 3QNXA 1JHKL 1IGTA 3O9WD 4PY7B 1ZLVK 4GRLB 5KSAC 2DBLL 4F9LC 4NKQB 5HYJB 2FO4B 4BSWB 1GC1C 5KSBE 4B7IA 2Z31D 2WWMC 2IC2A 1Y0LA 2EZ0C 4K3GA 3QT2A 1XT5A 1NSNH 1SM3H 3TPUB 1LDPL 2XZZA 2EC8A 4PRAA 3SDDB 1GGIL 4KGJA 1SYVB 2GK0B 3T3PF 3T0EC 2V17H 5DXWA 1CIUA 3K74B 4G43B 3UO1H 3VRJB 3PP4H 1CVRA 1RVFL 1G6VK 4P3CL 1IC7L 4MDIA 3U46A 1PKOA 2G75B 1Y18A 5IKCA 3LN9A 4TN9A 5ESAA 4PGDA 3PHQB 3T3ME 1WLHA 3I9GL 4P4RA 4JPIB 4W4OC 3VXME 1BF2A 4WWID 1S8DB 2WBJC 3BEWA 4ORGB 3FO0H 4NO3B 4BFIB 3ZE0F 2VZOA 3QQ3A 4TSCH 4P3DA 4PLNC 2EDJA 5J06A 3BPCA 1SBSL 2R69H 4OD2B 2BOCB 4M48H 4HXBH 3HI5H 1KJ2B 4JFHE 4MJ6A 5H94A 2W9DL 2XZQH 3CMGA 4PJAE 4N90D 3QIBB 1LEIA 3R8BB 4LGSB 5I1LA 1OCWL 1S78D 2H45A 1CGYA 1J1PL 4P46B 3OKNB 3JTCA 5MERA 5DO2D 1JFQL 2J88L 5GXBB 4NQCE 3F6LA 4RSVA 2X9WA 2VZ3A 3EYVA 3KXFD 4B53A 5EU5B 4KKNA 2UWEE 4ZODA 5HVWA 4WWKD 1JWMA 3K2MC 1A7QL 2PW1A 1QKZL 1A7PL 4UT9L 3VFRB 4JM2B 4C58B 5ACZA 4G6AD 1F6LL 4JRWA 3TVMC 1OW0A 3C5SA 4JZOA 3RL1A 1KCLA 2YOCA 3MO1A 1S7QB 1QO3B 2AQ1A 4FMFA 5DFVD 4G7VH 5D2LF 3KPPA 3TBWA 4YAQB 3BEVA 2ATPA 1CGVA 5C0CD 1WITA 4RDQF 5HYIA 1U58A 1TZHA 2EYRB 4NHUB 5HYSB 1WAAE 4G9FA 4WI9A 4NGHL 3B6SB 4KUCF 3MUGB 5KOMC 7CGTA 3ZE1E 2NLJA 3BW9B 4WUUB 2KQNA 5K9QG 4JDTH 3S4SB 4U1IB 4OFYD 1U3JA 4Q58C 4N0CD 2ADIB 3SE9L 5DVMA 4OFVA 3RKPA 1CFSB 5K59E 4TNVF 5C08A 5F7MC 2ADGA 2DM2A 4M1GH 1AQKL 1BGXH 3P77B 4WHTA 4PG9A 2NMSA 4KQ3L 1RJYA 5E8OB 2R23A 4BKLA 4M6ML 2Z93A 1CI5A 5CBAB 2YD6A 2XTJB 4YZFE 3P4NA 1C8PA 1PKQB 3NZ8A 3D85A 1DE4B 4JFXB 3EYFB 4I0PC 3OWEA 1JZ4A 4OLXL 2PTVA 1QBMH 4H8WC 3CD4A 2A1WL 1ZS8B 1OAKH 3TYGL 4L4TA 4S1SL 4M1CC 3CFEB 1NAMA 3ZSTA 4R4BA 1G6RH 1UJ3C 2B4CH 3BUYB 3FFCA 1IARB 2ESVD 1HOCA 4YUEL 3TBSA 5CD3B 4QRSB 4XPTL 3PWUA 5IHLB 1Q9KA 3KPNB 4EXPX 3T4AB 1G7PB 1RZJL 2HT3C 1JRHI 5FM4A 1MCCA 3P4MA 3RHWF 5GISH 5KS9B 4YK4B 5DF0A 1GL4B 5L7XL 2PCPB 1MELA 5FO8A 2PYED 1PY4A 3QFDB 1NH6A 3P2TA 4NN6B 5D7JC 3F58H 1A3RL 1G9NL 4Y2DD 3B43A 5DTFA 3UCRA 2PXYD 3MLWH 1XCTB 2FATL 2HAZA 3T77B 2OJEA 3FRPG 4R97C 1AQDA 4G8EA 3ERYA 4OQ1A 1JBJA 4CAGA 4L4VE 3N50A 1PSKL 3SDAD 4PRIA 3TNMB 1FYTE 3BP4A 3L5HA 5E9DE 1OTUC 5FYJH 4W70A 5H37H 4XPHL 1TENA 4Y19A 2Y7QB 3FQWB 2AJVL 3W2DL 3VMNA 4BK4A 5GGUA 2ARJB 4PRPA 1N7ML 5CCKL 3T1FA 4CJ0A 4WV1A 2FJHB 2HKHH 5IGXH 4PBVC 1TVHA 2X42A 4WTZG 2YD1A 1AXSA 1RZGB 5BJTB 1RUML 3X3GH 2Z8WC 2AGJH 1NC4A 5DD3L 5GRVK 4KH2A 3ZYJA 5I6XB 2P8LB 4YHIB 4HUNB 4MHHG 5BS0E 4UTAH 5T5FL 1ZKAA 2QSCH 3E1F1 1RUQH 1YJDH 2R9HD 1AGEB 3AB0C 4HS6A 3X11B 3ULUC 3WFEH 2YSSB 2I24N 3SGDH 1QLFB 3NVQA 5DVOA 1JPSL 4JDVB 5D7LB 3RGVC 5FGBA 4X4ME 3FT3B 5CGTA 5EU6A 2ITCB 5ISZE 1UA6H 3D5OF 1UZ6F 2C4FU 5MI0B 5EG6C 3GIZL 3BSZL 2EDYA 5AD0A 1RZIA 2VN4A 1S5IH 1I1FA 1Q0YL 3STZB 5H2BB 1QR1A 5C0FA 4F80A 3DRQB 3QXVA 4WUKH 3UBXA 5KSUB 2X10A 4JGUA 2V7HB 1DUYB 2MQ3A 3PDOA 4PJ9B 2VQUA 3LH2L 5DI8B 4A2LA 1INQB 3WO4B 4LKXA 5HYJE 3QRGH 3RBSA 3FQNB 3CJJA 4UDTB 4J4PC 1I7RA 2Y07H 3GSRA 1K3IA 5BCAA 1T5XB 5KZCD 2VLKD 2LU7A 1A7RH 4WU5A 4UOW1 4QHNA 2NTFA 3HC0A 4OZGF 1CIDA 4XNMB 4Y0GA 2XKNB 5I0ZA 4JKKA 4JHWH 3KYKL 5FO7A 1P1ZA 2A6DA 4KDWA 1X3DA 3BHBB 1DBBL 3O41B 3B2UC 2ZUUA 1UXSA 1G9MC 3D3VD 1OAUH 3UJJH 1LP9A 1P84J 1JWUB 1MREH 4PB9L 2HLFD 1FGVL 4RGND 3P11H 4F7MB 4HJGB 2ENYA 4KUZL 4I3RH 1XF4A 3VWKB 2HG5B 4XHJD 3DX6A 3PQYD 3QUZD 1AD9B 3GSNB 3BOVA 1Z9LA 1JN6A 3RWDB 5EZIH 3CFCH 5C0CE 4PRNB 1BREA 2AVGA 4NNPH 3JBG7 4FQXB 4XNYH 4PYHA 4Z7WA 1JTPA 3SDXE 4K8RH 2CKBA 2C4FT 5DZLA 1B4JL 5F1NB 2IPKA 3GHEL 1A2YA 3DXAA 3SO5A 3OQ3B 1JYNA 2GSIB 3LEYL 1UZ8A 4OM1L 1R5IA 4PGBB 4P2YA 3L95A 4I0CC 1PLGL 1TIUA 3QJHA 3V5DA 4Y5XC 3HFMH 5DURD 3LV3A 1Y6NR 3M45A 4ZXBD 3HI6H 3ARBA 1D5BB 2YHGA 4V1DB 3QB7C 3ULVL 2CLVB 4LLUB 4GQ9L 4PGEB 1P4LA 3O6LL 3HUJA 4MNGB 4E41B 4J1UA 5GGRA 1KTDA 3KPRD 4FZ8L 4LEOA 5I66B 2B1HL 5F1SA 4LVNC 1JGUL 4LCWB 3C6SB 3BAEH 3MRIA 3KNBA 1J86A 1JGVL 1F00I 1XGQB 1IMHC 5E4EB 1L7IL 2VE6B 5D9SB 4NHUE 3VCLA 3MUZ1 4HCRL 3TEUA 1KB5B 2A6JA 2XZCL 5E2WH 1GZPB 3B83A 5EUOE 3OMZA 1OPGL 3ULVD 5DMJB 3V5KA 1IZJA 4D0CB 2ZSVA 5GZOC 1X6NA 4F2MB 2YWYA 3MRRA 5DZNA 2MOVA 4FRWA 3RI5F 5CUSL 1N6UA 2FWOB 4NWUH 4Z7QF 1X5AA 3QULB 4PJEA 1WBYB 5D1ZD 4DAGL 1BJ8A 1DJSA 1FVEB 2VXSH 3ARGA 4RGMB 5AYUH 2CPCA 1ZT4B 3D0LB 1AKJA 4NO2A 3AMLA 4H26B 3PWJA 4KV5F 4R90L 1GGBH 4RISH 3RUGF 3WV0A 5K9JH 4B5EA 1F90H 3ARDD 1UB6B 2XRAL 4PBWD 4K07A 3REWB 4C56E 5FECA 1X5XA 3DSFL 2EEBA 5C0RL 5C2BH 2JCCA 3QDMD 4ZO9A 4UDUB 1A6WH 1KENL 3TGXA 2ZKHH 2BCKB 1NAMH 2YZ8A 3DTXB 4EBQL 4QRRA 1ED3A 5IROA 5CEZH 4UV7H 4LOUD 1S9XB 2GCYA 3JV4B 4S0TD 3TYFB 2EDBA 3INUL 3H2WA 5AZ2H 5KSAB 3QFJA 4RZCB 5KVGH 1U8PA 1K3ZA 1X44A 4DQOH 2ZWLT 1DDHB 4BH8A 1TNNA 4HKBA 5DJDB 5BO1H 3S98A 3JV6B 4JJ5A 3TZVC 2YA0A 3U36A 1A4JB 2IH1B 2VWEC 3ZDZE 2WLYA 3T0EB 3F5WA 3WKMH 5ETUA 1MJJB 5EOQL 3U7AA 4OZIA 1YEGL 2ZPKL 1DSFH 5FUCE 4Q9RH 1JPFB 4ODWB 1K6QL 4ZPVA 2ZP0T 4XCYB 1ZHBB 2LE9A 1YZZA 4HWBL 2X4NB 3TO4C 4HGWB 4JHAL 4OTXL 1AGDB 5IB3A 1YQVH 4LLAA 6FABL 3CPLB 1RI8A 3W9DA 5DRZA 4NNXA 4XC3H 4ZO7A 3THMH 2O5ZL 1TQBC 5CZXC 2WBJB 3K4ZA 9CGTA 3QAZB 4HIXH 3DV6B 5F1IB 2FECL 3OV6A 7FABH 3BE1L 3CFBA 3VD7A 1U41A 3F6IA 4ODXB 1RFDL 4FQHA 4PV9A 3BMWA 2ID5A 1SVZA 3NCMA 3F7VB 5CBEA 1BQLL 3E6FB 2AXHA 4G8IA 4U1KB 3V6ZA 1XCQA 4LLWB 4LSUL 3SGEH 4LRNL 1OTTD 2W0FA 3PWVB 4ODBD 5HDQL 3BJ91 1B90A 2VLRA 3L3HA 4EI5C 3C60A 4NT6A 3RWJA 2B5IC 2FECI 1FNEB 2X40A 5HPMA 1AY1H 3IKCB 1UB5B 3MRKA 4EDXA 2DQFB 4KK5C 1YC7A 1XR8B 1KIQB 4JVPA 4L3ED 2O5YH 1KLGA 3MV7A 1T4KA 4S1DD 1E4JA 2A74B 2WBWB 3GGWA 2FD6H 4X6EB 5GJSL 1U91B 1OT1A 1RK1B 1U8NA 3BIAX 3JUZA 5SWZD 4XNXL 4BZ1H 3TVMB 5JW4Q 4RGNE 2DQGL 2XXMB 3WXWH 1NGYB 4E42A 4GRWB 1J88A 1YEFH 3PNWB 4TTDC 3UAJC 4HLZG 3QIWD 1S7VA 5DK3A 1UM4L 4HUUA 4ISVB 2JJSA 3RNQA 2ADFH 4PJXF 5EU3B 1A6ZB 4H0GA 2NYYC 3DX7B 4KQ4L 5E08L 3T2PA 2H9GB 1ZANH 1HXYA 2DYPD 1C5DA 2PR4H 5I2IA 1HEZB 4OZ4A 5I76B 2WINB 1TCRB 5K9OB 3O6FC 4FQJH 1K2DB 1J8HA 3V79C 2XT1B 2BSRB 5BQ7A 1JZ8A 4YHKH 5DK2A 4IRJA 4TPRL 4YX2L 3L3JA 4KJWC 1KV3A 5D1XA 5E94A 2FO1A 4KU1A 3DIFB 3FFDA 4GKNA 3SJVD 3V0WL 4I4WA 3IDMA 2BNQA 5DJCB 3CNKA 5D1QC 5DD0L 3UYRL 5F9WC 4R7NA 4U1JA 1AHWA 4OIBA 3RWGB 3HPLB 4I0PB 4BZYA 2E7LE 1Y6MR 3CC5B 2OR9L 3EO1B 4XCEB 4KXZI 5FIEA 3NFNB 5DJ8A 3D18A 4JRXD 4HH9A 5DC9B 3LKOB 2CKBH 4DVRL 1IM3A 4M1DH 1UJ3B 4M6OH 5I1EH 2IFFL 4ZDHB 3WDIA 1OARH 1H8OA 4P9HL 3SCMA 3ULVE 4DKFH 5E70A 5ID0B 4N8VB 3I50H 4IRSD 4OGAC 4CGTA 1QACA 1UADC 5J6HB 4OZFA 1OD7A 3MOAH 2ED7A 3AREC 5T3XH 5I1JH 2F5AL 3WDHA 5GIRB 1E6JH 4M8QB 4OCLC 3X12A 4KVNH 5D7JB 3FTGA 4PRBA 4M6AA 1QR4A 3MRGA 4V1DE 3FQUA 5DR5H 1DEEB 5E99H 3VH8G 5ITBL 3O2VH 4R97B 1MCNA 4D9RE 1RZ8A 1EX0A 3AAZA 5JOEA 1N0XL 4GAYA 1IBGH 4G6KL 5HHNB 2IH3A 4HFUH 4RX4D 5IM7B 1UENA 2NW2B 2NY2D 4LCWE 4JVWA 4JLRB 3UTSA 3VI4F 1G7JB 2Q8BL 1I1AC 4ZFOA 1A3LL 2IAMC 2OL3B 4WGVB 4XT1C 4NO0B 4XH2A 3SE8L 3UDWC 3A0OA 2OQJA 3G08A 4KTYA 2XN9D 2Z0BA 2I9LB 1T21A 4MJ5B 4QHKJ 4ZUTB 2OZ4L 3HMXL 3S88L 1FL5A 5T1MA 1BVLA 1K5NB 3RDTA 4KWUA 5KJRH 3DECA 5F9DC 3T8XB 5EN2A 4HIEA 2OLDA 3ULSB 4ZS6C 3ZT5A 4RMQA 5EU4B 3AB0B 5C7XH 5TE4L 4J2XA 4GBXB 3C2AL 3VXSB 3RGVB 3Q1SL 3BRFA 4KRLB 5EZOH 1C5CL 4OQTA 2P8MA 3GHBH 2EH8H 1R5WA 2H32B 1T83A 3V6OC 5ANMA 4DKEH 1HK6A 2VR9A 2CUMA 5FB8A 5C0BA 1FL6A 4N9GA 5E8DL 4FFYH 3RWEB 3OKYA 5F7LB 2VIRA 1LK2A 3FO1B 3DUUB 1I4FA 1YUHB 2GITB 5FDYA 2ADJB 4L8SC 4OLWH 5ACLA 2RIKA 1E4XL 1HSAB 1X6LA 2HVJA 3BVNA 2ZSWB 3BXNB 4X8XA 1XF2B 2WIIB 3BDBA 1TFHA 5C70A 4GW4B 4TUOB 5KW9L 3UPRB 4Z5RA 4KJYB 2IADB 2NY6D 1RZKL 1NUFA 3T0EE 4Y5YB 5TF0A 1YDPB 3P9MA 4P4KA 1RZFH 1ZGLB 1JPST 1ADQA 5EOTB 2D31B 3CU1A 3MV9A 5B38B 4NUGL 1DANU 1XGUA 4EUPB 4NM4H 2XWJA 3VA2C 4BUHA 1T22B 5BVJA 5SWZE 4JAMB 3W11D 2VXVH 5B39G 4N5ED 3TO2A 4GS7C 4OLYL 1MH5A 4HDIA 4CRPA 5BOPA 2LU3A 3O8XA 1E4KC 3L6FB 2R0LH 3Q0HA 3ALXA 1JTTA 5C0IB 3IU3A 4GJTB 3I6KB 4ELKA 4NO5B 5E8EA 1CGUA 2PTTA 5ELIA 4QHUB 2AJ3A 3GI8L 4HC1L 1B0WA 2P8PB 1G7QB 1MCWW 4WCYH 5LBSL 1W8OA 5C0AD 1CLCA 1GJIA 4G6ML 2ZUVA 5HHXL 2EDXA 5E5MA 2ICWI 3W39A 2AAVA 2WLZA 1IKFH 4TVPE 3GI9L 1EMTH 5HHOE 4KDTA 4K2UH 5GHWL 3SDCC 2F53D 4XXCA 3RU8H 4AY0A 4WJ5A 1JWSB 3QR2A 1CL7I 1MFEL 1P9MC 2FX9H 4D0BA 2HJFB 1P4BH 4YC2C 4WENB 1MRDH 4JFDE 4NN7C 3OKMA 4TNVK 3EYSH 2GTWB 3UX9B 5JW4M 3A6OA 3VWJC 1EVUA 4P2QE 5C07A 4HHAB 4OZHF 4Z8FH 5D6DC 5CEYB 5BOZG 2F9BT 4LVNB 3N1GC 2IPUG 4F7EB 1K8DB 5C3TA 3T0DA 1W72A 3MSPA 1QFUL 4JRXE 1ZA6A 1RK0A 3CDGA 3KYMA 1DANT 2UZYB 4Z7OE 1QG3A 5TF1L 1RZ7L 5FAAA 3H9SD 3NA9H 4OFPA 3AS3A 2XPGA 2NY5C 1HHKB 4PJHA 5BRZD 3IETB 4M4RA 4S0SD 1FN4B 1I7ZA 4PTTA 2ZJSH 5D71L 4MD5B 3TF7A 3CLFH 2NQCA 3F65A 3ARZA 5EOCH 5J1TC 3PG2A 4OF8A 2N1KA 4OLZH 3RHWK 1F02I 3FHQA 3QZWB 1QFPA 1MCOL 4R6UA 5M94B 3CK0L 4M61A 1Q9OB 15C8L 4P2OC 4G8GA 1OAXL 1EXUB 3VRIB 3NIFF 3ZLQC 2CLZA 5FOBB 3WSQH 1BIHA 3RVXD 2KZWA 1YYMH 2DQJH 3MRQB 1JIBA 3C2SA 4LQ1A 3VXQA 1NBYB 4LLYB 3GMMB 3U7YL 2VL5B 3HZMB 4WFED 5DA4A 4UV4L 4PJ8A 2ATKB 4WFFD 2CDFA 3V4UH 4XVTH 1INEL 3VD5A 4N0FB 4JCMA 1T5WB 4U1NA 3HAEB 1DVFC 1IGJB 3C8KA 2ZOLB 4GW1A 3FQTA 4OZFH 3D39D 2VLLA 1RMFH 4HXAL 2VO5A 1U8QA 1U8JB 2B4CC 4ODSL 2J8UB 1EFXA 5GSVB 3TZVB 1AFVH 3MOBH 2CH8A 1I8KA 3U6RA 2R2EB 5IHZB 1MHEB 2DBJA 3RQ3A 4YE4L 4XWGH 3C5JA 4KHXL 5DC4B 1WFOA 3FB5B 2HJLB 5CD5D 2FEDC 2BNRE 4NRXB 3O6KL 4JQIH 4DK6A 2L7JA 4WU7A 3OKOB 2EDHA 3TO4B 5GS1C 2ZUSA 5ID1B 4I9WE 5LGKA 1KTKE 1XMWA 2CRIA 1T2JA 1CDHA 1JPGA 1B6DA 1JF6A 3LKQA 4G6FD 4PLKC 3Q48A 3MNWA 2Y72A 2WWKO 1TQBB 1NFIA 4L9DA 1X5YA 2IANE 3KLAA 4ZNEE 2HWZL 5DD1H 2GI7A 2FGZA 1CTNA 4MNHA 1VSCA 5JW5A 2HTKC 4PJCA 4DOHB 3NCEB 3BKYH 5I8EA 5KBNC 5E8NA 5F89A 3EO0A 1MWAL 4TRPL 4WW2A 1NPUA 3BPLB 5C9KA 4KHTL 1SY6L 1LNUA 2NY3C 1P5VA 3G6AB 2KPNA 1J9CT 3TIDA 3VXTB 3AROA 5F9AC 3QIUC 4AEHL 1V8HA 4Y1AB 4LIQE 4EI5B 1ND0A 2EDQA 3GMPA 1F42A 1UXWB 3ZZ1A 1A6AB 1U8IB 4K7FB 5IFAL 4Y16D 4OQTH 3VFNA 4JR9L 8FABB 5C6WH 1CLZH 3WBDA 4U6XA 4IRZH 2O5XL 1CVSC 2UZIH 2YXMA 3M17B 3RVWD 1LP9F 3ZTJG 1GOGA 1TNMA 4X7SL 1AXTH 3GMNB 2X9XA 4WO4A 1D6VL 2VUYA 4PJIA 1PZ5B 3H9HB 2GUOA 4QXTB 4M93C 2HN7A 5DHVB 2EDOA 1P7QD 4K3EH 4RCAA 5GS0L 4LARL 5F88B 3O2WL 4FNLH 4ETQB 2VQ1B 5KSVB 4OM0H 5LQBH 3O6FB 4DUWA 5IHUL 4Z7NE 3PGCB 5IQ7H 1FZJB 4U6VL 1ADQH 1YEHH 2HVKA 3RKDC 3VGAC 4YHML 5CILL 3RVVD 2X4TB 1HIML 3CLEH 2CJUH 2CMRL 4P5KB 5GS0D 1KGCD 5IIEA 4XPFH 2AXGB 4CMMA 3B9KD 3LIZL 1ZXQA 5D1QB 3B9VA 5JHLL 5DK0A 4NDMB 4MA3A 4HJ0D 5F9WB 1M7DB 1RU9L 2E5EA 3HE7D 5DQDH 3MLYL 4ZFZB 1T1ZA 1MVFA 3VXRE 2X1PA 2F58L 1I1RA 2BHUA 4H1LA 4I2XE 1MCDA 1I1CA 1WICA 4KRPD 1RULL 2F8VA 3OX8A 1CDGA 1XF5B 2R29H 3FONB 5D8JL 3ZT7A 5EIIA 4S1QH 3GIVB 3NOIA 3TN0A 3JSSA 1ORQA 3GRWA 3NACH 4YQXH 2YZ1A 2EO9A 1E6OL 4PJ7A 2VDOH 5EO9B 3T65A 4FQ1H 5BRZE 4JREC 3QUXD 4M00A 1JZ5A 1FNGA 2H3NB 3WIHA 3AREB 3MCKA 4JCLA 3T3PE 1ZVSB 1JGLL 1G1YA 1EZVY 4OZGB 4UTBH 3OXSA 4LNRA 1KCVL 2QADC 2XA8H 5KTEH 3RI5K 1FNHA 3L1OL 1G84A 5I1GL 3MLVL 4GRLD 2PTUA 4RA3A 2MHAA 1KB9K 1CFQA 4ZAKD 5IFHH 1OWWA 1YNKH 3QUYB 1CFTA 4HZLA 5HPOA 1QSFE 1W72H 1FJ1B 2MQCA 1VACB 2JK5B 3EFFB 4KTEL 1OM3L 1I1AB 3QNYB 3S3JA 3SDDD 2IAMB 4X6CE 3ESUF 4X99A 3ZL4L 3V7AE 2E8ZA 4KI5F 3ZE0E 1R0AL 3VFTA 2R4RH 5JUEL 2QQNH 3WD5L 1KBGH 3MODL 4NC1C 3V6BR 5T3ZL 5I1KH 3BQUA 1H3PL 2AK4D 5IB2B 4UBDC 1HSBB 3O9WA 5DS8A 1EJOH 4ZOBA 5J9PA 3MRHB 3I2CH 4MQSB 4MA7L 4NWTL 5ACMA 1ZT1B 3HZVB 3V0VA 1ZTXL 2BVEA 4PP1D 3EDFA 4RFOH 4CN4A 2C7UA 4OZIF 1TMCA 5C0EB 4Z7VB 4XPAH 4XBGB 4OBSA 5C3LD 1NEUA 2DWEA 3E8UL 3VXPA 2W9EH 4GKSA 3FAXA 1DQQB 5C71A 1UWXH 5TQ2L 3WEXA 5HI5C 1KLUB 2ZOKA 1YC8A 1MQ8A 4G5ZL 5I8CB 5D2LE 1IQWH 5C0DA 2EXYD 4U1HA 4EN3C 3N85L 4X4XA 4QTIH 2DQCH 3BGMB 3PWLB 4N0UB 5EBLB 3TCXA 3OAUH 4MB5A 2ZUWA 4L8SB 1K8IA 3EOAA 2NTSP 4YXHL 4HK3J 4NHCL 5I30H 5DRXB 1U0QA 1NDGA 4JFFB 4UI2A 1L4IA 1TZGH 3E2HA 3FO2B 3KHQA 5C9JA 1GOFA 3MRCB 3GBNH 2F19L 2NR6C 4YHLL 3BD4A 1X7QB 3WNKA 3HI1A 3OB8A 1NANH 4XZUB 4JN1L 3FQRA 4EQ3A 2I60L 1YN6A 5DVKA 3L7EB 1WFNA 4ZQKB 3QPQD 2EC9U 1MI5A 1CCZA 2YN3A 1DQDL 1NLDH 1QNZL 2R0KH 3MV8D 3RUGB 3MBEC 4O00A 1NMAH 2X4QA 3KXFA 1CD1B 5FGCB 2VKWA 4LSQL 4WWKA 4XXDB 4JPWH 4KK8D 2H6PB 2BNUA 4GS7B 1JJUA 1S5HB 1AJ7H 5DEGA 4YXKH 1BWWA 1T0MB 3VXNB 3BZEB 3GK8L 1U2CA 3BRDA 5MEOB 3KDMB 5BZDB 4XCNA 2WSKA 3WFBH 4J8RA 3GMLB 3CVHB 3GJFA 3D2UB 3IDIA 3Q3GB 3EOYG 3KYOB 4KMTH 2R1WA 2V17L 2R4SH 4YXLH 2XTJD 3PP4L 5BXFB 3V7MA 4Z0BL 1Z3GH 4FQPA 1UCBL 1N59A 4IDJH 1EUTA 4X4YA 3SE3C 5MENE 1U8KB 1IEBA 4Z95H 4MQ7B 3SDCB 5KVFL 3RNKB 3S5LG 3QQ9D 4XMKL 3TBVB 4Y1AE 3KPLA 4KJPC 5CZVH 4M7JL 3T2NH 3TJEL 2ARWA 4DGYL 5JPNA 2K7PA 4OFYA 1I8IA 3FJTA 5E95B 1EBAA 4YC2B 3O6MH 4YHZH 5IB4B 3U4AA 2HJKB 1JTOA 1OQOA 4NN7B 4RNRB 5EUKA 1QFOA 1KGCE 3QCTH 1FORH 1R3JA 1JZ2A 2OM5A 1YEEL 5CGYD 3L3OA 4HXBL 3BZFA 4XPGL 5FGSA 5FGBC 1QLRA 1L7TH 4OAWB 4POYA 1C1EH 3IDGA 5JR1H 1IM9D 2EC9T 2NCMA 2VNCA 3AS1A 4LHJB 4WGWB 1BMGA 4FFZL 4QYOA 3PP3H 1JYWA 3SQBA 5JLZA 5C86A 2DQHH 3MROA 1EHLH 4PJDA 4FFVD 2A73B 1P4IH 2ESVA 2YRPA 2PETA 2H8PB 1KPUB 1FHGA 4JN2B 1NDMA 2DQEL 3OGCA 5L2JB 3MZGB 1FAIH 4DKDC 4LSVH 3G5XA 3RWHA 3WS3B 4U3HA 4PG2A 4HF5H 4P2OB 1FPTH 1DUZA 1P53A 2NNAA 5IK3B 4Y2DA 3U1SH 3ZKNC 2H41A 1HHJA 2FHFA 4WFGE 2PXYA 1LD9B 4H1LH 4HT1L 3LN5B 4JB9H 1ONQB 3S3PA 2XNAB 3SQOH 4JDTL 1VPOL 1IQDA 2Z92B 5DMGD 1PEZA 5FUZL 1WCBB 3GRWH 1N5YL 4O2CB 3BJLA 4FXGA 3RWFA 4RBPH 1MUJB 1DVFB 1HNFA 2AXFB 1U9KA 4GLRH 1DR9A 2PO6C 1KJ3H 3A67H 1VESA 5EC1A 1KT2A 4WNQB 4PP2A 3HHRB 1RUAH 3WIHH 1GPOH 3A6BL 4M43H 5T1KD 3V4VH 4MJ4A 2VDML 3LN4B 2XWBB 4DUXA 1YPZA 3N06B 5IVXE 1W0VB 2YMXL 1HWHB 1QBML 1UH4A 3HG1B 1HDMA 3HTLX 3OZ9H 3O3EA 4PJ9D 1NKOA 2CGRH 1VEMA 1C12A 3CAFA 1KNOB 1LHZA 5FV2A 5GS1B 1UH2A 3P0VH 2X41A 2AJUH 2P5WD 4NM8L 5LXGH 3WN5B 1LO4L 2JIXB 2G5BB 1M7IB 4GXVH 5CGMA 3GSNL 2GJ6B 1R3LA 3F12B 2WW8A 2PN5A 3UTTB 2IALA 4NZDA 5DC0A 1BBDH 4OI8A 3EGSB 3MBXH 5SWSB 4QKXB 1NFKA 5IBLC 4M3JA 4JKWA 1VFAA 3O4OB 2BVPB 4HBQA 1MQKL 3MLWL 4KK9C 4G59A 4BH7A 1V7NL 2NY3B 3F7QA 2ZG1A 1QZ1A 3QO1A 1F58L 1N3NB 1OGAB 1RV6X 1LO5B 1T80A 1B2WL 5F1KC 3VD9A 5TJWK 3QIUB 2RCSH 1XEDA 2G2RA 1WTLA 3ZKQD 2GW5A 3O3BA 1SEBA 1YNTB 5FYJL 2VLKA 2VDKL 3G04B 3TCLA 4ONHB 3S34L 3OGOE 5IMKA 5HYSG 4OCRL 1I9IH 5SWQB 3L5WB 2WY3A 3WFHA 2DL2A 5IMOA 1UQSB 2P42B 3MUY1 2CIIB 4EKXA 2DBLH 1AD0B 4MLSA 3CSYA 4U6HB 1IVLA 3S4SG 3QDGD 4LDOB 1G0YR 3BUTA 1BZ7B 1MAJA 1WFTA 3D3VA 1MEXL 3F7YB 2Y5TB 1U6AL 3S35X 3U4EB 4M93B 1LDPH 4JRYA 1QSEA 1U8HA 1GGIH 4KI5C 5FYJD 5TFSH 3PQYA 2KBGA 3QUZA 5CLWA 1RUQL 1RUPH 1YJDL 4QRQA 4R8WL 4MXQA 2X5PA 1RVFH 1S9YB 4JFFE 3FOMB 3LB6D 1IC7H 4IMKC 4XNUL 5HHMB 5DJ0A 4Y7MA 1VDGA 3DUSA 1Y0LB 3VGAB 5H35B 4Z7QE 1AO7B 3I9GH 3PWPA 4OCSL 4F7CA 3D69B 1MIMH 5GS3A 3RGHA 3Q2CA 1F4YL 3O4LB 2AKRB 1RJZA 1JP5A 3IJHB 3RUGE 3SGDI 3UZEA 2OP4L 4TULL 2X7LA 4YHNB 1CU4L 2EXWD 1SBSH 5IEHB 3BP5B 1QSVA 1ORSA 4UNUA 3DGGB 2W9DH 1BLNA 4X98A 3GJFH 1KG0B 1X9QA 3IFOA 5F7WC 4JFEB 5T33L 4MQTB 4XI5C 4LAQL 5ESAB 1HQRB 1OCWH 3QEQE 1J1PH 2V2TB 1QBLL 4I1NB 1JFQH 2J88H 4Q0XL 5A2JH 4LLQB 5IB1A 3S35L 3IJSB 4LLVB 1QUNA 5J6GA 1F8TL 1A7QH 4JQXA 1QKZH 1GC1L 5T1DL 1A7PH 1FG2A 4UT9H 3OHXA 5J12C 1F3DH 1I7TB 4LSTL 4JREB 4PJHF 5DD6B 4ZUUA 5IOPB 4ORZC 3RPKA 4LLMB 5I1LB 1T0PB 3EO9L 4ZSOA 5JNYA 3OXRB 2QADB 1F6AA 1C16A 3HB3C 1Y6KR 2FIKB 5EZIL 3C60C 2EECA 4O5LL 5D1ZA 3PHOB 2UY7A 1S7XB 3MRDA 3HCVA 5KSAD 4PRDB 4KKLD 1JWMB 2CDEA 4XNYL 1S7SA 3R4DA 4IJ3C 4NGHH 3LPFA 1B0RB 1V3LA 4P2CG 3VH8A 4HCRA 1F11A 1BIIB 2P5ED 3FQXB 1HH6A 5TDNB 1QFWM 2VDQL 4HIHA 3RL1B 4JZOB 4KK6C 4NJAL 3MJ7A 1KN2L 1PG7X 3QDMA 4GSDL 4OV6F 1SEQL 4UOJA 3SE9H 1KJVA 2WNGA 2RB8A 2JJSC 4K71C 5JW4N 1JNHB 3HI6L 3OR6A 4M6MH 4Q2ZB 1XIWC 4MDJA 4HV8A 3GUTA 5JZ7D 3BDYL 2C1PA 4MQXD 1D5XB 4QXWA 4AEFA 3QWOB 4AJ0A 5I19L 2CO7B 2VISA 2A1WH 2VLJE 1INDH 4KJQC 5IT2H 3TYGH 3VFWB 4AENA 5IHBA 1JNJA 4I3GA 5CP7B 4S1SH 3L7FA 1NGWA 4K7PX 1EIBA 4WHTB 2D7PA 5D1XC 4PG9B 3SHSA 2R23B 4YUEH 2BC4A 2GTZA 1YY8B 1MJ8L 1QPXA 4BZ2H 2P5WE 3QH3B 3B8SA 4OZHB 1I9RL 1J05A 1YA5A 5HGBB 1RZJH 4EN3B 4LPVA 2FJFA 4BQ8A 4PJXE 3P9LB 2NX5E 5L7XH 1H15B 4WFHE 5EPMA 4OCWH 4P2RA 5C09A 2DKUA 3HC4L 4G9FD 1A3RH 1PG7L 5DUPH 3O3DA 3FFCB 1GGBL 2FATH 3E3QE 3PWUB 1WZLA 4NKIL 3M1BA 3FB8A 1IKNC 2B20A 5GGRY 3LKNB 4HWBA 1F13A 4HUKB 3FT4B 5JDSB 5E7BA 5DEFB 2P7TA 4YBQC 3HG1E 1BX2A 3UROR 3TJHD 4Q74A 2AJVH 4K9EC 3EJYD 4OCNC 5HHPB 1PQZA 1A5FL 3CUPB 3EFDL 4QCIA 3MBEB 1WZ1L 5DTFB 4BQCA 3O11A 5AZ2L 4NBZB 1DLHA 1MHCB 1N7MH 5CCKH 5KVGL 5CP3A 4L3EA 3KPSE 4G8EB 4K7PL 2RQ8A 12E8L 4H8WL 3RZCB 1RUMH 3EYQC 4CVUA 5SV3A 3WLBA 5BO1L 5B39A 5DD3H 4MD0A 4PJIF 2P45B 5SWSE 5CIPB 3B8YA 4Y19B 3QIWA 4XBPA 5FYJE 5T5FH 4S1RH 2KL6A 3QO0A 5IBUB 5JIKA 2R1XB 5D2NA 5ICYB 1JPSH 3JWOH 2DWDA 4MMXC 5DYOB 5MEPB 5ADPH 1OGAE 3T1FB 1BECA 4I0PD 5F7DB 2DYPA 1RIVL 5LAXA 1YQVL 1ZHKB 4LCIL 3GIZH 4XC1H 3BSZH 1FP5A 3ZE1F 4PJGA 5HGDA 1Q0YH 4XC3L 1MCPH 3VGGA 5DJ2B 3U0WH 3BH8B 3EJZC 3EYOA 3ES6B 1QYGL 4M1CD 5GJTL 4UILL 1M05B 3WIIL 4MA1C 4HIXL 4LASH 1CGTA 2B8OT 4ZOCA 4MNQB 3MRFA 4ELMA 3LS4L 3ROOA 5GZNC 1N2RB 4Q6IC 2DM4A 3SJVA 1T83C 4PRID 4YZFF 1JV5B 2R8SL 3C6LD 5AD0B 3HR5A 2W0KA 5DRNB 2OL3L 1I1FB 2CK0H 2D3VA 1XF3B 1L6XA 5C0FB 2LVEA 3RBGA 1HINH 5EWIL 3CZFA 3QYCA 4NCC2 1AY1L 4NRYA 2VLME 4NRZA 3FZUC 3KYKH 4PRPD 3PDOB 1FFNA 5IFJA 2O5YL 1DBBH 2AEQL 5CJBA 1FL3A 3T2OA 2FD6L 4ONFL 5CMAA 4BZ1L 1MAKA 5HGAA 2CLRB 4PB9H 2BSTB 3T4YA 1FGVH 3SGEI 4IRSA 3ARYA 3WXWL 1F97A 4KUZH 1MVUA 1YEFL 4WI7A 3MGTB 1N4XL 5T1LB 3UZQA 2DS4A 1XR9A 5HGHB 1MF2H 2AI0L 3OAZH 4JANB 5EORL 2BY3A 1P1ZB 5EU6D 1ZANL 3KWWB 2IMNA 2VABA 1B4JH 2PR4L 3GHEH 5DLML 1UXSB 4DJMA 1DBAH 1BAFH 1Q72L 4JFEE 5I73C 3LEYH 1BM3L 2AK1H 3IF1A 4WDIB 4O02L 4DUVA 4OM1H 3ZDXF 2AJSL 3O8XC 2HA1A 4RX4A 2GJZA 4P5MB 4G8FA 1A21A 4YHKL 1PLGH 3CFDB 2Q7NA 4GBXD 1S9WB 2VUOA 1AR1C 3X17A