2ESVA

Structure of the hla-e-vmaprtlil/kk50.4 tcr complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
275
structure length
268
Chain Sequence
SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, alpha chain E
publication title Structural basis for a major histocompatibility complex class Ib-restricted T cell response
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 67
structure length 268
sequence length 275
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2esvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2esvA01
4K94L 5INCB 3CFDB 2C3HA 4A2LA 4LSUL 3G6JB 1FSKB 1KTDA 3DLQR 5KSAA 1UWXH 3QUZD 1KYOK 2F5AL 4LASH 4P46C 3FN0L 1C5CH 3SDAA 5DHYA 1NANH 1G1CA 5C71A 4YZFE 5DQDL 1ZEAL 2YC1A 4YDVB 1HZHL 1KJMA 5JHLH 5T33L 1A6UH 4HZLA 4H1LH 5BO1L 3RI5F 1GGIL 3NA9H 3QO1B 4R96B 1AO7B 3VWKD 5J12C 1JHLH 1G7HB 1IGJA 3O6LH 4I5BB 3RTQB 5J13B 1I3RB 2Y36L 1SEBA 3D39D 3QXDA 1XF5B 5ABDE 5I1HH 2ZOKA 2M2DA 4DOHB 3LV3A 3MUGA 3IJYA 3LQAC 4X6CA 4LAQL 4JLRB 3GMNB 4P49A 4HIIA 4X9IA 4ODVH 1VFAB 3R1GH 1M05A 4N90D 2LAAA 3ZKMD 4NQDD 4YXKH 1ZSDB 1NDGA 3OQ3B 3VD7A 2PTVA 2X5PA 2GAZA 4ONFL 3FQRB 1G6RB 4NO5A 3IKKA 4MXVE 5JO5A 3LD8B 4NQUA 4UV4L 2EDFA 3RVTC 4LEXL 5BS0A 4ZS7H 3DVIA 3LCYA 3C6LA 3FAWA 4Y4FB 3LEXA 3RL2B 4AEIL 4FQXD 1KTKE 4AJ0A 3QUKB 4FQCL 4ACPA 5C1MB 1YEGL 3FO1B 2HG5A 3QCTL 3HB3D 3TA3D 3UTZB 3QFJB 3I2CH 5DO2D 4GG6A 3TBSB 4AT6A 3QULB 3TN0B 4ZMAT 5JR1L 3GIZL 4MAYB 4TRPL 1HQRA 3FMGH 3V5HB 1KCLA 5JOFB 1S9VB 2XA8H 2PO6A 4IDLA 4JHZA 4CAGA 5HVGB 3DV4A 2PKDA 2VLKE 4PRNB 3HFML 1IC7L 3DUUA 2ARJB 1QSFA 1CGXA 1OTUC 2YPKA 4MJ5B 1J0HA 4H25A 1MWAH 1CXIA 1KEGL 1ZHLB 3UTSA 3NFPB 3WLBA 4PY7A 5EUOB 1K8DA 5EO0B 4PJCE 1P7HL 4LARH 1R5VB 4HHAA 3BEWA 5CJXA 3IGAA 1XIWD 4UNVA 4LASL 4YHMH 5DEZA 3F7YA 5T1KB 3MV7B 1C5CL 3WFBH 5GJTH 3DETC 1W0WB 4WFGD 4ETQA 3GMPB 1G6RH 1A6UL 1RD6A 4MXQA 1DUZB 3ESUF 1JHTA 3Q3GB 2YA2A 4HKZA 5FV1L 1W2KT 3MLSH 4KHTH 3DXAB 1FYTE 2DIJA 1DBAL 1JHLL 1GH7A 5DZLA 1ADQH 3WFCH 1VKXB 3CX2A 2Z35A 1BVKA 1RPQA 2FDBP 3V95A 2W9DL 2CPCA 3UDWC 3QEHA 5I1HL 4P46B 5K33A 3GBLA 1PKQA 2OP4L 3GB7A 5GGQH 4WJ5A 4M8QA 1IC4H 3VCLA 4U1SA 1D3CA 1HHJB 4Y2DC 4U0RC 4KZEL 1KT2B 4HC1A 2JIXA 2V5MA 4ODVL 5H94A 1A3RH 1TVDA 4GOSA 4CW1B 3PNWA 4Z77A 5J12B 2NW3B 3QDJA 1TVHB 1AGFA 4XNZC 1JZ4A 3DYPA 1M4KA 3RBSA 4EUPB 4WHCA 1QQDA 2NNAA 1CD9B 5C0ND 3H9SA 1FL6B 5DC9B 1RK1A 3H7BB 5D1XD 4ORGA 1MCRA 3WL9B 4D0BB 2EDHA 4NO2B 3DIFA 5EZOL 1S7RB 4D9QD 3OJDA 1T1WB 1GAFH 3MOBH 3QEQB 3PWVB 4KMQA 5EU6B 3EYFB 2XN9E 4N0CC 3P73A 4PG9B 3SDXF 1RZJH 2A9NH 3E8UH 5IMOB 2IADB 2XWBA 3O9WC 5HGBB 1ZA6A 3RWDA 4H26B 3KPLB 3ES6B 2O5YL 3I2CL 4M43H 1OGAA 2R15A 4RGNE 1HHGA 4L8BA 2DYPB 4PYGA 2X1QA 4JFED 4X4YB 2PETA 4AENB 4LP5A 1HXMA 3FMGL 4J4PD 2XA8L 2XZAL 5T1MA 4U1HB 4UIMB 1C7SA 2F54D 1U8LA 4OV5B 4QRSB 1MHHB 3RFZC 1HILB 4K23H 2R2HA 4HPOH 4JQVC 2MJWA 1JGUL 1MREL 4M61B 3RPIB 2MHAB 2FZ3B 1IAIM 2O61A 5TH2A 4G6JL 4PUBH 3B8YA 3EO1B 3Q6FB 2JLLA 4NNYA 1U3JA 4QOKE 4Q0XH 4AQ1B 2NXZC 4LARL 3PWUB 1PDKA 4QRUA 1TPXC 4QRQA 5DA4A 2AW2A 4OCYL 4QRRA 3HUJB 2VYRE 1AXSA 3MGTB 3RJQB 5I9QC 3WFBL 2EO1A 5GJTL 4F37K 2ZUVA 3WS6C 3WSQH 5MERB 1WAAE 4PJAF 1G6RL 1MIML 1VGEH 2E5EA 5C0IB 3V5KA 1UXSB 4WO4D 3QIUA 2VAJA 1X7QB 4E41E 4MJ6A 5FHAH 1FBIH 2FB4L 5ACZB 4GQ9H 3WFHB 1P53A 4F9LA 1B2WH 3FO2A 3LKOA 4OGYH 1UACH 4WFFE 5D7JA 3STLB 3T8XB 3QH3B 3P3YA 2BNQE 1IC4L 4RBPK 2HKFH 3SGDI 3U7YL 1T20B 4X98B 3MRCB 4NKOA 4N0FA 3PHOA 4BH7A 1KB9K 3LOWA 2VWEC 4CVZA 1OQOA 2Q86A 2MQCA 2YD8A 2HFEA 4LSDA 2XQBH 4JHWH 3MLYH 1ZLWH 4N8CH 1SY6A 4ZFOB 3CXHK 1JVKA 2BP3A 3MV9A 1IRAY 5HGHA 3DX9B 1YQVL 2FLRT 4KMTH 4ZUTB 4Y2DB 1XR8B 5DHVH 4U0RB 3C9NA 5SWSB 5HYJA 2HLAA 3DVNB 3EOBA 3N50A 2E9IA 3DURB 1OCWH 5D7SL 4HS8L 3MV8B 3TBWA 4LHUB 5EOCH 1X5IA 2GY5A 5E7FA 1MVUA 4NQSA 5EOCJ 4XNZB 1G9EA 3REVA 4QHMB 1RZJL 2A9NL 2D31B 2CR6A 2GJ6B 1KC5H 5IVXF 5EZLA 5HYSG 1M7IA 5HHMB 4OFYD 5LVEA 4G9FD 3HZVA 1ZLUH 4Z76B 2YPLA 1EZVY 2FEEL 4JO2H 4M43L 1U58B 1BWMA 4BUGA 4OZHA 1EBPA 3CLEH 1OD7A 1NBZA 1HCFX 4XP1L 1BMGA 1MY7A 5EFIB 2X10A 3T1FA 3KNBB 3IXTB 5DRWB 3M8OH 3L6FA 4CMMB 4WEBL 3P30H 4HFUH 1YNLH 1AD9A 2LV4A 3CFBB 5EORH 4GUPA 1JGEA 1LO5B 1XF3A 1QO3B 3C5JA 2NX5E 1ED3A 1HYSD 2VERN 5IW6A 2Y5EA 4Y1AD 1AI1L 2V9QA 4YXLH 3BP7B 4ZPTA 4K55A 5JQ6H 3BPCB 4LSQH 1RUPH 2HN7B 3MFFA 2BY1A 3TBTB 3UPCA 3N0PB 2E6JA 3O2DA 1AGCB 4XC1H 2X42A 5DD5H 3N9GH 5IBLC 5F7UA 3WSQL 4ELMA 1LP9F 1VGEL 3LQAL 2P5EE 2PNDA 3AROA 3RNQA 2R29L 2I9TA 4FFEX 4R6UA 2JCCF 2NXZB 4QHKI 3CGTA 2CH8A 1EEYA 2ESVB 4PJ5E 3OKKA 4XMLL 1TPXB 5DSCA 4ZPVA 5FDYA 3ZYZA 3BDXA 2EIEA 5I9QB 3RWFB 4R7DB 4PRIB 5J4MA 5F6HI 2R0KH 4TUOB 5C09D 4KKAC 1CLZL 5EU5A 4Z78B 1FL3B 1KEML 3LKNA 3VU2A 1WZKA 4RFNC 5KBNC 3MSPA 3HMXH 1ZA3B 4JHWL 4OZGA 4GO6B 4ZSOE 2IH3A 2VISA 3UTTE 3WHE1 5JNYB 4QCIB 3CJJA 2VDOH 2ED7A 2A0LC 2BJMH 5L9DH 2QHLA 4GXUN 4QY8B 3U9UA 4HFWB 3I3EA 2WSKA 5GIRA 4UOW0 2YUXA 1OCWL 4K3EH 1PD6A 4PJ7F 3K8KA 3JBG7 2W0PA 5CKAA 1AGBB 1GJIA 1WK0A 4MMZC 4OFPA 2QADC 1OARH 2ZNWA 1YMHB 2WQ8A 3JTTA 5KG9A 5A2KH 1Q72H 3HLAB 2IQAB 2VDPL 1D6EB 4JFFE 4L5FH 4L29B 4LMQE 4PJCB 3VGAC 1UWEL 5TF0A 3VFRA 1FFNA 2AXFB 1QSEE 4NFDA 2F8XC 4PRHA 3D85B 2OJEA 4MD0A 3CLEL 4NO3B 5C08B 1FNEB 1T03L 3QDGA 3GJEA 1AP2B 4QHNA 3JTSB 5EB9A 3ILPA 2XFXB 5C0GA 3SJVD 3M8OL 5E6IC 1LK2B 4L8CB 4NYLB 5EORL 3L3DA 1NLDL 3VRJB 1PSKL 5FECA 1CI5A 3HE6D 3I75A 1WTGT 1MH5A 4G80B 2A6KB 3ILQC 4NN6C 1JK8A 3BW9B 4NUGL 1R5IA 1V05A 1T21B 1G0XA 2XWJA 3QSKB 4YXLL 3QWOA 4M1CD 3OKOB 2BNRD 2DJ4A 4LSQL 1RUPL 3VFMA 3KLDA 1U3ZA 2J12B 4ZFOL 4GAJH 2ZSWA 3OAYH 3GMOB 1FNSL 2WUCH 4Z7UF 1RJYA 5ALBH 5AG9A 4M1GL 1IGCL 4XC1L 3QAZC 2EYSB 3N9GL 5CIPB 3GSVA 3WIHH 4ZUSB 4RAUB 1I1AD 2A74B 3QDHA 3L3IA 2I26N 5HPMA 3AM8C 1JP5A 1BVZA 1PZUB 5D5MB 3CSYA 3RQ3A 3KLAB 3L5XH 4PTUB 5BV7H 3BEVA 2XN9B 2DLHA 2W0FA 5GGRB 4M03A 1BD2A 2XXMB 3DVGB 5I1GH 3WIFB 5ICXB 5KVEH 5F93C 5ISZA 3WIIH 4MJID 3HPLB 4X9HA 1T2QL 1U8KA 4NSKB 2VSCA 4LKCB 2FR4B 3CNKA 4YQXH 25C8L 1R3IH 5BZDB 4KJPC 4KROD 3PQYB 3TJHA 2H9GA 1IJ9A 1I7UA 5BS0E 1BPVA 2BJML 5L9DL 3WHXA 3C8KA 2WQRA 1KLUA 5IFJA 1YEKH 4JO1H 4K3EL 1UM4H 2AEQH 4P5TC 2NY4C 5CS7A 4RFNB 4YK4C 3ARGC 2VIRB 1FNFA 4EDXB 2GITA 1DN2A 1MJUH 1OARL 3SDDC 2VXTH 4GG6E 4F80A 1CFNA 3VGEA 4CU8A 1YY8B 4YHOL 3CK0H 3STZB 1EPFA 1NAMB 1RZ7H 4NQCA 4N5EA 4L5FL 4WHYH 4LDEB 2E7LA 4HGWB 1EA9C 3SY0A 1U2HA 4BYHA 2J8UF 2A77L 2VH5L 1I8LA 4Z7OE 3B83A 3SE4A 1XAUA 4TYUA 1X6NA 3U9PL 1QSFE 2GSGB 4GBXC 1LEIA 2QADB 1JPGA 4I13B 3UTSE 2CXKA 3WUWG 1N6QL 4LLAA 1UZ6E 3QRFM 3BMVA 3KPNB 4B7IA 4E41B 3HR6A 3VGAB 3AREC 5C7XL 4FQQA 3C5ZA 4X7TA 5D7LA 3MRIA 3SKNA 2IBBA 3DBXB 4XCYB 1UKQA 1R3LA 2BNQB 2IPUG 2EIBA 5JDJA 1MHPH 4TVSa 1NJ9B 5E6IB 2VKWA 2EH8H 5BW7A 3L5JA 3LKPB 1YN6B 2DWEB 5F7HA 2MCPH 4NC1E 4OZIB 3F7VA 1RZ8B 3QG7L 4NN6B 3WIHL 1FZMA 3VA2C 1K6QH 2OK0H 2HJKA 5IF0A 1PKQE 5FCUH 4NM4H 1DUYA 4Y2OA 4S0SD 2C4FU 4XHJC 2ZG3A 1JZ8A 1SJHA 1S9YB 1TQCC 5L7XH 4DKEH 2VLLA 3L5XL 5BV7L 4YPGB 4Y4KC 3O3BA 3GGWA 3QAZB 1ZK9A 4KK5C 5FGBA 2BRRH 4NKIH 5I1GL 4XCEA 5HI5D 4G7VH 4TNVK 3HAEA 3WIIL 3H9SE 2A38A 3RTQD 5FK9B 3VD4A 2PW2B 4JFYA 1U93B 4H0GA 4Z7VA 3TNNA 2Z93B 3IU3B 4YQXL 5KSAC 3NCYS 1R3IL 3X13A 2DQUL 4NDMB 2P8PB 2WZPD 2H32B 4NQXA 4R8WL 4NN5C 4LVHC 4L1DA 3FOLB 1CLCA 4LSRH 5E2TL 1JUFA 1ZWIB 4MSWA 5EIQA 3E6HA 2ZG2A 4LLVA 5GZOD 3ALPA 4JO1L 5A43C 2IEPA 1UM4L 2AEQL 1RMFH 3PWJB 4NZTH 5IOPA 2NX5B 1OGAE 3EHBC 3PP4H 4J8RB 2VXTL 3H3BC 2RAMA 3MROA 1U91A 2UUDH 3CK0L 5JDSB 4FQ2H 3U46B 4HIHB 4OD3H 3TO4C 1HWGB 2E7CA 4X0KA 4KKCC 4WY7H 3CMOL 2X4QA 3O41B 3SGJA 1QHOA 3B3IB 4PLOB 3MRJA 3ZHDA 2BK8A 1A7NH 5KSUA 4ALAH 4ZOAA 3L3JA 2X9WA 3QO0A 4P5TB 2AV1B 1OHQA 5CJ5A 5CP7B 2NY4B 3EAKA 1H5BA 4JCLA 4YK4B 2ADFH 2DLEA 3K1DA 3ARGB 4Y4FD 2BDNH 3FO0H 3SDDB 3SQBA 4JPKL 2P5EB 2YD1A 1DLFL 2B1HH 3RWGB 2X4PA 1GIGL 4JFPB 1KUMA 3VMPA 3ETBF 3RL1A 2EZ0C 3QFJD 4IMLB 5I8OL 2OSLA 3OX8A 1NGPH 2DQHH 4QRRE 4MAYD 1SYSA 1J0ZA 4OF3A 3BWAB 2FBJL 5EOQH 2AQ3A 3T0XA 5HDBE 1HI6B 4FMKA 4GBXB 1KENH 3HZMB 3V6OA 5EBMB 1MHPL 4C83A 5AAMA 5TF1L 1MFEH 2APTA 4GKOA 4E5XB 1DEDA 1MCFA 5BOZG 3LAFA 3AREB 2MCPL 2JE8A 4LMQI 4ZSOB 3ORJA 3WE6A 1MLCA 3TWCH 5ITFA 4J3UA 4TSCH 1IGMH 2J6EA 4I4WA 5FCUL 4XZUA 1NCBL 4NM4L 5J3HD 2ED9A 1NCDH 1T3FB 1WJ3A 4DAGH 2PO6C 1FZOB 3MTRA 1A6TA 4PGEA 1IL1B 1ITBB 3VXRA 5T1KD 4Q9RH 4N9GA 3MV7D 4O51A 2Y1VA 3K8MA 4QRPA 1C12A 3ARXA 1L0XA 3CD4A 4CNIB 2HKHH 4I18A 2XQYK 4XX1E 1A6AB 3MV9E 3DXAD 5DVOA 3T65B 2JJWA 4G7VL 4JFFB 3IVKB 3U4EB 3EDFA 1TVBB 4G5ZL 1XH3B 2ITCA 3UJJH 4PP1C 1TQCB 1QSEB 4P46D 5I8KL 2R1WA 2P42B 2QBWA 2XYCA 3LSOA 4HJ0C 3U82B 1Q0YH 4Y4KB 5FA4B 4LSRL 2B5IC 4XNQB 1I1FB 4QRTB 1N0LA 3T4YA 4KRPC 1JJUA 1ZLVH 4MXQC 5C6PB 1IZKA 1F6FB 3BT2H 2VNCA 1HN1A 1RMFL 4NZTL 4KZDL 3TFKA 3NFNB 3CDFA 2A6IA 1U8PA 5GJSH 1KTDB 2YPLE 5KSAB 2APVA 3ZMRA 3EDEA 5E9DA 4R26H 1GRWA 2Q1EA 4OZHE 2D3VA 4NN5B 4FQ2L 4LVHB 2CD0A 4OD3L 4UB0L 4YIQB 1KACB 5GRJL 3MUJA 1FNAA 3QEQD 1A7NL 3R8QA 1TFHA 5EU6D 4BM7A 2Q20A 5C86A 3H0TA 2BNUA 4FQIH 3OMZA 1B3JA 5GS0H 4MA7L 2BDNL 3FO0L 2A9ML 4HEME 1Z9OA 3RWHA 4BH8A 2B1HL 1OTTC 4WU7B 3TPKA 2ZOKB 3TO4B 3HNVH 4LRIA 3LV3B 3MUGB 4WUUE 4X6CB 1M7DA 2DYPD 1T83C 3RVTD 4EZMA 1NGPL 4L4TD 2F74B 1IAOB 2UZYB 4CVUA 3CC5A 1CLYH 2C4XA 1ETZA 5KVFH 5TQ0H 1MFAH 1KENL 3KPRA 3KYOA 4ELME 1MFEL 2E3VA 4X4ZA 1C5DB 4M7JH 2GAZB 3B6SA 3FRPA 4JO4H 4N0UA 3SPVA 3B2VH 3BISA 2WINA 4TSCL 2NY0C 3A6BH 4LPCA 1IGML 4C4KO 5DTFB 3HI5L 4WNQA 3LEXB 1NCDL 4DAGL 4BA8A 1RHHA 1FCCA 2AJUL 1WUNT 4KTEL 1H3TA 1EUUA 4QXTA 2HG5B 3T09A 4PLJD 1FC2D 5AZ2L 1UC6A 4OZGE 2FX8H 5F1KC 2R4SH 4MQXC 4DKFL 2X4NA 4AM0A 4QO1A 1YMMB 5E2UH 4FTVB 4XAKD 1SQ2N 1L7IH 5KJRH 3BUTA 1HQRB 3UTPE 1WEJH 4P2RA 3ZE2F 1RURH 2J2ZA 2PO6B 4J23A 5KSBA 3BP6B 3DECA 3DV4B 3UJJL 3V6FA 3WUZA 2LU3A 2W0LA 2W1NA 1Q0YL 3RNKA 5I76A 3WN5A 5GQBA 1QA9B 1QSFB 2YPKB 2GEEA 4YR6A 1FP5A 4H25B 4YJZL 3UTSB 3WLBB 3O45A 3ECBA 4PY7B 3QIUC 1OP5K 1K8DB 3BT2L 2Q3ZA 4IIQA 1I4FA 3P11H 3ZKSD 2H26A 4NRXA 5CJQH 5GJSL 4HIEA 4F9LC 1LVEA 3RU8L 4OLWH 5D70H 4CDGC 2BSRA 4NO0A 5TE6H 4R26L 3IGAB 1I3GH 5D7JC 3E0GA 4PRHE 4Y2DD 2IGFH 3MA7A 1LK3H 2PXYA 1GGBH 2B5IB 2XZCL 2ZKHL 3QDGE 4ETQB 5BJTA 3F12B 2NY2C 5FF6A 4KRPB 4AYFA 1IGFH 3MV8D 4K07A 4LHUD 1TTGA 4JQXC 4FQIL 4U1IA 2H2SC 3ARDC 1L6ZA 2Z35B 5F96L 1EXUA 4XVTL 1BVKB 3K74B 5IESH 3BRFA 3G6JF 4XP6H 4H8WH 2Q87A 2AKRB 4HXAL 5HHMD 3QEHB 2C5DC 1PKQB 2YA1A 3GB7B 4WJ5B 4M8QB 1CR9L 3HNVL 3QQ9C 4U1SB 3VCLB 3KDMA 5B38B 3LN4B 3MLZH 4PDCE 2AK4E 2DB8A 4RBPH 2JIXB 5TDPA 2X9YA 4N0CD 4Z77B 3ZT6A 4H1LG 4OCNC 5B4MD 3NMEA 1CLYL 3QDJB 4WFEE 5TQ0L 1MFAL 3VI4F 2FNBA 3WLWC 4F7CA 1BF2A 2CIIA 4PJBA 4GXUM 4XPAL 4XB7A 2EECA 2UWEF 1QQDB 3MJ7B 4PREA 2NNAB 5EIIB 2QQLH 4OF5A 1RK1B 3N1FC 3RDTC 5JORA 3DIFB 1H8SA 4LLQA 5HHQA 3B2VL 3OJDB 1BFVH 3BP4B 3JWDC 1VESA 4WI2A 4LRNH 5DI8A 2FECL 2Y23A 4MJ2A 3LRSA 2FSEA 1OGTA 3P73B 1KB5A 1BAFH 4LFHG 3ALWA 1JNNH 2XWBB 4LDLB 1ZA6B 5ISZE 3TC9A 4PJHA 4RAHA 5FKAA 4ZUVA 3RWCA 3N1MC 2DQCL 1HOCA 2PCPA 3MRRB 3VXOA 2FX8L 1OGAB 4DKAA 1HHGB 3PDDA 1SM3H 3G6DH 4L8BB 2NY0B 2NXZD 5E2UL 3DRTA 3EOYG 1HXMB 1ORQA 2ESVD 3MRKA 5LGHH 1BZ7A 4X7EC 4XH2A 5T1MB 3D0LA 2EE2A 1U8LB 3ZO0A 4GW4B 3B43A 1TLKA 2R2HB 4PRID 3C08L 3U36A 4RISL 2O61B 1A7QL 5TH2B 2R2BA 4JGMA 3QXTA 4NQCE 2UY6A 1T0NB 4FFVC 4EI6B 1V5JA 2E7LE 1GGCH 3P11L 1NC2A 4TOYH 2VDLH 4GW1A 4QRUB 5D70L 1QR1A 3B2UC 5TE6L 5F9AC 4QRQB 1I3GL 1AXSB 4G8EA 4GG8B 1EV2E 1GGBL 5FO8B 1HKLH 2R4RH 1R6VA 2G60H 1IGFL 4NFCA 2YD2A 4WV1C 3QIUB 5FDWA 3PHQB 4MJ6B 4JFDA 4PYHA 5DMIH 1RVFH 3GSRA 1J8HE 2QEJA 3DX7A 3KLSA 3OWEA 3P4NA 5FYJE 2CRMA 5D7JB 4H8WL 5HHPA 4RDQG 1T0MA 2YMXH 3UZQA 3QWRA 4KAQL 4JANA 4GRWH 2NY2B 4PBWD 2D7NA 3MLZL 4N0FB 3PHOB 4BH7B 1P6FA 3D85D 2VR9A 3EUUA 4CVZB 5C08D 2Q86B 3PGDB 5FGSA 3ARDB 3HZYA 3DGGB 3L3HA 5DC0A 1GGTA 2RCSL 1CGYA 2VKXA 5FYKH 1H8NA 3MV9B 5HGHB 5DUPL 5EU3A 3QUXA 2QQLL 3C9NB 4XVSH 1N64L 5HYJB 1PFCA 2HLAB 2JELH 4HK0A 3TBWB 1BFVL 2ADGA 5TFSH 5DURB 4NHCH 2VQ1A 7CGTA 3MRDA 4LRNL 1I9EA 1MVUB 4NQSB 1IC5H 1QPPA 2HH0H 2NR6C 5IHUH 1K2DA 4XBPB 3REVB 1BAFL 3FTGA 3QIBA 3A0OA 3X3FH 1JNNL 4HH8A 1U8IA 5I8EB 5EZLB 3QIWC 2V2XA 1C5BH 1M7IB 2YN3A 1WWWX 3HZVB 3RDTB 4Z7VE 1YEEL 4L8DA 2FL5A 3G6DL 4LCWA 4OZHB 3MV11 5DJXA 5HTSA 4ZFGH 5BXFA 3DSFH 4LIQE 1NBZB 3QA3B 4DGVH 3KYAA 5LGHL 4U6HA 3T1FB 4KI5E 5F9DC 4XWOD 3L6FB 7FABL 2HTKC 3IDMA 1MCNA 4GUPB 2XN9D 4WW1A 4A6YH 3ROLA 5IBLD 4DGYH 1P5VA 4EBQH 5IW6B 4HC1L 4P57B 3DOSA 4LSVH 4YHLH 4TOYL 4HG4J 2VDLL 4U6VH 3PQYD 3MFFB 4HWNA 2SEBB 4KRMB 3VXQA 1NC4B 4HWZA 5F21B 1HKLL 2R4RL 5SX4I 1GPOH 3MC0A 2P8MA 3PF2A 2CRYA 2ILLA 3T77A 2I9TB 4ZTOL 3NIFE 2PR4H 3FCTB 5LBSH 4KQ4L 2V7HA 1RVFL 3RAJH 4EIZC 5DSCB 2A0LD 3OXSA 5FA3A 1UB5A 3RKDD 2YMXL 3TCXA 4G43A 3G6AB 2E6PA 1R0AH 5A1AA 4L4VA 5DRNA 3V6OE 3BOVA 3EZ8A 2Y5TA 1SBSH 4WV1B 4XP4H 3JUZA 4WVRA 3LKNB 4R97C 1JMXA 3QWQB 3EO9L 2EYTB 4CMHC 4KXZH 2WAHA 5BZWA 5HGDA 4GRMA 1LQSR 2VDML 5FYKL 1IM3A 4OCXH 4E41D 4AIOA 4N5EC 3MJGX 5CEZE 1MAKA 1RY7B 1ZVSB 2C3GA 2EDRA 1UQSA 4KKBC 5F1OB 2JELL 5GIRB 3CU7A 4F9PA 1I8LC 1DCLA 4RMRA 3TH4T 4Z7QE 4LCYA 4P48A 3O6FA 4Q58C 2BNQD 2GY7B 3SE4C 3VGGA 2F53A 5L8KB 5IHUL 3VFOA 5KANG 5E6ID 1GVIA 3B4NA 4LF3A 3T3MF 5B3JE 5TDNA 3KYKL 4F58H 5FKPA 5MHSD 4G7YH 1QVOB 1FFNB 3C5ZC 4C56A 3ILQD 1FNHA 5EULV 1F42A 4V2CB 2FYYA 3GI8H 1JCKA 4PRHB 2OJEB 3EOAA 5GRVK 4MD0B 4ZFGL 3BQUA 3V0VA 3DSFL 4NQTA 4CVXA 3QDGB 3OG6B 4DGVL 2WV3A 3WFDL 2V9TA 5CLTA 1FVEA 3ILPB 5CZVL 1MJJA 1KJVA 5C0GB 1ZE3C 2EDJA 3CCHA 3QIWB 2B2XL 3ZYJA 3RGVA 2WP3T 3PDOB 4JE4B 3TVMC 3QCUH 2DBLH 1G9NH 3BN9D 5IB2A 4IOIA 3I75B 4MGXA 5MEPA 4EBQL 2EXWC 1MH5B 1GL4B 1FLRL 5E9DE 2XWTA 1JK8B 1HXYA 1CFVH 4M5ZH 2XWJB 3HS0A 3IAQA 1J05A 1IKFL 2Y06H 4A6YA 4LSVL 3K4ZA 4JRWA 2Q6WB 1F90L 4P3DA 3VFMB 2H3NA 4DUXA 1VFBA 3HPJB 3HN3A 3ARUA 2VABA 3DO7A 2V6HA 5EU4A 2YSSA 1GPOL 4NZUH 2AK1H 1DLHA 3WNKA 3D9AL 4L1HA 5H37H 3N1GC 2PF6A 5LBSL 1T5WA 1CL7H 2PTUA 4KJPD 5J0BA 4HF5H 3CSYB 3EDJA 4BSWA 2DLIA 3OJVC 3BEVB 1DBJH 3KPRE 2W0FB 3SGEH 1BD2B 1LO2H 1UB6A 4K7FA 5JXED 2WNGA 1JNJA 5I30H 4P5TD 4KI5C 1SBSL 4LCCA 4XP4L 3VFSB 2NY4D 3ARGD 1P6AB 2IPTL 3TV3L 2O5XH 3MRFA 5ESQA 4N0UE 4UTBL 3SDDD 1MHEB 5KW9L 3VGDA 1Q0XL 2P5ED 2P24A 3BSZH 2VZOA 2H9GB 2X09A 2WUBL 3C8KB 1GZQA 5ETUA 3WNPA 1KLUB 4OB5L 1PQZA 2YPVH 5IFJB 4Z0XB 4R97B 5C9KA 3GMMA 2HRPH 1OAYH 4GBXD 3VA6A 4NKMA 1H5BC 3I6GA 3JVGA 5SX5H 5I1DA 4CMHB 4Y5VC 1BBJB 4JFOB 1KN4H 1GSMA 3PXHA 3OKDA 3ARED 4AY0A 1DFBH 2EKSA 4P2RE 4LLYB 4F58L 2V5TA 2GSIB 4G7YL 1PEZA 1SBBA 5KSBE 2DIBA 3O2DL 1QHPA 1VEOA 2HMIC 3MNWA 3IFNL 2I9LB 3HMWL 32C2B 4RA0C 1J12A 2EEBA 2P5WA 1LEIB 3QYCA 1JPGB 4JGJA 2PN5A 5HYQA 3AS3A 1UM5H 2Q8AL 1A7RL 3AS0A 3AS1A 3NGBC 3QCUL 2DBLL 4PRPA 4PGBA 2LQRA 3C5ZB 2J5LC 1QSZA 2IAMA 2YBRB 4FFWC 4JRXD 4X7TB 5D7LB 3SKNB 2V5YA 1QFHA 3RVVD 4JFFD 1CFVL 4M5ZL 5FO7B 3ARBA 3NCFB 3PUCA 5LCVH 4PRBA 5CP3H 2Y06L 5DC4B 1BBDH 4DVRH 4XHJD 1FQ9C 4FQLL 1QSED 1T6VN 3ZDXF 2DQFB 5TPWH 5B39G 4UV7H 4Y4KD 1T22A 4FNLL 3TVMB 3ZHLA 4KK5D 2WK2A 3FFCA 4AL8L 1R3KB 3F7VB 4JY4A 5KZCB 5F88A 3QNZA 1A14H 4I18C 1FZMB 1Z5LA 1HNFA 2HJKB 3MJ9A 2VE6B 2VR5A 1YY9C 4P9HC 1BVLA 1UKTA 1WVZA 4Y4HA 3MXVH 1CL7L 1HCVA 4MA1C 1NCUA 4HWBH 4C57C 1SJHB 3GSUA 1DSFL 4FXLA 5CMAA 4OSUL 3O3BB 1DBJL 1PYWB 1CLOH 5JOPE 1Z9LA 1QSVA 4PJBE 5C07A 2R2CA 5E03A 2QHRH 2YD6A 4OLXH 3HAEB 1VHPA 3BH9A 3NIFF 3D3VE 1P1ZA 4JFYB 2NY5H 3EHBD 2O5XL 4NQEA 3TFKC 3GUTA 2MTPA 4Z7VB 4R4BA 3C5SB 3ZE1F 4NZRL 5EWIL 2KQMA 3BSZL 5C0EA 3TO4D 3OB0K 4NQXB 4KKCD 5DJZA 1X3DA 2FO1A 4ODXA 3JUYA 1JUFB 2ZCHH 3HA0A 4M6OH 4NBYB 4PJ9C 3TIDA 3E6HB 4NFBA 4XCCH 1BHGA 1BZ9B 1CD0A 4POUB 4LLMB 4PJHE 2DQJL 2HRPL 1OAYL 1H0DA 4OGAC 2Y25A 4CJ1A 3I84A 4F7EB 4L3CA 5F89A 4PJ8C 5IUSA 1BFSA 1GC1C 3MROB 1U91B 5I8CA 4F7TA 4JR9L 2BRQA 1DFBL 1YC8A 4X0KB 4LRIC 2ICWJ 4IRSA 3P4MB 5IVNA 2WIIA 4DJMA 2OL3B 1YPZB 2P48B 3HNTH 4Z7QF 3QO0B 4HCRH 4P2OC 4PJFF 3RIFF 4OCSH 1H5BB 4Y5VB 4YHPB 3E3QC 2ARWA 1HHKA 3C2SA 5INDB 1F13A 1UM5L 2X4PB 4K3GA 4IOSD 1HHHB 4LAJH 3RL1B 2H6PB 3OKLA 2M8XA 1CXFA 2OSLB 4LHQB 3ZT7A 3OX8B 4WHYG 4QF1B 4APQA 1YMMD 2K7QA 4FTVD 2DIAA 1FE8H 1SYSB 5D4QA 1AQDB 2GT9A 3RX8A 2PO6D 1E28A 1BBDL 2JB5H 3OAZK 2CKNA 3VXMB 3NGBB 4JFDE 2IPUK 4YGVA 1W0YT 4PV9B 2J5LB 3IU4H 4Q6YA 3UTSD 1U6AL 1DN0B 3GI9H 2RGSA 3AC0A 5FGCB 1ORSA 2HLFC 3OPZL 3DUSB 4EQ3A 1OSPL 4H0IA 3FB8A 1LMKA 4EN3D 3MXVL 4PP1D 3X14B 2OS7A 5D2LF 1A6TB 4HJ0D 4PGEB 5IMLB 4HWBL 3VXRB 3MRBA 4N9GB 4O51B 3O3EA 4OD1H 1IGTB 2XA3A 3KPQA 4QRPB 2DD8H 1C12B 4OQ1A 3CXDH 4OIAA 3T3PF 4KRPD 4OZIF 2VQUA 3VRLE 3ARZA 4I18B 3RY6A 2BVOA 5CD3A 1PY4A 3OBAA 5A16B 2K1MA 1DJSA 1JYWA 4BKLA 4J3OC 3AUVA 4YHIB 4Q9CA 4MA1B 3SKOB 2A2QT 2ITCB 4M93C 3LSOB 4OZ4A 5T3ZH 2LABA 2JIXD 3EYQC 4XCCL 4HK3J 4DGIH 3S5LB 3TGXA 3QDJD 4KVNL 1MAMH 2A6IB 3FJTA 5DJ8A 1OTTD 5E9DB 2E7MA 4LCWE 1IGIH 2DQTL 1J87A 2HRLA 1NGWA 4PJ9B 4WTWA 1BGXH 3MLTB 5EO9A 4HXBL 3I50L 3UTOA 4HCRL 2W59A 2ICWA 3H0TB 4OCSL 1QLRA 1C08A 4CBPA 3V9FA 5EN2A 4PJ8B 3M07A 3S37H 3RWHB 3Q6GH 4XVUD 1JN6B 1F6AA 5E8EB 4JCMA 1KGCD 3MREA 3RIAF 1OGAD 3MUHL 4YLQT 3F5WA 2NY0D 4P2OB 3I02B 2XNAB 1FE8L 4K71C 3MXWH 3X11B 5J6HA 4F15C 5BRZE 1KULA 1KPUB 3KVQA 3MOQA 4P2YA 1ETZB 3MNZA 5FYKD 1F8TH 3KPRB 2C1PB 1FGVH 4I0PA 4PV8A 4R4FH 3VXPA 1P9MA 3BP5A 5F8RC 1ITCA 1P5UA 2WWMC 3B6SB 1WF5A 4UINH 4XBEL 1J5OH 1KJ3H 4N0UB 4KRNA 3IU4L 4YEFA 5KVDH 3SPVB 3R8BB 2FGZA 5I1EH 3TO2A 4JG0H 3GI9L 4UNTA 1GZPA 1RUQL 2VMFA 4M7KH 3NN8A 4F2MA 2X44D 2E9WA 2VZUA 3MRGA 4Z5RB 3MRHA 5DJ6A 4WNQB 3FRPG 3BIKB 2WBKA 1JRHH 1RHHB 4KJWC 1H3PL 1BEYH 4OD1L 4BSVB 1AJ7L 4FABH 4LSPH 4QYOA 1LD9A 1OW0C 3VFPB 3LS5L 2X4NB 4AM0B 4UUJA 2OL3L 4FXKB 3NCBB 2G9HA 2QSTA 4J6RL 5CSZA 4NRZA 4ZODA 4OFVA 1RJZA 4O2CA 3MR9B 2ORBH 2B1AL 5KSBB 5D7JD 3WD5H 4LNVA 2Z8VC 2WANA 5FB8A 2F53E 2B0SH 3RNKB 3V6ZB 5I76B 3NH7H 3O8XA 2DWDB 5F7EH 4YR6B 3W11C 5EBWA 2W65B 3GK8H 1H3WM 3O45B 1G7MA 5I0ZA 1LE9B 5K59E 3GSWB 4OCWL 5HVWA 2C3XA 1I4FB 3ARDD 5DYOA 1CQKA 1MAML 2H26B 2R0ZH 4NRXB 4HIEB 4YDKL 4FQHA 5F9OH 4M93B 5CLWA 4PJGE 1KXVC 1JIBA 5MENA 5SWZB 3MV9D 1UCBL 4PB9H 1IGIL 2YZ8A 3QQ9D 1A9BA 4K3JH 3GIVA 3MA7B 43C9A 1IM9A 3VWJD 5HYJD 5BJTB 1K4DA 1IVLA 3NCJH 5L2KA 1BGXL 2X4UA 1JGVL 4Y5YC 5DURD 5F1NB 4KPHH 3WLWD 3MRNA 2EDBA 3QQ3A 2J6EL 5L8JB 1NGYA 1EXUB 2V2WA 5ADOH 3Q6GL 1D6VH 4R2GC 4TVPE 3RDTD 2D7OA 2XKUA 4NRYB 5GS2H 3EGSA 3QUXC 1OTSC 4PJDA 2LE9A 3GRWA 5CILH 5DR5H 4X6DE 5TDPB 3ULVC 4WU5B 3MXWL 3VFWA 2Q8BH 1IT9H 4P9HL 4F7CB 1F8TL 2LVEA 4P2QA 1FGVL 1VADA 2CIIB 4KUCD 4PJBB 4R4FL 3NCCB 4QXWA 4XWGH 3CDCA 2AEIT 4HUMB 3W2DH 3BGAA 2A1WL 4K2UL 4RFEA 4UINL 3UP1A 1E27B 3NPZB 5JORB 3ARPA 5KVDL 3V52H 3HNSH 4X6CF 1EEQA 5CD5C 4K71B 3BDBA 5CJOH 5DI8B 4F15B 3LRSB 1FN4A 2FSEB 3IFLH 1OGTB 5FUOH 1JE6A 1EO8L 4G8FA 1JRHL 5AZEL 4EIGB 5ITBH 3EYUH 1NC4D 1BEYL 1EVUA 4QWWC 5FKAB 4ZUVB 4LSPL 3RWCB 1Q94A 5E56A 3WNOA 2HJLB 1JFQL 2FX9L 3TNMA 3BD4A 3ARWA 3DRTB 4FFVD 2GK0A 1CTOA 1CK0H 3MRKB 5KS9B 2VDRL 1BZ7B 3ULUC 3E2HA 2CGRH 3B2UD 3D0LB 2R1XA 4M00A 1FPTH 3WD5L 3OR7A 1OAQH 2LFGA 5D1ZA 4DEPC 1A1MA 1UCTA 2YD9A 2PYFA 3GJFB 3U36B 4HH9A 2ZZUT 5DQJA 5F7EL 2YKLH 5JIHA 1VEMA 3QXWA 2R2BB 1SVCP 4PBXA 2YRPA 3GK8L 4HDIA 5F9OL 4UQ3A 1DQTA 1G6VK 4PB9L 4M8VA 1BQLL 3S36X 1EGJA 2FD6H 5E1AB 2AXGA 2WW8A 2P5WE 3VMOA 3RZCD 3CLFH 4C58B 5DRZA 3NIDE 4CRPA 2GW5A 3FT4B 5HHOA 3DI2B 3CVHA 2JJSA 2O5ZH 5IB4A 3QUMA 5FDWB 1H15A 4NJ9H 2PW1A 4PRPE 3X17A 5JA9A 1WBXB 1KJ2H 3GSRB 5ANMA 4ONHA 3MMEA 1WT5A 3MGOA 1CXLA 5HHPB 5L6YH 1D6VL 3GO1H 1MQKH 1QRNA 3BUYA 2DQEL 1P7QB 2AVGA 4XXDB 5CILL 4Y5YB 3V7MA 5DR5L 1NGZA 4PRHD 1UWXK 3T0ED 43CAA 3O6FC 2NR6D 4LSSL 2Q8BL 4Q9BA 3GEWB 3DVFA 3FFCE 3LH2H 2IH1A 1IT9L 2XPGA 3HZYB 5HDLA 1RK0A 4XTRC 5FYLH 5FHBH 3L3HB 3KGRA 3QIWD 4XWGL 3W2DL 5GGTH 4R2GB 4U1GC 5CUSH 1YEDA 5KOMC 3O0RH 4ODHH 1N8ZA 2OYPA 3ZDYE 3QUXB 4TQEL 1DBBL 2R56L 3GJFH 1MFNA 3V52L 1VENA 4HK0B 1IBGH 3PHSA 2NZ9C 2ADGB 5CJOL 5F1SA 2VQ1B 3MRDB 4DK6A 4HUWB 3FRUA 1X44A 3LQZA 1MUJA 3IFLL 3BQUC 3IJHA 4H88L 5FUOL 1JWUA 1K2DB 4WW2F 5C07E 1DQQB 2HTKD 4MS8A 5ITBL 3EYUL 2V2XB 2X7LA 3U2SB 4F8QA 5ESAA 1UWGH 3QZWG 4WFED 2EDEA 1U95B 4NQEE 1J0JA 2BVQA 4L8DB 4UDTA 1FORH 2MNUA 2ZG1A 4LCWB 5DJXB 1FFPA 1FV1A 1YA5A 4V1DA 1CK0L 5E99L 4XCFL 4U6HB 1MHCA 4Q9QH 5A3IC 2CGRL 4N9OB 2Z4QA 4DZ8B 1FPTL 3IDMB 4OLVH 1OAQL 1QFWH 4K7PX 4YEEA 3QHZH 3ROLB 1BD2D 1NLBH 4GRWF 3EYOA 2Z31A 1EBAA 5J6GB 4Q97A 1LO0H 1T7WA 5LWYL 3CH1B 5GPRA 3V2AR 4KTDH 1PLGH 4DEPB 5MEOA 2AJ3A 3VXQB 2CUMA 4GMTH 4HWZB 2FD6L 1IQDA 1EJ6A 5HHVL 3GSXA 1ONQB 1N59A 3BJLA 1C8PA 4EVNA 1C7TA 2C3VB 3NACL 3T77B 1A7PL 5E0QA 5B38G 3UJTH 5FO9A 2WLZA 3SDCC 3OHXA 5IFHL 3RRQA 5IHLB 3ULVH 2X89A 4CADB 3LPFA 4DKDC 4GKNB 1QBLH 3O2VH 1QNZH 1TJGL 4L9LA 1T0PB 4N5ED 4HUXA 3OXSB 4PRAB 3S35H 1UB5B 5T1LA 5KTEH 3PGFH 4KKBD 4JPIB 4L4VB 4OAWB 5DRNB 5JW4N 3BWUC 3L3OA 2DLGA 3CZJA 3SKMA 1PX3A 2Y5TB 1S7VA 1Z2KA 1AXTH 3ARTA 3KPTA 1FZJA 4M62H 4ODWA 4BFBD 3RVXC 5I1KH 4EI5A 3JVGC 1VCAA 1ZXQA 5FYLL 2OQJA 5BZWB 4BQ9A 5HGDB 4GRMB 1Q9OA 1S9WB 4URTB 3UPAA 1IM3B 2GIYA 1WQVT 5HD8D 5CUSL 3SDXA 5JW3L 3C5ZD 3FT3B 5D7LD 3GDBA 2BC4B 4W6YB 5D6CA 3KXFD 4X6DF 4LCYB 1U92A 2AJVH 3OKEA 1NCNA 1Y6MR 1S5IL 1RZIA 1ZMYA 4ZOBA 1FIEA 3MBXH 4ODTH 4E0RB 1TZHA 4OFDA 3IDJA 3ULUH 1R5WA 4G8IA 3TVMD 4U1GB 4LF3B 3RY4A 1URLA 5KZCD 1A5FL 4C56B 2AI0H 3QPQD 2MPAL 3HG1D 5EIVA 4WIQA 2AEWA 4U3XA 2FYYB 1FORL 1CD8A 1T1XA 2E8YA 1ZANL 1A1NA 3EOAB 1JGLH 1C16A 4MNGA 3BQUB 4Q7DA 4EDWH 3P40A 4CVXB 2ARJQ 4D0CB 1RHFA 3KJ6L 4RAVB 1FVEB 4Q9QL 5FXCH 1KJVB 4FN0A 2YK1H 4Y16C 1V7MH 2OM5A 3CCHB 2QR0B 2OTPA 1QFWL 3QHZL 3MOAL 1XGPB 5HYSA 5IB2B 5I6XC 5MEPB 4CU7A 4F33A 4PJXF 1HSBB 4JDTH 3V8OA 5IT2H 2XWTB 2RHEA 4UOJA 1MCHA 1JNLH 1LO0L 3HS0B 1T1YA 4PJAA 1WBZA 1I8IB 4NKDA 5C0AA 2Z91A 3GKWH 3L7EA 3BMWA 4P3DB 4Y4HC 3H6JA 2H3NB 3CDYA 2MQ3A 3OKNB 5F7DA 3MRQB 1VFBB 2VUYA 3ZL4L 2PTTB 1PLGL 2YUVA 2VABB 3GBNL 4KUCF 3KPSA 1WIOA 4GMTL 3DO7B 1HH9A 4LPYA 1NBVH 5EU4B 4MD5A 2YSSB 4KI5D 5L88L 1M6OA 1S7WA 4RMSA 1N2RA 2HFTA 5I1CH 2OBGA 3ULVL 3PABA 3FHQA 1F4WH 3P77A 3AXLA 1F4YH 3O2VL 1MRFH 5GGVL 2R2EA 3DI3B 3RWIA 1BQHB 4BSWB 4MXWH 3S35L 2GJZB 1QYGH 1JZ7A 1UB6B 5FUZH 1WWBX 3NTCH 3MLRH 2YWZA 5GGSA 2YRLA 1AXTL 4TTDC 4X6EA 3SDCB 1AKJA 3OAUH 4ZO7A 1QFPA 1IEAB 1CDBA 3QI9C 4D2NA 1BLNA 2P24B 1WICA 1VFMA 2YA0A 5A2JH 2CDFA 1OP3H 2HTLC 5E2JA 1ZS8B 1GZQB 4IOFC 4IRSC 5ETUB 5IVXA 3H8NA 2DKMA 2RR3A 4J12A 4BK5A 2AJVL 5DJYA 5EBLB 3GMMB 4NKMB 4JZNB 5I1DB 4LBEA 5CINL 3MBXL 3GHBL 2R23A 3UTQA 5GRZA 4LPXA 3VXMD 3ULUL 3OKDB 3LS4H 1XGTA 4FFWD 2VLJB 3VWKA 2EEAA 5T3XL 1FFQA 1T89A 3D39A 1MCWM 3FQNA 1ZLWK 1EHXA 3ZE0E 3MNWB 2DL2A 3H7LA 4OF6A 4NCDA 1JGLL 3LDBC 1A4JA 3C6SA 3QXUA 2P5WB 3ARVA 4XBGA 5DF0A 3VXRD 5HYQB 2YK1L 3MBEC 1V7ML 4QRPD 4YBLC 3EOTH 1M7XA 4PJEF 4PRPB 4PGBB 5T3ZE 4NQDA 1Z3GH 1NAKL 2V17H 4JDTL 3TYGH 5MENE 5IT2L 3QEGH 3AU1B 1YY9D 5F9WC 1Q9KB 2DOCA 1JNLL 2EEDA 3W5NA 4XAWH 3MNVA 5E94B 4PRBB 1LP9A 1K9TA 1ZLUK 4Y16B 2JCCA 1Q9LB 3P9LA 1J1PH 5F3BA 1JF1A 2KH2B 5I6XB 5E2VH 3KYMA 1NBVL 4JY4B 3MLPA 3QNZB 2R69H 4HAFA 3RY6C 4FQXA 1Z5LB 2IFGA 5EA0L 5GGUB 1H3UA 4ODUA 2AP2A 5AWNH 1IFHH 5IB5B 4QTHA 3H3PL 2DI9A 2LAGB 2UZXB 1BVLB 1KIPA 5JPNA 4PJDE 4Y4HB 4M6NH 3RUGF 1F4YL 4IMKA 1MRFL 1ZT7A 5EBGA 1BIIB 5ICYA 1Z0MA 3QPXL 4MXWL 1MNUH 2VOTA 1JMZA 3CSBA 3ABZA 4PJ9D 1NBQA 4P2QE 2BVTA 4P2CG 4RMWA 5DFTA 4OGAD 4LCUB 3OAUL 3BH9B 2V5RA 4NNXA 5DVKA 3CH8A 1P1ZB 4NQEB 4PY8I 4PJ8D 2BY2A 4PJ7A 4JKPH 4R7NA 5I1JH 5C0EB 4HBCL 5DJZB 4OF8A 5DGQA 1XCQB 4LCIL 5DDHB 1LO3H 1P2CB 4ODXB 4HS6A 1RAMA 3INUH 3TIDB 3ZDZF 3L3KA 4P2OD 3BIBX 1U8JA 1JFMA 1X6LA 1KSRA 1HNGA 1CFBA 4U1KB 1BJ1H 3QI9B 4NM8H 3CMGA 1KXQE 4JVUA 5KSVB 1DQMH 1HSAA 1K5NB 3P9WB 4XPTL 2VSDA 4KK8C 4KV5F 4IRSB 2WIIB 1A6ZB 4ISVA 5IIEA 1EHLL 4GT7A 5B8CA 4OZFH 1UKSA 1I7RB 1Q9WA 1S5HA 3S7GA 4HUVA 4IDJL 4Y5XA 1SMOA 4RA3A 4I0PC 4J3TA 3MRMB 3JXAA 3G5VA 2F8OA 5GS2D 5HGGS 4IS6A 1J11A 5IM7A 1I1YA 3OKLB 4HAGA 4KGLA 2GCYA 2APXA 3LHPH 4M3KB 4JFQA 5DLMH 3FN9A 5DMKA 2V17L 3TYGL 3QEGL 1DEEB 2HLFD 4Z7UA 3FFDB 2GT9B 3LDBB 1RULH 3K0WA 4WI8A 4J1UA 3A6OA 1ACYL 1AD0B 3GSOB 3U79A 5HHOE 3MBEB 1YYLH 4YBLB 3BYTA 1CFSB 3HRZA 3WUWA 2EDOA 4RGOL 5ANME 1I9IH 4PPTA 2NZIA 4XP9L 2A83A 5F9WB 1ORSB 2VC2H 4YFDB 4CGTA 5C9JA 4HEPG 1QRNE 1DANT 2WP3O 4U49A 3NCMA 3FB8B 4C4KT 4M6NL 5GRYA 1B6DA 5SWZD 4MLIA 5IHZB 4JM2F 1S7SB 4U1NA 3MRBB 5DUBA 5HDOA 5DRXA 1VFUA 3KPQB 4JFEA 1Z9SA 1OF2B 3BXNA 1ZAGA 2VL5A 1PG7X 3EYQD 3SOBH 3EFDL 5DVLA 5CD3B 1ZGLB 2F54A 5E4EC 1PKOA 1AY1L 4OM1L 5IMKA 3OAYK 4D0DA 4ZOEA 4YAQB 4MB3A 3D0VB 4JKPL 3DJ9A 2Q7YA 5I1JL 1D5IH 2XG4A 1OM3L 1MRCL 4OZ4B 4XMPH 3UYOD 2X2YA 4I3SH 2ICWI 1B9ZA 3GSQA 3MLXH 4O9HH 5MP6H 1IEHA 3G5ZA 4Q2ZA 3R0MA 1IEBA 1ZVYA 1OWRM 1MCPL 2J8UA 1QFUH 5JOPD 4FMFA 1I7ZA 2XQYG 2Z8RA 1BFTA 3VE0A 3O4LB 1OT2A 2BOBA 5GXBB 2H1PL 1BECA 3O6KH 4NM8L 4XRCB 1YC7A 2VXQL 1DQML 4V1DE 3LEYH 3PG2A 5CKGA 1NGWB 3AY4A 3VRIA 1XT5A 4KC3B 3VGHA 1L8JA 1I85C 3WEXA 3TBVA 8FABA 1RZFH 1QLRB 2QKIA 2G5BA 1RUAL 3J7HA 3K81A 4Q6IC 4B50A 4G6KH 2IPKA 1F6AB 5EC1A 3LRHA 5D1QC 3LHPL 4LLWA 5DLML 5E00A 4WGWB 3SO3B 3P0YL 1EEUA 5FYLD 1QOKA 5DZNA 1YPZF 1CDYA 5HHNA 3MGAA 3MNZB 4YH6A 3F8UB 2F5AH 2RFXA 4I0PB 4PV8B 4KJWD 3VXPB 3UYPA 5C0DB 1YYLL 3MFGB 3WDHA 1MOEA 1G7JA 5DQDH 1ZEAH 1HZHH 3GHEH 1CIDA 4POYA 1H3XA 2YR3A 2ZPKL 1I9IL 3TO2B 3IF1A 2VZTA 2B7DT 4Z8FL 1GZPB 2VC2L 3NN8B 5ESVB 2AJZA 4F2MB 3MRGB 5DWUH 4OFYA 4G9FA 5ADPL 3HZKB 2YEZA 1T2XA 4I3RH 5D1ZC 1X4ZA 4POZC 2OJZL 4QYOB 4MHHG 4LAQH 1LD9B 3MYZA 3W11D 1X5YA 5HHXL 2IANA 3GNML 1AIFB 3TCLA 1OVZA 3SDXE 4YNYB 4EKXA 5DJAA 4NRZB 1RJZB 4O2CB 5IK3B 1L6XA 4CDHA 4ZD3H 4ONFH 1D5MA 2Y07H 5DK2B 1SJEA 2ATKA 5DJDA 4XMPL 3RIFK 2GUOB 2XTJC 1P7QD 2B8OT 1DQJB 4PP2B 4UV4H 5AG8A 4EOWH 4CUCA 4O9HL 2D03H 2FJHA 4GKZB 1G7MB 3ZSTA 5E4EB 2YOCA 4DZBA 1WFTA 2KBGA 1A2YA 5B3NA 2VXVH 3T08A 1K4CA 3QCTH 1J0IA 1WT5C 3O6KL 4R2GD 1PG7L 3UJIL 1A9BB 2NY3B 3QUXD 43C9B 3IDIA 1OTSD 4JB9L 1UA6H 4KDTA 3I85A 1CT8A 5IB1A 1K4DB 3QJFA 3OV6A 5L2KB 4TRPH 3MA9H 3VDCA 5GRWA 4C59B 3ULVD 3U4BL 3ZKQD 2P44B 4HIJB 2HJFA 3V79C 3DGCR 1YEJH 1RZFL 4UMGA 2FGWH 3HFMH 1JGDB 3T2OA 3CPLB 2VAAA 4IEFB 5JW4M 1NGYB 2OZ4A 5DK0B 2V2WB 4G6KL 5C09A 2DI7A 3GSNA 5CEYA 3KPMA 2FJGA 4PJAE 5F7WC 5HJ3A 4ZDHA 5C0AE 5GRUL 3EGSB 1MCJA 4JPVL 1ES0A 1Y6NR 2CIKA 4LCWD 5C0JB 3KPSE 2C3WA 3U1SL 2CDEA 1I8MB 2UUDK 5HGAA 1G7IA 4L3EB 4JN1H 4P2QB 1EAJA 4Q6IB 5DUML 2HT2D 4MS8C 4GFTB 2CKBA 4Z7NF 4GAYA 3VFVB 1G7QB 2MMXA 2FHBA 3GHEL 4RFEB 5D1QB 1J18A 1NFIA 5JHDB 4X6BA 1NFDB 2Z92A 2G2RB 2Z9TA 3QJHA 3BYYA 1DBAH 4JFZL 5ILTH 1FN4B 1T4KA 1F45A 3ULUD 2W9DH 4NWUH 5DWUL 3W0WB 1CZ8H 5D2NA 2OP4H 5HY9B 5I16A 5SV3A 3BIAX 5CEXB 3ZTJH 5T3XD 3OGCA 3IFPA 4I3RL 4KZEH 1QBAA 2YD5A 1NH6A 1K8IB 3BZEA 3HC0A 1JHKL 4WI6A 4I9WD 5LG1A 3SJVA 3TNMB 4F7PA 2H2PC 2YHGA 4GKSA 1U8HA 2Z8WC 4JY5L 3RVUC 3HE6A 4M4PA 5IVXE 2I07A 3FN3A 4YHNA 3NABL 2J1KA 5E8PA 3V0WL 4ZD3L 2ZSVA 2Y07L 3OR7B 4Y7MA 1DBML 5D1ZB 3PWPA 4DWHA 2PYFB 4L4VD 5EZOH 3MRLA 3NPSC 4LHJB 1G0YR 5DQJB 5ENWB 3G5XA 4EOWL 2D03L 4KK9C 4TULH 5HYIA 4JKKA 4X8JA 3HI1B 4HDIB 3PJSA 2VXVL 4MA3A 3D39E 4ZYKB 5GSRB 3RIAK 5EH1A 1KG0A 3MJ6A 3HC4H 4L9LC 5IR1A 4FFZH 4LPVA 2O5YH 1I1AA 2XTJB 4Q74A 4IRZH 1UA6L 1I8KA 1UZ8B 5J8OA 4N0RA 5GSVB 4DVBA 3MA9L 5HHOB 1KLGA 3FQTA 3CVHB 4QXUL 1YYML 2EXYD 2XZAH 4XTRD 1YEJL 4N90E 4NQDE 4EI5C 3I3BA 2FGWL 4QT5A 4X9GA 5ANMB 1S8DA 5K9OB 1JGUH 1MREH 4K8RC 4QEGA 1ZLVK 3EDKA 5B21A 1LP9E 4MJIA 1CFQA 3BUYB 4G6JH 4C56D 1R3HA 1YDPA 3CAFA 3F65A 2NZ9D 2JCCE 2UVEA 3AB0C 5GRXG 3BQUD 1W0VB 3HR5A 3IAPA 3QNYA 2XPGB 3MACH 4PS4L 1RK0B 4MDJB 2CSPA 4JN1L 4OCYH 3TF7C 2Y7QA 2L7UA 4GAGH 3H9HA 1HHIA 4QGTA 1KPRA 4XXCA 1YEDB 3FZUC 1MIMH 4OBRA 5DA0B 3KR3H 2EDLA 4X5XA 2J7LA 5CWSA 5C8JA 2FB4H 3BFOA 3IS0X 2MOVA 3NCYP 2E9BA 5ILTL 35C8H 3FRUB 4O58L 1KTLA 1E4KA 4GW5B 5A3ID 3OZ9H 4H1LA 4NWUL 1X5GA 2HVKA 1CZ8L 3HKFA 1J1OL 2XKSA 3U7YH 2P46B 1INQB 5LGKA 3QT2A 2GTZB 3EO0B 3W5MA 2JTDA 4PJ7E 4G8GA 2BVQB 4JGUA 2H8PA 4UDTB 2EDQA 4V1DB 4D9RD 1I3VA 4YDJA 4U1JA 4JAMA 1UJ3A 1MCDA 1EH9A 1MHCB 4YFLF 2IALA 1YQVH 1U8QA 1F3JA 1EK3A 1NGXB 4MCYB 4Z0BH 4WFGE 5D7SH 4HS8H 3DV6A 2OMBA 2JF1A 3ZTNL 5IBUB 4TULL 1QBBA 3SDCD 4N5UA 1G9MC 2I5YH 2KZWA 3DMMD 4B53A 3ZZ1A 1KPVB 4DK3A 1OAXL 3B9DA 3B9EA 1KCRH 1XGRA 5KS9F 2ZCKL 4MB4A 4S2SA 1D5ZB 3HC4L 1M71A 3FQUA 3S4SB 4FFZL 5MEOB 2AJ3B 1ND0B 3CFDA 4V2BA 1JWSB 4PRDA 4IRZL 1U8MB 3NPSB 5IJVA 3G6JA 5E6YA 3JSSA 4UU9B 1CS6A 3GSXB 3WXVL 1N59B 1KELL 5EO1A 3L7FA 4XP1H 3RVXD 2ITDA 3OHXB 2VO5A 4U6XB 4WEBH 3DROA 4G9DA 4L9LB 2XKNB 4Z7UE 1GOGA 5T1LB 2VLJD 1BQSA 4PJIF 3REWB 4RZCB 3RTQA 1QBML 1A02N 3SKMB 2VLRD 1AI1H 1O0VA 1S7VB 4D9QE 2UWEA 1VGKA 1FZJB 5I2IA 3I9GH 4LK4A 2XZQL 4KK6C 1MWAA 3MACL 4MAUL 1QPXA 1EHNA 1Q9OB 3LRGA 4GAGL 5HYFA 3SGKC 1VFAA 1F97A 4EUPH 3ME0A 3D2UD 5ALCL 1NMCC 5F97E 4PRPD 3CU1A 3LQAH 1XEDA 3CFIC 2HP4A 3VWKC 4JDVA 2R29H 3MO1A 1T89C 3KR3L 4U3CA 5JQHC 3AB0B 4JFEE 1WTLA 35C8L 1G6RA 5T5FL 4XMLH 3OZ9L 4PLKC 4Y16D 2F54E 3V4PH 1FVCB 1IAII 4O4YH 1ADQA 3Q2CA 3WXWH 2HWZL 4I77H 1CLZH 4Y4FA 3RL2A 3C60C 1KEMH 1CICC 1QLFA 5IG7B 4RWYL 1A1NB 2P45B 3BPOC 4PD4K 5ID1B 4MNGB 3ULVF 3UZEA 4Y4HD 3TZVA 2OR7A 5GGRY 1GGUA 5HI3D 1TMCB 5EPMA 1JNHA 1U8NA 3QULA 4MAYA 2DL9A 3WS3A 2J8UE 3V5HA 4Z0BL 5HYSB 1S9VA 2K7PA 3GM8A 2E9JA 4I0CC 3QG6B 4F33B 1FIGH 4OLYH 2DMKA 5IW3A 3BKML 3VXSA 4PRNA 1HEZB 4KKNA 4D3CH 3SQOL 5CHNB 5D7KD 2XIDA 5E2WL 2I5YL 5KVGH 3R06B 5C6WH 4NQED 4PJAB 1WBZB 4WGVB 4F3FA 3B9KC 5C0AB 1DQLL 3CUPA 3L7EB 1KCRL 5AYQA 2VDPH 5KAQF 1D9KD 1ZHLA 3NFPA 1UWEH 3KPSB 3BVNB 1R5VA 2I25N 2L4OA 1FL5B 1R3JB 4MD5B 5IHBA 3JWNC 1FLTX 4FOMA 2D7PA 3IDYC 4TTDD 1D5XA 1K3ZA 1S7WB 3S34H 1T03H 5MI0C 1T1ZA 5EG6C 1UVQB 1W0WA 2EDXA 2NTFB 3PABB 5IEHB 4XT1C 1D5BA 1MRDH 3O9WB 3QI9D 1MFDL 1NLDH 1PSKH 3ULUF 2R2EB 3Q3GA 3KPOA 2HTLD 1HINH 2XY2A 1X5KA 4DFIA 1L7TL 3QBTB 1J86A 4IRSD 2V7NA 3UXFA 4JVPA 4NUGH 5H35A 4S10A 5C0CD 5D7IE 4X6EB 1AKJB 3I9GL 1YJDC 4WUUA 1J0YA 4J3WA 2QSCL 3L9RB 1BLNB 3OKYA 1VFOA 1FNSH 4BSJA 4M1GH 5CBAB 1IGCH 2EC9T 2CDFB 5F70A 3IDNA 3D18B 2NW3A 2D0GA 4G9FE 2BCKA 3DTXB 3SE8H 5LQBH 4WWKD 5B8CC 2HT4C 1XFPA 2W92A 3EKCA 5DJYB 1CU4H 3SGDH 2VB5A 2AS5M 4LBEB 2IANE 4LLDB 1NKRA 4RGNC 4Y5XC 1YNTA 3MBED 1S7RA 3UTQB 3DRQA 1DE4B 2OMNA 3MPCA 1NDMA 3QEQA 3V4PL 1NUDA 2J4WH 4O4YL 1W72B 1NMCB 5F7NC 4XMKH 1XGTB 3M1BB 3CDGA 3VFGH 4I77L 3WXWL 3VWKB 1C1EH 1WSST 2IADA 5IMMA 3FQNB 3S3PA 1JV5B 1T2QH 5A2IH 5BQ7A 4H26A 4MA8L 4N8VG 2KQNA 3PP3H 3KPLA 25C8H 3ES6A 1G9MH 1A4JB 2BXZA 3C6SB 4LVEA 5CGYC 4FS0A 3OF6A 4XBGB 4NNPL 1SYVB 4L4TA 4JKLA 5IVZA 4X4YA 1FO0B 3RY5A 4NQDB 3C60B 2VLKB 4U1HA 1QD0A 1CICB 4UIMA 1FIGL 2WM0A 4OLYL 4OV5A 4QRSA 4D3CL 3BPOB 5DHVA 5ICZA 4MZ3A 3TJEH 2RQ8A 3S97C 5KVGL 1LP9B 3MCG1 5AYUL 2FZ3A 3Q48A 4YHOH 2DTSA 3EO1A 3EIFA 3P9LB 1E4XI 1ZHBA 5F3BB 2A77H 1T7YA 2VH5H 4K8RL 3KYMB 1MVFA 3FL7A 4HUUA 4M02A 5C09E 3U9PH 4HQQL 3S34L 3MGTA 3I6KB 4M6AA 3B9KB 5J1AA 1N6QH 1KIPB 1MRDL 3PWNA 3O4LD 4HULB 1TETH 3L5WB 3VG9C 4IRJA 3OB8A 1CE6A 3A6CH 1ZT7B 4NZDA 1UXSA 1MCIA 5C7XH 5ICYB 1FYTB 3F6IA 1X7QA 1HINL 1W72H 1FCGA 1A4KB 3I6LD 1FVDA 1P4IL 3IDYB 4HG4K 5IROC 5CGTA 3STLA 2MSPA 5MI0B 5ERWB 3T8XA 4H0HB 3QH3A 3BGMA 4NNXB 1QACA 4OLUL 2AK4A 3DSNA 2Q7NA 3LZFH 1T20A 3KPPA 3MRCA 4IBLT 4PJ7B 3BGFC 3LY6A 4HJJL 5JOEA 4KK8D 5DVMA 4GXVL 5M7QA 3QG7H 1T5XB 3BZFA 1FO0H 3SE8L 5D2NE 5H8DA 3AY4C 4ZFOA 5LQBL 3L3KB 3RVWC 1Q1JL 3UDWA 5FM4A 1U8JB 5GRVL 5CSGA 1IAIL 1CU4L 3CFEB 3DX9A 4ZUTA 4Y2DA 1XR8A 1TZGH 3MV01 4P5KA 5F6HJ 2YN5A 2D7QA 5I1IL 1CBVL 4MWFA 5FM5O 3SJVE 3MV8A 4LHUA 5GZND 2J4WL 1HSAB 1KXTB 4XMKL 3VFGL 5AD0A 1XF4A 4GRLC 1C1EL 2D31A 5IIEB 2IBZX 3O11A 2GK2A 3UO1L 5B8CB 1K3IA 1FG9C 1ZT1A 3PWPE 4N1CA 4RGMC 1S5HB 3FQWB 1G9ML 1MI5D 1NGQL 3UBXG 4Z76A 4RGNB 2DQUH 2BFVL 4Y5XB 1VA9A 1F4HA 2QSQA 1XGUA 4R8WH 3R4DA 1JTPA 5E2TH 3JWOC 5CBEB 4N0CA 3HMXA 5IM7B 3EJJX 1I1YB 1IGYA 5AEAA 1XF1A 4JFQB 5DMKB 4CMMA 3VH8G 4Z7UB 1AGEA 4X9FA 5D96C 3TJEL 1LO5A 2HFFA 3FONA 4I1NB 4B41A 1F00I 2YXFA 3BH8A 4QOKB 3LKSA 1FYHB 4OUUA 3CMOH 4NOFA 3MCKA 4XNXH 3WUWB 5SV4A 1NSNL 3EYSH 1HDMB 3PV6B 1JYVA 5CIPH 1NQBA 2JB6B 2JK5A 2A83B 3VFUA 4PLNC 2ICEA 3KS0H 4JKWA 4MJIE 4UQ2A 2R0LH 2C7UA 3KS0J 4JPKH 1AGCA 1RU9H 1DLFH 1MFBH 2DRUA 1TETL 3FKUS 4X7FC 1GIGH 3A6CL 4U1NB 2D0FA 4GLRI 5DUBB 3BDYL 2NY3D 4HWEH 5I8OH 1DZBA 4X83A 1J8HA 2ESVA 1CVSC 1W72L 5B39A 2VL5B 4MCZB 4JHAH 5L2KD 1BOGB 2PUQT 2FBJH 4K9EC 2HFGH 4JQIH 3RWFA 4R7DA 4PRIA 5TF1H 1NEZG 2AXJA 3VG9B 3LZFL 5E4IA 2APFA 4UDUA 4ZUUA 1D7FA 4X4MA 3GSQB 1ZA3A 1LEKA 1FO0L 2ED8A 2X70A 1NCBH 1X5FA 4YWGH 5JNYA 5D7IF 3MODL 1RIVL 3ZE2E 1IEBB 3LMJL 4L3ED 1TZGL 3WIHA 4QY8A 4G8GE 5AUMA 4MYWB 4MDIB 1NAMH 1AGBA 1YNKH 3MRPB 5D1QD 5JHDD 2P7TA 3LB6C 1INDL 1AO7D 3VRIB 3T1WA 1YMHA 1S7XA 3WEXB 4HUKB 8FABB 3S6CA 1PBYA 4L29A 3STBA 4G5ZH 3V8CA 1WC7A 3W0WD 5I8KH 3IDXL 4RSVA 1Y6KR 2BSSA 4J7RA 2ID5A 3O2WH 2IPKB 3SDAC 1S9KC 5JIIA 4NO3A 4GRLB 5C08A 5SX5K 1B6UA 1TXKA 1LK2A 5E00B 5EDXA 4KZDH 3IKCA 3T2NL 4PTTA 4RGMB 1ZHKA 3G6JE 4OZFG 5DEFB 1DQDL 1CIUA 4P4KA 2RFXB 5C6TL 2DDQL 5DJCB 3DHJA 4UB0H 5D1ZD 4POZD 4YXHL 1FRGL 3K4DA 1N4XL 4X5WA 6FABH 4XNXL 5FIEA 1G7JB 5GRJH 4ZQKA 1U3HA 4Z7WF 3OKOA 3EYSL 1RZGB 3THML 2I24N 3IF1B 3UC0H 5D96B 3VI4E 3DARA 4MA7H 1B0WA 2A9MH 2AJZB 3GMOA 2R0LL 2BMKB 1YJDL 1RU9L 3HE6C 2EYSA 1MFBL 2Q76A 1IAMA 3TPUA 1XMWA 1FJ1A 2UWEE 3WBDA 1DANU 4BQ8A 4HWEL 4RAUA 2XTJD 4PJ5B 4DOHE 5J56B 3WV0A 1CYGA 3TN0D 2IANB 4JHAL 1B0RA 5HHOD 4ZUWA 5IW1B 1QLEH 1QP1A 2AJXH 3EBAA 2HFGL 4OI8A 4PTUA 3C6LC 4JQIL 3CZFA 2ZCLH 3EJZC 3G08A 3T4AA 4KHXL 1NCCL 1MPAH 4OQTH 3WIFA 4O2FB 4JO3H 3VDBA 1D5MB 3ALXA 1PEWA 1SJEB 5F7MC 2H32H 3S88L 4NSKA 3TT3L 4O5LH 1WIUA 3UTTB 2WMPA 4W6WB 4HWUA 3BD5A 5BZDA 2FJHB 1F4XL 4R4NC 3PQYA 4YWGL 3HI5H 4XNUL 3FOMB 1PJ9A 2OTUB 4FQPA 4XPBH 4DZBB 1KCKA 2AJUH 4OD2B 3B8SA 5DD3H 2B4CC 4WWID 4PJFA 4KTEH 3AAZA 5FOBA 4U6YB 5AZ2H 5JLZB 1NAML 1YNKL 4DKFH 3IDIB 4D94A 1YEFH 1EFXB 2ERJC 2VIRA 5DEGA 5IB1B 1IE5A 1I1RA 3QJFB 4KRLB 2F9BT 3TBYB 5FM8A 3CX5J 5C3TA 4KVCL 1YY8A 4OV6F 1F3DH 1YZZA 1F3DJ 4ERSL 5HDQH 4NPYB 3TLRA 4MS8D 5CJXC 2VAAB 3VXSE 3WMSA 4L4JA 4HPYH 3V4VL 2BOCB 3O2WL 5DJ0B 3VXUA 1JI2A 3GSNB 3MLWH 4XXCC 5CEYB 3KPMB 2FJGB 1VPOH 1WWAX 4ZDHB 5HJ3B 1SEQH 3D25A 1ES0B 3SDYH 2BVPA 2NW2B 2CIKB 4B0MM 3L5IA 4NC1C 3KJ4C 2XG5A 4F7MA 1JPSH 3RU8H 5HGAB 1G7IB 1E4KC 2IMMA 5LKNA 1A1OA 2CKBB 3SDAB 5DHYB 2XZCH 2ZKHH 2YUZA 3DBXA 5I19L 6FABL 4XCYA 2YC1B 3T0BA 1KJMB 1NFIB 3DPBA 4HZLB 2IC2A 5D2LA 4X6BB 3RKPA 3QJHB 3UC0L 2H2PD 1IC1A 3LKPA 1IGJB 3VJ6A 3W9DA 3O3UN 2DWEA 2IQ9H 3RVUD 3DXAE 5F96H 1SEBB 4OZIA 1T4KB 4XVTH 3MUY1 3HTLX 4FQJL 3QXDB 1UJ3C 1RZ8A 4HXAH 3IETA 1CR9H 4XC3L 2UYLA 4HMDA 3IFPB 3IJYB 1UADC 2MKWA 4HIIB 1LDPL 3BZEB 4KK9D 4LPTA 3HC0B 1FGNH 1BZQK 1M05B 1QLEL 3SJVB 2AJXL 3S9DB 1QEWA 4F7PB 1SHMA 1NDGB 4YPGA 3HE6B 4XPAH 2ZCLL 1Y0LA 4YHNB 3WO3B 3NZHH 1MPAL 2VXUL 4OQTL 4JO3L 3IDUA 4NO5B 5T1LD 3PWPB 2OCFD 5CGMA 5JO5B 2IJ0C 3C8HA 3MRLB 4O5LL 1SJXA 1SVZA 1U93A 5BS0B 3QEQE 1CDHA 3C6LB 5E24E 5E95B 3QHTC 3FOLA 2VN4A 4XPBL 5DD3L 2P49B 4MA3B 3CVIH 1NMAH 4M48L 1KG0B 4K8RD 1JZ5A 1OTUD 1UENA 2DQCH 5IR1B 1P4LA 4BZ1H 5I18H 3LKQA 1YEFL 5DD0H 1I8KB 4GG6B 3F7RA 4AT6B 5BVJA 4DVBB 5TGBA 1NL0H 4L4TE 4RIRA 5T1DL 4HIHA 3PXJA 4X8XA 3T2QA 3O41A 4X80L 5HDQL 4HW6A 4QT5B 4ZNEA 3K1KC 1S8DB 1Z6JT 2VZ3A 3DETD 5JXEA 3U0PA 3GMLA 4HPYL 3C08H 3FZUD 4P5TA 3DUUB 3TH3T 2D4FA 1QR4A 4RISH 5EOTA 1BWWA 3MLWL 1A7QH 1NANI 3LVEA 2ERJB 1VPOL 4QNPF 5K9JL 1R3HB 1SEQL 3SDDA 1G1YA 4U05A 3SDYL 4CU6A 4M7LL 4X6FA 3VI3F 4HHAB 4JFPA 1JPSL 3QNYB 3BEWB 2XZZA 4IMLA 1DBKL 4GMSH 4OCRH 4L9DA 2Y7QB 3F7YB 3H9HB 2A73A 3MUZ1 5SWSD 1KPRB 3BWAA 2X4OA 4FHBD 3HZMA 3SHSA 3BZDA 1CGUA 1JHTB 4HKZB 1KIRA 4PG2A 1OAUL 4X5XB 2C1OA 5EC2A 1T66C 3KJ4B 1JF6A 2IQ9L 3AREA 5HBBA 1KTLB 1N3NA 5C0AD 2GJ6D 3BPLC 2O93L 4H1LB 3DUHA 3TZVC 3UAJC 2D9QB 4KAQH 3WDIA 4S1RL 1OQXA 4OFKA 3RJDA 1F02I 1T3FA 4DUWA 5K9QG 4U1MA 5H94B 4G8GB 1FZOA 1FGNL 3PNWB 4WUKL 1J88A 2H8PB 1NFDF 1AGFB 2Z8SA 2V2TA 1INEL 2RCSH 3O9WD 4U1JB 4YDJB 1Y18A 1UJ3B 4K3DH 4JRXA 1ZV5A 3NZHL 2B4CH 5DUPH 12E8H 4PD4J 3T3ME 4O02L 3A67L 3H9SB 3SCMA 3D3VA 3T65A 1N64H 4ORGB 3ZTJG 1RZJC 3GSNL 5J3HC 1P84J 1TVBA 3D6GA 3MV8E 1AKJD 4XNMA 2DI8A 1A6VH 5C0RL 4XNQA 1XGRB 3QUYA 3CVIL 1NMAL 3RWDB 4JHBA 4TNWF 3CIQA 4HJGA 1YEEH 2CKBL 1AR1C 4UT9H 3VG0H 4PRDB 4BZ1L 5I18L 5IJVB 3NFNA 4ELKA 5DD0L 1NPUA 5E5MA 1NL0L 3L7FB 5EO1B 4KK6D 2ITDB 4YIQA 3JV0A 1MCOH 2I60L 7FABH 1MF2L 3DROB 3VMNA 1JYNA 4G9DB 3GMRA 5J57B 3RI5K 4OGXH 2XT1B 2FX7L 2GFBA 4HC1H 4NNYB 2UWEB 1VGKB 3ERYA 2ZUXA 4WU7A 5I2IB 1TNNA 1NBYA 3TO4A 4PLKD 1MWAB 2AV7A 1TTUA 3DYOA 3QB7C 1KV3A 4QRRB 4GMSL 4OCRL 2ICES 4WI4A 2F74A 1IAOA 3NIGF 3HI6H 4WHTA 1CDUA 4YE4H 3MLVH 3WJJA 3C60D 2VLKD 4JDVB 5I1AA 3V5KB 1CICD 2ZUWA 3MO1B 4ZTOH 3NCEB 4JPWH 1KNOA 4KQ4H 5EUOF 1WZMA 1C5DA 2EE6A 2IWGA 3EJYC 3Q5OA 1ACZA 2ESVE 3FO2B 3LKOB 1A47A 1NUGA 3ULSA 1S7QA 4ZG1A 4PRIE 1LWRA 4OKVA 1I7TA 4NKOB 1ZKAA 1FZKA 5DTFA 4NIKB 3X12A 1QLFB 2GTWA 3EO9H 3U48A 1EIBA 2HFEB 1I9JH 3B9KD 2N7BA 4FZ8H 1JYXA 3BPLB 3BKCL 2VDMH 4TUKH 4X4ME 3TZVB 4K3DL 2B4CL 1JNHB 5EPMB 12E8L 1FYTD 4PBVC 1TZIA 1U8NB 2VDNH 1YMMA 4FTVA 3JV4A 3WS3B 3OJMB 3EOBB 2CLRA 2FEEI 3K2MC 1CGSL 3QZWA 3SE3A 3BP6A 3VXSB 2VWEE 5F7KC 2FIRT 3CFJA 4NP4L 4KJQC 3QQNA 1KTRL 1PW3A 5J89A 1QA9A 4F3FB 1A6VL 3CUPB 4PLJC 3NBNA 3K80A 4IRJC 1MEXL 5JMRA 3KYKH 4M7LT 1TJIL 3D69A 1JI1A 2VXSL 1E6OH 4RRPA 2YPLB 1JPST 4UT9L 1QUNA 3VG0L 4Z18A 1SMAA 1KIUA 2VITA 2CXGA 4EN3A 2BVEA 1D5XB 1CG9A 3WFDH 1T1ZB 2J3SA 5C08E 5CZVH 1MCOL 1D5BB 3GM0A 3ZDXE 3ZSSA 3F12A 4YBQC 2B2XH 2DLTA 2V9RA 1AD9B 5JHLL 3ZLQC 1JGEB 1XF3B 4OGXL 3C5JB 1E6JH 3KPOB 3NA9L 2YWYA 2V7NB 3RPKA 1FLRH 1ED3B 3O6LL 1TCRA 5H35B 2WBJA 2HT4D 1IKFH 2AKRA 4ZPTB 1F90H 4WUUB 5B38A 4RGND 1UFUA 4V3EB 3VW3H 3LN4A 4DTGH 1SY6H 3G9AB 4R0LA 5BRZA 3RA7H 3QDAA 3R1GL 4OIBA 4WW2A 2MCG1 4ELMB 3IDNB 3HI6L 4KKAD 4YE4L 3MLVL 4YXKL 2BCKB 4WTZA 3RNQB 3TPUE 1V3LA 3D9AH 4JPWL 1EEYB 1P4BH 3RWEA 5KANI 3MJ7A 3OKKB 5CGYD 5EIIA 1S3KH 5I75C 1DVFA 3GMQA 3AMKA 3ZE1E 4QOKD 4ZPVB 1YNTB 1T83A 3BKYH 3TJHC 3DRQB 3BP4A 5D5ME 1NDMB 3FAXA 3HUJF 3CDGB 4ZS7L 1TCMA 5B4MC 4EUPG 2G75A 5EU5B 2EIZA 1BJ8A 5IMMB 4DN3H 3JWDH 2IPTH 3TV3H 5BQ7B 1KLFA 2QADD 4UTBH 1I9JL 5KW9H 4OZGB 4FZ8L 1GHFH 1Q0XH 5C0FA 5IBUG 2ADJA 2IH3B 2VISB 4TUKL 1L4IA 3MRRA 3QXAA 3GJFK 1S78C 3PQYE 1A7BA 2VDNL 2WUBH 4L4TB 5IVZB 2ZUTA 3G5YA 3QEUA 2E7LC 3U9UB 4WFFD 4OB5H 4WDIA 3RWJA 4X7SH 4PJFE 3ROOA 3S4SG 3NVQA 3HE7A 1E4JA 4GW4A 5DHVB 5ICZB 2QL1A 3IDGA 4HX1A 3JTTB 1XGYH 5KG9B 1FG2A 5TJWK 4LQ1A 3QFDA 4RQQA 5IP4A 1MWAL 4M5YH 1ZHBB 3VFRB 5C70A 3O2DH 1E6OL 4BZYA 1T0NA 4EI6A 4PJGA 5JXAH 3IFNH 3HMWH 4HUUB 1KCVH 5H2BA 3VXUE 4YHML 5JIPA 3GJEB 3H9ZA 4QHNB 5E5RB 4GG8A 3DHMA 4KH2A 4ONOA 5FO8A 5J1AB 3PWNB 2Q8AH 1A7RH 5BW7C 4RNRA 1MQ8A 4IRJB 3L3DB 1CE6B 4QGYA 5TE4H 5FECB 3IT8D 2GYSA 4NQVA 2F58H 1WBYA 1E6JL 2CLVA 3OTTA 3PHQA 4F8TA 3MLSL 4KHTL 4AG4H 2JJUA 1ADQL 3RVWD 3WFCL 1R5IB 1FVDB 5M94B 1WFOA 3QWOB 1XR9A 4FQLH 5GGQL 3BGMB 5SX4H 5D2LE 2AK4B 4YZFF 3VW3L 4X6DA 4DTGL 3KPPB 1SY6L 4P3CH 4FNLH 2BSED 2ZSWB 4JQXA 2E6QA 1A3RL 3RA7L 1RJYB 3ARSA 4PGCA 3T3PE 4AL8H 4GRLD 4OZIE 4WCYH 3PGDA 5FGBC 3ARDA 3GSVB 2YRZA 3BZFB 5MHSE 1EVTC 3DGGA 2L0DA 2EC9U 3L3IB 5BV7C 1A9EA 5DD6A 1U2CA 5EU7E 2NX5D 1P4BL 5HPMB 4K3HA 2FBOJ 1S3KL 4XI5C 4P5KB 3VWJA 1DSFH 3MCLH 3BKYL 3BD3A 4MWFB 4OSUH 3S96A 1GAFL 3MOBL 1A64A 5GS1A 5AD0B 5FOJA 1XF4B 4XBPA 5ISZB 3E8UL 2CR3A 2EDNA 3O11B 3WFEH 4DN3L 3JWDL 5I8EA 2NYYC 1U8KB 1ZT1B 5I75B 4HMEA 4LHUG 2AGJH 1X5JA 4GAFB 4PJXA 1GHFL 1AE6H 3PWLA 1F5WA 4MXVF 4P3WA 3JV6A 3RDTA 4NZRH 2XY1A 5EWIH 5KVMC 3PGCA 4P4KC 2R9HC 1I7UB 3UCRA 1XGUB 4I3GA 4MNQA 1CXKA 4PJ5D 3J8F7 3WHXB 3E6FA 5JA8B 3QA3A 3SGJC 4DUVA 2IAND 1U3HC 1IGYB 4J3XA 5F7LB 4X7SL 1EJOH 2DQJH 1DDHA 5M95B 1CXHA 4ODSH 1AGEB 4K23L 4UI2A 4HPOL 2GITB 2HFFB 3FONB 1XGYL 1CFNB 4FXGA 3TT1H 1MFCH 3BH8B 2CMRH 4NQCB 4JR9H 3LKSB 4PUBL 4OUUB 4M5YL 4P57A 3MCKB 5F7YC 2VL4A 3W39A 4Q0XL 3SY0B 4NBZB 4HUNB 4OUOA 3UTTD 3CFCH 5JXAL 4ZNEE 1EX0A 1WWCA 2PYEA 1F4AA 2JK5B 3AVEA 3VFUB 1KCVL 4XWOC 2SEBA 3B9VA 2ICEB 2HA1A 3V6OC 1NC4A 1L0YA 2YZ1A 4UQ2B 5D9SA 2C7UB 3ZHKA 2KUTA 2E7BA 3VXNA 4UT7H 5TE4L 4FQQB 4BQCA 2F58L 5FHAL 3MRIB 1FBIL 4PJCF 1EFXD 3FCTA 1J8HB 5B39B 2FLBT 3BX7C 4GQ9L 4AG4L 1B2WL 2KL6A 2F5BH 4OGYL 1UACL 3O6MH 1R3LB 1GOFA 1HQ4A 5TDOA 3K2UH 3G6AA 1K85A 2ADIA 2WIMA 4H5SA 4XPFH 2HKFL 2BSTA 4JRYA 1O7VA 1OLLA 4P3CL 4WV1A 4UDUB 3LB6D 4LKXA 4WCYL 1N7MH 1U6AH 4ZUUB 2EYTA 1LEKB 2XQBL 3MLYL 2H45A 4N8CL 2P43B 5IF0B 1LGVA 2X70B 3OPZH 5C92A 3RX7A 1OSPH 1DUYB 5KSAD 4EQ2A 3KHOA 5CZXC 4KMTL 2XXCB 1ZVSA 3RKDC 4HS3A 1CQYA 3PIQA 5E8OA 3MCLL 5AUMB 3RZCA 1ERNA 2WWKO 3SDAD 4OCMC 2VLLB 2Y6SC 3GGWB 5EOCL 2W60A 4KWUA 2P7TB 3ZKXC 2NPLX 3AFLA 1N5AA 4JRXE 4XCEB 4R90H 4G6FB 4W6XB 4WEUD 5BV7B 3WFEL 1KC5L 1S7XB 4PJEA 3ARQA 3P9MA 1WC7B 3TNNB 2AGJL 2DN7A 1AE6L 1QVOA 1OP3K 2FJFA 3X13B 4MD4A 4JO2L 2BSSB 4LLUA 5D5MF 4CJ0A 5LAXA 3T0EA 4MSWB 5F71A 3P2TA 8CGTA 4LLVB 4D9LH 1EJOL 2HT3C 5FYJH 4KVNH 3QIWA 3P30L 1AHWA 1YNLL 3DX8A