2ESVA

Structure of the hla-e-vmaprtlil/kk50.4 tcr complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
275
structure length
268
Chain Sequence
SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, alpha chain E
publication title Structural basis for a major histocompatibility complex class Ib-restricted T cell response
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 268
sequence length 275
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2esvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2esvA01
4QOKB 2XA3A 4XP4H 3JWDL 1SEQL 2WUBH 2BC4A 1BQSA 3RUGE 1OP3H 2AJZA 4NQCD 5HHOA 1REIA 5F89A 4DUVA 1FL5B 4KQ3L 3VH8B 5D1QD 1V3LA 4GT7A 1EFXB 3TFKA 3PP4H 4XPTH 5E9DE 4OFKA 2BNRB 1TTGA 4MB4A 2EYTB 4TNWF 4EXKA 3F6IA 5T1DH 6FABL 1RZGB 1FC2D 4ZMAT 5D70H 4PJ5B 4ACPA 3NZ8A 2ESVB 5DJYA 4YDKL 5IVXA 3E1F1 3OXRB 3EDFA 4BSVA 4MA7H 1M7DA 1CFNB 2FZ3A 4OZFB 1TJIL 1PGRB 1C5CL 5FF6A 1NLBH 3FHQA 1NGZA 2H3NB 5F6HI 4KY1H 4YWGL 4CKVX 2GQHA 4KTEH 3H9HB 1TJGH 4NGHL 5IBTL 2E7HA 2GITB 3VXRD 3U7WL 4X4YA 1TCRA 1FFOB 3PWPD 2HKHL 4WWKB 3SE4A 1D9KD 2DMBA 2HVJA 4NWTL 1FVEA 4JFOA 2P7TA 1T89A 4AMKH 3LS4H 1NANI 3PGCA 3N50A 3JWOC 1DQML 2H6PB 3EHBC 4QRPA 4Z7VE 1S5IH 4LMQE 3T3PE 3T4AB 1V7NL 1AI1H 1Y18A 5D5MB 3BVNA 3CJJA 2RCSH 4R2GD 3SKNB 3AAZA 5KVFH 3L1OL 4JKPL 4Y4HB 3C2SA 2C4XA 1IARB 2YEZA 2DQEL 4QHKI 5DK0A 1XGPB 1S7WB 2VKXA 3GJFB 2CUHA 3X13B 2WZPD 5I1KL 2X4SB 1EO8H 5JA8B 4KRPD 3RWCB 3E2HA 5KZCD 4P2RD 3QWRD 1CU4H 3DURA 1R3HA 4OFVA 1KLGA 2QBWA 4WWKC 1KN2H 5CFHA 4KROC 3S88H 4KI5D 3ZL4L 3R0MA 5HYJE 2FNBA 4P9MH 2W92A 5FYKE 1JE6A 5J9PA 5E24E 3R4DA 3MV11 2OP4H 1YMMB 3KDMA 3EBAA 3QIWA 4KQ4L 2E7MA 3U48A 3QNZB 4NQSA 4TULL 5JIHA 2ADJA 4MDIB 1DANU 3P73B 3FKUS 2X4PB 2ADFH 3WFHA 3GSXB 3ULVH 1WISA 4PTTB 3WXWL 1IAOB 3BXNB 4TUKL 3L3OB 1RHHB 2CR3A 4BQ8A 1UWXK 1B0RB 2UUDH 3HZKA 2IGFH 2MCPH 2R2HA 4NQDB 3T0EB 4N8VG 1OTSC 1QHPA 4QO1A 1TVBA 3EOTH 3B9DA 4BFIA 3A6CL 4I3SH 1X5KA 4D0DA 2PYFB 1G6VK 5L6YH 2NX5A 2R2BB 1ADQH 4HG4K 2BNQD 3IJSB 4JZOB 2EDXA 3IF1B 3QJHA 4ZO8A 3T65B 1NGYB 1W8OA 1T03H 4IRSA 3WIHL 2V9RA 1ZHKA 3D18A 4GW1B 3S3PA 3JXAA 3TJHA 4JPWH 3QFJA 3HI1B 1KB5B 4NP4H 1A6ZA 1U3HD 1QPPA 4X4MA 1UJ3A 4Y89A 4NO0D 3MYJB 4GSDL 1P5UA 1P53A 4WUKH 1A6TB 3FQNA 2AQ1A 2JELL 2X5PA 5E95B 3T0EC 4M5ZH 1NC2A 4NRYB 4K3JH 1IGYA 4S2SB 4NO3A 5F96L 3NACH 1QZ1A 4OD2B 3KHOA 2C4FT 1OSZB 2FBOJ 5DS8B 4CRPA 2VLRE 5H37G 1HSAB 2IANB 1JF6A 4KZDL 2W0FB 3E8UH 4P59L 1HINL 1ZLWH 2XZQL 4I2XB 1YNLH 1KIQA 4G3YL 3BGMB 4EBQH 4MAYD 1DQJA 3NBNA 4G80A 1T1ZA 5CGYD 1J5OL 2ADIB 3KLAA 1KV3A 3QAZB 1A1OA 2KPNA 3LB6D 4LQFL 3VA2C 5EBLA 3GZKA 2PKDA 1FN4A 1RIHL 3U82B 4W4NA 1WCBA 5BV7B 2F53A 1QACA 4IRZL 1U8MB 3VFSA 1NDGB 4K8RD 3ZLQC 2B1AH 1FFPA 4P4RB 3RNKB 5GSRB 3KYNA 3LDBB 4OFYA 3ZTNL 4XCEA 5CD5C 1PKQE 5EN2A 3U9UB 2YR3A 1RU9L 5BZWA 4X4XA 4LCWE 4P57A 5FA3B 2DQTL 2AP2A 1IM9A 3S3JA 5KSBA 5IMKA 3BDYH 4JLRA 1ZSDB 1S3KL 3LOWA 2CH8A 3D69A 4TOYH 1KENH 4WJ5A 1JWMA 3HCVA 3CPLB 2CKBL 1ONQA 4N0FA 3TV3H 4PV9A 4MCYA 3JVGA 5SX4H 2P49B 4JKLA 2PR4H 2R0WH 5BV7C 3SPVB 3WFCH 4D8PA 1MIML 2BCKB 1IQWH 5CP3A 1GC1C 5I1EL 3B83A 4PV8A 3SKMA 1RULH 1J0YA 1VGKA 4N5ED 1F4XH 1YYLH 4X6DA 5BJTB 1TMCB 3O0RH 4MHHG 4YHZL 2ENSA 3LDBC 4HCRL 4EI5A 5T3XH 2NLJB 4R7NA 4ZAKB 4M5YL 3ZTJH 1BVZA 1UH4A 3MTRA 3JWDC 1KNOA 3IDMA 3EFDH 4HUMB 5EU6E 4ODHL 3P2TA 3Q3GA 3OV6A 3K0WA 3U0PA 3WE6B 4XPFH 3KPPB 3INUH 3CH1A 2J4WL 1ZA3B 2WINB 3GMRB 5SWZD 3VH8G 2WBWB 4O02L 3WHXA 3MFFA 4PLNC 4U3XA 4P2YA 1P9MC 5IMLB 4I0KA 1DLFH 1UH3A 5EOCL 4V1DB 1A8JH 5F88A 1S8DA 5D72L 4MNGE 3WDJA 4Y5VB 4LHUB 3KLDA 5GZNC 1MWAL 3WNLA 4F7MB 2I9LB 2OJZL 3O6KL 4WTZG 4E0RB 4HBCH 4FFYL 5CILH 3P0VH 1K6QL 2NCMA 1KIPB 1VEPA 2QADC 1A4JB 1YQ2A 3BUYB 5FGBA 3N85L 1QUNA 1KPRA 1RZIA 5GGRY 4ZAKC 1T04A 5CCKL 3CMOH 2R0ZH 2BVOA 1RQ5A 3GO1L 3HUJB 3RFZC 1WUNT 4HKXB 5F9DC 5KVGH 4NQVA 4XCYA 4FQ1L 2WK2A 2AXGB 1BD2A 4KGLA 3QG6B 3BO8B 2K1MA 3FO0H 4WUUB 2X10A 2F5BL 1T7WA 2R23B 2IWGA 1AFVH 4JDTH 5K9KA 2DI9A 4ZYKA 4OZGA 9CGTA 5JHDB 3ULVE 1CG9B 1F4WL 3QXDA 5DUPH 3TPUE 3I6LD 2QQKL 1L9NA 1RUPL 4M7LL 5BZDB 2BOBA 3QQNA 4ODWB 3MNVB 1A4KA 4QGTA 4ONGH 4P23C 4A6YH 4AT6A 2VN7A 5IB5A 5HVHB 4JO1H 5GS1A 5DWUL 1DR9A 5CINH 1N7ML 1R3KA 3LEXA 3GHEL 5FHBL 1T2JA 1LP9F 2BFVL 2DM3A 4PJXA 4UTBH 15C8L 1J0IA 12E8L 1GIGL 5JLZB 4E42B 1NMCB 2W60B 1W8NA 4ZUTA 2FRGP 3SBWC 1ND0B 1MJ8L 1H3GA 2XKSA 3MXVL 1BBJA 4FQCH 3D2UD 4X7CC 5CGMA 3FOLB 2NY5L 4P2QE 5IG7B 5SWSB 1I1YB 4DEPB 1WBXA 2F54D 4UT7L 3MV01 1K8DA 4JGMA 1FE8L 1NAML 4ELME 1EZVX 5I71C 4CVUA 4PY8I 2JCCE 3GRWA 1UXSA 1BWWA 4OCYH 3JV5A 1RMFL 4WI3A 3RDTC 3VGFA 1I1CA 5HYSB 4B41A 1BAFH 2C3HA 1QHOA 4J4PC 1BHGA 1NEZG 1HZHL 5DXWA 1JNNL 4U1LA 3LRSA 1MLBB 4ZSOB 3CX5J 3ZE1E 4GH7B 2A6IB 4DOHB 1MFBL 2VL5A 1NMCC 2FX8H 1TXKA 1I8KA 4TNVK 4OV5B 2PW1A 4AJ0A 1RJLB 3BN3B 4BK5A 4P9HC 4XNZB 2XQYG 3PWNB 1XZ0B 3QULB 4X8XA 2BNUB 4DEPC 1CICB 2ICEB 1UZ6F 2IQAA 4OLZH 4HHAA 4MGXA 5CJOL 4WFGE 1BBDH 3VWKD 1LEKB 1P1ZA 3EYFB 4Y16A 2DKSA 3MLTB 2AXJA 4PR5A 3C5JA 2W0LA 3IDUA 1H9VA 3RWGA 3L3KB 4RBPK 3TNNA 3EZJB 3ZDZF 1FORL 4KHXL 2XV6B 4P49A 4RGOL 4UIKL 1GGTA 4PP1D 3U4EB 3CCHA 4NM4L 3GIVB 3MOAL 5AYUL 3LHPL 1FH5L 2Y7QA 1HEZB 5E9DD 1MVUB 3FQUB 1EEZB 4U1HA 3FO1B 3PDDA 4YHOL 3LEVL 4LVNB 2WBJC 1OM3L 5HVFB 1FNEA 3VFUB 1KPUA 1I85C 4XNZC 4OTXH 1U95B 2CKBB 3F58H 1YDPA 4NHCH 2I25N 2FLRT 3IDGB 4UZGA 5FCUH 1CICC 2PUQT 4MLSA 3VGDA 3S98A 25C8H 4HKZB 5GHWL 1D5XB 4GMSH 5HHXL 1RV6X 4R8WL 2F58L 2N7BA 1KCKA 4HJJH 3ALWA 4MD5A 4EXPX 3TO2B 2VXUH 4U1IA 3DO3A 5T3XE 5IMMB 5EIQA 1Z9LA 1PAMA 4PJ7F 5EU7C 1A7OH 3LEYL 2D3VA 3R1GL 1MI5B 3QIUD 2VDKL 4QRQA 3LMJH 1XGTB 1WBZA 4KTDL 1Z9SA 3WNPA 1J0HA 5DD5L 4F2MB 4LVNC 5CEYB 4X6CE 3VXMB 1KACB 3CUPA 1V7MH 4YHYC 3DVFA 2H8PB 3F7VB 1T3FA 1YJDH 1VADA 2P5ED 1MCEA 3LH2H 3SE8L 1EXUB 5EO0B 3FONA 2ZUSA 4QOKA 4LAJH 1MWAB 2DTMH 5I0DA 2FYYA 3S36H 3ULUH 3PXHA 1IQDB 4PJHE 2OI9B 5MHSE 3DPBA 4KZEH 4O9HL 4JHWL 3QUZD 2JIXB 4TQEH 1EMTH 1FL5A 4HUNB 4D9QE 4N0UA 4P46D 1YECH 3KPQA 4O4YH 1EFXA 3FN0L 4APQB 3MRCA 3V0VB 3GMLB 2ICCA 3DARA 1CDCA 4CGTA 4JG0L 3L9RB 4GW4B 5T33L 3C5ZB 1AR2A 4PJ5A 4HKJB 3K8KA 4L8SB 2DWEB 3LS5L 5C0ND 1SY6H 1A5FL 3O11B 4DZBB 1CFNA 1I1AB 4J6RH 5I16B 4FZ8H 3H9HA 3ZKND 4UTAH 3WBDA 1FG9C 4HJ0C 2OI9C 3PWLB 3MLWL 5DVKA 3EKCA 2BHZA 4WWKA 5CZXD 3B5HA 3DTXB 3KPLB 1YEIH 3WO4B 2CO6B 4NQTA 2NW3A 4UQ3B 5K9OB 3CXHJ 4ODBD 3RY5A 3VFNA 1ZVSA 3I75A 1BOYA 2EE2A 2DTSA 2VXSL 3IDYC 1XAUA 4UB0H 5D5MA 4APQC 1RFDH 3SKNA 2VE6B 4DWHA 5CP7B 2EECA 4MD4B 3TN0D 3UTTB 1LK3L 3C5ZC 1WICA 1JK8B 2FSEB 3MCKB 5E70A 5LXGL 3GJFA 5FAAA 4GUPB 3X13A 3DWTA 2IQ9H 2BRRH 2X4SA 1FZJB 3MRHB 3BN9D 1I1AC 2AJVL 3CFIC 4PJEB 4MNQD 4KHTL 4LL9A 1OAUH 1EAPB 5DLML 4M1DH 3SHSA 4JPVL 3WKMH 5TE6H 5L88H 1DBJH 4M3KB 4OZHB 2DQIH 4OLWL 2BSRA 1K2DB 3IS0X 3FTGB 3WO4C 3SDCB 2YUZA 5E94B 4QRUB 3GMNA 3PJSA 2F54A 1FIGL 3EDEA 3T8XB 4MDIA 2CPCA 3P73A 3HI5L 4RDQF 5HGDB 5FM5M 3VDAA 1V05A 2AV7B 3L3OA 4PJ9B 1S7TA 2HAZA 4NCC1 2APWA 5MEOB 1A22B 1Q9WB 1UKTA 4NYLA 1BM3H 2Y9RT 3GK8L 3W9EB 4M6NH 4NQDA 3T0EA 5I30H 3P9WB 3TWCH 3ETBF 3MV9A 2Q76B 4XNXH 4R7DB 4XHJD 4XX1G 2AK1L 4HXBH 5EO9B 5CIPB 3ARDC 1RD6A 2QEJA 1C7TA 4UOW0 2PYFA 1NMBL 2ZOKA 4IMKC 4M7LT 1OWWA 1QYGH 2R2BA 3M45A 2NTSP 2XY1A 1A7QL 3I50H 1BMGA 3AROA 1RUAH 3IF1A 4LCWD 5EU5B 5TFSH 1NGYA 5T1LD 1S7RB 3BKCL 3NA9L 5T5NF 1Q72H 5HJ3B 4KRMB 1MF2H 3ZKSD 3RVTD 2K7QA 4GOSA 1BD2E 1FIEA 1I3VA 1KB5A 2EDWA 4NO5B 3TM6A 3D6GA 4GRWH 4PJ9C 4U2ZA 5J13B 4MJ2A 5ICZB 1CDYA 1I1RA 5IQ7L 3MYJA 2NY1B 5BMFH 5JW4M 1J18A 2KZWA 4Z7UB 1CLOH 3SDDB 3H9SD 5LJYH 3RP1A 3V0WH 3O3AA 3UEZA 4CMMB 3BKYL 4M6AA 4CUCA 4OD2A 3O6LH 5IKCB 1OSZA 3OBAA 3K80A 4YHIA 1F6AA 5GGRB 4ETQB 3MROA 1HSAA 2GJZB 2IANA 3T2PA 2W0FA 4RAVA 3HI6H 3TJEH 1QFHA 1XH3A 4I2XA 1W0VA 4O2CB 1AE6H 4OFPA 3BGMA 3VE0B 5DFVC 5FECA 2G2RB 1A7PH 3MBEB 5BRZA 1W72H 1QKZL 4JQIL 1JPTH 3BT2H 1G9ML 3OGOE 1FLRL 4MD0B 5IEHB 5J13C 2HP4A 3GI9L 1U8MA 2NW2A 1N0LA 4OGYL 2NY0D 5FV1L 1NDGA 2NY1C 5F9OL 3TZVD 1E28B 4JHAH 4YXLH 3SDDC 5CMAB 4BH8B 3QIUA 3MRPB 3U9UA 4O5LL 3OG4B 3ZE0E 2BMKB 4EOWH 1VCAA 4KRLB 5FA3A 4WI5A 2W91A 1RZKL 2P5EA 1JI1A 5DJ6B 2A0LD 4S1RH 3C6LD 3AU1B 2B4CH 4ZUVB 3P0YH 5ADOH 2MTPA 3WNMA 5DQJA 4WGWB 2ITDB 1NFIB 2F19H 2V2XA 2F5AL 4FHBD 5INDB 1J1OL 4YQXL 3MBEC 4G8EB 1RVFH 1HHIA 1UCTA 1PX4A 1FNFA 1T21A 2D4FA 4O58L 4R4FL 3SPVA 5JO5A 3IDXL 4BQCA 4P46A 1LEGB 2EXYD 2BCKA 5DRXA 2FJHA 4LMQI 2WANA 4M7JH 3ULVD 4HXAL 1H8NA 1H15B 3LPFA 5CHNB 4OGXL 3T0DA 3F65A 5KANG 4ZAKA 2A6JA 5E8PA 1EVTC 1VACB 2AW2A 3CZJA 3P4OB 1JFQL 4N9GB 4HWBH 2YK1L 1QFPA 4J3OC 4NN6B 5TJWK 2ZSVA 3DGCR 4X83A 3O6FD 2R56L 3BSZH 3PQYE 2WINA 5I66B 1EUTA 3V4VL 3GNML 1MFDL 4HPYH 2B2XH 1N3NA 4WDIA 5FYJH 1A0QH 1AO7D 3P9MA 1LO3H 5IMLA 3W5NA 3G6JF 4JVWA 2Z92B 2HT4C 3Q5TA 4LHUA 3NZHH 3MJ6A 4S0SD 4F7MA 3ESVF 3QHFH 1AH1A 1Z6JT 1T7YA 1O7SA 3O8XC 3S35H 3W5MA 1WZ1H 1B6UA 1Q1JL 4P23A 1LQSR 4HIXL 2UY6A 4EDXA 3RWIA 4LLUB 4MWFB 4OQTA 1ZXQA 3HUJA 3AY4A 3PWVA 4OIAA 3WUWA 5ACZB 2CGRL 2UZXB 5DJCB 2AXGA 1PQZB 3KPRA 2GTWB 1T22A 3QG6A 4PJ8C 3U1SH 3VXOB 1F3JA 2R29L 4BQ9A 3BYTA 3SBWA 3QH3A 1UEYA 3IFNL 3WIIH 1UH2A 1C7SA 2NZ9D 2P24A 3HPJB 4I1NB 1BX2B 3OAUH 1CG9A 3E3QC 3S4SA 1WSST 1CFQB 5T1MB 3QPXH 4Y8DC 3G08A 3KXFE 3P77A 1TQCC 2WBKA 4M4RA 3MNVA 3RDTA 3HZYB 2DL2A 4TUOA 2JK5B 5EZLB 3OKYA 4WFGD 2Z35A 4J4PA 1MAMH 1JGUL 4Z77B 1O0VA 3CIQA 1OT1A 2H41A 3RBSA 4NZUH 5J4MA 3L3DB 3MLPA 4NC1C 2GAZB 5JLZA 3C9NB 2LTQB 4E42A 4KQ3H 3K1KC 2W60A 2Y5EA 4QTIH 3GSQA 4TTGA 1BZ7B 1ND0A 4FXKA 3WIHA 5GSVA 3CFJB 3FOLA 2BNRE 5IG7A 5SWSA 3KPOB 4LKCB 4LSVH 4HFUL 4ZUWA 4J2XA 4X7TA 3GFUA 4AL8H 4KKBD 5H35A 5IUSA 3OKMB 2ESVE 3MRKA 4XVUD 3HZMA 1KCUL 3MFGB 2Q8BH 1Y6KR 1A6AB 2GCYA 5JPNA 1TJIH 1C5CH 4R3SB 4PJAB 5HYSA 1JNLL 4KUCD 1PG7L 3NIGF 4DKDC 3MRLB 3U7WH 5HDOA 4XCCL 5I1AA 4PGCB 3QT2A 5T3XD 4ZSOA 2COQA 1MHHA 5ETUA 2LTQC 4DKEH 3CXDH 1DQMH 2WBJA 4XB7A 4Y4FB 1U91B 3HE6B 4G6AC 1V7NH 2VDLH 3U79A 1IKFL 1RJLA 2A1WL 4UDTA 2C26A 5DRNB 5EU4B 4BFGA 1I85A 3JSSA 2D0HA 3PWNA 1FPTH 1XZ0A 4GKNB 4JKPH 1BZ9B 1QFUL 5L2KE 4RQQB 1CICA 4LPYA 3L3IA 3Q48A 3MRDA 5J06A 4NNYB 3AS2A 1RZ7H 4YPGB 1DANT 1L9MA 1Z2KA 2Y23A 5ANMB 3W2DH 3MV8E 1LEKA 4YHNB 1GOGA 3MRIB 4ISVA 5GGVH 2DIBA 4D0CA 1I3GH 2IFFH 4WEBL 5D7SL 3L3KA 3OKEB 5LGHL 5JW3L 2AGJH 1ZA6A 3UTSA 5F8RC 3EAKA 4X4ZA 3P0GB 4D9QD 4HAGA 3OAZH 2P1YA 3K2UL 2WIIB 1MNUL 5IB4A 1CXLA 1U8JA 2R9HD 1MVUA 3B2VH 1EEZA 3EJZC 2RFXA 3P30H 5FUZL 4JY4A 4OKVA 1YMME 5C0EA 4DJMA 4Y4FC 3HE6C 1BQHB 3AMKA 3BP7A 1SJEB 4KQ4H 3VFUA 3L5XH 2Z8WC 2DQHL 3ROOA 3EDJA 1IC4L 3I2CH 1RUMH 3HMWH 1JZ5A 1F4AA 3T0WA 3WXWH 4F80A 3DI2B 4HKZA 3FQRB 4GS7B 4TUKH 1CLZL 1D5XA 5EC1A 4S1QH 5LAXB 3VI4F 2NTFB 4H1LA 5CWSB 4GG6E 3C2AH 1U8NA 3TO2A 5EC2A 3LN4B 3T0EE 3O3UN 1A6VL 3QCTL 1N8ZB 3OPZH 5D7IB 3A6CH 4YDIH 4OAWA 1FDLL 1INDL 4X5XA 4UT9L 8FABB 3EGSB 4OM1L 1MI5A 4QRSB 2P4AB 1RZKC 2UYLA 4U1NB 1LP9B 3QDGB 2EO1A 4NZRL 1PDKA 5FYJE 5K9QG 3GDBA 3F7VA 2ERJB 1JTOA 1UVQB 1EXUA 5J6HA 4L29B 3OKDB 2G75B 5E6IB 3IAPA 5IVNA 3RTQC 1KT2A 3JUZA 4GS7C 3QQ4A 2ITCB 2OI9A 3MJ9A 3U46B 4M43H 4OI7A 1KXVC 2I5YL 3B8YA 5GISH 2JIXA 2G9HA 4GSDH 5CJXC 5C0RL 1AO7A 2JELH 5AWNL 1K5NB 3O3EB 4HGMA 1DUYA 1CVRA 3GMMA 3KLSA 4PJDB 4APQA 1Q9KB 3GMLA 4OGZA 2W59A 3EYUL 2OM5A 3C5ZA 2YPLE 5LGKA 3DUUB 4RX4A 3QHTC 2OCFD 2XZQH 5DTFA 3V79C 4Q7DA 3BH9B 2DWEA 4X5LA 1I8IB 1J8HE 2ERJC 4DZBA 2FWOA 4P3CL 3HLAB 2X41A 1CK0L 5E6IC 5TQ0L 5I16A 1JPFA 3BMWA 4Y5XB 3TLRA 2AJSL 4IRZH 1YEHH 5L2JB 2EZ0D 3KNBA 1MCSA 1IGCH 5IIEB 4UNTA 4AG4L 2OSLA 4MX7B 2XWBB 4Z76B 3G6DL 1FNLA 2ADGA 3IXAA 5K9OA 1FO0L 3ZTNH 4URTB 2ID5A 1IAIM 5C6PB 3DSNA 3RUGF 2VUYA 2VE6A 5CP7A 2IPTH 1OTTC 4LGRB 2DQTH 1X4XA 4MVBD 5INCA 2CJUL 3ARGD 3IXTA 4FQXD 1G7PB 4OIBA 1JK8A 2FECI 4X8JB 3MCKA 1S3KH 3O2VL 3UTZB 1CTOA 1T5WB 1NCCH 1FYTA 1AKJA 1I4FB 3OJDA 3TF7C 1WK0A 5GRXG 4W6WB 5C0CB 1B3JA 1XGQA 2BXZA 2FIRT 4QY8A 4Y5XC 1CLYH 1NGQH 1MEXL 3ARDA 5AUMB 2WNGA 4RMUA 2VUOA 5I1EH 1I9RL 3T0VA 5CKAA 1OPGL 4DVBB 4XVSL 1ACZA 2R0KL 3G6AA 3WS3B 1QA9B 2DN7A 1F2XK 3T8XA 4AEFA 1PX3A 3SDYL 4AM0A 4ODHH 1IILE 1SYSA 3RWDA 3VGBA 2DWDA 3FFDB 1MQKL 2Y6SD 3HG1B 5HGDA 2XRAH 2FD6L 4JO3H 4UILH 5HI4D 3TESA 3L3HB 5FB8B 4PJ9A 3MGTA 3AM8C 5LWYL 1KN4H 1KCSH 1Q9WA 5E5MA 1X9QA 3TH3T 4V1DE 4JY6B 4S11A 5EOCH 4YIQB 2UV3A 1NCUA 3FT2B 1MWAH 2ILLA 2OJZH 3O6KH 4KK5D 5CIPA 5EO9A 5A3ID 4YFEA 4L3EB 2MMXA 2FX9H 1T1YB 4S1SH 4ODVH 4HF5L 1TZGL 4QHNB 3ULUD 1T4KB 4L4JA 4UI2A 4UU9B 5EU5A 2D9QB 2P8LB 5SX4I 1S7RA 1NH6A 1CDJA 2NR6D 3GO1H 5D7LB 5HJ3A 5ITBL 3O3BB 4BJLA 5DVNA 4H20L 4FQ1H 1HILB 4NO5A 4PRBB 5AEAA 2XWTB 2PTUA 4WUUE 4MS8C 5C0DB 3DX9B 4PJBB 1BFTA 1YPZB 3UO1H 1CGSH 3B9KC 3ZSSA 3FQXA 4JFHE 4Z7UA 4DUXA 1E6JH 2PO6D 3SDDA 5JHDE 5T1KB 4BK4A 4CMMA 1UKSA 4JFYB 4F9PC 1F4WH 2X4NB 3VRIB 2XICA 4B50A 3V4PH 5IKCA 5MEQA 3FB7B 5C8JB 3QI9C 4ETQA 2EKJA 1RUPH 4M7LH 5E99L 5F3HB 4JRYB 1MIEL 3CFDB 3DLQR 1PSKL 3ZHDA 1HHHB 3HRPA 3B3IA 4O2CA 1QOKA 4N8CL 5I9QB 4EUPB 4WHTA 5DWUH 2DQJL 1N7MH 3BEWA 1NAKH 4TTDD 3V52L 3PQYD 3MBEA 1B4JH 4XPAL 2IPKA 3BRDA 1GIGH 1OLLA 3D3VB 3OR7B 5IEHA 2AK4D 3EW3B 3SO3B 4G6ML 1MJ8H 3MXVH 1WWBX 2VLJB 1E28A 1CFTB 2NY5H 3D1MC 5E0QA 5CMAA 1QPXA 4QNPE 3D39B 4UT7H 3FT4B 4XX1E 1FE8H 1NAMH 2BMKA 2ZUYA 4XRCB 4U6XA 3O6MH 2VR5A 1B9ZA 2GT9B 1KCVH 1E4WL 3HE7D 3IRZA 5B3JF 5I9QC 5JXEC 3CFBB 3MRNB 5EIIB 1J86A 4YFLF 4W70A 1MCOH 2A77L 3C8DA 1MH5B 3QUYD 1WC7B 3B9AA 4DOHE 3MRMB 3R06B 4LVEA 1MFBH 3O45A 4ODUB 1YUHB 5E2WH 1LEGA 4P3WA 3SO3C 2Y5TB 4LRNL 4PJIB 4U0RB 2EDKA 2Z4QB 4U6YB 3O8XA 1FZKB 1MLCB 3BESR 5EBWB 5KN5A 3VD5A 1F42A 1VACA 3KXFD 3FHAA 1YNTB 4MXQC 4N9GA 2NY7L 3ZHKA 2IG2L 3L3JB 3OF6A 3O2DL 2OR7A 1H0DB 5IM7A 5I66A 4PJ8A 1FO0B 4X9HA 4LIQL 3RVXC 3WHE1 1GGYA 3K2MC 5E8OB 4RGOH 5GJTL 1MCRA 3SGDH 5EU7E 5I15L 1W0WB 3TO4D 3RAJL 4KK8C 3VXTA 2Z92A 3G04B 1INQB 1LO2L 4GKZB 3E3QA 4ZD3H 1N5YH 5IW1B 3WD5L 1HYRC 4XCNB 4ZS6C 1OM3H 3OXSB 3RX7A 4U0RC 4OF8A 4RFNB 5F9JB 1OF2A 1VB9A 1M05B 1WZLA 4KH2A 3T2OA 1G6RB 3BFOA 2ESVD 3P11H 4L9DA 2OMBA 2DM4A 5GHWH 2A6KB 4G59A 2ATKA 2NY4B 3MCLL 4JRXB 2WSKA 1MFAL 3HNTL 4NBYB 5HYEA 5DJCA 3RVVC 3HB3C 4ZTOH 1NSNH 2VDRH 2GTWA 3VXOA 4ZTPL 5AYQA 1OVZA 1YEJH 1AQKL 3B5TA 4D9RE 3D87B 1CE6B 5K59E 1JYXA 1MRDL 4WU5B 1IGJB 1OL0A 1CXEA 3R1GH 3HPJA 3QCVL 2EDBA 1CFQA 3SOBH 2E7BA 2NYYD 2YXMA 5DD5H 5T1MA 5IP4A 4Y4HD 3VXME 4JM2C 3O4LB 2R1WB 3ILQD 4RFNC 5L2KD 1FNSL 2H32H 2HTKD 4JDZB 4O2FB 4JQXC 3VI3F 2E7LC 2GJ6D 4WFEE 2NXYD 4EN3B 3HZYA 3SDAB 4HGWB 3V5DB 5D6DC 2JK5A 5EZLA 3MV8D 5ENWA 4FG6C 4HC1H 1QRNB 4WO4D 4G6KL 4Q2ZA 4O9HH 3MJ8A 2EE3A 2V5TA 1UWXH 3DMMD 2JJUA 5EOCJ 2P46B 5HGHB 2E5EA 1QSFE 4HZLA 1BVKB 3SJVA 1T5XB 2D7MA 5EWIH 3H8NA 3E6HB 1EPFA 4JO4L 4YHPB 1BZ7A 5HHME 3FN0H 2BXYA 2J88H 2VQUA 1HK6A 2Y06L 4N8VA 2WQ8A 3HC3H 4LKCA 3C5SA 3CVIL 1YZZA 5DDHB 5T33H 3DGGB 4AYFA 2X4TB 1OCWH 5DK2B 3OKMA 5F7LB 3LS5H 32C2B 4JKMA 3HC4H 2PYEB 2HWZL 2XA8H 4LEXL 2OL3L 3FMGL 5DJAA 4MA3B 4TRPL 3SDAC 1TFHA 5GGQH 2OK0L 3N1GC 4R3SA 1CL7L 2AI0H 2YC1B 4JZNB 1Z3GL 4PJAA 5GRUH 3MXWH 5I1JH 4DK3A 3LZFL 2VABA 1PBYA 3MRLA 2VL4A 3F12A 3VXUB 35C8H 4LLDB 4PGCA 2O61A 1YNKH 1P84K 2MOVA 2QQLL 4CL7A 1WWAX 1BLNB 2QQQA 2I27N 2W1NA 2PO6A 1FSKB 3QUMA 1JZ2A 5JNYB 4Y4FA 3HE6A 2VXSH 4IOFD 3PP3H 1UA6L 1YYMH 4GKNA 4DZ8B 2AABH 3UTTE 4RQQA 4K7PY 4F7EA 2VSDA 1BP3B 2EXWC 5FYJD 1ZHBA 2OXGA 1A14H 4NNYA 1DVFB 4LLVA 2CK2A 5I2IA 2MQ3A 5J7CC 5HI3D 3TT3L 1YY8B 1GVIA 1A3RH 4NO2B 2R1YB 4YHNA 5C07E 1SBBA 1VFOA 3MRIA 4FFWC 1Q38A 5DZLA 4IDJL 3TT1L 4PJEE 2BOCB 4MXWL 3OKEA 5E6YA 3MQIA 4JO2L 4KC3B 1FBIL 4KK6D 5IVXF 1N2RB 3C09C 4YEFA 1DN0B 4OZHE 1FL3A 5BOZG 2WIIA 5AD0B 1GSMA 4OLWH 1S9KC 4HZAA 3SGEH 1VHPA 1FSKC 2IH1B 1G7HB 4YPJA 2LU3A 4PP2A 4ZUUB 4XHQA 2YPLD 3HAEG 3V95A 1M7XA 4WEUD 1GGBL 3TBYA 3RTQA 4M48L 4LSDA 2VXQL 1J8HD 2AKRB 1DVFC 3FQRA 3P40A 4R0LA 2DOCA 2Y25A 5LAXA 1U3YA 2GFBB 2NTFA 5CWSA 2VLKE 3MCG1 2YPKB 3KJ6H 1MCPL 5CJXA 1B0GA 4PFEA 3BJLA 3GK8H 3PF2A 1ES0B 1KGCE 5L9DL 1NFDB 2MQCA 5GS0H 4XWOC 1N8ZA 1OTUD 2AK1H 2X1XR 3TIEB 1UXWB 4OCLC 8FABA 3UAJD 2IF7A 5LVEA 3F7PC 3MV7D 1A9EB 1A7QH 1ITBB 2FATH 2VDOL 3ZDYF 1JPSH 4U1NA 5DA0B 3QDGA 3RI5F 5E08L 3FN9A 5LG1A 3VFGL 2AEQL 1KULA 2YBRA 1JZ7A 5FK9B 3RGVB 4L29A 4EIGB 3G5YB 5JW4R 1IVLA 1CE1H 2VTFA 4NJAL 3RVWC 3U46A 3QISA 4RDQG 3WFDH 1QEWA 1S9WB 1AIFA 4Q97A 4JDVA 2J6EA 3SKJL 2YD1A 5HDQL 4G8GB 4I5BB 3MUHL 5HGBB 4JFFB 2Y4SA 3VWJD 2W9DL 1X5ZA 3IDJA 3BKYH 4PJDA 4EDWL 3FZUC 4YGVB 2BVTA 3BP6B 3IS1X 3LKPB 4KTYA 2OS7A 1EUUA 4ONHA 1TPXC 4P0DA 3ERYA 1BZQK 3DUUA 4NJ9L 4MHHI 3D85A 2PTTB 5KSAB 1FZMB 1RIUH 1I8IA 5I17B 5DFTA 5EULV 3BP4B 1C08A 3TF7A 4Y1AB 1QKZH 2CDEA 3RGVC 4EKXA 2XTJB 3PHSA 5FA4A 4MJ6A 4C56E 4I0CC 1S7XA 2NPLX 1CD8A 1I7ZB 1G9MH 5D2NB 4Y5XA 1FLRH 5T5NG 4V1DD 4HGKC 5CBEB 2DI7A 3IFLH 3AS3A 4WIQA 5DZNA 5FIEA 1UM6L 3IAGC 3FQWB 4R26L 3VG0L 4UAOB 4KJWC 2CUMA 1JN6B 4O5LH 3QPQD 1HXMB 4L4TB 2FB4H 3NFNA 1QFWL 1A6UL 4XP5H 1W72A 4UQ2A 4JANB 4MJID 4U3HA 3FB8A 2QQNH 3UJIH 4DN3H 2GJ6A 1ZGLP 1G7PA 4E41A 5KSAC 1OGTB 3NCYP 3QG7H 4K7PL 3BDBA 1FG2B 1T5WA 1Z9MA 2F5AH 4XVTL 4YQXH 5DMGD 5ACLA 3TEUA 2XTJC 2ORBL 3MZTA 5ISZB 1AC0A 4YR6B 4V3DB 3WXVL 5D2NC 5B39B 5JDJA 4O58H 4R4FH 2CKNA 4XPHH 1JV5A 5AUMA 4PGJA 5JHDD 4R9HA 1DBBL 4DVBA 2OL3B 4HXAH 4U6TA 1WTLA 2DYPD 4UAOC 3B5GA 4PLKD 1AY1H 2NY6B 4JFEA 3WS3A 5T3ZH 4JFDB 4C57C 2ZPKL 1WITA 2P5WE 3KPMB 2YZ1A 1IC5L 4NRZA 2WMPA 3GGWB 5JQ6L 5MEND 2R56H 4MA8H 2DS4A 5SWQA 5GRVK 3L3HA 3LKRB 3I84A 5HDBE 3V4VH 5A1AA 4MS8A 2BVQA 3GNMH 1QR1B 5IJKA 1MVFA 2BHYA 1YEGL 4N0RA 4BZ1L 3B9KA 3TYFB 1YEKL 4LCYB 4M8VA 2HTLC 3MLYH 4JY6A 2YD5A 4HSQA 2ZSWB 4LPXA 3E3QE 4WTWA 5KSBF 5F1NA 3FT2A 1GGCL 1ZV5A 4LLQA 4F9PA 3GJEA 1NEZA 4KUZL 2A73B 1XF3B 2AXHA 5FOJA 2CLZB 4L3EA 1T1YA 3QI9A 3TA3B 2R2CA 5J12C 4ZUSB 1DEEB 4RGND 1XGRB 3ARXA 2FEEL 4Y4KD 3LVEA 3FO9B 2DLTA 3AC0A 3VFWB 3KPSD 3ALXA 3V7AG 4UU9A 3S36X 1B0WA 2B5IC 1XIWD 5E1AA 4LLYB 1X5HA 3ILPA 1BQUA 1JP5A 5A43C 2X9WA 4PRBA 1AQDB 4RBPH 4UT6L 5C0DA 1VGEH 1KCGC 1S78D 4PJBA 1YPZA 4HQQL 3QHZH 4J3UA 3X3GL 2V5YA 5AAMA 3HPLA 1XCTB 3OHXB 2OTPA 1Q0YL 5TPWL 4OF0A 1FGNL 4OGAC 1IL1B 3VGAC 3LV3A 3VFPA 3CSPA 1ZHLB 5F72S 2WW8A 3NA4A 3VFOB 3M8OH 3QDME 5DEGB 3VRIA 3REWB 1GHFH 1MY7A 1O7VA 3FB7A 3N9GL 1T2QL 2FBJL 5EA0L 1I75A 1UYWL 4LKXB 5HPOA 5FDWA 5AZ2L 3TBVB 1CQYA 4JRYA 3CFDA 4JGJA 4QHMA 2Z8SA 4IOIB 1HHHA 4EUPA 4DUWA 1S7VB 5JXEA 3HR5B 2H2PC 2XQBL 3KPNB 4UOJA 3QEHB 1ZT7B 2F9BT 2ZKHH 5IFJA 3IFPB 2XN9E 1KUMA 5EZJB 3SN6N 3OR7A 4PS4L 5KSUB 3LPGA 5F1IB 2AS5M 5KJRH 1L7IH 3BI9X 3F7YB 4P4KD 5BS0B 2OTWB 2VLJA 5IR1B 4OI8A 1EK3A 1CQKA 4GAYB 4ZFZB 2IBBA 5J3HC 1XF2B 4Z7WA 3KYOB 5HGAB 3D39A 4J1UB 3VJ6B 4MCZB 1DQLL 3TYGL 3MV7A 4X7DC 4HFUH 4LSPL 4LEOB 1ED3B 3H0TB 3BWAB 2NXZB 4MXQA 4NNXA 4E9LA 5KTEH 4RAHA 2J8UB 1KCUH 5ADPL 4OZGF 1X6NA 3VW3L 1Y0LB 3QUXB 1PG7H 3CFBA 4P5TB 4AIZB 4U6VL 1LMKA 3ZZ1A 4OF7A 1S7SB 5EIIA 3GSNL 4OLXH 2VDPL 4Y2DD 4HH9B 3O81A 4D9RD 4FTVE 1KLUB 3WCYA 3R06A 3UYOD 4ODUA 1YUHA 2DQCL 3GSUB 4PJIA 3LKNB 2Z4QA 4R90L 5IJVB 1OP5K 1MLCA 2DLHA 1HH6A 5EU3B 5EBWA 3B43A 4PJXF 4C58B 5IB1B 3KLHC 3BKML 3VXMD 4HKBB 1KPVB 2DB8A 2W65B 1HOCB 2WAHA 1YEFL 2AJXH 1JWUA 1YNTA 2NXZC 4WFED 2MSPA 4OLVH 5ANME 3LN5B 3L3JA 3MJ7B 3UX9B 2XI9A 1ZWIB 4LASL 1H0DA 4OD3H 4WEBH 5TDNB 5D7SH 2Q8AL 1EHXA 5LGHH 1RIVH 3QUXC 4P5TC 4YBLC 3FOMB 4F58L 1QSFD 2EDTA 3REVB 1W0WA 4NIKB 3T0AA 5FOBB 2O5ZL 3IU4L 1L0YA 1INQA 5E8DH 1RHFA 5HHMD 5FO9B 2X7LA 5IW1A 4XCNA 4JM2A 1WGOA 1CYGA 4C83A 2YN5A 5JQHC 3EFFB 4JQXA 5F9JA 4PD4K 3PDGA 2E7LA 4OD1L 2XACC 1M05A 4GKSA 4GQ9L 1IC4H 5D6DA 1G6RA 2VC2H 4MJIA 3BWUC 2JKXA 5LGJB 4OCSH 2QKIA 4F7TB 1M6OB 1QSEB 1FL6B 5F7EH 3UPRA 2CLRA 4Q6IB 3K81A 3DV4A 3FCTA 4CN4A 3GI8L 4JRXA 1Z5LB 4YX2L 4ZNEA 2YUWA 3PWUB 5T3ZE 2D03L 1Q94B 5D7IE 1CE6A 4WU5A 3QIBB 3FRUB 3TBWB 4XBGA 1IGJA 4GAGH 4ERSH 1LE5B 4H8WC 2ATPB 4HWZB 1LP9E 4F9LC 3IYLW 3EUUA 5HD8D 5CGTA 3B2UC 2OR8A 4G8IA 4BM7A 1DBAH 3NTCL 2EDJA 4PYGA 1HDMB 1IGTB 5E2VL 3SDAA 5F70A 4KJQC 3S3SA 3PHOB 4RAUB 3CFKB 2IC2A 5MENA 5C07D 4FXLA 3ARFB 2GYSA 4GXUN 4Q6IC 1VESA 2I5YH 2JB6A 3SDXB 1HKLH 5FXCH 1HYSC 3BDXA 4FQIL 2VWEC 1G7LA 3I3BA 4JCLA 3E6HA 3ARPA 4LSQL 1IJ9A 2LE9A 3SDCD 3QIBC 2ZP0T 3V8CA 4HK0B 3U0WL 1RJZB 4YDJA 3MRRB 3W0WA 1O5DT 3DGGA 5DK2A 3KPSA 32C2A 3QEQB 3U9PL 4F7CB 2ICWB 4TVPL 2DM7A 4MNHA 1AGBA 4P3CH 5A16B 1OAKL 4YJZL 2CRMA 4XMLL 3VXNA 2VLKD 3ARFC 4NQEB 4WW2A 4RFOL 2AJSH 1UZ6E 3LIZL 4ELKB 4LLDA 5TF1H 1KGCD 5FKPA 3PWJA 4PREA 3ARBD 4XPBL 4UV7L 1JHKH 5DD1H 1DQQA 3FB6A 1KIUA 4QRRA 5DMIL 4OZIB 4HWEH 4WI4A 3ZDZE 2DF3A 4HUWA 1PYWA 4G9FB 3WFEL 4Z78B 4K9EL 2CJUH 2X4QA 4CADB 4WEMB 1M7IB 1DVFA 3SE3C 3UZVB 1DTUA 2FLBT 4QXUL 3X14A 5I1LB 4HS8H 2AQ2A 4NO2A 4AIOA 2J7LA 3OKOA 4ZO9A 3H42H 3Q1SL 1J1PL 5DYOB 5C0CE 2BOCA 2SEBB 3V5HB 1R24A 5B38B 1VPOH 1MREH 3CZFA 2IH3B 3VCLA 3CK0H 1MAJA 2FL5B 2WV3A 4N9OB 1MEXH 3UBXG 4BZ2L 2EEAA 1N2RA 2E8ZA 4PRHE 3RIFF 2EYSB 1I9RH 3OSKA 1RURH 1OPGH 4MZ2A 4P4KA 4XVSH 1EHLH 1JBJA 4YHML 2R0KH 4FMFA 4Z5RA 3BZEA 5T5FL 5CEZL 4QTHB 4RFEA 2A6DB 4WHDA 3ARQA 3TP4A 3K74B 3SDYH 4LLWB 4HS6A 3GSNB 4L5FH 3WFBH 1H3WM 1MRFH 3HG1E 3X11A 4MQXD 3IFOB 2LABA 4PJ7E 3CFCL 5C08B 4HJGB 3V9FA 1A7RH 5D5MF 2K3TA 4M61B 5B8CB 4C56D 5LBSL 1KB9J 4KKAD 1NC4A 2WY3A 2VLLB 1FRGL 4YDLB 4FNLL 5GGUB 1UXWA 5F7NC 1AGFA 3BW9B 4XAWL 2D7TL 1CGTA 3FB5B 3GHBL 2X4UB 1SYVB 2CQVA 1BIIA 4HF5H 1TZGH 2Q86A 3KPTA 5J1AA 3DVNA 1QNZL 2YRZA 5DHVH 1GYAA 2MQ0A 4Y5YB 1HQ4B 5D7LE 5FK9A 1U41A 3LQZA 4NUJB 1D5BB 3RGVA 4DW2H 2EDHA 1B88A 5JIPA 3W11D 4H20H 1U0QA 5GRVL 1I7UA 3V6FB 3MC0A 5GRWA 1QO3B 5D2LA 1LK2B 5GIRB 1YPZE 2ZUVA 5M94B 1I3RB 1S9WA 5B8CC 4PJCB 2MWCA 4K94L 1X5JA 1NBVL 4LU5H 1LDPH 3PL6D 4G8GA 4I5BA 4GXVH 1JWSB 1P2CB 2V9QA 3GJFK 3GBNL 5HGBA 5EOTA 4JFFA 2HFFA 3RU8H 4HIEB 3U6RB 5DJ8A 3HTLX 4YDLC 1CWVA 3IKCB 2NZIA 3BP6A 1IFHL 4ZPVB 1OWRM 4AH2B 4F15B 5BVJA 5E99H 4W68A 1MIEH 1OARH 5JOFB 1TCMA 1PSKH 2X05A 5KSAA 2P5WD 3ET9F 5KANI 1NGXA 3LKOB 4Y5YC 3WS6C 3EOAB 3BP4A 43C9B 3HNVH 4XH2A 2H1PL 5TQ2L 2GK2A 1SM3L 2BC4B 1AR1C 2X9XA 1T83A 3CLFL 1JNHB 5HHOB 3D3VE 4Q58C 5IVZB 4LPWA 3MRQA 4WY7L 5CBEA 1AGDA 4G6MH 1ZLSL 5HY9B 5DJ0A 2GEEA 4WI8A 1VFMA 5CLTA 1JN6A 3NIDF 2RGSA 3J8F7 3GBML 4L4TA 1JRHL 1F4HA 1IAMA 4PRAA 1UWGL 3BQUC 3CC5A 5F6IB 4F15C 3EOYG 2DD8H 3EYQC 1LO5A 1E4WH 5DJYB 5IVXB 2IAMC 5E5RB 2LV4A 2N4IA 1NCAL 4BSVB 3ZMRA 3LAFA 5D7JB 1M7DB 2FZ3B 4JREC 1MHPH 4GBXD 4XMKL 3TBSA 5GJSH 4NCDA 1MRCL 1YEEH 1CR9H 2A77H 4XNUL 2QHRH 1J11A 3H3BC 4TVSa 5B39A 5IHUL 2HVJB 2J5LB 1FVEB 2P7TB 3NABL 3PGCB 4I4WB 3GMQB 2ED8A 3NAAL 4QRPB 3TFKC 4PLJC 5DUBB 3QDMD 1Y18B 4JZJC 5DURB 3BVNB 2EDYA 5I1CL 4M62H 4ZFOA 2NY3B 4F57L 1E4XH 2YEZB 4NPYA 2HT2D 2IG2H 5C0AA 5DK0B 3BP5B 3RL2A 2EH8L 1CF8H 5GS0D 4XBEH 3QDHA 4K3DH 4IM8A 5D1XC 1L8JA 3LKRA 4L4VA 5D7JC 4KVCH 2F8OA 2BY1A 1QR1A 3AVEA 2ED9A 1T6VN 2XN9D 5FFLA 3E2HB 5GJTH 3HC0B 3O2WH 4JFZL 4LCYA 5CKGA 5DD0H 3DURB 2PCPA 1R3HB 4JFPB 1XGYL 2ZSWA 3H7BA 3W9DA 2J5LC 2KQNA 3WD5H 1WCQA 2ZOLB 2A73A 2CLZA 4H88H 3QDJA 2BVEA 1H3XA 3LKSA 4ZUSA 1DEEA 2OJEA 4XP1L 3KDMB 2XZCL 1DBML 1AP2A 3VFWA 2Q7YB 5JW5B 2P45B 5C71A 4I3RH 4DKAA 1XGUA 2NY3C 3NCMA 5C7XL 4PY7B 4PRPE 4EQ3A 1R3JB 2VOTA 3MCLH 3PV7A 1BFSA 5DI8B 5A2KH 3MA9L 2AV1B 3MOQA 2DBLL 1Q8MA 2G60L 1AQDA 2QLVB 2VQ1B 1AQKH 4UINL 1JUFA 1F02I 2OX5A 3DBXB 3E2HC 1MRDH 1TVBB 4FTVD 3S96B 3DVGA 3OKKA 1CZ8L 4BFIB 4G6JL 4S1DD 1IL1A 5TDOA 4K9EC 4WFHE 1ZHLA 4PRID 3H7LA 4WCYL 4JEGB 4PJFB 3O4LE 4Z7OE 1FNSH 2MNUA 3G5VA 1P6FA 3QJHB 3SGDI 5E2TH 2AJUL 4IRSB 4IOIA 2NMSA 3DROA 4KK9D 1QRNE 3HR5A 3KPNA 1ZLVH 3BPNC 3BPCB 2VYRE 1ZT7A 1T1WA 2X1OA 3FT3A 3SCMB 4RWYL 1MCHA 4HK3N 1A6ZB 3IFPA 5F7FA 5EZJA 3K4AA 5KSUA 5TDPA 1I9EA 3NIFE 3VGHA 1EGJH 5DRWB 3MA7A 4RGMB 3HUJF 1IGYB 5F7HA 4GAYA 4ZFZA 1MJJA 1XF2A 5HGAA 3KYOA 3CVIH 1SJXA 4J1UA 3VJ6A 3Q5OA 4LOUD 4MCZA 4QWWD 4U1GB 1ZGLA 4OLUL 4HC1A 1ED3A 3O3DB 4LQ1A 3H0TA 3BWAA 5H2BA 2BVUA 4GRLD 2PYEE 2WP3O 3GUTB 3RZCD 1INEL 1OSPL 3FMGH 4JGUA 4TRPH 5J56B 1DQJB 4G80B 5TF0A 1CL7H 1Z3GH 2BSED 3KLAB 5I19L 3QUXA 4P5TA 4AIZA 5EBLB 3L6FA 3VXUE 3TJHC 3V0AC 2GY7B 3SCMC 1A1NA 2QQLH 4K2UH 5T3ZD 4HH9A 5D71L 1R6VA 3VFSB 2HT3D 5IB2B 1IZKA 1FFPB 4LHQB 4F33B 5E5UB 5DVOA 3BE1H 3LKNA 5IJVA 2DBJA 4RGMC 4XCEB 2VAAA 2ZCHL 5IB1A 1JPGA 4CVXA 1XR9B 4HKBA 1KPVA 5BZWB 4X4XB 4HUVA 1OAYL 4U1GC 3OZ9H 5I1GL 4P57B 3DXAA 3N1PC 1VFUA 3ZYOA 3TT3H 5K9QI 4K94C 5IMKB 4JLRB 4DKFL 3D69B 1ZWIA 1OY3B 4ZFGL 1JWMB 1MCCA 4IDJH 2I60L 2YMXL 4MXWH 1ONQB 3WN5C 4NQCB 3CFEB 4PV9B 2JF1A 4MCYB 5FOBA 4NZTL 2LVCA 5C9KA 2X40A 1P7QA 2P8PA 2FEDC 3EJJX 4D8PB 1JHTB 3H3KA 1JZ4A 5HPMA 4JY5L 5D1QB 5FO9A 4F9LA 1KYOJ 4PV8B 5IBLC 1VGKB 5E7BA 3KYMA 4X6DB 5C3TA 3MOBL 3OGCA 4YDVA 3DETC 3EFFA 1T6WA 5KW9H 1KNOB 2E6JA 3Q3GB 2PXYD 2K7PA 2VXQH 3L5HA 5C0IB 3U0PB 1M6OA 2HRLA 3MLXL 5C2BH 1FAIH 5IGXH 3BIBX 4KKLD 4Q6IA 4KDTC 1OP3K 4XP9H 3WHXB 3MFFB 1U6AL 3DUSB 1NFDE 4CJ0A 5L9DH 4OV6F 2DLIA 2VZOA 1Q94A 5TGBA 3Q6GH 3RKDD 5F88B 1KC5H 1YQVL 5EZIL 1J87A 3QIBA 3FRUA 3JVGC 4P2CG 1VFBB 3TBWA 2QV2A 3VD9A 1LE5A 4AEHL 3C8KA 5D1QC 4HWZA 3ZE2F 4JR9L 1WT5C 4MB3A 4LIQE 3MRJA 5E08H 3MACH 3LRGA 2AXFA 3KHQA 4G7YL 3JWOL 2AEQH 2QSCL 1RZIB 2X4OA 1T04B 1N6VA 5KOVC 5DHYB 2BVOB 5KOMC 1C5DB 3ARFA 1I1FB 3SGEI 1U36A 4NJAH 4YK4C 3BRGC 3AXLA 3KJ4B 4ENED 1E6OL 1IEHA 2LAGB 3KYKL 1IC7H 3SDXA 4G8GE 3NFSH 4OJFL 5HDQH 1N59B 3K8LA 5KZCB 5ALBL 1NKRA 4P2RB 4JFFE 5JDSA 4XMPL 1QRKA 3L3GB 2W9DH 4PRHD 1D9KC 2DQDL 4ZYKB 3UYPA 3ARYA 3NIGE 5AG9A 3QXDB 1RJZA 4Q6YA 1UB6B 4U6HB 2VITB 3G5XB 4NJ9H 3SE3A 4H25A 3RA7L 1FLTX 4R2GC 1OT2A 3HG1D 2R4RL 3QEQA 1W2KT 4Y1AE 2XKUA 4NKMB 5IB5B 2FO4B 4QT5B 2XTJE 3DYPA 3LEXB 5D2NE 3X17A 5IVOA 3JV6A 2DLGA 1ERNA 2Z0BA 3ALPA 4M00A 3KR3H 4KRPC 1SMOA 2GKIA 3F62A 1G7JA 3A6BL 4R26H 3VG0H 5EZOL 2O5XL 3SO5A 4PRIA 1QFWH 4OZIA 1IGFL 5C6TL 4KI5C 2BNQB 1K8DB 3VFMA 2YKLL 4QXWA 4Z78A 4G9FA 4CADA 4ODSH 5K9JH 4QRTB 1M7IA 1I9IL 4KKCD 8CGTA 1UADC 1ORSB 5I1LA 1V3MA 4XZUA 5FYKH 2XFXA 4S10A 4IRJD 4FQJL 1TZIB 1DFBL 2UUDK 5ISZE 1U3HB 2SEBA 3V5HA 1T66D 1U8LB 3LRSB 3TIDB 3LPWA 4NO0B 4PBVC 4Z8FL 3S34L 1IBGL 4FOMA 2RHEA 4HX1A 3HN3A 2VL5B 2EYSA 3MGOB 4Q74A 2FR4A 3NCBB 3ME0A 1I8KB 4GRMA 4JN2B 3VI4E 4XPGH 4WWID 5FYLH 3PGFH 4QTHA 4JFDE 1QR4A 2A6DA 4MSWB 1QLEH 4I8DA 1RK1A 2C1OA 3U7YL 4HHAB 2Q7NA 4M4PA 1RZFL 1WAAA 2A9ML 5DQDH 4HJGA 5E00A 3EZ8A 5JA9A 1P1ZB 1MFCL 3BKJL 4Y16B 4HV8A 3C5JB 4DGVH 1L7TL 1YEGH 4M6OL 2ZCLL 5B8CA 2QJDA 1FVDB 1J0JA 4MQ7A 3TNNB 4D9LH 3UJTL 4I13B 1NCBH 4JRWA 3RWHA 1U3HC 3CX5K 5E8EA 3CCHB 4NBZB 2J12B 1UB5B 1GGCH 2XNAB 5IW6A 2VLLA 2BSTA 2X2YA 4NZJA 1KB5L 4Y19A 4U1HB 1SYVA 1I8LC 1XT5A 3U0TA 1G9NC 4PJEF 1KPUB 1D5ZB 5TE4H 5GZOD 4U2YA 1ZLWK 3WS6A 2YUVA 4S0UC 2I26N 5IHLB 1HQ4A 5CSBA 4X80L 1D5BA 1CDIA 4EZMA 5MI0C 1ACYH 5DVLA 2ZZUT 3I9GL 5C0BD 4GAFB 3STZB 4X7SL 3V6FA 3FO2B 4MD5B 4MAYC 3S5LG 1LK2A 5CGYC 5GIRA 1UFUA 1I3RA 4PJCA 4U1IB 3LB6C 4ETYA 2X1WL 1ETZB 3BGFC 1AD0A 4JPIA 1JWSA 4JM4H 1P2CA 5TPWH 1FV1A 1U58B 4LPCA 5EORH 1EHNA 2F8VA 1AJ7L 3MO1A 4HIEA 3U6RA 4JN1L 4K8RC 4PG9B 4QRQB 2GTZA 3IKCA 2AJYH 3DVIA 3BQUA 1WBZB 3N9GH 5J11B 1T2QH 1ZMYA 1UYWH 3H9YA 4ZPVA 4DN4L 3NCJH 4D3CH 1GC1L 3CUPB 2IAMA 3ZDXF 5JOFA 2VZ1A 4OF6A 1VADB 1IAKB 4O51B 5F7KC 3EYSL 3LD8B 3LKOA 1N5AB 4BZYA 2PXYA 3FONB 1CGXA 2VISA 4OB5H 2FYYB 5I8CB 1FNAA 4FN0A 1PW3A 3CDGA 1JNHA 1NGPL 5IVZA 5J8OA 4YZFE 2VLME 3QZWB 2ZUQC 2YWZA 5F7DB 5BS0E 5HY9A 4N0UB 2KKQA 3KPQB 4JPKL 4U33A 1QVOB 4JZJA 2D0GA 3MRCB 1UCBL 1DQDL 3HFMH 1R5IA 1D3CA 5TE7L 4N5EC 5J11C 4QHUB 1RJCA 2J8UE 4Z7UF 1RUQH 4YC2B 4R4ND 1EERB 3H2WA 5ADPH 3ZT7A 3MBXL 5D1XA 4H5SA 3DV6A 2NY4D 4I48A 4PRPD 5D7JA 3QWOA 3LD8C 4BYHA 3DJ9A 4B0MM 1MPAH 4LFHG 1C5BL 1SEBA 1R5VB 3DX8A 3LQAL 4RRPG 1JF5A 3GSNH 1MCLA 1OAXL 4KGJA 5JXAL 1YMHA 4KROB 3O9WD 4DAGL 4YXHH 1LO4L 2DQCH 4I4WA 4OM0H 5E7FA 5A40E 4R90H 2NW3B 3GMQA 1NKOA 1WEJH 4RIRA 4OUOA 4WFHD 3VFNB 2GSGB 2A38A 1ZVSB 3VD3A 3I75B 5DUBA 5FGCB 3OAYH 2DLFH 3BKMH 3O4LD 1P4IL 4TUJA 4N1EA 5EG6C 4EN3D 5JZ7D 4OCWH 1WZKA 5BXFB 4X5WA 1QQDA 3BP5A 4YC2C 4HEPG 1QRND 2B1HH 4LASH 2Q6WB 1BF2A 5DMJB 1NBZB 5DT1H 3PNWA 3HC0A 3VA6A 4JFPA 3IU4H 2E6PA 3DIFA 4OQTL 1ZEAL 3DYMA 2F74B 1E4KC 1KEGH 1FCCA 5EOQL 3D2UB 3IDNB 1AXTH 2ZOLA 1BJ8A 2BSRB 3JZ7A 1S9XA 4FXGA 1FC1A 2R4SL 4MYWB 2P43B 3GMNB 3PJSB 2F54B 4OCXL 1MCNA 2Q7YA 5JW5A 1E27A 5GGTH 2HRPL 4FP8L 3Q2CA 1EHAA 3Q6FA 1QSEE 5I75C 5ID0A 1CGYA 2Y07L 4LPUA 4JAMA 4PY7A 1U8KB 4K7FB 1R3JA 5C09E 3OKNA 5DI8A 1S7TB 3GI8H 2AV1A 5D8JL 4R4BB 1MHCA 2RAMA 3AFLA 3VXUD 1G7QA 4NYLB 3THML 2E9IA 2VQ1A 3OWEA 4WFFE 5FYLE 4C4KT 2OZ4A 4AQ1B 4LARL 4G42B 3DBXA 3MV9B 2BX5A 2FDBP 3S96A 2H9GB 2FHCA 5FUCE 1FNHA 3F5WB 2MJWA 2ZOKB 3TVMD 5JPMB 5HDBF 4PJFA 3ARSA 1XMWA 4I0PD 3VFRB 3HMXH 4XTRD 1B2WL 2IPUG 1KSRA 3T2NH 4U1KA 2GY5A 1C1EH 4P9HL 4GJTB 5F9AC 3TGXA 1RZJL 5C1MB 3IRPX 3VXPB 3BPCA 3HAEA 4F3FB 4FMKA 3VWKB 3SCMA 2WUBL 4HFWB 5D7KE 4M9PA 2YPVL 4ZOBA 2A2QT 1M71A 3ARUA 5DRWA 3N0PB 3T0XA 3O3AB 5B3JE 5F71A 3PP4L 4XPTL 4Z95L 1F5WA 4ONOA 1DLHA 4N0CD 4DFIA 4H26A 4YHIB 1F6AB 4MAUH 3MROB 3O3DA 3HA0A 5CSGA 1IC1A 5GQBA 5GRZA 4RAVB 3VXSA 1T0NB 4DTGL 3GUTA 1XH3B 1W0VB 2QL1A 2O93L 1DP0A 1SVCP 1EO5A 2XY2A 1QFOA 4MA7L 5FECB 3WN5A 5BRZB 5IEKA 4NQEE 4XMLH 5C0BA 2HJFB 4WU7A 1NLBL 1PLGL 2ICWJ 3VWKC 1N0XL 4JVPA 4KY1L 4RFOH 3LIZH 4KTEL 1TJGL 3DRTB 1GPOL 2NW2B 5IB2A 4AMKL 3LS4L 3RL1A 4M1GL 4F33A 3AGVA 4PP1C 3ELAT 2NY2D 3QIUB 1S5IL 3MREA 2VDQL 3PIQA 4PGDB 4Z7VB 1AI1L 3LSOA 2RCSL 5IK3B 1XR9A 3WFEH 5KVFL 2DQUH 4XCFH 4ZFFB 4O2EA 1HE7A 5I1DA 3T08A 2P5EB 4KDTA 4WI6A 5DQJB 4PB0H 1J1PH 1QLRA 2V2XB 1I7RA 4N0YH 1EO8L 4NQCA 3CFEA 2VIRB 4XGZA 4W81A 1LILA 2RIKA 3QUZB 1HHIB 1UC6A 4BZ2H 5EDXA 4KJWD 1T21B 4YHLH 5JO5B 4YH6A 1JHTA 2NNAA 4OSUL 4P46B 1XCQA 1FP5A 5D1QA 5DRXB 4YHMH 2FJHB 1GAFL 4PJAF 1WT5A 3DX7B 2QADB 4P9ML 5CEZH 1VKXA 3W82A 2WUCH 4J8RB 3QIUC 2OP4L 2E7CA 2A6JB 3CLEH 5E4EB 5E8PB 4WGVB 4NT6A 5C08E 3NGBB 2L4OA 5C0IA 2ADFL 2ZSVB 5DGQA 1ZTXL 2HG5B 4L1DA 3RPIA 1N3NB 3DUSA 3IU3B 4FFEX 4WDIB 2R1XA 3P9MB 2MCPL 3VXRA 3VI3E 4PRDB 1CDUA 3PWPA 1D9KA 3QUZC 3EOTL 4FNLH 1A7NH 1G7IA 5CBAA 3O9WA 1VFBA 4UMGA 1IZJA 2D7TH 4I3SL 5CEXB 4P46C 3MJ9L 4K23H 5E8NB 1ADQL 2EH7L 2V2WA 5CAYB 1X5XA 1W0YT 4FABH 2M8XA 4OZFG 2OR9H 3T3MF 3LQAC 4P23B 3TN0B 1NUNB 5EBGA 1R0AH 1T03L 1J9CT 4U1MB 5E4EC 4EDXB 3RWIB 5DHYA 3NGBC 1C8PA 1C5DA 5C0NC 1I1FA 3PWVB 5IHZA 3WUWB 4NP4L 3EYOA 5ISZD 3KPRB 1T22B 1IMHC 4OBRA 1P84J 1F3JB 1N59A 1KJ2A 1AC6A 3QH3B 4MNQB 4P2RA 3QWRA 3N1FC 3ZKNC 4XBPA 3L3GA 4QF1A 3RHWF 2P24B 4M5ZL 5CZXC 1NJ9B 2E9WA 4H0IA 1A3LL 5E03A 3ES6A 2NY6D 3S4SB 3ARED 3NACL 5JIIA 5I71B 4JFDD 1OGAE 1UB6A 2HH0L 4U6HA 2VITA 3WV0A 3G5XA 3G08B 4J23A 3UTQB 3P77B 4C55A 1PG7X 3E8UL 5D7IF 3RDTB 2X1PA 3B9VA 1KCLA 4TUOB 3TN0C 3JBG7 1VEOA 4NKMA 1YNLL 3QXWA 1TETH 2FO4A 2ARWA 4EBQL 5TQ2H 3IGAB 4MJ4A 1SM3H 4QT5A 2VRAA 2Z35B 4TN9A 3IDIA 3WJLC 3BD4A 3QP3A 3VGEA 1JCKA 2DRUA 5HHOE 3CLFH 4JKWA 5IROC 3QYCA 5IB3B 3AY4C 4HIJB 1K3IA 3CD4A 4WY7H 5FHAL 3RHWK 2MKWA 1U93B 4LSSH 5I18H 3BN9C 1IT9H 5HI5D 3GSQB 3WFZA 4FXKB 3BIKB 2B1AL 5CJBA 2IMNA 4OIIH 5GSVB 2CRYA 2FX7L 3TA3D 2C4FU 1PZ5A 1ZS8A 1A21A 3TVMA 4Z0BH 4XP6H 4ZO7A 4TNVF 2VZ3A 3MR9B 2BNQA 4ZUWB 2ZG3A 4X7TB 5H35B 3BYYA 3UYRL 3MRKB 4LCWB 5IVXE 3G6JA 5CP3H 4QRTA 2J1KA 3HZMB 2B0SH 4KRNA 1ORSA 3CX2A 4PJDF 2GCYB 5JPNB 1C16B 1Q9OA 3BDYL 3JTSA 3MUY1 2DKUA 4TSBH 4TOYL 1KENL 1TZIA 5HYQA 3FFCD 4KPHH 3RNQA 4U0QB 1U3HA 5I1AB 5HHQA 3L5JA 5IHUH 1U8LA 3TIDA 4D2NA 4NO0A 5A2FA 3NABH 2GW5A 3F8UB 1MHHB 2PR4L 5CUSL 5ETUB 4TVPE 3WFCL 2RJMA 3H9SB 3MGOA 3AS0A 5D1ZD 4QRPE 3NAAH 3MNZB 2W38A 1I8LA 2WBJB 4MZ3A 4JN2A 1LDSA 1F4XL 4UDTB 1YYLL 4XHJC 1RZJC 1DN2A 4FQ2L 4AEIH 3O0RL 4V3EB 2W9EL 4MSWA 1TVDA 5I6XB 3NH7H 4F57H 2WWMD 3L3IB 3MRDB 3ZKMD 1QTYT 1FQ9C 2EH8H 2N1KA 3RX5A 3SKOA 4ODTL 4MAYA 3INUL 4OT1H 3VFTA 4ISVB 1F6LL 4D0CB 3ZDYE 1L6ZA 5F7UA 4J3TA 4IJ3B 1FVDA 1MY5A 3RVTC 1ZA6B 4Q9BA 3UTSB 5KS9A 2DJUA 4RNRA 1XGYH 1DLFL 3NPSB 5CJ5A 5KG9A 1UB5A 2XNAA 4N90E 5IB4B 1I7TB 4MNGB 1WVZA 1HIML 1U8JB 2J8OA 1KJVB 3CVHA 2HLFD 2RFXB 1OP5H 4HBCL 3MRFB 4JY4B 1MCKA 1JGLL 3P0VL 4OKVB 4Q0XH 4XP1H 5CILL 3SGJC 5C0EB 2XZCH 1BQLL 3BP7B 3GSVB 4YHYB 1D5ZA 4JFXB 3ROOB 4E5XA 4HMEA 1UACH 5LQBL 5I6XC 4M8QB 3CMOL 5EC1B 4LAQH 3STZA 3STBA 3FO2A 5KVGL 4H1LB 3RVUD 5DJXB 2BJMH 5CEZE 4AIXA 3SQOH 1U8NB 4UINH 5EC2B 2V7HB 3FO0L 4IJ3C 4DVRH 3BZ4B 1ETZA 2HMID 1R3IH 4ALAL 1E4XI 5J57B 4NUGL 1CZ8H 1U58A 2ZG1A 4G6JH 4OAWB 3WSQL 1UG9A 3D0VA 3NPSC 4HPOH 4X5XB 1AFVL 4JDTL 2NX5E 1KFAH 2NY0C 4PG9A 4WCYH 3TZVC 4L3CB 3C60D 4N5EA 2UYLB 4KXZH 2H2SD 4AY0A 1F00I 4O51A 1IAKA 2DQGL 1YN7A 1N5AA 1UZ8B 2VH5H 5J6HB 4KVNL 2GIYA 3QFJE 2Z8RA 4JO1L 1TZHB 1KT2B 3O6FB 2X6MA 5I8CA 3KWWB 2A0LC 4X4ME 3C6LC 3QQ4B 5SWZA 3GRWH 3GB7B 2G9HB 4WI9A 3QZWA 1AO7B 1RJYA 4KI1A 5F7DA 4FQHA 3EYVA 3JV0A 4NCC2 1DUYB 4FQCL 4K71B 1BFVL 1NUDA 1QVOA 3GMMB 3IDYB 4ZOCA 5HYJD 5FYKD 1NCDH 5MERA 4PGBB 2EXYC 1MCDA 3M17A 4ZQKB 4ZXBD 4PJBF 1UM5H 1YPZF 3ULVC 2DI8A 4PYHA 4QHUA 1P4BL 5DTFB 4ELMB 2JJSC 1INEH 1OSPH 2JCCB 4OCYL 4G9DB 2FWOB 3ZT5A 1EGJA 5I19H 4NHUA 5C09D 1MUJA 1R5VA 4RMWA 1JPFB 2CDFA 1U9KA 1F45A 4LHUG 1P5VA 3O6FC 5FYLD 2F53E 2XQYK 3ARZA 3KNBB 1E4KA 5B4MD 5A2IH 1IEBA 3QWQB 2OSLB 3GIZL 2IMMA 2ADGB 3IXAB 1X5AA 2GSGA 1N4XH 4FQQB 3K8MA 2ZCHH 2Q3ZA 4K71C 2EC9U 2GK0A 3QDAA 5JHLH 5I1GH 2YD4A 1ZE3C 4NQXB 1F2QA 1N6QH 4OLZL 5INCB 5KSBE 3IXTB 5BXFA 4JG1H 4ZFGH 3BPOC 4WI7A 1FYTB 1AKJB 3OJDB 4G7VH 2Q6WA 1NBZA 5D7KD 1A6WH 1L6XA 1XGQB 1LHZA 3NCYS 3TH2T 4NZTH 4QY8B 3RPKA 3ZYJA 3ARDB 2F74A 4JY5H 3FAXA 2XPGB 3D2UA 3IDNA 1CL7I 4X6DE 3ECBB 1QSVA 2C3WA 1IAIL 4ESKA 1A9BB 2PW2A 4M1CD 2UZIH 4C4KO 2NZ9C 3G6AB 4NRXB 2V17H 2VLRD 1NGWA 3F58L 3V6OC 4AM0B 5E4IA 3S8WA 3RWDB 1SYSB 2VXVH 2DWDB 3QNXA 3CH8A 4PJIF 3G5ZA 1U8KA 4K7FA 3WEXB 3MGTB 4GMSL 2X89D 4CW1A 5JOPE 2LU4A 5DD6A 4NQED 4R4BA 4HJJL 1U6AH 1T2XA 5E5MB 3FFCA 2JJTC 2V7NA 4BSWB 2X70A 2VXUL 3L7EA 4G42A 4HWNA 4WW1B 3K1DA 2H9GA 4DFHA 1WQVT 3DHJA 5F9WB 2G5BA 3A67H 2EE9A 1A7OL 4ZO6A 3F5WA 5JPMA 4I77L 2UWEA 4JR9H 2CRIA 5ESQA 1NMAH 4G7YH 3VFRA 3JWOH 5IFHL 2QSCH 4YFDB 4X6CB 1F8TL 5HYSG 1V7ML 3EJYD 4KKBC 4XVUC 3VXPA 1U8QB 4F3FA 4JM2F 3VWKA 1TQBB 2DTML 4HFWA 3ULUL 3RUGA 3KYKH 2XIDA 4YHKH 4OJFH 2KUTA 4PJHB 4KZEL 1JI2A 2FIKB 4TQEL 1JYVA 1FCGA 3FQXB 4LSRL 1EMTL 4G6FD 2DJ4A 4OZFH 5GS3A 1DBKH 5J89A 4OZGE 1YECL 4O4YL 3UBXI 1JVKA 4KI5E 2EKSB 1QG3A 5E9DA 5F9WC 5DJDA 1TNMA 4XI5D 4HMDA 5MEQB 4HH8A 5I76B 2F15A 3RA7H 4KV5F 1T0NA 5EU6D 3RWJB 3B3IB 3QUML 1T0PB 4WHTB 3P4LA 1P7HL 4LSUH 1IEAB 3BEWB 5D96C 4PJXE 2IPKB 2HJFA 4WRLA 1TQBC 4Z7OF 4UTAL 4GAJH 3DRTA 3U7AA 4M9OA 5DK3A 3A6BH 4X0KB 4LPVA 2VXTL 3GJFH 5EZOH 3GKWL 4TSAL 4HLZG 2R39A 1T7ZA 3ZSTA 4PGDA 5GRJH 5C6TH 4Z7VA 5ITFA 4UB0L 2BY2A 2R9HC 2XXCB 4PD4J 1RFDL 5IK3A 1G7MA 4OKDA 4Z7QF 3PDOB 4U6XB 4ZFFA 1CTNA 3NIFF 4H1LG 1RI8A 4QLRA 1C12B 2VDMH 3RWEB 1JZ8A 1RAMA 1RZ8A 1UWEH 4POUB 1SJHB 1YY9D 5MP6H 2VIRA 4M6ML 4PGEB 3QUZA 2APFA 3S34H 4CBPA 1KJ3L 3MUGB 2K9UA 5TH2B 4M1DL 3O45B 1DQTA 3WKML 4WVRA 5TE6L 5L88L 1DBJL 2DQIL 3O8XB 3VG9B 3DX7A 1OAQH 5HYJA 5JUEH 3UJJH 4J8RA 5KN5B 1OGAD 1R5WB 2FH6A 4Q9RL 3U7YH 2OYPA 5DUMH 1PZUB 3OB0K 1RZFH 3FQTB 1NLDH 5MEPA 1MFCH 5HHPA 1L7TH 2H26A 5IM7B 5HHOD 2HG5A 4PJ8B 1QFWI 1TLKA 3MODL 4JHZA 2GSIB 3IU3A 1BM3L 4PRDA 1VFAA 3VXTB 3TWCL 5I30L 2QSVA 4XNXL 1UKQA 1KB5H 5F7YC 4HUKB 5ERWA 4HXBL 1UQSA 5CEXA 4P2QD 1GGUA 4UV4L 2EO9A 3VFVB 2XZZA 4KJPD 4EVNB 5E8NA 1QP1A 2J6EL 4XT1C 3VG9C 3I50L 1TQCB 4XWGH 3NN8A 1OF2B 4PJGB 3TN0A 4XVJH 4U1MA 4X80H 1MQ8A 4M7ZB 4X99B 3WJLA 4PRNA 5IROA 3EOBA 1Q72L 2ATKB 4GG8A 4X7SH 1MF2L 3MSPA 2JTDA 2MKLC 3UCRA 5ELIA 3ESUF 5CJQH 4NSKB 2ZUWA 4M03A 2EDNA 4MNQA 3DSFL 4QXGH 5BMFL 3C08L 1AJ7H 2QSQA 1NJ9A 2EZ0C 1BOGA 2CK0L 4QRPD 4NM8H 2VB5A 5BV7H 3QQ3A 1GGIL 4X7FC 1GC1H 1NFDF 1D6EA 3UTQA 4DQOL 3U4BH 3HI6L 4LCUA 3QB7C 4NOFA 3TJEL 1QBML 3WDHA 4QOKE 5ENWB 4MVBC 3IGAA 1YN6A 4M7ZC 3JWDH 1SEQH 3ARGC 4PDCE 1A7PL 4FQXC 2PTVA 5IB3A 1W72L 2BY3A 4Q2ZB 2FEEI 1NGPH 3MJ8B 4HIJA 4YE4L 4HZLB 1OLZA 2P44B 3SJVB 4I9WE 5L8JB 4N0UE 5DQ9A 1U93A 2ARJQ 3GEWB 2LFGA 4UDUB 4N90D 3BIKA 5EIVA 2ZWLT 3VMOA 4CDGC 2CRZA 1UGNA 2DIAA 4N8VB 5D2LF 5F93C 3C5SB 4LGSB 3QIWD 4YFLI 5F1OB 6FABH 1WFTA 4X98B 5TE7H 3MR9A 4PJ5E 2ICWI 1NUGA 3FN3A 2JJVA 1RUKL 4LCWA 4YDKH 5T1LA 4FFVD 3U36A 1GZQA 5DJAB 2KDGA 4YAQA 4S1RL 1C5BH 1C16A 3P0YL 5ADOL 4GMTL 4BKLA 2Y6SC 4JHBA 4YWGH 5SX5H 2F19L 4GFTB 2VABB 4NGHH 1U8HA 5IBTH 5CEZD 1GZPB 5HI4C 5CLWA 3F12B 1OAXH 5DZOA 2O61B 2HKHH 4POZD 1RVFL 4RWHA 4NWTH 2PN5A 1DSFL 5L7XL 3TC9A 5C9JB 2PO6B 3H9SA 4CVWA 2CDGB 3QUMB 3DNKA 3MGAA 3MNZA 3SGJA 2NX5D 1U92A 5D5ME 4M7JL 1ZLUK 3I85A 3BUTA 1YJDC 1AD9A 5A3IC 1P4IH 4KK5C 3L1OH 2YD3A 4F7EB 4IRSD 1GCFA 2UZYB 3EDKA 2C7UA 1ZHBB 2DQEH 3ULUC 4LLVB 5I2IB 4HWBL 4J3SA 2APTA 5EU6A 1WBYA 4MB5A 3QFJD 5I1KH 3BSZL 5E2UL 2NR6C 1EBPA 1ZANL 1NBQA 5MHSD 1LO3L 1II4E 3SE9L 4X6BB 3QBTB 1NC2D 4EJ1C 2AK4B 1FL3B 5EOQH 1I7TA 4MNGA 3TZVA 3ZL4H 1KJVA 3S7GA 2PO6C 2L7JA 2R4SH 3OKLA 3MRFA 2F54E 4OCXH 3GSVA 4PP2B 3S35L 4TULH 3GMPB 1EA9C 2HRPH 4JFXA 3FRPG 1WZ1L 4RSVA 3TBYB 2D9CA 3RTQB 1LE9B 3BEVA 5CZKA 4M8QA 1J05A 4R0LB 1ZT1B 3C6LA 5D8JH 4LBEB 3THMH 4P5MB 5DJXA 4N1HB 1B0GB 4TTDC 2H45A 4NQDE 5DO2D 2F53D 3U1SL 2V7HA 1NPUA 3QCUL 3MV9E 4LARH 3BZ4A 5FO8A 4UBDD 1CXFA 3QUYB 2XKNA 4P5KB 2C3GA 4YBQD 1CT8B 4OFYD 3DHMA 2HKFL 2BSSA 3U83A 4L3CA 5BCAA 2J8HA 5FO7A 4NKQB 4UNUA 2XXMB 2WIMA 3TPUA 2XG4A 2JJSA 1J1XL 1HNGA 3QPXL 3WIHH 3L7FA 1IM9D 2QR0B 2YBRB 3KXFB 4P9HH 3L5WB 2V2TB 1UZ8A 3CU1A 3NIDE 2O26U 1TZHA 3O6FA 1MAML 1CFBA 4Y8AA 3KWWA 3NCCB 3HE7C 4R0LC 2YPVH 4NZUL 1QEWB 1AIFB 1ADQA 4JDVB 4CNIB 3GB7A 5SV4A 3HMXA 5CSZB 3TO4B 1IGIL 4QTIL 1MCWM 3A0OA 3QUYC 4Z95H 3IDJB 5F96H 2D31B 4P2QA 3VGGA 4PGBA 4LSVL 4EI5D 2X44D 2IANE 4ZQKA 4KZDH 3S37L 4K7PX 3CSBA 4ONHB 3QXUA 4AL8L 2YS4A 4GRWB 2IBZY 1HINH 4I2XE 4P59H 4J3WA 1QBLL 3ZKXB 4DTGH 4ELMA 3D85B 4X9BA 2C3VB 2JCCA 4D0BB 4G3YH 2XWJB 4G9DA 1CFVL 1QD0A 2Z31D 1C08B 2Q8BL 3PV6B 1J5OH 4HIHA 5BRZE 5F44A 3EDDA 4HULB 2CDEB 4LQFH 4QCIA 5JOPD 5FA4B 1PLGH 4MJ6B 4V2BA 1N0XH 1S7XB 1Q0XL 1RIHH 4RMTA 1CDBA 1MCIA 4LFHD 1GPOH 4HS3A 2EDDA 3QQ9D 4M1GH 1Q9LA 3G9VA 3TO4C 4DKEL 5I0ZA 3ZYIA 3CXDL 4TNWK 1ROWA 2VDQH 4FQQA 2VDLL 1RU9H 3NFNB 3V6OA 1FPTL 1W72B 4UQ2B 1U8IB 5D9SB 4YZFF 5L2KB 1XEDA 4U1SA 4NQXA 3FB8B 2P5EE 1MHEA 2GJ6B 1RZ7L 2NXYB 1FHGA 1J10A 1DJSA 3P4NB 3ZKXC 4E41B 1MAKA 3W2DL 3MV8B 1X5YA 5ID1A 1BD2D 2CKBH 4HLZH 5GGVL 2JJTA 4WO4B 1B90A 5IBUB 1SBSL 1FFNB 1I3GL 2IFFL 3I6KA 4FFZL 3H3PL 1G6RL 2AGJL 3DMMB 4OI9A 1AXSA 2J8UF 1CXKA 1JV5B 1DUZA 5DVMA 4OSUH 1KIRA 1MIMH 3L95B 2XPGA 1GAFH 4H1LH 5IOPA 4MDJA 1MJUL 3B2VL 1D6VL 1CDGA 3ECBA 1A9BA 3P30L 4YHZH 3AS1A 4NRXA 4HCRH 4JFEB 3WLWD 4M5YH 3L5XL 1I9JL 5FCSH 2NYYC 4Y4HC 3I2CL 2QTEA 3ILQC 1RUML 3HMWL 4NRZB 2OXHA 2HTKC 1ZTXH 4HAFA 4MLIA 3TCLA 2J4WH 5SWQB 3WEXA 2NXYC 2UVFA 4X6EA 1PVHA 4S1QL 1OP9A 2BVQB 4O02H 4P2OD 4ZPTB 1L0XA 3B9KB 5J6GA 4H0GA 3C2AL 4GG6B 3RWFB 4WO4C 4BSWA 1NDMA 3OJ2C 5I8OL 4WW1A 3DMMC 5D72H 5C70A 4JJHA 2R8SL 1KLFA 5F1NB 3OPZL 2I07A 4LLQB 3GJEB 4YDIL 1NEZB 2A9NL 3VRJA 5E2JA 3MJ9H 4FFYH 1K6QH 5F7MC 1BF8A 4OF5A 2EH7H 3QI9B 2HVKB 1OD9A 4J3VA 2B4CC 2V9TA 3N85H 4X6CA 5CCKH 3KAAA 5E1AB 4UOW1 3HUJE 1HQRA 4HEME 3ILPB 3EO1B 1U8QA 3KPRE 1ORQB 3ULSA 1BIHA 4PJHA 3TBTA 4M43L 2BHUA 4MNQE 4F7PA 5IJKC 3BIAX 5GISL 2FIKA 4POYA 1LEIA 3HPLB 2F5BH 2X9YA 3IETB 5GGSY 1BJ1H 3WJJC 2IEPA 2Z93A 1PEZA 2EKSA 1A3LH 3LV3B 3VFPB 3PP3K 4BQBA 1K4DB 2QQKH 3ZYZA 4MJ5A 2HH0H 5I76A 1JFMA 4IOFC 5FDWB 5I1IL 2YPLB 4QHMB 3RWJA 4XXCC 4Y16D 4YO0B 1GXEA 1IEAA 1J8HB 3DO7A 4K3EL 3GHEH 5FHBH 2AEIT 5HI3C 5IFJB 2BFVH 1F97A 5FHAH 15C8H 12E8H 1I3UA 3T1FA 3PHQA 1YEHL 4X0KA 1BQHG 3S5LA 1IGCL 3BD5A 4R6UA 4KK6C 1KEML 2FX7H 5SWSE 4A6YA 2YXFA 4Z7WB 3OB8A 1JHLL 5GRYA 2RB8A 3MV7B 2MPAL 3SDXF 1WLHA 4NNXB 2FCBA 3WNNA 2IPTL 3PDOA 3UYRH 4KFZC 1RMFH 1C12A 1TENA 4PBWD 4QEGA 4BH7A 3RWEA 3WUZA 4JFQB 1NCCL 1PY4A 1SJHA 3QAZC 3R8BB 1HZHH 5CD3A 1JNNH 4HK3J 5FKAB 4ZSOE 4PGEA 4Y0GA 5CUSH 3MUGA 3H9SE 1CLYL 1NGQL 5TH2A 3E6FA 5I1HL 3VWJB 1HH6B 1OTUC 4FQ2H 3UAJC 4F8QA 2W9EH 1XFPA 1R5WA 3UP1A 3PABA 3CSYB 1JWUB 1TJHL 1S5HA 5CIPH 5ICXB 5CJOH 3FQTA 4QOKD 1FAKT 4ODTH 2XRAL 2Z31A 4JO3L 4UILL 3ZKQD 3ZE2E 5DMYA 4OZIF 1JGEB 1JRHI 1KN4L 3UTSE 4BFBD 2XTLA 1FORH 2GSIA 1KCSL 4KHXH 4UIKH 4GXUM 4I9WD 4NM4H 4RRPA 5KAQF 3EHBD 5D93B 3MOAH 4K55A 1EFXD 5AYUH 2AJ3A 3LHPH 1FH5H 1HIMH 4ZOAA 2DL9A 2X7LB 5KSVB 1BFOB 1JGVL 5EUOB 2BNRD 4QXTB 4YHOH 2LU7A 1JGLH 3LEVH 1MCQA 4JM2B 3VFVA 2FX9L 3VWJC 4EVNA 4C83B 2EE6A 4S1SL 5K93A 4LF3A 1BQLH 4ODVL 2VSCA 2R2EB 1S7UA 4PJ5D 2LAAA 5I8EA 5DGRA 4GKSB 5LQBH 4PJGA 1EX0A 4MJIB 4MVBA 4XXDB 2QKIB 3KS0H 1HH9B 3ARGA 4X99A 4FQXA 2HJKA 5HHXH 3UPRB 4R8WH 2CLRB 5DFWH 2F58H 2Q1EA 3DV4B 3FCTB 4NSKA 4WWKD 1A1MB 3UO1L 4FS0A 4YNYB 1CGSL 4KROD 4ALAH 4NUGH 3QXTA 3WSQH 1E6JL 1WAAF 4NKOA 3X3FL 4XBGB 3LEYH 1MI5E 5B22A 1B4RA 5D93C 4Y5VC 2VDKH 2DYPB 4KTDH 3V4PL 1KTDA 3MLZL 4OZ4A 4G8IB 4Z9KB 3QPQC 1TITA 2DQGH 5IBUG 3SE8H 3CU7A 4KVNH 5DD3L 1H8OA 5MENB