2ET1A

Oxalate oxidase in complex with substrate analogue glycolate
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
201
structure length
201
Chain Sequence
TDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and spectroscopic studies shed light on the mechanism of oxalate oxidase
pubmed doi rcsb
molecule keywords Oxalate oxidase 1
molecule tags Oxidoreductase
total genus 44
structure length 201
sequence length 201
ec nomenclature ec 1.2.3.4: Oxalate oxidase.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2et1A00
4MH0E 2B9UA 5BUVA 1EY2A 2EA7A 4Z82A 3FE5A 4ONUA 3B02A 5FLHA 5BPXA 4E2SA 4DINB 4XFGA 1X7NA 4IEOA 4HLTA 2UY9A 4L2NA 4KL1A 2WFPA 4XF0A 4XF3A 1WA4A 4E2QA 3FX3A 3RPQA 3MZHA 3H1WA 3KSCA 2Z69A 1O3RA 2CGPA 4JV4A 3H7YA 5LEKA 1YWKA 1I5ZA 5J3UA 1J3QA 2XGXA 3OTFA 3MPBA 4IEZA 1X82A 3LAGA 1XE8A 2UY8A 3GYDA 3BALA 4EWDA 1CX4A 3FJSA 5KBFA 3ACLA 3ELNA 2KXLA 4P9GA 4E2GA 4XFFA 2OA2A 2ETEA 4META 4D7SA 4QGNA 3OF1A 2UYBA 4Z07A 2CAUA 1EYBA 3MYXA 4TLFA 4RD7A 4IERA 1ZNPA 1ZZ6A 4QGLA 3H3ZA 4BH9A 1ZZBA 5EZWA 4I0BA 4JTNA 4WZCA 4MGIE 1YFXA 4IETA 5AVPA 3DN7A 4WVZA 2XLGA 5C8WA 3UKTA 3H1MA 4XEZA 3EQEA 2CV6A 3WW1A 1DGWA 4HMZA 3KGZA 1V70A 4D7TA 2I45A 5KHHA 2H6CA 1LR5A 1ZRRA 4I3PA 2K9ZA 4IEPA 3R6SA 3LA7A 1YLLA 2H6BA 2FMYA 1LRHA 2D40A 5JSOA 4HN1A 3VHRA 1U12A 1DZTA 4FAHA 4XFIA 5JAXA 3FZ3A 3KCCA 1JUHA 4O9GA 1G6NA 5FDBA 1SFNA 4FT8A 5KHJA 4EROA 4LUKA 3G7DA 5T3NA 5I93A 2D93A 3FWEA 1CAUA 4BYYA 4LLOA 3D82A 4KWLA 4LULA 4ZU7A 5CADA 3SCFA 1RTVA 3S7IA 4HZFA 2ET1A 2O1QA 3SHRA 4KU7A 1Q5OA 1O3SA 3QOPA 4O9EA 4HVRA 4I0AA 1CGPA 3LZZA 3KMHA 4AVAA 4ORFA 4AQ2A 2IXIA 2BYVE 3U0ZA 1YFUA 2OZJA 2PHLA 1X8MA 3H7JA 3CJXA 1WLTA 4IEVA 4YRDA 1OFNA 2PFWA 3S0MA 1NYWA 4QMAA 1H1IA 1Q43A 5FLJA 2C0ZA 2XLAA 2XKOA 1HW5A 3CL1A 4JTOA 3I54A 1EPZA 1YHFA 4J1XA 1ZZ8A 2P17A 2PAEA 2QJVA 3CEWA 5I0UA 5JSPA 4XF4A 4HVOA 1WGPA 3U11A 1L3JA 1FI2A 3ZDSA 1QXJA 3D0JA 2EAAA 3ST7A 4MGKE 1UPIA 2HJIA 2QDRA 4HSLA 3LA2A 4NVPA 1RGSA 1O3TA 1LKNA 4R8HA 1TQ5A 3PLQA 3EO6A 1YFWA 5F1RA 1CAUB 2XLFA 4HSJA 4AQ6A 3DKWA 4XF1A 4KWKA 1YUDA 5BY5A 2WC2A 5I0SA 4L11A 4IESA 1QWRA 1UW8A 2PTMA 4IEYA 1CAXA 5I8SA 4HN0A 4ZU5A 3I59A 4XFBA 3E5QA 3C3VA 2HKXA 3M70A 3NSTA 2MNGA 4UBGA 2Q0AA 3DV8A 3RDIA 4OFGA 3RZZA 3IDCB 3MDPA 4N9IA 1UIJA 3IIAA 2BGCA 2PQQA 3WW2A 4QM8A 5LRRA 1ZRFA 1H1MA 3O14A 2B8MA 3CLPA 2BEOA 1VP6A 1ZRDA 4N9HA 5C6CA 3E6DA 1GQGA 1SQ4A 2VQAA 4YNIA 2E9QA 4PIYA 4AVCA 1CAWA 4IEWA 5HI0A 4QGMA 4OLLA 4YYOA 4I01A 4Q0PA 1IPKA 5I0TA 4Q0QA 1X8EA 4KU8A 3SMHA 3H3UA 2IXJA 2PYTA 2D5HA 1IPJA 4EWAA 1LB2A 2MHFA 5FLIA 3RYRA 2QNKA 3E5UA 2Q1ZB 1NE6A 1PMIA 3RYPA 2V09A 3LWCA 3N4MA 3TNPB 4I09A 2Y0OA 4PIXA 2GZWA 4BIFA 3GBFA 2PAKA 3PNAA 4MZUA 1UIKA 1FT9A 2UYAA 4Q0SA 5KHKA 3IWZA 3OCPA 3QACA 2VPVA 3E97A 4IEQA 4YSFA 1PM7A 1CAXB 4Q0VA 3WW4A 3I59B 4JVAA 4XF9A 4B29A 5I91A 3NW4A 1XRUA 1ZX5A 2OYZA 4XFHA 3EBRA 1NE4A 5CU1A 1J58A 4AXOA 1RUOA 2XKPA 4IEXA 3IDBB 2VECA 4XFCA 2XHKA 1FXZA 3U10A 3S7EA 2EVXA 4J1WA 3E6BA 1YFYA 3E5XA 1OD5A 4I02A 3FFQA 3LOIA 3PVBB 1NXMA 3NVCA 1O3QA 3TNQA 3OGJA 1CAWB 3H8UA 2K0GA 4IEUA 4MX3A 3D0SA 4XETA 3WW3A 3E6CC 4UBHA 3H9AA 3M3IA 4QX5A 2GU9A 3HQXA 2IC1A 2OZ6A 2PA7A 2XL9A 2GC0A 3ETQA 4H7LA 2GH2A 1CAVA 2IXCA 4F8AA 3DL3A 3NJZA 3HT1A 4F7ZA 4LA2A 1XE7A 5KHGA 1DGRA 1OI6A 3USSA 2Z2SB 2MPFA 1Y9QA 5FPXA 5FCCA 2O8QA 1J1LA 3RNSA 5I8TA 1UCXA 4LUMA 2GC1A 1OMIA 1ZRCA 1SEFA 2DCTA 3H1YA 3NKTA 3H50A 5EFUA 3OD0A 2Q30A 3BPZA 4EV0A 1UD1A 3KGLA 2N7GA 3RYKA 1O5LA 2IXLA 1VJ2A 2GAUA 3ES4A 3LA3A 1I6XA 1ZREA 3JZVA 5I8YA 2PAMA 1J3RA 1DZRA 4PIZA 3UKVA 4R52A 4LA3A 2BNMA 5J7MA 1Q3EA 2F4PA 4ZU4A 5LRSA 3I7DA 4MV2A 5FQ0A 5LEJA 2ZKLA 4PJYA 2IXKA 2QVSB 3ES1A 2ET7A 1ZZ7A 4QXKA 4X6QB 5J48A 2GC3A 4CYDA 1O4TA 4KWJA 4HVQA 1J59A 5E16A 2ZCWA 1QY4A 3SCGA 4UXAA 2CAVA 1CAVB 5JCTA 2IXHA 4LEJA 3SCHA 2BNNA 5BXXA 2H0VA 4XFAA 1RUNA 2FQPA 4MGYE 4LTAA 4Q0UA 5E1RA 5FPZA 4I2OA 3SXWA 2PHDA 2Q4SA 3IBMA 4MGZE 3HIFA 4Q29A 5JSRA 1ZZCA 3EJKA 1NZCA 4GULA 4X6RB 1ZZ9A 3UKNA 3BCWA 4HBNA 4AVBA 2ATFA 2OPKA 4MUVA 1O7FA 2B5HA 3FHIB 4FBFA 4QM9A 1J3PA 3BU7A 1QXRA 2GC2A 1RL3A 2BNOA 1EP0A 5BV6A 5D1IA 3CO2A 4BHPA 3BB6A 1O5UA 4WBBA 1Y3TA 3HT2A 5FQ0B 4K8FA 5CVRA 4FAGA 1VR3A 1ZVFA 4YARA 1GQHA 3CF6E 3ROUA 4A2UA 3EHKA 2D5FA 5I0RA 5JR7B 2XL7A 3NL1A 4EWEA 1RC6A 2QCSB 5KHIA 3L2HA 5K8SA
chains in the Genus database with same CATH superfamily
3AM2A 3M3CA 1V6MA 5IUQA 4QAWA 1QOOA 4MGTA 4WV8A 1F31A 5IW0A 5F5IA 5SV5A 3MEPA 2ZGPA 2IVJA 3BPSA 3ZFFC 1LHVA 1DQ0A 3USUA 1MR5A 2R0HA 4L0PA 4ONUA 3B02A 5K0UB 3V64A 3MFAA 4GMP1 4MHUA 2YGMA 2WZPP 2FZ1A 2V5YA 4GB31 4E2SA 1C8NA 4FFFA 1E57A 1AR83 4XFGA 2A71A 4YM0A 3TAYA 4L2NA 3TRSB 4DUXA 3VV1A 4AHYA 4FPOB 5AFEA 4YZ3A 5K9YA 4CUAA 5IVYA 4BQXA 1Y9MA 2JG8B 1XNKA 3ZOIA 3FX3A 5T52A 3OGRA 1OPOA 4R4XA 1W8OA 3WUDA 2W5FA 5T55A 2DDUA 2WO3A 2PLV3 3KCXA 4A7ZA 5LEKA 3H7YA 5FPBA 4QB6A 2YV8A 4UW4A 4ET7A 2Z42A 4A4AA 5EIYB 1NY72 5FY1A 1CVNA 4FPHA 3IMMA 1MS3A 4XCAA 2UY8A 4CP2A 2A3YA 2RDSA 3IM0A 3TBDA 1VBA3 3BALA 4BXFA 5KBFA 1W8TA 3ACGA 3WF3A 1OQEA 1ENQA 1QJU3 3B9IA 2DBNA 1D7PM 1UMZA 1VBC2 4L99A 1E5SA 4XFFA 1OLQA 2VUAA 5ABJA 4FFHA 5FXWA 5C9AA 5FAXA 5C71A 1ZBE3 2VTFA 1EYBA 1DLCA 1OLMA 3PUQA 2VG9A 4Y33A 2JDUA 2AENA 1D4M3 5C8CA 3SH5A 1UOJA 1PO12 4YW3A 3VZNA 4NMIA 1XU1A 3NV4A 1ZZBA 4JTNA 4B4QA 3ZO0B 4WZCA 4AVTA 1HXS1 4HXCA 3CHXA 3KV4A 3RI9A 4W8JA 4YFZA 4WVZA 2X05A 1W0NA 2VCMA 5DDJ2 4ZKTB 3VKFC 5EJ1B 1UNBA 5FUNA 2Y6HA 4S2FA 2V4AA 3VBFC 1JOJA 3EQEA 2CV6A 3I3MA 1A78A 4HMZA 4YW2A 4LBJA 1WWYA 1JZ8A 4L8QA 1W03A 2C24A 4QKBA 5KHHA 2H6CA 1LR5A 4FOWA 4AEDA 5CFDC 3MV11 1A8MA 4IEPA 4IV1C 4XXPA 1QU0A 3J7LA 4M4RA 1UKRA 4CTEA 1SLIA 3VB9A 1X36A 2YPJA 2EF6A 3FZ3A 4LBQB 4Q4W1 3TN91 3WNPA 3ZYFA 5C4WC 2GP3A 4NHMA 4XUQA 3S6PA 1WD4A 2WLPA 1QNYA 2WSVA 1G6NA 3AL6A 4A45A 1SFNA 4FPGA 1UU6A 4S2HA 4EROA 1QEXA 4MOAA 2IFWA 3OSDA 1W8UA 3MF6A 2WT1A 5T3NA 5I93A 2FMDA 2NZ9A 3CBNA 1LHOA 1R1A3 4PLNA 1H4GA 3LPGA 1RINA 1UY1A 4UF0A 5A3OA 1OSGA 4CPBD 1QQP3 1HRI3 1COV1 1RTVA 2EIEA 2HBTA 2WZ8A 3FLRA 2ZZJA 3HOBA 5G05L 1CZSA 2YC0A 1OBNA 2O1QA 2WNVC 2XVGA 3LB9A 4GJZA 3VDDB 3PUHA 1OD3A 5FY4A 2WDBA 2C26A 1O3SA 5B2GB 3K3NA 4O9EA 2Z79A 3PMEA 2OUJA 1STMA 2ZHLA 5JWPA 1CGPA 3JB4C 3WDVA 3N7LA 3B9CA 2BVVA 3DPRC 2IXIA 5L19A 5FKBA 1PGL1 3U0ZA 1YFUA 4GJYA 4GMP0 5JPMB 1FV2A 1SDDB 2EIGA 1WCUA 2OZJA 2VE1A 3MBWA 4YVWB 1XNAA 3HQUA 5FFOC 4BQ5A 1X8MA 4JKMA 2D6NA 2ZMLA 5BNPA 1SPPB 2BDRA 1NCRB 5C33A 5LWBA 5CFCA 4IEVA 4YRDA 4EN6B 1BMV1 3H3LA 2HWE1 4W50A 4Y5Z0 4XUOA 4AYUA 4NAMA 3HR9A 3VN4A 5DQ0A 1HW5A 4Y4YA 1W6MB 5IFPA 5JPNB 1WZXA 2RM23 4D7YA 1FATA 3AMPA 2D98A 3N9OA 1YHFA 4RN5A 1NAEA 4J1XA 3AYAA 4YVSB 2PAEA 1W6NB 2CTVA 4DUVA 3J8F1 1RHI2 3DYOA 4LT5A 2VQTA 4W6XA 1H30A 5FYMA 1W6PB 1DFQA 3POGA 1Q8SA 1FI2A 3FUOA 5JOWA 1RUE3 4OI0A 4ARXA 2VOVA 3ST7A 3JCIA 2W95A 5DXDA 2VMEA 5HV4A 1UPIA 2HJIA 4HSLA 4CSWA 2W92A 2EICA 3OBRA 1RMU1 3LSEA 1S4CA 3KHBA 1HJFA 1N1SA 1QOTA 3SEPA 1U5YA 3PJQA 4JKKA 2B4KA 3LEMA 2XLFA 3ACFA 3VHOA 4BMEA 3P3NA 1DQ5A 1OA4A 4AQ6A 1X33A 1XYOA 1SDWA 3OGSA 1RUI2 3N9LA 2F17A 4IE7A 4PDWA 4Q5OA 4QXHA 3SH3A 1V6IA 3GXUA 4LXLA 2VMHA 4CDQC 4IESA 1MVQA 1UW8A 2PTMA 5E8AA 1PK6B 1QIQA 1S0FA 1RUG3 1DYKA 2P37A 1FMD1 4XJAA 4ZU5A 3I4IA 4O61A 4D94A 1TZOA 1UAIA 1WW4A 4UWDA 3A0KA 3ILRA 2GNMA 4IGOA 5DN2A 5FYHA 5A80A 4AHXA 3NSTA 2ZX3A 4B8EA 1ZM1A 2JKBA 1QJY1 1T6GC 4QHBA 1D2SA 4NN0A 3U1XA 3LPFA 3RDIA 2WO7A 5HXMA 4KWUA 1LODA 2XJPA 3IDCB 4RQPC 3WOGA 2ADEA 5BNOC 3LOBA 2DCZA 4CEWA 3ZX7A 3WW2A 5LRRA 1BQPA 1ZRFA 3CLPA 3PTRB 2R071 3I3BA 1W2UA 4QPGB 1W2AX 1VP6A 2BEOA 1ZRDA 2RS32 1PZ7A 2VVFA 1RVF3 2VBBA 1GQGA 1CZVA 1WCKA 2J22A 2VQAA 2ZX4A 2YDEA 3HD8B 4GB32 4GKYA 4B7EA 2W87A 1CAWA 5J96B 4LBLA 4QGMA 4YYOA 1MS0A 5A3MA 1X8EA 4COVA 1UMHA 2LRPA 5T54A 4MO3M 4SLIA 4EWAA 2D5HA 1VAMA 2Y26A 3AMNA 2MHFA 1LB2A 4PT6A 3VDCA 3RYRA 2QNKA 1XQNA 1NE6A 1OQ1A 4ATEA 3AYCA 3INAA 5FZ1A 3AXDA 3RYPA 1YQCA 3N4MA 2WT2A 1RUF2 1GP5A 4I09A 3POFA 1ZBA3 2QFEA 4XILA 1UYPA 4LBQD 1KFXL 3S30A 5LY1A 1UZZA 4WM8C 4FTBA 4KH9A 1XOYA 1JW6A 5FMCA 5D8AB 1JZ7A 1OH4A 3T0BA 2P34A 2UWBA 3IWZA 5FYUA 1OT5A 3UETA 2GMEA 4OMDA 3GDBA 2W1QA 5LA9A 3O1SA 4K7JA 2DU1A 2WNUB 3WNKA 2XDVA 2J1SA 3U14A 3E97A 1CAXB 1HN0A 2VTXA 1JUIA 2ZEYA 4N53B 3I59B 5FZ3A 4N90A 5L9BA 1KEXA 1Y7BA 3OEBA 3VBSB 4AFCA 3MIEA 5DAVA 1LGCA 4V2WA 5ACA1 4JQRA 2YFZA 3T1LA 3KWVA 3CU7A 3WP5A 3EBRA 1G86A 4AFBA 1GKBA 3UGGA 3WQ7A 5EXOA 2XKPA 3BYWA 4U2AA 2VECA 2B46X 1HXS2 3THDA 4GWJA 4BIOA 3WDUA 3VLBB 4QPIC 5A32B 5FKCA 1VBE3 1W2OA 2A3XA 2EVXA 4GWNA 4AI8A 4WM7A 1PM4A 2QUOA 1YFYA 1JYVA 5CB7A 1U0AA 2P3IA 1S0IA 2V5DA 2WFF1 2D6LX 3LOIA 3M3EA 3CZUA 2YG0A 4IV3B 2YXSA 1UPSA 1ND3C 4JZRA 3T4VA 4M3CE 1GUIA 2VAUA 2Y0IA 4RHV3 4Y22B 1G9CA 1AUYA 4HL0A 3ZXAC 4QHOA 4FP2A 3H42B 4IEUA 2VO5A 3BIWE 3D0SA 4QXCA 4UFHA 1WA6X 3M3IA 3E6CC 4HKOA 2GU9A 3GZAA 1C4RA 2O0OA 1K5MB 1UO9A 1E5RA 2IC1A 3BGAA 5K7PA 1JHJA 1KJLA 4JGZA 3TN92 4AAXA 1NCQC 5H9RA 1Z7S1 4CXWA 2DTWA 1KS5A 4LLFA 3ZFGC 2FHRA 2IXCA 3SISA 4F8AA 3DL3A 4FQ4A 4Q4X1 4A3XA 2JE7A 2JDKA 1H1AA 4XQ4A 3USSA 2Z2SB 5DG1A 3BKZA 1RUJ3 4RYDA 1AL22 4UT5A 5FCCA 1J1LA 1EPWA 2GN3A 2NM1A 3MICA 3QH6A 2E31A 2ZTNA 4KMQA 3RNSA 1UCXA 1I9RA 2VMFA 2GC1A 4LUMA 3IPVA 4M0HA 5JMOA 3FLPA 1UYZA 4MLOA 5EFUA 4N43B 5LASA 3WF4A 3OD0A 4MADA 2Q30A 5JR2A 4EV0A 1UZYA 3R05A 4HKWA 3D3AA 2X5IA 4AL9A 4JRAA 2N7GA 1DGLA 3B00A 5A6XA 1MS4A 5FZ4A 1JS9A 2ILMA 3VBRC 2I74A 1RXFA 1TMF3 4UW5A 4YVSC 5HCHA 3LA3A 2VVEA 4L9BA 4NHYA 2RS13 2WWSA 3N35A 4TTGA 4CPBA 2AGSA 1ZREA 2JD9A 3JZVA 5I8YA 2QQIA 5FY0A 2W1WA 1N3PA 1OVSA 1SMVA 3KQRA 2DVGA 1PVC1 2HWE2 2BWCA 2XWBB 2YZ4A 3UGHA 2YFUA 1OUSA 2HWB1 2CDPA 1OFSA 3MW3A 4Z1VA 2D7FA 5C3QA 4BK4A 4RFRB 4MV2A 5JVVA 3VKMA 4DFSA 5C70A 5FQ0A 4M00A 5LEJA 3D5OA 2ZKLA 3UV9A 5JI7A 2ZGNA 2VGDA 4QPWA 5GZEA 2JDHA 1JH5A 3I2JA 3CJIB 5J48A 3ZN5A 3L9JT 3ZMNA 3J8F2 1IQDC 4FXKB 3VBHB 4DRVA 5CKQA 4KWJA 1J59A 2IFRA 4QX3A 2ZCWA 4HKLA 3NV2A 2D44A 4RS5B 3KT7A 3ZN6B 4CDUA 5F9TA 3T2OA 2VUCA 2XJSA 1OKOA 3PIGA 1F15A 3POYA 2VZUA 3IIIA 2AACA 2ZX1A 1AR93 1YC61 4WVMB 2JWPA 3B7MA 3LFIA 2JX9A 5DAQA 1URXA 4FOQA 3RS6A 3ZXJA 4DEQA 2IXHA 4KGQA 5BXXA 1N1TA 3WDTA 2IZWA 3J4UH 4ZXKA 2H0VA 3HN3A 4XFAA 2XJQA 3ZSLA 1SLLA 2OW4A 1G9FA 4GZ9A 5FPZA 4OI4A 5FZ9A 5A3LA 3Q8EA 4XUPA 1AYM3 4I2OA 1ULDA 5K0UA 1PGSA 2Q4SA 2WZR3 3JXSA 3HIFA 1B09A 1H2LA 4H2AA 5IVVA 1WLWA 1S2KA 1FMD2 4RR3B 2RM21 1Y4WA 4X6RB 3RRDA 4ASLA 4UI9L 4NAOA 3VBOC 3WDYA 4AVBA 1ASJ2 2JG8A 4FPJA 5FYZA 5JZGB 1W9YA 5A7WB 1QJY2 4MVTA 1AXZA 3W9AA 2VMIA 2ZHMA 4CZSA 2B5HA 4M4PA 4Z2AA 2WAAA 3ZFFB 2C6SA 4CCNA 1HV0A 1D0GA 2WBKA 4QM9A 4AI1A 2XONA 5FZMA 5FYYA 2BERA 4BISA 5L7OB 4LOSA 4OUSA 2R072 1NY71 5D1IA 1D2QA 5FYCA 1X9PA 1NOVA 4CUCA 1BCXA 1TEIA 2E7QA 1S0GA 2C1FA 2J1VA 4PCRA 4AWDA 5EYYA 5EJZB 1VBC1 3BTXA 3CF6E 4ISQA 1RJ8A 3M7AA 4HK9A 2DTYA 4AEKA 4CUBA 2OKXA 4NIDA 1C3HA 4XJZA 1RUG1 2G19A 2WNUC 3PUIA 1JZ4A 1PO11 1JOPA 4BLJA 2YY1A 4A3ZA 1HQNA 2WYSA 2RDRA 2Y34A 3KVBA 1WCQA 3VBSC 2DVBA 3L2HA 4XBQA 5JUVA 1ULPA 5LW9A 1YNAA 3LEGA 1YIFA 4XIKA 3BODA 1JN2P 4EN9B 2ZAHA 5DDJ1 4Z82A 1AR73 4BZ4A 5KC5A 3FE5A 2UWAA 3WNXA 4NR1A 1XNTA 1D4VB 4PI2A 4NRQA 5BPXA 4BJ0A 4DINB 5C3PA 1C57A 3PU8A 2UY9A 3RZGA 1QJZA 3UJOA 4BQ3A 4E9KA 2RDNA 2VQUA 5GKAC 4W6YA 2KM2A 1RVF1 2FCTA 1APNA 2JG9B 3JB8A 3VD9A 4IV3C 1GZ9A 2WN2A 3ZYRA 1W2TA 2Q1MA 2VOTA 4LBQA 5ACA2 4DRRA 4XF3A 4FPLA 1B35B 4E2QA 4QKDA 2Z4FA 1PZ9A 3ZR5A 2ZABA 4NHLA 3LD8A 5LA0A 2HYKA 1GZWB 2VCCA 1O3RA 3VBFB 4JV4A 5LZ6A 2VCBA 3HMYA 1QDOA 1CIWA 1I5ZA 2W68A 3AFKA 5FUPA 3OPTA 3NNMA 4LIUA 4Y24A 1PO23 4IEZA 5JXHA 3W21A 1W99A 1XE8A 2PLV2 4PHZA 1MZEA 5IK8A 5CFDB 5KWRA 2NMOA 4IV1B 3ZM8A 3FJSA 3VDDA 3ELNA 4BOWA 1PGW2 5FTTC 3NRUA 5A7SA 2ETEA 2VMGA 1BBT1 1WLCA 1VBA2 5APAA 2UYBA 5JDBA 1UXXX 4QD2A 5C4WB 3FN9A 4Y1VA 2ZMNA 5A7PA 1QJU2 3MYXA 3ZSMA 5JLVA 1WCDJ 2A7AA 2TUNA 4HFSA 1N3QA 2JKXA 1DQ1A 1PIV3 4N43C 1F4AA 4YVWA 3T2QA 1ZBE2 2PHRA 4I0BA 1BVP1 1SPPA 4XBLA 1NCRA 5L36A 1D4M2 4RGAA 3AKSA 4MGIE 3AKQA 3R0RA 1DP0A 4IETA 3T4HB 4XC9A 3DN7A 2O8OA 1POQA 2P5BA 2FDFA 2ARXA 2XLGA 3V56A 1MQTC 3UKTA 2WNVB 4XEZA 4FTSA 4OUMA 1W6MA 1W0OA 2VZQA 1DGWA 4LHSA 4OMCA 2WRAA 1VBE1 5IVCA 2I45A 4LBNA 4P9YA 2RS53 1LEMA 4YVSA 1W6NA 3NNGA 5F7UA 3GHMA 4I3PA 2P3JA 1NUKA 2K9ZA 3LDBA 2Y6FA 3LA7A 1YLLA 3HNBM 3DPRB 5FJHA 5FXXA 5IAVA 1W6PA 1LRHA 2JB4A 3WG2A 2FD8A 1RHI1 1DZTA 4RHV1 4FAHA 1NA1B 3PVNA 4XBNA 4XFIA 5JIAA 5JAXA 3KCCA 3NKGA 4Y4RA 5LA2A 2RJLA 2W1SA 4XDOA 2CHHA 3VBHC 3T0AA 1J1TA 4FT8A 5E6HA 4XW3A 4Y1YA 4OCTA 2D3PA 4LUKA 4XCBA 2Q8CA 1GQPA 4TN7A 2QQJA 2VL4A 2JD4A 2JDMA 2WQZC 2G1MA 3FBMA 4AE2A 1DGRN 4ZU7A 3TB0A 1CR7A 3W5NA 1I3HA 4XQDA 3AXEA 2ET1A 1I1EA 1FOD3 1PK6A 3N7KA 5IK7A 1R1A2 5LATA 2FBEA 3QOPA 4DO0A 2A6VA 1QQP2 1HRI2 2VQ0A 3M4FA 4I0AA 4Q4Y3 5CNAA 3LZZA 3RWNA 3HPNA 3KMHA 4AVAA 3VKOA 5I0DA 3VBUC 4XHBA 1GNZA 4IE5A 4JX0A 5DABA 3SKJE 1KITA 1VALA 4HG6B 5G04L 3J7MA 5J37A 1XJAA 2FDGA 4O7XA 3H7JA 4HT1T 2QTWB 2JB8A 1MZ5A 3RGBA 2ZGLA 1WLTA 2R49A 1AX2A 1TMF1 1BXHA 2PFWA 1IKPA 2D6OX 2RR13 4Y5TA 5H9QA 1UY2A 3HWJA 1H1IA 2YBKA 3MIBA 2IVIB 4QPGA 2XLAA 4CDQB 2JENA 2EALA 4DOUA 1W06A 2Q1FA 3HAGA 3MI8A 3MLKA 1EAH3 3I54A 4XIOA 2WAOA 1EPZA 2VC9A 2RS31 3ZFEC 5FYVA 3FL7A 3VL8A 5J09A 5L7OC 2A1XA 2P17A 3CEWA 2WWJA 1FPN3 4XJ9A 4CCEA 1PNFA 2RM22 4AR2A 4Y20B 4AF9A 4YW7A 4COWA 4XQWA 5ISLA 3HNMA 5LCWL 1REFA 4RQPB 5BNOB 3D0JA 5AC93 4TSVA 1PHMA 4SBVA 3OBAA 3LA2A 1IG0A 1DU3D 3AJZA 1XB9A 2FCUA 3GCXA 1O3TA 1RUE2 1C8M3 2QQVA 3GJAA 4XACA 1OH3A 1TQ5A 1C5IA 1IS6A 2XJUA 1RUF1 1Q8QA 1YFWA 1KGYA 1S2BA 1AR91 1CAUB 4HSJA 3CQOA 5D8AA 3DKWA 2P6CA 4JKLA 4KWKA 4R9AA 4XF1A 4CDXB 4D6SA 4HK8A 3RSJA 4YPJA 1YEWA 2WNUA 4L11A 5DUVA 3POIA 3NO8A 1GWKA 1GR3A 5AVAA 1CAXA 5I8SA 4N53A 5EWSA 3I59A 2WZR1 3VBSA 2V4VA 1NKGA 3POWA 3ZIWA 1V9U3 3WNOA 4G9SB 2HWC3 1M4WA 3M70A 2BV4A 1RUG2 1R093 3RG0A 3NMBA 2VJXA 2XQRA 3R4SA 4Q4V3 2XJRA 2P1BA 2JG9C 3JBG3 3MDPA 2WZEA 4N9IA 4WM8B 2ORZA 5A32A 1QNWA 2BGCA 2PQQA 2VUDA 4AFAA 4QM8A 1AYN1 1B35C 1H1MA 2XUMA 2W2IA 4AHWA 3OYWB 3PDQA 4P14A 4FPCA 5HCFA 1LHUA 1MEC3 5A3TA 3KV9A 4LBMA 4N9HA 4IV3A 3POJA 5FZCA 4EZ4A 3EYPA 4QX2A 3HN1A 1S0DA 3J26N 4AEMA 4Y22A 4PIYA 4PLOA 4IEWA 3AMHA 4I01A 3SQOA 2OUHA 4Q8LA 2RJKA 1KS4A 1RVF2 3SMHA 1WW7A 4FP3A 4W4ZA 3HBZA 4QDQA 4TWTA 1XYPA 1UX7A 2XBO1 3FC0A 1K5MA 5FZLA 3VKNA 4BLIA 3O1VA 4E8CA 3ZVXA 2QKDA 3AK0A 2VD7A 4FPKA 4QPIB 4ZS2A 4CCKA 1WLDA 2WSUA 3W58A 1UKGA 3O1RA 1LENA 1DYOA 2GMPA 1GP6A 3AX4A 4IE6A 1QKQA 2GZWA 1RUC3 3JUUA 4BIFA 1CJPA 2Y33A 1AR61 1ND3B 2PAKA 4G4FA 5F6KA 1AZDA 4MZUA 1FT9A 4FQZA 1ZBA2 1TME3 4DS0A 2TNFA 5KHKA 1AL21 4ISRA 1H9WA 3OCPA 4LE4A 5IK4A 1BEV3 1HRV3 3THPA 1F2NA 1WMDA 3X29B 5FO8B 3QACA 1IGOA 1BBT2 1AR71 1X9TA 2P3YA 4N43A 4XABA 5F39A 1PM7A 3WVJA 1BYHA 4B1LA 5HV0A 5FZ8A 1RUH3 4Q0VA 1U5XA 2AH2A 4LKFA 1NCQB 3U37A 5GZDA 5I91A 2VOXA 5DZFA 3ZFGB 3GBWA 2OYZA 4CE8A 2OS2A 4LO8A 1LU2A 1NE4A 1J58A 2NMNA 2W1UA 5A3UA 1O4ZA 5IJRA 3ZKYA 3POEA 1RUOA 5FP8A 1NXD1 1POV3 3NJYA 2VZTA 4Q8KA 1UN1A 5KXCA 4XTPA 1MS9A 2XHKA 3SEEA 1FXZA 1NA1C 3EMRA 3KZ4C 3ZPOA 4DXRA 3GJBA 2RMU3 3A7QA 4J1WA 2AEYA 3E6BA 1LOFC 3KT4A 3NNLA 4AFMA 1GSLA 1AL0G 2D6KA 3E5XA 4EN8B 1VBB3 1K5JA 4I02A 5GLVA 3GZTB 3FFQA 3RWKX 2A6YA 3NVCA 4YGBA 1VBE2 1MS1A 1N1YA 5C5TA 3CJIA 3WX5A 3TNQA 3OGJA 5BNNB 1VE0A 5IVEA 1VBD3 3VBHA 3CZJA 3VBRB 4MX3A 2P4EA 4OHZA 4XETA 3WW3A 3GF6A 1W8NA 3TEXA 3LDRA 1W39A 1OA2A 4RHV2 4RS5A 5LBEA 2LS6A 2JICA 3ZN6A 4QU1A 2PA7A 2XL9A 2ARBA 3WZ1A 2A6WA 3DYMA 2IWGB 2B9VA 4Y1ZA 4PLMA 1F4HA 3RZLA 2C9KA 5FMDA 5FZOB 3NJZA 4P9JA 3KVAA 1OUXA 1OHFA 2R16A 2VTXJ 1GNHA 1LGNA 1OI6A 1XU2A 2VUJA 1YJKA 1Y9QA 3OB8A 4FPYA 2VMCA 4MXWB 4RL7A 3ZYPA 5M0TA 3MHZA 1WMXA 2O8QA 5I8TA 1Q8OA 4AHZA 4JDNA 4PQQA 4X8NA 1SACA 5F3CA 5E88A 3WEZA 4JDOA 5FY5A 3WR0A 2QQNA 5CYYA 2D43A 3NKTA 1BKZA 3SLIA 4RR3A 1RUJ2 2ZEWA 3WD5A 2PMWB 1YXWA 4CP0A 5IWFA 1UY3A 2VZ3A 4M0NA 4AK3A 4BU2A 4XDQA 3RYKA 4BQ2A 5JZGA 5A7WA 2R043 1O5LA 1LESA 3HBKA 2GAUA 2JDAA 1NLQA 1ASJ1 4LBOA 1WBLA 3ZFFA 3V0AA 2VZOA 4URAA 5FZBA 1JYTA 1NLSA 4Y26A 1GOHA 4GXLA 4LA3A 3VZKA 1BHGA 4XVHA 4PBOA 1TMF2 5J7MA 1SZBA 3WXPA 4AGGA 5L7OA 4P02B 3N9MA 4GA9A 3VD4A 1O91A 2XQXA 4XE9A 3A23A 1BK0A 2BVBA 5T5PA 1VAKA 3I7DA 5F3IA 4IGPA 2ZX0A 2DV9A 5DAPA 2QVSB 3FHAA 2BRTA 2BU9A 3ES1A 4EN0A 2BW8A 4XOGA 1QJX3 3VBOB 2YU2A 4NO4A 1WW6A 2JDPA 5JXJA 2QBXA 2C9AA 3A4UA 4R9CA 4CDXC 3O0XA 1ULOA 3A21A 4HVQA 5HCAA 3DKQA 3K46A 3ITQA 1HB4A 4IXLA 1XNDA 1HB1A 1GANA 3ZSEA 2LROA 1QY4A 4BE3A 4Q4Y1 3I3EA 1EV13 2VW2A 1W9WA 2YU1A 3NQHA 1ONAA 2CNAA 3ZN4A 4P08A 4Q1RA 1XC6A 1CAVB 5JCTA 1JU3A 4LEJA 2BNNA 5FK7A 4ATFA 1KDKA 3RJ2X 4A7YA 3LDKA 4LMFA 1RUNA 2FQPA 2UU8A 4MGYE 4LTAA 1AR92 4LO6B 4Q0UA 1IHMA 5FBZA 3SXWA 3BIEA 1UL9A 2PHDA 4GALA 4LORA 3IBMA 3N7MA 1UU5A 2RR11 3U4XA 5C7GA 3FFZA 4Q29A 1AYM2 1SLTA 2WNOA 1ZZCA 1QDCA 1NZCA 2JG9A 2WZR2 3BTAA 4H55A 4QU2A 1W3VA 3A22A 3IKWA 3BCWA 1B35A 3K2OA 1FPN1 4QXBA 2HWD3 4XJUA 1AR81 3PL0A 1IG3A 1GZWA 2J1RA 3VBFA 3ZSJA 4FXGB 3A0NA 4NWVA 3K48A 3VD5A 5AC91 1J3PA 1AYN2 4MGQA 2GC2A 3UJQA 1REDA 2BNOA 4CDWB 5IAXA 1RITA 1US2A 1EP0A 1OVPA 1JOBA 1UMIA 2R1BA 2Y6JA 5A7NA 5CFDA 2PQSA 3NWKA 4IV1A 3AZWA 3BB6A 1NQDA 4FPFA 1O8SA 2PLV1 3HT2A 2XH6A 1R1ZA 3NAPC 4XAEA 3MIDA 3IAQA 5FZDA 4FAGA 1XSRA 1VR3A 1PGW1 5FZKA 1OXCA 1OOPC 1W8WA 3PUSA 3GALA 3OOXA 5C4WA 3NJVA 4BMBA 4A2UA 1QHDA 1YCIA 3EHKA 2YROA 2D5FA 2E7AA 1VBA1 2XBO2 1DQ6A 3ZDVA 3ZYHA 3PJYA 2XHNA 3I2GA 1QJU1 1SBFA 1RC6A 4QQLA 4ZXEA 4D6RA 2DFCA 4Y5SA 1SBEA 4XZUG 4NIAA 1GOFA 1V9U1 2HWC1 1ZBE1 3OBZA 5K8SA 2AUYA 3ZXFA 3JD73 4OVEA 3UK9A 1D4M1 1S0BA 2B9UA 2WQ4A 2WNVA 5BUVA 1EY2A 4YWAA 1OLRA 1AR62 2EA7A 1PX3A 2IUWA 1MZ6A 2Z5WA 3CKHA 3JBG1 4A42A 5A6ZA 5CG9A 4ZONA 1O59A 4CRQA 4HANA 5CZKA 1LNSA 1C1LA 3MUY1 1LHNA 3WNLA 4LQRA 3UYJA 1X7NA 1AR72 3DPRA 1XPWA 2RG4A 4HLTA 1MEC1 1AJOA 4IEOA 4XUNA 2F4LA 5DPNA 3G6JB 4P5HA 1CPNA 4AI3A 2NLRA 2VM9A 1NA1A 1QH7A 3ON7A 2GP5A 2XG3A 1WA4A 3E1F1 1DDLA 2WA3A 3RZJA 5BNNC 5FUIA 3H1WA 2BP6A 1GZTA 3UNPA 2LALA 4JAAA 1AXKA 4EYUA 1MQTB 5A33B 2W47A 1XNCA 1YWKA 3IMNA 5J3UA 1J3QA 5HXVA 4CXYA 4P5YA 4D3WA 3QCWA 1V6OA 4FOVA 1DCSA 4OI1A 3GYDA 2QQPA 4CP1A 4EWDA 4GD4A 1CX4A 3ACLA 3VUOA 3WSOA 1PO22 4A7KA 2OQ6A 2VXRA 3LEKA 2VH9A 1GFF2 2OA2A 3O0VA 4META 1W2NA 3WDXA 4D7SA 4NWWA 4COZA 3OF1A 2W91A 3B69A 1R1A1 4JQTA 2ORXA 1RUD3 3WQ0A 2CAUA 1CONA 2L9LA 1ND2C 3WCSA 4ITCA 1QQP1 1HRI1 3AZYA 1AJKA 2QQKA 2E63A 2E32A 3IN9A 3MW4A 3DGTA 3MPPG 3GHNA 1AX1A 5FYBA 1ZNPA 1ZZ6A 5E89A 3AVRA 4QGLA 5JOXA 4A6SA 4KI5M 5EZWA 1H2NA 2XOMA 1U5ZA 2XUEA 2DFBA 1RXGA 1YFXA 4GMP3 2XXZA 5AVPA 3T1MA 2FDJA 3GGLA 4GB33 2ID4A 3T30A 2DVFA 1PIV2 1UY0A 3WUCA 3MFCA 4BDVB 5FWJA 1C1FA 1LGBA 5CEHA 4CDQA 2OPWA 4QDSA 5C8WA 5L9VA 3K75B 1A6CA 5FZ0A 1H8VA 4ES8A 2WWUA 3WW1A 1VLNA 1KXGA 3RMYA 1EUTA 3VD3A 2HLEA 4L97A 1CN1A 1W8FA 4D7TA 1SFYA 4ES9A 1VRH3 2C5DA 4KBZA 4IQPA 1ZRRA 3S5QA 4AFDA 5F2WA 3VBUB 4Y20A 4YW1A 4FTEA 2ZGRA 4OHWA 2A70A 5FY9A 4AQSA 2D40A 3ZXGA 1K12A 2PHXA 3OUHA 3QH7A 3VHRA 1U12A 2RS52 5HBAA 4RQPA 5BNOA 4AQTA 1QXPA 3C7EA 2ZEXA 4ZY9A 2NQYA 4ZS3A 3ZXKA 1JUHA 2WYFA 4O9GA 5GM0A 2JXAA 4LKSA 5FDBA 4NIGA 4OHYA 3BOWA 4N7IA 5KHJA 1QH6A 1V6LA 3PMSA 3J9SA 3G7DA 1RUE1 4H3WA 4XDPA 2VOWA 2D93A 4DQAA 4UYBA 1CAUA 2ZX2A 4BYYA 3D82A 3POBA 4NE9A 2RHPA 3I2KA 3ZFEB 5CADA 2WS93 1UZWA 4CDXA 2VMDA 4J6GA 3SCFA 3S7IA 5FOJB 3I49A 4AI0A 2PN5A 1XSQA 2B42B 3PURA 4HZFA 3WG3A 4DMIA 3LIHA 2GNBA 2BQPA 2OIIA 1Q5OA 2HWF3 2BFUS 3AL5A 5DAXA 2ARAA 3RZHA 1HQLA 1NX9A 3M3QA 1FOD2 5A6QA 3CDZB 4OQ8A 3CNAA 2R6QA 3NJXA 4LBKA 3MLJA 1VMJA 2EXIA 4AQ2A 5BYNA 2QE3A 4QQPA 4Q2FA 4Q4Y2 3WHTA 5IVFA 4CA9A 2PHLA 3T0DA 2BFUL 2ZACA 4WM8A 3VZLA 4RGKA 3M3OA 2EXKA 4YM2A 5IK5A 3OD4A 3DCQA 3F2ZA 2R041 3OPWA 3ZYIB 4DY3A 1H4HA 2GDFA 3S0MA 4AGVA 4BQYA 3AZZA 1AHSA 1NYWA 3OYWA 4QMAA 1Q43A 5FLJA 4EQVA 2C0ZA 2NP0A 3AC0A 1HX6A 4XMIA 2E53A 3CL1A 5GALA 1OA3A 4RGGA 5IATA 3OGVA 1N3OA 2HEVF 2RR12 1KD7A 3O12A 4OI2A 3P3PA 4FFIA 4AOCA 3Q9OA 4Q4W3 4CDWC 3TYJA 2O14A 4LK7A 1EAH2 5I0UA 2I2SA 4XF4A 3ACIA 1S0CA 3WF2A 1WGPA 3U11A 1L3JA 1LU1A 3ZDSA 1SCRA 2KD7A 5ABJC 2RE9A 4OYUA 4YW5A 2R063 1FPN2 2DU0A 4AAPA 5C9AC 4QPIA 3OBTA 1AR82 1QOSA 1GNYA 1XBFA 3T2TA 1RYYA 3MV01 2HYXA 2Q8OA 4EE2A 1COV3 5FYSA 5C8CC 5JOZA 4R8HA 1V0AA 2GMMA 1NLRA 5AC92 3PLQA 3OY8B 5FK8A 1EV11 3C7OA 1ND3A 3EO6A 2R32A 4A44A 1WKYA 3O1TA 5F1RA 4DNYA 3JQWA 3VGIA 4D8MA 4IE0A 1C8M2 3S57A 2ZS6B 1V6JA 4OULA 4ARYA 3B01A 1DHKB 1ZRIA 3AZXA 4XJ8A 2WC2A 3THCA 2TBVA 5I0SA 1FNYA 5IYYA 2KA3A 1JZ2A 1QWRA 1ZBA1 2X10A 3GNEA 4BB3A 4IEYA 5T5LA 1H8TB 4HN0A 4URTA 2YHJA 1YI7A 3I2DA 5DUWA 4V1PA 5K4LA 1NCQA 5DZEA 3U75A 2QQLA 3C3VA 3ZFGA 3OUIA 2VCAA 1MPXA 4AEDC 2HWE3 4H7MA 1G9DA 3T08A 1UY4A 3LE0A 2ZEZA 2MNGA 4UBGA 2Q0AA 3LIGA 3DV8A 4OFGA 3RZZA 3I3DA 1DLLA 1V9U2 2XMLA 3I2HA 5HCBA 1ST8A 2HWC2 3RMXA 1R092 3MLLA 4DB5A 2AEZA 2QQMA 4TLGA 4E4ZA 4Q4V2 3PUAA 1UZ0A 3RI8A 4OUEA 2MEV3 3JBG2 1HLCA 5FJKA 4GH4B 3RJRA 2ADDA 3BN6A 5FRAA 2JDZA 5FIXA 4B4PA 3AFGA 2QQOA 4FSJA 2BWAA 2D3RA 3E6DA 1S0JA 1SQ4A 4YNIA 5CIRA 5DUUA 5F2SA 2E9QA 5BNNA 2WINB 5HI0A 1GWLA 2SBAA 1DYPA 4OLLA 1S55A 3VBRA 1MEC2 2ZGTA 1RMU3 1IPKA 5I0TA 3H8RA 4Q0QA 4KU8A 3K3OA 3W20A 2R30A 5FWEA 2FDHA 3AYDA 4LO5B 5FMOS 3H3UA 1T2XA 1IS4A 2PYTA 3APBA 3GM8A 3I3QA 4XURA 5FLIA 1GBGA 2H0BA 1JZ5A 3BOPA 3E5UA 1RIRA 4NPMA 4AVVA 2Q1ZB 4X8PA 4YGDA 1FYUA 1PMIA 1G9BA 5FZHA 2YUEA 5IFTA 4KBBA 5FZOA 3WV6A 4PIXA 3FMGA 3VD7A 3RQ0A 5A3PA 2DCYA 5FMOL 1SLAA 1BJQA 5CISA 5KXDA 4MXWA 5BNPC 3GBFA 2RVAA 5F5QA 5CFCC 3JU9A 2UYAA 4K20A 4EJRA 4NHXA 5JXIA 2ZKNA 2ZGUA 3URFA 1RUC2 4KG0A 5FZFA 2WL1A 2PHFA 1V00A 2YB7A 1MACA 3RZMA 1GOGA 3O0WA 4DPNA 1HV1A 4Q27A 4AVSA 1TME2 4B1MA 1RUJ1 3WW4A 4XF9A 1OQDA 4JVAA 1ULFA 5FPLA 5A1AA 1BEV2 1HRV2 1CX1A 3AP9A 4K21A 4O65A 1V6NA 3HQRA 1XRUA 3NW4A 3BU0A 3F95A 1RUH2 4OZXA 4NIIA 2B45X 4EN7B 1W3XA 1L7RA 4H14A 4IEXA 2A3WA 3IDBB 4YW6A 1S0EA 1HB3A 1YQ8A 2RV9A 5GLUA 1ZYBA 4AI2A 2W9XA 2JDYA 3D6EA 1HIXA 1WW5A 4P00B 2UWCA 5FPAA 2FDIA 3QD6A 4LIVA 2HH9A 4GKXA 1W9TA 2GALA 1DZQA 1GV9A 4KNCA 3N9NA 4K9SA 4KGGA 1OD5A 2RS11 4B4RA 3PVOA 1W04A 5GJ6A 3ZPYA 3ATGA 3PVBB 3PIJA 1GZCA 2RMU2 5EQUA 2V72A 3O7OA 5GLWA 1W6QB 2J7MA 3VBOA 2DUPA 1F9KA 4GQ7A 3TEZA 2FDKA 1VBB2 2K0GA 4JHZA 4PDWC 3KQ4B 1FX5A 3THTA 3H9AA 4AGRA 3V0BB 5EPAA 3HQXA 2YPDA 2ZZQA 1VBD2 3W59A 1IKQA 4GAZA 1ULGA 2E51A 1KRIA 1RUD1 1W6OB 4WZFA 3I97A 3WNMA 2WN3A 3QBQA 2OQ7A 2VVDA 1CAVA 1F5JA 2VW0A 4CU8A 4JHTA 1JYNA 2ZPXA 3U07A 4Z2WA 2BJSA 2YC4A 5FZ6A 3WF0A 2VBDA 1A3KA 3HT1A 5FYIA 4F7ZA 1FAYA 1W28A 1OURA 3W5MA 3DYPA 5KHGA 1DGRA 2DF7A 2G9GA 2MPFA 3K4ZA 3T3YA 1S1AA 4PF5A 4AEJA 4CEWC 1BK1A 4ZZ8A 4G3YC 3U78A 4AW7A 5ACA3 4CXXA 4DEVA 1OMIA 3T09A 1JYIA 4D0QA 1FV3A 1SEFA 3H1YA 1ZRCA 1W9FA 2WLQA 2VOKA 2OX0A 3H50A 4CP9B 5JXGA 4CU9A 3Q8CA 3BPZA 5T5OA 4LO4B 4M01A 1AYM1 1UD1A 1VMFA 1VRH1 2W3JA 4E27A 1VJ2A 2QDNA 1OF3A 1LECA 2BBAA 1VB4A 1IPSA 1HN1A 2G4IA 2WFF3 4ASKA 4NOTA 2D6PA 4C0HA 5T50A 1J3RA 1DZRA 3IAPA 4PIZA 2SLIA 3UKVA 4R52A 4XZPA 2R042 1WMFA 3ZYBA 1QJFA 2BNMA 2ZA9A 1Q3EA 3MGUA 5F37A 4CDWA 2G9FA 2UURA 2ZHNA 2F4PA 4ZU4A 2BOJA 2ZGOA 4K8RB 1Y9GA 1C28A 2AC1A 4NJ4A 1WUVA 4CEYB 5LRSA 4TYSA 2J1EA 3KD4A 2VU9A 4BM8A 2IXKA 4KG8A 4RA0A 5FXZA 3O1PA 2ET7A 2WS91 5F8PA 1DGWX 1Z7S3 2DUOA 4LHLA 4LNVA 1REEA 1W05A 1SLBA 1Q8VA 2BZDA 2CWMA 5DUXA 4CYDA 4Q4X3 1IOAA 4C0BA 5E16A 2HWF1 1QJX2 1BZWA 2JE9A 2HEYF 3SCGA 2ARCA 1H8TC 3AYEA 5F3EA 3VDBA 3C2UA 4XYXA 3LF7A 4BQWA 2XVKA 5EV7A 1LAJA 5GZCA 2CGOA 2CL2A 2ZXQA 2JIJA 5FZGA 1MVEA 1EV12 3NAPB 3M2MA 1H9PA 2WABA 4K40A 5GLTA 4CUGA 1SFPA 2X53S 3LSDA 3ZLIA 2VW1A 3M1HA 1XYNA 4WVWA 2YC2A 1OOPB 2ZGMA 4C90A 4MGZE 5JIUA 2J1UA 1YRZA 4WM7C 3WP6A 5DMYA 5EP9A 1LOAA 1R083 3N9QA 4GH4C 2WQ8A 4GULA 3SH4A 2PXJA 4JDMA 1PVC3 2EAKA 4AG4A 1DIWA 2ATFA 4QQOA 3SNMA 5A1FA 2HWB3 2OPKA 3WHUA 3NV3A 4UW6A 4MUVA 4HPKB 1MQTA 1E5IA 1ULCA 5A33A 3BTYA 4BQ1A 5FBJA 1X50A 2R061 3DXTA 4JGZC 1PMHX 3J7NA 4JGYB 2HWD2 3BU7A 2Y6KA 1QXRA 3DEMA 3UL2A 1JYCA 1YQ5A 1UWWA 3H8OA 4QX0A 5FYTA 5BV6A 3ZXEA 4N8MA 5C5UA 3B3QE 1TG7A 3CO2A 4BHPA 4XHXA 1O5UA 1E5HA 4DXZA 3OUJA 4LITA 3WT3A 2VZPA 3ZMOA 5AFBA 4K8FA 3J7HA 5CVRA 4V2VA 1PO21 1ZVFA 4YGEA 4YARA 5J98B 1GQHA 2ZGKA 3ROUA 4WVMA 1Y43B 2W94A 2D97A 5I0RA 1S2EA 1YYNA 5A7QA 1SCSA 2XL7A 3ENRA 3NL1A 5A7OA 4BA6A 4DIQA 4E4HA 1FNZA 4EWEA 4FO9A 4ASMB 1JYWA 2RJ2A 3K77A 4CU6A 2VBPA 1ACCA 3LKJA 5H9SA 3TOJA 3V65A 2CYFA 2X5IC 2QCSB 1A8DA 3TEYA 2WA4A 1PMJX 5CBLA 1IQAA 4MH0E 1O8PA 2DYCA 3KF5A 3L2YA 4ZHNA 4MG2A 1HKDA 5EJ3A 3TWIA 3Q8BA 3D8CA 1PIV1 3CMGA 4QKNA 3K4AA 3WP4A 2YMZA 4BPZA 4M3CB 2VNGA 3JD72 2QQWA 3AVSA 4HETA 3JQXA 5F3GA 2CGNA 1LOEA 1YO8A 2QQUA 2TEPA 2VZRA 5EYXA 5FLHA 5FY8A 4LK6A 2Q8EA 4CCCA 1ND2B 2MEV1 3VBUA 1YQ2A 3C7FA 1R64A 3HEIA 2J42A 4OQ9A 4KL1A 1M06G 1WMEA 2P2KA 3O1OA 1ENRA 2WFPA 4XF0A 4TZDA 5LA1A 4R9BA 2K2SA 2WNEA 2WIIB 2DUQA 2WO1A 4QPYA 1U5IA 2RS51 1YJLA 4W65A 1EUUA 1N47A 3IDAA 3RPQA 4CCOA 3MZHA 1RB8G 2F6BA 1DBNA 3GBGA 3KSCA 2Z69A 2CGPA 2YBSA 3ZSKA 2JIGA 2AR6A 2JDNA 5CA6A 4CDUC 2XGXA 3OTFA 3MPBA 1ALYA 2D3SA 3BTZA 1X82A 3LAGA 1VBC3 2EIBA 4NRPA 3K51A 4LHNA 3ZFEA 1JZ3A 1AF9A 2RS12 4GWMA 5FZAA 3TEWA 4CU7A 1K45A 3AJYA 2KXLA 4P9GA 3SKVA 4E2GA 4BQ4A 2BPA2 4CVUA 1PO13 1UX6A 4QGNA 4OHVA 3KB5A 5K0UC 3PHMA 3T2PA 4COUA 4Z07A 3ORJA 2YYOA 3IB3A 4N7UA 1CIYA 2VZVA 2CY6A 4TLFA 4AI9A 4RD7A 4DXSA 4IERA 1FOD1 2NYYA 5DDJ3 3H3ZA 1RUD2 4BH9A 5A70A 4C1XA 5JI9A 5C3OA 1Q56A 4NPLA 3POSA 2JG8C 2I07B 1MS8A 2XJVA 1PX4A 5IVJA 4OZOA 2Y60A 3MIGA 5F5CA 1NG0A 3HNYM 2WJSA 4FPEA 2ZJCA 2BGPA 3H1MA 4LE3A 3NV1A 3USUB 3KGZA 4E4DX 1SLCA 1V70A 1H0BA 1W90A 5FR3A 1HJGA 3OG2A 4IL7A 4QWNA 5CKMA 5F32A 5H9PA 2DVAA 5LK5A 3R6SA 2V73A 2H6BA 4FOYA 4CEYC 3C7HA 2FMYA 2VZSA 4LKEA 1SG3A 5JSOA 1EAH1 1ENXA 4HN1A 4IDZA 4K6BA 3ZYGA 3WNNA 1VRH2 4I30A 5KR7A 1HB2A 4R9DA 3MIHA 1H6YA 1YQ6A 3D4KA 2BOIA 1VIWB 5JOYA 5F5AA 4EZHA 1ODNA 2ZAAA 4LKDA 2ZBJA 2BGOA 4Z92B 3Q8FA 3OY8A 1TNFA 3DUIA 2EIDA 4YG3A 5LY2A 1BBT3 1US3A 3FWEA 4NROA 1Q8PA 5F6LB 1A34A 1NT0A 4LLOA 1IS5A 4KWLA 4LULA 5ANNA 4B3NA 4IUGA 1JMUB 3AP7A 2GNDA 2E7TA 4QQ2A 4E4SA 1ENSA 1C8M1 1WD3A 2G9ZA 1LEDA 1LTEA 1ZA4A 2J1AA 2QZ3A 2A6XA 3I8TA 3SHRA 4KU7A 3VL9A 3WF1A 1H8TA 2WS92 4QX8A 1O4YA 1DQ4A 2C4XA 2YBPA 4HVRA 2VNRA 5ABJB 5FZ7A 2ZGSA 5C9AB 4XXAA 4YGCA 2AREA 4PF1A 3O1MA 5A3WA 2PHTA 3BI3A 2WUHA 1GYKA 4ORFA 2HWF2 1TE1B 5C8CB 1F8VA 2BYVE 2NPIA 3WY6A 1QMJA 2DCKA 4FCAA 3ZR6A 4C1WA 5B4NA 3CJXA 2EXHA 1CWPA 1JTZX 1NQJA 4S2GA 4DZGA 1JZ6A 1OFNA 4DY5A 1W0PA 4MXVA 1R091 2K46A 4Y1UA 1H2KA 2CWSA 4GH4A 3FLTA 2XKOA 2VULA 4Q4V1 3AP4A 4JTOA 1UOFA 4I0WB 4U36A 3VDAA 1RHI3 2DVDA 4NPRA 4P9IA 1JU4A 2ENRA 4UOJA 4JGYC 3VHNA 4YM3A 2JECA 3Q8AA 3B93A 5FO9B 1ZZ8A 5FP9A 2QJVA 1OKQA 4AEDB 4YZ5A 5JSPA 2DCJA 2LUWA 4HVOA 3VDDC 2J1TA 3AP5A 4IGQA 4MYEA 2GH8A 4Q4W2 4WVVA 1QXJA 5FXVA 4B7KA 3KF3A 3KLSA 5CAZA 2EAAA 5SV8A 1GP4A 4MGKE 3WLUA 2OT7A 3N36A 1VB2A 2QDRA 3ZXLA 5FV3A 3I2OA 2ERFA 1LOFA 1RGSA 4NVPA 4NIHA 1LKNA 2R062 3DXUA 2VXJA 2PHWA 1RUI3 4YVWC 4LJHA 1W8ZA 2NN8A 2HEWF 2RDQA 2AYHA 1CPMA 1Z0HA 1NCRC 3ABZA 4A6OA 1C5HA 1COV2 4XTMA 2CU5A 2CDOA 1PZ8A 1UZVA 1YUDA 3IZOA 4UF0B 5BY5A 4J25A 4CCJA 3S5AA 4Q1PA 3FBYA 1Z78A 4S2DA 1O6UA 2ZMKA 3VZJA 1RUC1 4XMAA 3AKPA 1UOGA 1BVVA 2DWRA 4XFBA 2GN7A 1PNGA 3E5QA 2XB6C 1UF2C 1AVBA 4INDA 1PGL2 1TME1 5DG2A 2HKXA 1TVGA 1R081 4PBPA 1BEV1 1HRV1 2WR9A 3NNFA 3GCWA 1YIPA 3UT0A 1LOBA 3PU3A 4W6WA 4Y1XA 3OPZA 1AX0A 3I2IA 4FI9A 1BMV2 1RUH1 1KQRA 1UIJA 5BNPB 2ES3A 3ALQA 4QKFA 4P9LA 3IIAA 2RS33 5CFCB 4COYA 3ILNA 1KDMA 1VMHA 3O14A 2B8MA 4BXSV 4YG0A 5JMCA 4QT6A 5LBCA 4BWOA 3GZUC 1UQXA 1G8WA 5C6CA 1POV1 4IW3A 4C91A 1LCLA 1W6QA 1AXYA 3UGFA 2X09A 3KCYA 2MEV2 4AVCA 2RMU1 5L73A 3SITA 2E33A 1XNBA 5ANQA 3WDWA 1SHWB 4UAPA 1N1VA 5BNQA 4Q0PA 4XJWA 1W9SA 2ZGQA 3EB7A 1VBB1 3V0BA 3KM5A 1PK6C 5B4XA 2IXJA 1JODA 1IPJA 1KFUL 1RUF3 1HQWA 1OF4A 3C7GA 4MSVA 5FZIA 1W6OA 3MW2A 1RMU2 5FY7A 1K42A 3ZIXA 3ECQA 3AMQA 4YZ2A 1VBD1 2Y8KA 3ZXDA 2V09A 3LWCA 4OHXA 3TNPB 2BBVA 2Y0OA 3P6BA 3H8XA 4QX1A 5CG8A 4R4ZA 2ZHKA 5LK7B 1IZ3A 1F35A 2EXJA 5LBFA 3AP6A 3PNAA 1UIKA 2ZOEB 4Q0SA 4XUTA 4UFIA 3WQBA 4PDWB 4FFGA 5EHDA 4QPGC 4YZ4A 4CP9A 5A6YA 3HVDA 1J84A 2KR2A 2VPVA 3R4DB 4IEQA 4YSFA 1UU4A 4I3GA 2PHUA 1IS3A 4B29A 5TSWA 1K3IA 2LTNA 4MHRA 1HXS3 4LOTA 1AYN3 1OLME 1YI9A 5A3NA 5GZFA 1ZX5A 3I2FA 3M8LA 4XFHA 5CU1A 3HJRA 4AXOA 2W46A 2YGLA 4C8DA 3V0AB 1LOGA 4LR4A 3DECA 3KS7A 2JE8A 4XFCA 3OEAA 1LOCA 1NZIA 1VRBA 4BCUA 1MZFA 2W08A 5FPUA 5LB6A 4CEWB 1T6BX 4UW3A 3U10A 3S7EA 2VR4A 1ULEA 4NHKA 4CEYA 2QZ2A 3GZEA 2VNOA 2D6MA 4QHZA 3WQ1A 2Y6GA 3VKLA 5GZGA 1NXMA 2XBO3 3ZKUA 1O3QA 2WT0A 2LW8A 2XR4A 1UYYA 3K4DA 3PVEA 4E8DA 3WG4A 4LHKA 2B39A 3VZMA 1CAWB 5D8AC 2B7YA 3H8UA 1GU3A 1L7QA 3RFRA 3N7JA 3TN93 1GWMA 4UBHA 4XPVA 4QX5A 1LULA 3N3HA 1BLZA 2OZ6A 4CCMA 1AR63 4N53C 4K3UA 2GC0A 1GLHA 3ETQA 4H7LA 1ODMA 1DF0A 1QJX1 2X29A 4P9XA 5DZGA 4HOOA 2GH2A 4UFJA 5J36A 2GNTA 1XE0A 1AL23 3R4UA 3KV6A 1UOBA 3ME2A 2XJTA 3N9PA 4GWIA 4ZZ5A 3NAPA 2XVLA 4LA2A 1DQ2A 1XE7A 1QGLA 4UFKA 1JXNA 2GSYA 3B5LB 5FPXA 2WO2A 1PVXA 4K1ZA 5C3SA 1OOPA 5CKNA 3LGRA 4QQHA 2BTVC 4XAAA 4UFLA 2DCTA 4NUBA 4DXTA 1WBFA 4CCLA 2OVUA 3DF0A 4YLZA 1W8HA 1P8JA 5HPOA 3KHCA 4QB2A 4QDRA 1RJ7A 3KGLA 3NNJA 4Y3OA 3KT1A 3MF9A 4JCKA 2DURA 5FP7A 1GMMA 2LM3A 1POV0 5KXEA 2IXLA 2XPJA 3ES4A 4RFT0 2E6VA 3ASIA 2DBIA 1I6XA 2OXBA 2P6HA 4PI0A 4QB1A 4HPKA 2CSGA 3SC7X 1H2MA 2JJ6A 1QJEA 2PAMA 1K5MC 3AB0A 3LQCA 4QX7A 1QF3A 1JHNA 5IVBA 4JGYA 4YG6A 3P1IA 1KJRA 5J1XA 5DAWA 2WFF2 2FZ2A 1G7YA 2HWD1 4UFMA 1CESA 4WM7B 4D69A 3WINE 5FREA 3QLQA 2BUKA 4RSUA 3J8F3 5IHRA 2A6ZA 4M3CF 4PQ9A 5GLZA 5C3RA 1CJDA 4MGSA 3CIHA 4PJYA 4Z8BA 4IE4A 4CCDA 1F5FA 4AZZA 1ZZ7A 3C8XA 4QXKA 1CQ9A 4X6QB 1J83A 4DUWA 1GICA 3MUZ1 5D21A 2GC3A 2WKKA 4KQ7A 1O4TA 1I5PA 5A1LA 4P9WA 1OC1A 4YFWA 5FP4A 5FPVA 1VAVA 2PELA 4GIQA 3OGGA 3WCRA 3IT8A 4F83A 4FVVA 1Z7S2 4ZPIA 5LBBA 4JGZB 2Q5TA 4LO7A 3LFMA 4YZ1A 1G9AA 3O1UA 4UXAA 4Q4X2 5IT6A 2X8KA 2CAVA 3SCHA 4A41A 2VNVA 3BVCA 1H6XA 3UESA 3ACHA 4YM1A 3B94A 3WG1A 1XXNA 5E1RA 4M3CA 3O5SA 1FMD3 1OPMA 1CZTA 1WCSA 1TNRA 2R0FA 2VY0A 2FCVA 3LCPA 2VZ1A 3LEIA 5KXBA 1UXZA 3JD71 1ND2A 1D0HA 3RVHA 2R1DA 3IPVB 1SBDA 2HBUA 2W52A 1ASJ3 5L9RA 5JSRA 3EJKA 1QJY3 3MIFA 5KC6A 1ZZ9A 2Y64A 3UKNA 2AZ5A 4K1YA 5D2AA 3CJIC 3EXUA 2X5IB 4HBNA 3H0OA 5ERLA 3FHQA 1JYXA 3RZKA 1R082 2A5ZA 3MO4A 3ETPA 2R7EB 4LPLA 1L7LA 1DG6A 1O7FA 2R073 3AZVA 2Y6LA 3ILFA 5FOBB 1PVC2 4YW4A 3FHIB 4RS5C 4FBFA 4TXWA 4JC1A 3VZOA 3P5BA 2HWB2 2XWJB 4HONA 1RL3A 4JRLA 2W39A 1JBCA 3OJBA 2A73B 2A75A 4D6QA 3IDEA 1UYXA 4WBBA 1Y3TA 1RUI1 5FQ0B 3FUQA 5FO7B 1V6KA 3AKRA 5FP3A 5T5JA 1ZA7A 3VHPA 2Q8DA 2Y38A 2E26A 3ZYJB 3KV5A 1CD3G 1LHWA 4L92A 4Q26A 1VPHA 4RR3C 1HDKA 4NRMA 5JR7B 2JEMA 2W0XA 2P3KA 4F3JA 3PTYA 1LJ7A 5FMBA 5FZEA 4CDUB 3WP3A 3AKTA 3BUCA 1MS5A 3U4SA 1JI6A 4BK5A 5KHIA 5JZGC 3AMMA
chains in the Genus database with same CATH topology
3AM2A 3M3CA 1V6MA 5IUQA 1QOOA 4WV8A 1F31A 5SV5A 3MEPA 2ZGPA 3ZFFC 1LHVA 1DQ0A 3USUA 1MR5A 2R0HA 4ONUA 3B02A 5K0UB 3V64A 3MFAA 4GMP1 2YGMA 2WZPP 2FZ1A 2V5YA 4GB31 4E2SA 1C8NA 1E57A 1AR83 4XFGA 2A71A 4YM0A 3TAYA 4L2NA 3TRSB 3VV1A 4AHYA 4FPOB 5AFEA 4YZ3A 5K9YA 2JG8B 1XNKA 3FX3A 5T52A 1OPOA 4R4XA 3WUDA 5T55A 2PLV3 3KCXA 4A7ZA 5LEKA 3H7YA 2YV8A 4UW4A 2Z42A 1NY72 1CVNA 4FPHA 1MS3A 2UY8A 4CP2A 2A3YA 3IM0A 3TBDA 1VBA3 3BALA 5KBFA 1OQEA 1ENQA 1QJU3 3B9IA 1UMZA 1VBC2 4L99A 4XFFA 1OLQA 2VUAA 5ABJA 5C9AA 5FAXA 1ZBE3 1EYBA 2VG9A 2AENA 1D4M3 5C8CA 3SH5A 1PO12 4YW3A 3VZNA 1XU1A 3NV4A 1ZZBA 4JTNA 4B4QA 3ZO0B 4WZCA 4AVTA 1HXS1 3RI9A 4YFZA 4WVZA 5DDJ2 4ZKTB 3VKFC 4S2FA 3VBFC 1JOJA 3EQEA 2CV6A 1A78A 4HMZA 4YW2A 4LBJA 4L8QA 5KHHA 2H6CA 1LR5A 4FOWA 4AEDA 5CFDC 1A8MA 4IEPA 4IV1C 4XXPA 1QU0A 4CTEA 1UKRA 1SLIA 1X36A 2YPJA 2EF6A 3FZ3A 4LBQB 4Q4W1 3TN91 5C4WC 4NHMA 3S6PA 1WD4A 2WLPA 1QNYA 2WSVA 1G6NA 1SFNA 4FPGA 1UU6A 4S2HA 4EROA 2IFWA 3MF6A 2WT1A 5T3NA 5I93A 2FMDA 2NZ9A 1LHOA 1R1A3 4PLNA 1H4GA 1RINA 1OSGA 1QQP3 1HRI3 1COV1 1RTVA 3FLRA 2ZZJA 2YC0A 3LB9A 2O1QA 2WNVC 2XVGA 3VDDB 1O3SA 5B2GB 4O9EA 2Z79A 3PMEA 2OUJA 2ZHLA 5JWPA 1CGPA 3JB4C 3WDVA 3N7LA 3B9CA 2BVVA 3DPRC 2IXIA 5L19A 1PGL1 3U0ZA 1YFUA 4GMP0 5JPMB 1FV2A 2EIGA 2OZJA 5FFOC 4YVWB 1X8MA 5C33A 2D6NA 2ZMLA 5BNPA 1NCRB 5CFCA 4IEVA 4YRDA 4EN6B 1BMV1 2HWE1 4Y5Z0 4AYUA 3HR9A 3VN4A 1HW5A 4Y4YA 1W6MB 5JPNB 2RM23 4D7YA 1FATA 3AMPA 2D98A 1YHFA 4J1XA 3AYAA 4YVSB 2PAEA 1W6NB 2CTVA 3J8F1 1RHI2 4W6XA 1H30A 1W6PB 1DFQA 1Q8SA 1FI2A 3FUOA 5JOWA 1RUE3 4OI0A 2VOVA 3ST7A 3JCIA 5DXDA 1UPIA 2HJIA 4HSLA 3OBRA 1RMU1 3LSEA 1N1SA 1QOTA 1U5YA 3PJQA 2XLFA 3VHOA 4BMEA 3P3NA 1DQ5A 1OA4A 4AQ6A 1X33A 1XYOA 1SDWA 4PDWA 1RUI2 3SH3A 1V6IA 4CDQC 2VMHA 4IESA 1MVQA 1UW8A 2PTMA 5E8AA 1PK6B 1S0FA 1RUG3 1DYKA 2P37A 1FMD1 4XJAA 4ZU5A 3I4IA 4D94A 1UAIA 1WW4A 3A0KA 3ILRA 2GNMA 4AHXA 3NSTA 2ZX3A 4B8EA 1ZM1A 2JKBA 1QJY1 1T6GC 4QHBA 1D2SA 4NN0A 3RDIA 1LODA 2XJPA 3IDCB 4RQPC 3WOGA 5BNOC 3LOBA 2DCZA 4CEWA 3ZX7A 3WW2A 5LRRA 1BQPA 1ZRFA 3CLPA 2R071 1W2UA 4QPGB 2BEOA 1VP6A 1ZRDA 2RS32 1PZ7A 2VVFA 1RVF3 1GQGA 1WCKA 2VQAA 3HD8B 2ZX4A 2YDEA 4GB32 4GKYA 4B7EA 5J96B 1CAWA 4LBLA 4QGMA 4YYOA 1MS0A 5A3MA 1X8EA 4COVA 5T54A 4SLIA 4EWAA 2D5HA 1VAMA 2Y26A 3AMNA 2MHFA 1LB2A 3RYRA 2QNKA 1XQNA 1NE6A 1OQ1A 4ATEA 3AYCA 3INAA 3AXDA 3RYPA 3N4MA 2WT2A 1RUF2 4I09A 1ZBA3 2QFEA 4XILA 4LBQD 1KFXL 3S30A 1UZZA 4WM8C 4FTBA 4KH9A 1JW6A 5D8AB 2P34A 2UWBA 3IWZA 2GMEA 4K7JA 2DU1A 2WNUB 3E97A 1CAXB 1JUIA 4N53B 3I59B 3VBSB 4N90A 4AFCA 1Y7BA 3MIEA 1LGCA 5ACA1 4JQRA 3T1LA 3CU7A 3WP5A 3EBRA 1G86A 4AFBA 1GKBA 3WQ7A 5EXOA 2XKPA 4U2AA 2VECA 2B46X 1HXS2 4BIOA 3WDUA 3VLBB 4QPIC 5A32B 1VBE3 2A3XA 4GWNA 2EVXA 4AI8A 4WM7A 2QUOA 1YFYA 5CB7A 1U0AA 2P3IA 1S0IA 2WFF1 2D6LX 3LOIA 3M3EA 4IV3B 2YXSA 1UPSA 1ND3C 4M3CE 2Y0IA 4RHV3 4Y22B 1G9CA 1AUYA 4HL0A 3ZXAC 4FP2A 4IEUA 3D0SA 3BIWE 3E6CC 3M3IA 4HKOA 2GU9A 3GZAA 1C4RA 2O0OA 1K5MB 2IC1A 5K7PA 4JGZA 1KJLA 3TN92 1NCQC 5H9RA 1Z7S1 2DTWA 1KS5A 4LLFA 3ZFGC 2FHRA 2IXCA 3SISA 4F8AA 3DL3A 4FQ4A 4Q4X1 4A3XA 2JE7A 1H1AA 4XQ4A 3USSA 2Z2SB 5DG1A 1RUJ3 1AL22 5FCCA 1J1LA 1EPWA 2GN3A 2NM1A 3MICA 3QH6A 3RNSA 2ZTNA 1UCXA 1I9RA 4LUMA 2GC1A 4M0HA 3IPVA 3FLPA 4MLOA 5EFUA 4N43B 3OD0A 2Q30A 4EV0A 1UZYA 3R05A 4HKWA 2X5IA 4JRAA 2N7GA 1DGLA 3B00A 1MS4A 2ILMA 3VBRC 2I74A 4YVSC 1TMF3 4UW5A 3LA3A 2VVEA 4L9BA 2RS13 2WWSA 3N35A 2AGSA 1ZREA 3JZVA 5I8YA 1N3PA 1SMVA 3KQRA 2DVGA 1PVC1 2HWE2 2BWCA 2XWBB 2YZ4A 2HWB1 1OFSA 3MW3A 4Z1VA 2D7FA 4MV2A 5JVVA 3VKMA 4DFSA 5FQ0A 4M00A 5LEJA 3D5OA 2ZKLA 3UV9A 5JI7A 2ZGNA 2VGDA 5GZEA 1JH5A 3CJIB 5J48A 3ZN5A 3L9JT 3ZMNA 3J8F2 4FXKB 3VBHB 4DRVA 4KWJA 1J59A 2IFRA 2ZCWA 4HKLA 3NV2A 2D44A 4RS5B 3KT7A 3ZN6B 4CDUA 2XJSA 3POYA 4LT5A 2ZX1A 3VUOA 1AR93 3RS6A 3B7MA 2JX9A 1URXA 4FOQA 3ZXJA 2IXHA 4KGQA 5BXXA 1N1TA 3WDTA 2IZWA 3J4UH 2H0VA 4XFAA 2XJQA 1SLLA 2OW4A 1G9FA 5FPZA 5A3LA 4OI4A 4I2OA 1AYM3 1ULDA 5K0UA 1PGSA 2Q4SA 2WZR3 3HIFA 1B09A 1H2LA 1WLWA 1S2KA 1FMD2 4RR3B 2RM21 4X6RB 3RRDA 4ASLA 3VBOC 3WDYA 4AVBA 1ASJ2 2JG8A 4FPJA 5JZGB 1QJY2 4MVTA 1AXZA 3W9AA 2VMIA 2ZHMA 4CZSA 2B5HA 3ZFFB 1D0GA 1HV0A 4QM9A 4AI1A 5L7OB 4OUSA 2R072 1NY71 5D1IA 1D2QA 1NOVA 1BCXA 1TEIA 2E7QA 1S0GA 2C1FA 4PCRA 4AWDA 5EYYA 1VBC1 3CF6E 4ISQA 1RJ8A 3M7AA 4HK9A 2DTYA 4AEKA 1C3HA 4XJZA 2WNUC 1RUG1 1PO11 4BLJA 2YY1A 1HQNA 3VBSC 2DVBA 3L2HA 4XBQA 1YNAA 1YIFA 4XIKA 3BODA 1JN2P 4EN9B 2ZAHA 5DDJ1 4Z82A 1AR73 4BZ4A 5KC5A 3FE5A 2UWAA 3WNXA 4NR1A 1D4VB 5BPXA 4DINB 1C57A 2UY9A 1QJZA 3UJOA 4E9KA 5GKAC 4W6YA 2KM2A 1RVF1 2JG9B 1APNA 3JB8A 4IV3C 1GZ9A 3ZYRA 2Q1MA 4LBQA 5ACA2 4DRRA 4XF3A 4FPLA 1B35B 4E2QA 1PZ9A 2ZABA 4NHLA 2HYKA 1GZWB 1O3RA 3VBFB 4JV4A 3HMYA 1QDOA 1CIWA 1I5ZA 2W68A 3AFKA 4Y24A 1PO23 4IEZA 1XE8A 2PLV2 1MZEA 5IK8A 5CFDB 5KWRA 2NMOA 4IV1B 3FJSA 3VDDA 3ELNA 4BOWA 1PGW2 5FTTC 2ETEA 2VMGA 1BBT1 1WLCA 1VBA2 5JDBA 2UYBA 4QD2A 5C4WB 4Y1VA 2ZMNA 1QJU2 3MYXA 3ZSMA 5JLVA 1WCDJ 2A7AA 2TUNA 4HFSA 1N3QA 1DQ1A 1PIV3 4N43C 4YVWA 1ZBE2 2PHRA 4I0BA 1BVP1 4XBLA 1NCRA 5L36A 1D4M2 4RGAA 3AKSA 4MGIE 3AKQA 3R0RA 4IETA 3DN7A 2O8OA 2ARXA 2XLGA 3V56A 1MQTC 3UKTA 2WNVB 4XEZA 4FTSA 4OUMA 1W6MA 1W0OA 1DGWA 1VBE1 2I45A 4LBNA 4P9YA 2RS53 1LEMA 4YVSA 1W6NA 3GHMA 4I3PA 2P3JA 2K9ZA 3LA7A 1YLLA 3DPRB 1W6PA 1LRHA 3WG2A 1RHI1 1DZTA 4RHV1 4FAHA 1NA1B 3PVNA 4XBNA 4XFIA 5JIAA 5JAXA 3KCCA 3NKGA 2RJLA 3VBHC 1J1TA 4FT8A 4XW3A 4Y1YA 2D3PA 4LUKA 2WQZC 2JD4A 3FBMA 4AE2A 1DGRN 4ZU7A 3TB0A 1CR7A 1I3HA 4XQDA 3AXEA 2ET1A 1I1EA 1FOD3 1PK6A 3N7KA 5IK7A 1R1A2 2FBEA 3QOPA 2A6VA 1QQP2 1HRI2 2VQ0A 3M4FA 4I0AA 4Q4Y3 5CNAA 3LZZA 3RWNA 3KMHA 4AVAA 3VKOA 3VBUC 4XHBA 1GNZA 1KITA 1VALA 5J37A 3H7JA 4HT1T 1MZ5A 2ZGLA 1WLTA 2R49A 1AX2A 2PFWA 1BXHA 1TMF1 1IKPA 2D6OX 2RR13 5H9QA 3HWJA 1H1IA 3MIBA 4QPGA 4CDQB 2XLAA 2JENA 2EALA 4DOUA 3MI8A 3HAGA 3MLKA 1EAH3 3I54A 4XIOA 1EPZA 2RS31 3ZFEC 3VL8A 5J09A 5L7OC 2P17A 3CEWA 1FPN3 4XJ9A 1PNFA 2RM22 4Y20B 4AF9A 4COWA 4XQWA 1REFA 4RQPB 5BNOB 3D0JA 5AC93 4TSVA 1PHMA 4SBVA 3LA2A 1DU3D 3AJZA 1O3TA 1RUE2 1C8M3 1TQ5A 1C5IA 1IS6A 2XJUA 1RUF1 1Q8QA 1YFWA 1S2BA 1AR91 1CAUB 4HSJA 5D8AA 3DKWA 4XF1A 4R9AA 4KWKA 4CDXB 4HK8A 3RSJA 5DUVA 2WNUA 4L11A 3NO8A 1GR3A 5AVAA 1CAXA 5I8SA 4N53A 5EWSA 3I59A 2WZR1 3VBSA 3POWA 3ZIWA 1V9U3 4G9SB 2HWC3 1M4WA 3M70A 3RG0A 1RUG2 1R093 3R4SA 4Q4V3 2XJRA 2JG9C 3JBG3 3MDPA 4WM8B 4N9IA 5A32A 1QNWA 2BGCA 2PQQA 4AFAA 4QM8A 1AYN1 1B35C 1H1MA 2XUMA 4AHWA 3OYWB 4P14A 4FPCA 5HCFA 1LHUA 1MEC3 4N9HA 4LBMA 4IV3A 3HN1A 1S0DA 3J26N 4AEMA 4Y22A 4PIYA 4PLOA 4IEWA 3AMHA 4I01A 2OUHA 4Q8LA 2RJKA 1KS4A 1RVF2 3SMHA 1WW7A 4FP3A 3HBZA 3VKNA 4TWTA 1XYPA 3FC0A 2XBO1 4BLIA 1K5MA 3ZVXA 2QKDA 3AK0A 4FPKA 4QPIB 1WLDA 2WSUA 3W58A 1UKGA 1LENA 2GMPA 3AX4A 1QKQA 2GZWA 1RUC3 3JUUA 4BIFA 1CJPA 1AR61 1ND3B 2PAKA 4G4FA 5F6KA 1AZDA 4MZUA 1FT9A 4FQZA 1ZBA2 1TME3 4DS0A 2TNFA 5KHKA 1AL21 4ISRA 1H9WA 3OCPA 4LE4A 5IK4A 1BEV3 1HRV3 3THPA 1F2NA 1WMDA 3X29B 5FO8B 3QACA 1IGOA 1BBT2 1AR71 4N43A 1PM7A 3WVJA 1BYHA 1RUH3 4Q0VA 1U5XA 2AH2A 1NCQB 5GZDA 5I91A 2VOXA 5DZFA 3ZFGB 3GBWA 2OYZA 4LO8A 1LU2A 1NE4A 1J58A 2NMNA 1O4ZA 1RUOA 1NXD1 1POV3 4Q8KA 1UN1A 5KXCA 4XTPA 1MS9A 2XHKA 1FXZA 1NA1C 3KZ4C 2RMU3 4J1WA 3E6BA 1LOFC 3KT4A 4AFMA 1GSLA 1AL0G 2D6KA 3E5XA 4EN8B 1VBB3 4I02A 5GLVA 3GZTB 3FFQA 2A6YA 3NVCA 4YGBA 1VBE2 1MS1A 1N1YA 3CJIA 3WX5A 3TNQA 3OGJA 5BNNB 1VBD3 3VBHA 3VBRB 4MX3A 4OHZA 4XETA 3WW3A 3GF6A 1W39A 1OA2A 4RHV2 4RS5A 2JICA 3ZN6A 2PA7A 2XL9A 2ARBA 3WZ1A 2A6WA 2IWGB 4Y1ZA 4PLMA 3NJZA 4P9JA 1OHFA 2R16A 2VUJA 1GNHA 1LGNA 1OI6A 1XU2A 4RL7A 1YJKA 1Y9QA 4FPYA 4MXWB 3ZYPA 2O8QA 5I8TA 1Q8OA 4AHZA 4JDNA 4X8NA 1SACA 5E88A 4JDOA 3WR0A 2D43A 3NKTA 1BKZA 3SLIA 4RR3A 1RUJ2 3WD5A 1YXWA 4CP0A 4M0NA 4AK3A 4XDQA 3RYKA 5JZGA 2R043 1O5LA 1LESA 2GAUA 1ASJ1 4LBOA 1WBLA 3ZFFA 3V0AA 1NLSA 4Y26A 4GXLA 4LA3A 3VZKA 4PBOA 1TMF2 5J7MA 3WXPA 4AGGA 5L7OA 4GA9A 1O91A 4XE9A 2BVBA 5T5PA 1VAKA 3I7DA 2ZX0A 2DV9A 2QVSB 3ES1A 4EN0A 2BW8A 4XOGA 1QJX3 3VBOB 4NO4A 1WW6A 2C9AA 3A4UA 4R9CA 4CDXC 3O0XA 4HVQA 5HCAA 4IXLA 1XNDA 1GANA 3ZSEA 1QY4A 4BE3A 4Q4Y1 1EV13 2VW2A 1ONAA 2CNAA 3ZN4A 4Q1RA 1CAVB 5JCTA 4LEJA 2BNNA 4ATFA 1KDKA 3RJ2X 4A7YA 1RUNA 2FQPA 2UU8A 4MGYE 4LTAA 1AR92 4LO6B 4Q0UA 1IHMA 5FBZA 3SXWA 1UL9A 2PHDA 4GALA 3IBMA 3N7MA 1UU5A 2RR11 3U4XA 3FFZA 4Q29A 1AYM2 1SLTA 1ZZCA 1QDCA 1NZCA 2JG9A 2WZR2 3BTAA 4H55A 4QU2A 3IKWA 3BCWA 1B35A 1FPN1 2HWD3 4XJUA 1AR81 1GZWA 3VBFA 3ZSJA 4FXGB 3A0NA 4NWVA 3K48A 5AC91 1J3PA 1AYN2 2GC2A 3UJQA 1REDA 2BNOA 4CDWB 1RITA 1EP0A 2R1BA 5CFDA 3NWKA 4IV1A 3AZWA 3BB6A 1NQDA 4FPFA 2PLV1 3HT2A 2XH6A 1R1ZA 3NAPC 3MIDA 4FAGA 1VR3A 1PGW1 4BMBA 1OOPC 5C4WA 3GALA 4A2UA 1QHDA 1YCIA 3EHKA 2YROA 2D5FA 2E7AA 1VBA1 2XBO2 1DQ6A 3PJYA 4QQLA 1QJU1 1SBFA 1RC6A 2DFCA 1SBEA 1V9U1 2HWC1 1ZBE1 5K8SA 2AUYA 3ZXFA 3JD73 4OVEA 3UK9A 1D4M1 1S0BA 2B9UA 2WQ4A 2WNVA 5BUVA 1EY2A 1AR62 1OLRA 2EA7A 2Z5WA 3JBG1 1MZ6A 5CG9A 4CRQA 4HANA 1C1LA 1LHNA 1X7NA 1AR72 3DPRA 4IEOA 4HLTA 1MEC1 1AJOA 3G6JB 4P5HA 1CPNA 4AI3A 2NLRA 1NA1A 1QH7A 2XG3A 1DDLA 1WA4A 2WA3A 5BNNC 3H1WA 2LALA 4JAAA 1AXKA 1MQTB 5A33B 1XNCA 1YWKA 3IMNA 5J3UA 1J3QA 5HXVA 4D3WA 3QCWA 1V6OA 4FOVA 4OI1A 3GYDA 2QQPA 4CP1A 4EWDA 1CX4A 3ACLA 1PO22 4A7KA 2VXRA 2VH9A 1GFF2 2OA2A 3O0VA 4META 3WDXA 4D7SA 4NWWA 4COZA 3OF1A 3B69A 1R1A1 1RUD3 3WQ0A 2CAUA 1CONA 1ND2C 3WCSA 4ITCA 1QQP1 1HRI1 3AZYA 1AJKA 3IN9A 2E63A 4WVMB 5F9TA 3MW4A 3DGTA 3MPPG 3GHNA 1AX1A 1ZNPA 1ZZ6A 5E89A 4QGLA 5JOXA 5EZWA 1H2NA 1U5ZA 2DFBA 1YFXA 4GMP3 5AVPA 3T1MA 4GB33 2DVFA 1PIV2 3WUCA 3MFCA 1C1FA 1LGBA 4CDQA 5C8WA 1A6CA 4ES8A 1H8VA 3WW1A 1VLNA 1KXGA 3RMYA 4D7TA 4L97A 1CN1A 1SFYA 4ES9A 1VRH3 2C5DA 4IQPA 1ZRRA 4AFDA 3VBUB 4Y20A 4YW1A 4FTEA 2ZGRA 4OHWA 2A70A 4AQSA 2D40A 3ZXGA 2PHXA 3QH7A 3VHRA 1U12A 2RS52 5HBAA 4RQPA 5BNOA 4AQTA 1QXPA 2NQYA 3ZXKA 1JUHA 4O9GA 5GM0A 2JXAA 5FDBA 4OHYA 3BOWA 4N7IA 5KHJA 1QH6A 1V6LA 3PMSA 3J9SA 3G7DA 1RUE1 4H3WA 2VOWA 2D93A 4DQAA 1CAUA 2ZX2A 4BYYA 3D82A 2RHPA 5CADA 3ZFEB 2WS93 4CDXA 4J6GA 3SCFA 3S7IA 5FOJB 4AI0A 2PN5A 2B42B 4HZFA 3WG3A 4DMIA 2GNBA 2BQPA 2OIIA 1Q5OA 2HWF3 2BFUS 1HQLA 3M3QA 1FOD2 3CNAA 2R6QA 4LBKA 3MLJA 2EXIA 4AQ2A 5BYNA 2QE3A 4QQPA