2ET1A

Oxalate oxidase in complex with substrate analogue glycolate
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
201
structure length
201
Chain Sequence
b'TDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxalate oxidase 1
publication title Structural and spectroscopic studies shed light on the mechanism of oxalate oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 44
structure length 201
sequence length 201
ec nomenclature ec 1.2.3.4: Oxalate oxidase.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2et1A00
3E6DA 1ZRCA 4QXKA 1RUNA 3FE5A 1SFNA 1J58A 2F4PA 1QWRA 2IXIA 1EYBA 5JR7B 5FLIA 1ZZ9A 5F1RA 4H7LA 2IXCA 4ZU7A 3ES1A 3DKWA 1NXMA 4XFFA 2CAUA 1YLLA 2QDRA 2EVXA 1ZZBA 4XF0A 3EJKA 4EWEA 1ZVFA 3CF6E 1LR5A 4EWDA 3HT2A 2XLAA 5KHHA 4BYYA 4J1WA 4Q0VA 4OLLA 2BNNA 5HI0A 2ET1A 2FMYA 5FQ0B 2D93A 3IIAA 2XL9A 4QGLA 4HBNA 3NSTA 3PLQA 2CAVA 4PIYA 5T3NA 4E2QA 4I3PA 1L3JA 2PA7A 1O5UA 3B02A 4ORFA 4KL1A 4AVBA 1GQGA 4HVRA 2E9QA 4IERA 3LA2A 1WGPA 1WA4A 4MX3A 2XLFA 5C6CA 3SMHA 4HVOA 5LRRA 4E2SA 1RGSA 4HLTA 4XFHA 3HT1A 3SCGA 4ZU4A 4KU7A 4IEQA 1NE6A 4JTOA 3ZDSA 2QCSB 4R52A 4JV4A 3I59B 1DZRA 1LB2A 1RL3A 3OF1A 4LUMA 4YARA 5BV6A 3E5QA 2DCTA 3CEWA 3H8UA 1WLTA 3DN7A 2MNGA 2VPVA 4IETA 5I0UA 3PNAA 1UW8A 3FFQA 1LRHA 2Q30A 5I8YA 1CAVB 5BY5A 4HVQA 1ZX5A 5LEKA 2HKXA 2K9ZA 4Q29A 3N4MA 2XL7A 3GBFA 4LULA 1EPZA 1YHFA 2V09A 3S0MA 3IBMA 1IPJA 4WZCA 3ETQA 3WW1A 4QX5A 2ETEA 4CYDA 4LEJA 3ELNA 1IPKA 4IEPA 3U10A 2IXLA 5CU1A 4XETA 4YRDA 4A2UA 5I91A 3SXWA 5JSRA 5FPZA 5LRSA 1I6XA 3E5XA 4L11A 1LKNA 3SCHA 3NKTA 3EHKA 2BEOA 1XE7A 4XFIA 4QGMA 1RTVA 1DZTA 1FI2A 1V70A 4KU8A 1NE4A 1XRUA 2XKPA 2GH2A 5K8SA 5KHKA 2EA7A 1X82A 2GC1A 3MPBA 1CAWB 1I5ZA 1XE8A 1CAUA 3S7IA 3OGJA 2BNOA 4AVCA 4O9EA 3LAGA 2GAUA 3WW3A 2H6BA 4WVZA 4AQ6A 4LA3A 2Q0AA 3L2HA 3CL1A 3NW4A 3D0SA 4MGZE 3WW2A 3DV8A 4I2OA 2N7GA 2ET7A 4RD7A 5CVRA 3BALA 4N9IA 2B8MA 1QY4A 1YFWA 3NL1A 4OFGA 3MZHA 4MV2A 3H50A 3UKTA 4IEYA 4R8HA 1OFNA 2Z2SB 2ZKLA 3RYPA 5I8TA 3I54A 4MGKE 2O8QA 3TNQA 3C3VA 4META 1FXZA 1O4TA 2HJIA 2MHFA 3BPZA 1NYWA 1J1LA 4TLFA 4I01A 5FDBA 1GQHA 1SQ4A 2BNMA 4KWKA 4I0AA 2GZWA 4D7SA 5KHIA 3GYDA 4BHPA 1YFUA 3FJSA 5I0SA 3ACLA 1VP6A 1RC6A 4P9GA 5CADA 1Q3EA 4F8AA 3H1YA 5I0RA 2BGCA 2CGPA 1U12A 2UYBA 3LA7A 1UIKA 1O3SA 1ZZCA 2GC2A 3H7JA 4IEWA 5I0TA 1ZRFA 3QOPA 3KGZA 4DINB 2PHLA 3H9AA 3RNSA 4B29A 3NVCA 2K0GA 3H1MA 3D0JA 2VQAA 4IEZA 2FQPA 5FCCA 3MDPA 4EWAA 3DL3A 4Z07A 3ST7A 3EQEA 2EAAA 3I7DA 5I93A 3RDIA 5KBFA 4UBGA 2O1QA 2QJVA 4IEXA 3M3IA 3PVBB 4IEUA 1J3QA 1OI6A 3NJZA 1NZCA 4O9GA 5EZWA 5JAXA 2GC3A 2Q1ZB 4WBBA 3U0ZA 3LZZA 4XF4A 4IEOA 1YFXA 2IXHA 4XEZA 2Q4SA 4YYOA 4HSLA 4K8FA 4IESA 1J3PA 5JSOA 4FAGA 1X7NA 4PIXA 1ZRRA 5FLJA 4KWLA 3KGLA 2XHKA 5I8SA 2Y0OA 3HIFA 1CX4A 3UKVA 2Z69A 3CLPA 3U11A 4HN1A 4Q0SA 3QACA 3CO2A 1H1IA 4MGYE 4EROA 5BPXA 4AVAA 3O14A 4JVAA 4Q0QA 1JUHA 1ZRDA 1O7FA 4D7TA 2CV6A 3E6BA 1YUDA 4PJYA 3LOIA 1ZNPA 2B5HA 5KHGA 2IC1A 2C0ZA 2H6CA 4MZUA 2UYAA 5C8WA 4XF3A 3R6SA 2QNKA 2OZ6A 3HQXA 2MPFA 3USSA 2D40A 2VECA 2IXKA 1Q5OA 5D1IA 2IXJA 2BYVE 1O3QA 3H3UA 4UXAA 5EFUA 4AQ2A 3OD0A 2OPKA 3ES4A 2D5HA 1ZZ6A 1RUOA 4Q0UA 1CGPA 4QM9A 3OTFA 5AVPA 4XF1A 3E97A 3H7YA 3FX3A 5FQ0A 1EP0A 5BUVA 4ZU5A 3MYXA 5J48A 5FLHA 3G7DA 1OMIA 4QMAA 3E5UA 3RZZA 4Z82A 4KWJA 1HW5A 1CAUB 2XKOA 2XLGA 3ROUA 1SEFA 2B9UA 4LUKA 2WC2A 3UKNA 2GU9A 1YFYA 2PHDA 1ZREA 5J7MA 4NVPA 5JSPA 2WFPA 3FWEA 2PYTA 1O3TA 4FT8A 4I0BA 4YNIA 3I59A 1VR3A 4BH9A 2OZJA 2H0VA 5E16A 1EY2A 4QM8A 5LEJA 5JCTA 4GULA 1G6NA 1Y9QA 3RPQA 3JZVA 3BU7A 3E6CC 2ATFA 4XF9A 3SCFA 4I02A 1CAVA 2PFWA 3RYKA 4XFBA 4ONUA 4X6QB 1OD5A 4EV0A 3IDCB 3BB6A 3D82A 1UCXA 3OCPA 5E1RA 4MH0E 2QVSB 4F7ZA 3BCWA 3VHRA 4XFGA 4LA2A 2UY9A 4HZFA 1PM7A 4J1XA 4HSJA 1X8EA 4LLOA 4UBHA 3H3ZA 2PTMA 4YSFA 2OA2A 2PAKA 1X8MA 4XFCA 4JTNA 2OYZA 4IEVA 1UPIA 4QGNA 1QXJA 1UD1A 3WW4A 2PAMA 1DGRA 1YWKA 5J3UA 2P17A 2PAEA 3KSCA 5KHJA 4MGIE 4XFAA 4BIFA 1O3RA 1CAXA 5BXXA 1QXRA 1O5LA 1Y3TA 3SHRA 5FPXA 2I45A 3CJXA 4Q0PA 1H1MA 3EO6A 3RYRA 3EBRA 3FHIB 1PMIA 1DGWA 2GC0A 4PIZA 2KXLA 4AXOA 2ZCWA 3TNPB 4X6RB 4LTAA 3M70A 1CAWA 3H1WA 2D5FA 4I09A 2XGXA 2PQQA 2UY8A 1Q43A 1FT9A 1UIJA 1TQ5A 4HMZA 4N9HA 3S7EA 3IDBB 1J3RA 1VJ2A 4FAHA 3KMHA 3LWCA 4HN0A 4FBFA 4E2GA 3FZ3A 4MUVA 1CAXB 3KCCA 3LA3A 3IWZA 1J59A 4L2NA 1ZZ7A 1ZZ8A
chains in the Genus database with same CATH superfamily
2I07B 5IUQA 2EIBA 3UETA 4E9KA 5H9QA 4QXKA 3PHMA 3W21A 2AGSA 3VD4A 1ND3A 1DP0A 3MGUA 2F4PA 1RJ7A 5LA2A 1PNFA 2R041 4TZDA 5FLIA 2J1AA 5F6LB 4C8DA 4AOCA 4AEKA 3AL5A 1SCRA 1FX5A 3N7MA 5FZKA 2ZGQA 4Q4V3 1COV2 3DCQA 3QLQA 3DKWA 2XPJA 2PXJA 3TB0A 3JQXA 1UYXA 2VC9A 1ZM1A 2CAUA 4AE2A 2EXJA 4XF0A 3T0AA 1R081 2CWMA 3LEIA 4EWEA 4CA9A 3RZGA 3NQHA 3CF6E 3JXSA 5A33B 4LE3A 3H3LA 1OH3A 1X9TA 3AKRA 1BEV1 2WYSA 4LHSA 1R1A2 2XUEA 4ARXA 4P14A 3RJ2X 4BYYA 2AC1A 2VNGA 3N9PA 4AAPA 1LULA 3TEXA 2QQUA 4H2AA 2RE9A 5HCAA 3MW2A 4QDQA 2JDHA 4R9BA 1QH6A 2VM9A 1GZWB 4LO8A 2VZUA 2VZSA 2CNAA 2BV4A 2HWD1 3IIAA 4QGLA 1FOD3 5B4XA 1H2MA 1RUG3 3LEKA 3ZOIA 4XW3A 4PIYA 4E2QA 2JDNA 2W1SA 1GNYA 1H8TB 1MS8A 4LBOA 5FBJA 2WNVA 1O5UA 1VBA2 4AI0A 4LBMA 4ORFA 2WT2A 5A3NA 2X5IA 4JRAA 2ZKNA 5E6HA 4ZS2A 1W6QB 3ZSJA 4ASKA 1GQGA 3HNBM 5IAXA 3LDRA 5IK7A 1LTEA 3MUY1 1NY72 4CDUC 2XLFA 2D3RA 4IGQA 2RS31 3JB8A 4XJAA 1RGSA 5LRRA 2XUMA 3AK0A 3KZ4C 4HLTA 3HT1A 2XVKA 5E89A 5F32A 1FMD3 2X8KA 1DFQA 1NE6A 3F95A 2VUAA 4JTOA 3ZDSA 1C8M2 1BBT3 4XIKA 2WZR2 5EXOA 4P9IA 2RDSA 3GBWA 1PIV3 1CESA 1UZVA 3OF1A 2P2KA 1MEC2 4K1ZA 4LUMA 4UFLA 4Y20B 1RHI1 1G9AA 4KH9A 1UZYA 4IE5A 3CEWA 1WLTA 2VZ1A 4AW7A 3FUOA 3WNLA 4OUMA 1XNKA 4IETA 5I0UA 1UN1A 2R0FA 4GB33 1WLCA 1GOFA 2VZPA 2WA3A 3VBOB 1VRH2 3U37A 5IAVA 3UGHA 4K8RB 1O8PA 3K3NA 3RZLA 1VBD1 2XQRA 4GWNA 4OCTA 1JYTA 4COZA 4Y33A 5CIRA 5FP4A 3OY8B 1W3VA 2ZAHA 1RUJ3 5A7WB 2HKXA 5TSWA 1RVF1 1RUD1 3GBFA 1K42A 3AP4A 4GH4C 1YHFA 4LULA 2HWF3 2QQWA 2KR2A 2WS91 3AFGA 4WV8A 3B93A 3P3PA 4EQVA 4DRVA 4G3YC 2C5DA 4DMIA 1KITA 1HQLA 3HOBA 4NHKA 5FZ0A 1IPKA 1YQ8A 2R072 5ISLA 4IDZA 5CU1A 1QQP3 4YRDA 4YGDA 4A41A 4A2UA 3SXWA 3N9LA 3VD3A 5LRSA 1JZ2A 5CG8A 2EIEA 2V72A 3M8LA 3NNJA 3BODA 4NPRA 4FP2A 1HJFA 2YV8A 1W28A 3ZKUA 2VOKA 4CCJA 5FZOA 5FBZA 1HX6A 1XE7A 3JBG3 4XBQA 1GWMA 1NT0A 2ZMKA 4HKOA 4R4XA 4U36A 5IVCA 4BWOA 1DDLA 1ZA7A 5GALA 2BGOA 5F8PA 2OUHA 1HRV3 2JB8A 2XKPA 1N1YA 3VBRC 1V6LA 2XHNA 4YZ5A 5K8SA 1ULOA 2QFEA 3NRUA 2WNEA 2ZZQA 1H2NA 4PI0A 1D4M2 4EE2A 5A1FA 1B35B 1XE8A 1CAUA 1WD3A 2SBAA 1A6CA 5C8CB 4QQPA 2RV9A 3OGJA 1W6OA 1URXA 2B45X 4IGPA 4K6BA 1HDKA 3O7OA 1Y4WA 1C1FA 1O4YA 2JIGA 4GALA 1GNZA 4O9EA 4DXTA 1BLZA 4P9YA 4CXYA 4AZZA 1Z7S1 3WW3A 2XVGA 1HKDA 2H6BA 3PUSA 4AQ6A 4CP2A 5C3PA 5DN2A 5B2GB 1ASJ3 3L2HA 2UWBA 1ULDA 3CL1A 3DPRA 5EPAA 3D0SA 4BCUA 4OUEA 3O1OA 3GNEA 2N7GA 2VUCA 2WNUA 2D6NA 4RD7A 4CDQA 2HYXA 1FV2A 1SLCA 3ZFEA 4YW2A 4AG4A 1VBB2 4K1YA 3VKOA 3VHOA 4IEYA 1PX4A 2Z2SB 1OKOA 2OPWA 4OHWA 1K12A 2NN8A 4QHOA 5CNAA 3K3OA 1Y43B 1CD3G 4KBZA 2QQVA 2HJIA 1OQ1A 4DOUA 1HRI2 1KGYA 3SH5A 4YW6A 4TLFA 4W65A 2ZMNA 1SQ4A 2JB4A 1V6OA 4KWKA 4OQ9A 3KD4A 4NUBA 4AVTA 2ZHKA 2HYKA 1RUE1 2GMPA 3S5AA 1AR73 1NAEA 5A1AA 5A3UA 1MVQA 2HBUA 3J7LA 5L36A 2GN7A 4BHPA 2W47A 4ZXKA 2F17A 1YFUA 4Y22B 3FJSA 4RQPC 4A3ZA 2DCKA 5I0SA 4MGTA 3J8F2 1OPMA 1DLLA 3HN1A 4YGCA 4Q1PA 3H1YA 5I0RA 1REFA 3GF6A 1S0EA 4XQDA 3N9OA 1UY0A 2W52A 2R16A 2XBO1 5I0TA 1PNGA 3N7KA 1I9RA 1GBGA 3RMYA 2BRTA 4E27A 2DF7A 5J96B 2BPA2 1EAH1 3HQRA 4XACA 1NCRC 3H9AA 4B29A 1JBCA 2HEVF 2K0GA 3ATGA 3FLPA 1JYXA 4NIAA 2GNBA 4YW7A 2WNVB 1GR3A 4KNCA 3V0AA 2R7EB 4IGOA 2X5IB 5FYBA 5FCCA 3MDPA 2E26A 3VBOC 2HWB3 1VAVA 3DL3A 4Z07A 2D3PA 4ET7A 2VQUA 3ZR5A 4PDWB 4CU8A 1DIWA 4QB2A 3RDIA 1NKGA 1WKYA 4NO4A 1YI7A 2QJVA 4Q4W1 2ZGLA 4A44A 5FMCA 3B00A 2YU1A 5K4LA 2XJSA 2ILMA 2ZEZA 3K4AA 3OBAA 1RUI3 4MADA 3VLBB 4Q2FA 2B42B 4K9SA 1NZCA 1UQXA 4PLOA 3ZPYA 2Q1ZB 1PGW2 3LOBA 3LZZA 4Q4V2 4BE3A 2DDUA 4IEOA 1REEA 1WW7A 4JKLA 4AL9A 2DCJA 4DUWA 2VTXA 4AFMA 1QGLA 3V0BA 4S2GA 2VMFA 3AZYA 3Q9OA 2I2SA 2RDQA 4YYOA 4YVSA 2PLV1 5D2AA 4OHVA 5C33A 4HT1T 1X7NA 2LRPA 5A32A 2EXHA 3KGLA 2XHKA 4JKMA 4L8QA 4QQHA 5C5UA 1AL23 1OFSA 1CX4A 4XTMA 1PVXA 3UKVA 1AR83 4INDA 1JXNA 1H1IA 4MGYE 1D2QA 3K48A 5A7NA 3ON7A 4FPOB 1CIYA 1KQRA 4M0HA 1M06G 1A3KA 1CIWA 2RJLA 3VHNA 4NHLA 4LK7A 3CZUA 1XU1A 5J09A 3ZR6A 2C1FA 3E6BA 4Q4Y3 3LOIA 3MI8A 3DUIA 3SLIA 2Z4FA 1F15A 2AZ5A 2C0ZA 1S0FA 1BK1A 2H6CA 4KQ7A 2ARCA 2D6MA 4MZUA 2W92A 3MIBA 4LKFA 1RXFA 3WD5A 3AXDA 4B3NA 4ZZ8A 4CEWC 3PTYA 4UT5A 2WFF1 1MPXA 4QPWA 2KA3A 3WG3A 2IXKA 3WDXA 1Q5OA 2DCZA 2VW1A 1VIWB 2IXJA 5LA9A 3H3UA 4MG2A 3KT1A 5E8AA 2RG4A 3PUIA 4AQ2A 2W95A 3KB5A 3NNGA 2J1RA 3MBWA 1H9WA 5EJZB 3VD5A 2HWC3 5FZOB 4FVVA 1LGNA 4XABA 4LLFA 1AR62 1B09A 3C7GA 2FD8A 1DYPA 3SKVA 1BBT1 3AB0A 5EV7A 4A7ZA 4CE8A 1NQJA 1PIV2 1VBE1 3OTFA 4LO6B 3MF6A 4A3XA 5AVPA 1BHGA 1CONA 3H7YA 3GGLA 1N1SA 5DAQA 1O8SA 4KBBA 1YXWA 4QB6A 5BUVA 1JYWA 1FPN3 5JOZA 2IZWA 1O6UA 3RZZA 2ARAA 2ZGKA 4Y26A 1CAUB 2BUKA 3MW4A 3OBRA 2BQPA 2XLGA 3ROUA 1SEFA 5JXJA 5IW0A 3UKNA 2WC2A 3TYJA 3UGFA 4FTBA 4XUTA 4P9JA 4YLZA 2E31A 4MGSA 2R0HA 2TEPA 2ZA9A 1PMHX 3P5BA 3NNFA 2EIGA 3TOJA 4CDUA 3DPRB 3OJBA 5JIAA 4UFJA 2QTWB 2WWUA 2VMDA 3T0BA 2WNUB 2WQ4A 4CDQB 1SG3A 4LR4A 2E6VA 1MQTA 3VN4A 1N3PA 3TN92 3ZX7A 5FPLA 4TWTA 1QQP1 3ORJA 4BH9A 4YZ3A 2H0VA 3V0BB 5F5CA 3HVDA 1EY2A 1OD3A 4QD2A 1RUF1 5F2SA 4F83A 3LFMA 5LEJA 1AR93 2J1VA 2RS51 5JCTA 4XHBA 4DB5A 1PVC1 3JBG2 5IFTA 3JZVA 2VTFA 3BU7A 1DGRN 1YJLA 4OHXA 4JKKA 5A6ZA 5F3CA 1ODNA 1GANA 4JGZB 4I02A 1D4VB 2PFWA 2A6WA 3RYKA 2PHTA 2JECA 3WDWA 4GWMA 5APAA 3OYWA 5L7OC 4PDWC 3NV2A 1COV3 1POV3 2HWE1 3LIGA 3RI9A 1PMJX 4JHTA 3OGRA 4MVTA 1SLLA 5E1RA 1QJX1 3LGRA 3MIGA 1N47A 3PUHA 4GH4A 2A70A 4A45A 1W9FA 2JDZA 1ULFA 1TME2 4Q4X2 2G4IA 2XJQA 4ATFA 3OUJA 4UW6A 1MZEA 2VAUA 1RUC2 2W94A 1PGL1 1LODA 1GZTA 1V9U2 1IQAA 4NIHA 5FZAA 1X8EA 1R1A3 4UBHA 5IVJA 3CIHA 2OA2A 1NA1C 4D0QA 2DV9A 2VXRA 2UWCA 5L9BA 3WNNA 2OYZA 2HH9A 1RUH1 1JTZX 1IG0A 1UOFA 5FKBA 2VZ3A 1UYYA 2WO2A 2NMOA 2P1BA 1BXHA 4LORA 4AGRA 2RR11 5KHJA 4MGIE 4XDPA 3PVEA 3X29B 3MLLA 4N90A 1VBA3 1Y3TA 2VMHA 2VVEA 2I45A 1PO12 5GZEA 3I2HA 2FCUA 2WDBA 4PQ9A 3VBRA 1MZ5A 3FHIB 3I2OA 1H9PA 1DGWA 1PMIA 2GC0A 1DQ4A 1ODMA 3TNPB 1WMFA 5AC91 3VBHC 1CN1A 1DYOA 1OF4A 3PMEA 3POWA 4QHZA 2YFUA 4J25A 1JZ4A 3L2YA 1OPOA 1UKGA 3VKFC 2PQQA 3GJAA 2UY8A 2Q1FA 3VGIA 3WDUA 1Q43A 3ZYIB 1CR7A 1Q56A 4N9HA 3AKQA 1AR72 1IKQA 3IDBB 3LD8A 4RSUA 2WZR3 4YVSB 3NV4A 1UOJA 4CVUA 1W39A 1MEC3 4HFSA 4CCKA 5FMOS 4FBFA 1DQ0A 4PHZA 2Q8DA 1VB2A 1RYYA 1LGBA 1OHFA 1VLNA 4H14A 4LOSA 4ES9A 5JI7A 4D7YA 1MACA 2J1TA 1AVBA 5GKAC 4K3UA 3HBZA 1VRH3 4GWJA 4DNYA 1ZZ7A 3U14A 4M00A 4YM3A 2EF6A 3E6DA 1R092 1CZVA 5FZEA 1GZWA 4PCRA 3FE5A 5GM0A 5ACA2 1AYM1 2VBPA 1J58A 2IXIA 1QWRA 5FRAA 5JR7B 1W8UA 5LBBA 2VY0A 5FIXA 5A7QA 4X8NA 3O12A 3S5QA 5F1RA 2VL4A 2JENA 1HN1A 2ZEXA 4N43C 2XH6A 2HWB2 2VMEA 4ZU7A 1VAMA 2JG9B 3D6EA 1C4RA 4KI5M 3ZFGB 1LGCA 1NXMA 5BNNC 1US3A 5LCWL 4D6RA 2RJKA 1QOSA 2R30A 3B3QE 5C3QA 1WCUA 3T2OA 2OVUA 1GOHA 1ZBA3 1YLLA 2QDRA 2EVXA 1V6KA 1HLCA 1ZZBA 2R073 2ZGOA 3HWJA 5IK8A 3AMPA 1S0JA 1RUI2 1YEWA 4FOQA 1GMMA 1ULGA 1VAKA 3EJKA 3ZM8A 4QQ2A 4C1WA 1U0AA 5FY8A 1X50A 3NV1A 3AFKA 4KG8A 4COWA 1LR5A 4RQPA 1FNZA 1VALA 3B01A 3HT2A 5KHHA 1NLSA 4RFRB 4EYUA 2LM3A 5ABJB 2DCYA 4Q0VA 4OLLA 4BQ3A 1VMFA 4XURA 2FMYA 2R49A 5JMOA 2CYFA 1W3XA 4W8JA 2PHUA 1QEXA 3CDZB 1GP4A 2XL9A 1AHSA 4C91A 4MXVA 1YJKA 3WDTA 1RB8G 2CAVA 4LKDA 3ILFA 3LE0A 4N7IA 3LF7A 1W0NA 1NCRA 5T3NA 3C7EA 1KS5A 1IS3A 5FUNA 4BLIA 2YGMA 2ORXA 3B02A 2BP6A 2EIDA 1D4M3 1DYKA 1W06A 4A4AA 5IYYA 5GJ6A 3VBOA 4JGZC 2VOTA 4AFDA 3JD71 2E9QA 2ZS6B 4IERA 1WGPA 4XUOA 1MS1A 3N3HA 4D8MA 3BPSA 3O1UA 1ZYBA 5C6CA 1ULCA 1FV3A 1MZFA 3DXTA 3MEPA 4HVOA 4M4PA 3SMHA 4CDUB 2D6OX 1HQNA 4JRLA 4IV1C 5A7WA 4XFHA 3BI3A 5CG9A 3LEMA 3RZMA 4KU7A 5FUIA 3RVHA 3S6PA 4QKFA 4U2AA 5FO8B 5FPUA 1QJY2 2ENRA 1OKQA 4JV4A 5FXXA 5AFBA 2HBTA 2QQPA 3P1IA 1IPSA 1ST8A 4GJZA 1LB2A 1C28A 3FUQA 2FDJA 5KR7A 3E5QA 2DCTA 1N3QA 1YYNA 1VBB3 5LK5A 5T54A 2DVGA 3DN7A 1WW5A 3B5LB 4B4PA 4XJ9A 4R9AA 3MW3A 1H30A 2BGPA 2ZZJA 3O0VA 1Q8OA 2JDYA 1EUUA 1CQ9A 2Q30A 3MIHA 3ZYBA 1MS5A 1MR5A 4HK8A 4Z2WA 1HRI3 2BZDA 3OYWB 1ZX5A 3IM0A 4RGGA 5LEKA 3L9JT 1NLQA 4IW3A 5DAPA 1JS9A 4LXLA 4Q29A 5EYXA 3N4MA 4HONA 4B4RA 3I49A 4GH4B 2GNDA 1UKRA 3R05A 3ZO0B 1XU2A 3THCA 2CGOA 3ETQA 3WW1A 4LO5B 3C8XA 3S57A 4LEJA 3J8F3 2DURA 1PK6C 3T4HB 2WWJA 4XE9A 4B7EA 4CEWA 2QBXA 1JI6A 4OZOA 3POEA 4L11A 4FFHA 1S1AA 5EHDA 1G9DA 1IKPA 4BLJA 2WJSA 4XFIA 1V6JA 1W04A 4FPJA 3S30A 3Q8EA 5JOWA 2V5YA 2A6VA 2VZQA 4JAAA 1RTVA 1DZTA 1IQDC 1YRZA 1ZBE1 3NJVA 2VBDA 3POIA 3PDQA 3EYPA 2BWAA 1SLAA 5A3WA 3R4SA 2EALA 3VBRB 4AQTA 5L73A 1AR92 4HK9A 4GMP1 3VZJA 5FO7B 3TEYA 5D21A 3HN3A 5FZLA 2GC1A 3MPBA 4W6YA 5J37A 1IOAA 3T2TA 4BQ1A 3WNOA 2P6CA 2XOMA 3NKGA 2BNOA 4XMAA 4AVCA 1BVP1 2AR6A 1OVSA 3LAGA 4GD4A 4OVEA 1GYKA 2JG9C 3BU0A 3ZFGC 4WVZA 1COV1 4M01A 2XJTA 4L92A 3PU8A 3RJRA 4BDVB 3KCYA 3LB9A 2YGLA 3FL7A 1CPNA 3WF3A 4RL7A 4AI3A 4MGZE 3CZJA 1N1VA 3WW2A 4I2OA 2VMIA 2W08A 2JDMA 5CVRA 1G9CA 4CXWA 2C4XA 1S2KA 1AF9A 4LBQA 2X10A 4Y22A 1HIXA 5LA1A 4JQRA 3OGVA 3ZN6A 5A6YA 3H50A 2R042 2VU9A 2X53S 3UKTA 2CDOA 5ABJC 4EN0A 1J83A 2Q5TA 2ZKLA 5A3MA 2O14A 4L0PA 4LPLA 2W91A 3ZN5A 5I8TA 4OULA 3VD7A 1J1TA 1SBEA 3KM5A 4TXWA 3VZLA 4HKWA 3TNQA 5K9YA 4E4HA 1JUIA 1SLTA 4CZSA 4RHV1 3N9MA 2X29A 5BNOC 2YBSA 1QXPA 1NYWA 2BOIA 4BM8A 1J1LA 1GNHA 4Q8KA 5M0TA 2RS11 1XC6A 3AP9A 4FOYA 2B46X 4RS5C 1R082 5FZIA 1GU3A 4E4ZA 2O0OA 4AI1A 4SBVA 5A7SA 4OI4A 1BEV2 3LQCA 2GZWA 3IKWA 5KHIA 4Y1ZA 4PDWA 2JICA 2K46A 5CFDC 5L7OA 4ZHNA 2A6ZA 5KXBA 1LJ7A 2WO7A 1XYNA 2JE7A 3GJBA 4NOTA 5FPAA 1NY71 3ACLA 1VP6A 2BOJA 4RQPB 2HWD2 4UAPA 1XQNA 5C4WC 4LIVA 1UXXX 1U5IA 4F8AA 1JYCA 2BGCA 3BUCA 2UYBA 4AEDC 1AR63 3LA7A 1VMJA 1ZZCA 2ZHNA 3B7MA 3MV11 1C8M1 2VTXJ 3W5MA 5CBLA 2A6YA 3QOPA 4ISQA 1ZRFA 2RVAA 1TMF2 2CSGA 3JQWA 3ABZA 1UU5A 3MIFA 1H0BA 1NCRB 1DQ1A 2WWSA 3NVCA 5GLWA 3KHCA 4BQWA 4FPYA 1JHNA 3ZVXA 3D0JA 4NHMA 3NMBA 1K5MB 5FYCA 3WDVA 3ZYJB 3WT3A 2RS32 4CU9A 1NQDA 3CU7A 4DUXA 5FZ3A 3EQEA 5HBAA 2EAAA 5KBFA 2NQYA 4UBGA 4GQ7A 5D8AB 2O1QA 3BTXA 1XE0A 3M3IA 4P08A 4IEUA 1BKZA 4YW4A 4TTGA 1SDDB 2JX9A 2DYCA 4O9GA 1RHI2 4WVVA 5DDJ1 5EZWA 1WZXA 5F39A 2ES3A 5JAXA 4E8DA 3VBHA 3POBA 1W0OA 4R9DA 5JIUA 1K5JA 3E1F1 2W1UA 2RMU1 5FYVA 2IXHA 5DUXA 2DVDA 1HXS1 3ZXEA 2P4EA 3ZYGA 4QB1A 4YZ1A 3TN93 4K8FA 3M7AA 1ZBA2 5JSOA 1VBD2 3SEEA 1VRBA 1W9TA 5K0UC 1ZRRA 5I8SA 5A80A 3VL8A 1H1AA 5FR3A 2MEV1 2Y0OA 2YUEA 3CLPA 3GZTB 1OF3A 3QACA 4HN1A 2EICA 1XSRA 2E51A 1RVF2 2ZGMA 3AMHA 3D8CA 1AYN3 1PGSA 1RUD2 4UW3A 4Y1XA 2P34A 3O14A 4AVAA 5A7OA 4Q0QA 3K51A 1JUHA 2WS92 3AZWA 3PU3A 3KVAA 3F2ZA 3O5SA 2CV6A 2ZHLA 3A4UA 1WD4A 3T30A 4ZY9A 1MS4A 1ZNPA 2B5HA 4MHRA 1UZZA 2IUWA 3OOXA 5KHGA 4LKSA 3K2OA 5C7GA 3DEMA 3I4IA 5K7PA 3WQ1A 3UK9A 1HB1A 2UYAA 4MO3M 1YNAA 5C8WA 4XF3A 3MICA 3I3QA 4HXCA 1PO21 4ZZ5A 5FMOL 4OI2A 3MIDA 3K75B 1YQCA 4N43A 4Q4X3 1TME3 2MPFA 3OD4A 1LOBA 2D40A 3USSA 3GDBA 4GAZA 4CEWB 1QOTA 5BNNA 1TVGA 2BYVE 1O3QA 1BQPA 1RUC3 3KQ4B 1V9U3 2V73A 5FAXA 1U5YA 3RGBA 3OD0A 4XXAA 3ASIA 2RM21 3ZYHA 3KF3A 5IK5A 5HXMA 2PHFA 3HPNA 5EP9A 4MOAA 5DUUA 1JZ6A 1LECA 4UFMA 4AEJA 5LASA 3AP6A 1RUOA 1H6YA 1YQ2A 4QM9A 1EV11 1CJPA 4L97A 1JYNA 4OHZA 4YVWB 3WEZA 2LUWA 3ACIA 4H55A 4QDSA 4CP0A 5LB6A 2ZOEB 1Z0HA 4AQSA 4D94A 2WT0A 1BMV2 4FTSA 3ZXJA 5DAVA 2P37A 4NHXA 2DUOA 1QDCA 3WNXA 4PLMA 1KJRA 2D44A 1JU4A 3MYXA 4QX2A 2NYYA 4XIOA 1PO13 2YROA 2ZGPA 1OOPC 3E5UA 4Z82A 5FY4A 4C1XA 1HW5A 2RDNA 5JPMB 5HCHA 3C7OA 2FDKA 2XKOA 5IVBA 2PHXA 4ZS3A 5JZGC 3WXPA 4XHXA 2B9UA 4LUKA 2GU9A 1AJKA 2VZTA 4ITCA 5CAZA 1QMJA 4LE4A 5FPBA 4UFHA 5FMDA 1JZ7A 1ZREA 4JGZA 1QJU1 4IE4A 2XJUA 1STMA 4BQXA 4FFIA 2WLPA 4YG3A 2ZX3A 3OEBA 3T2PA 3BKZA 2KD7A 2OX0A 4IV1A 4BXSV 3CHXA 3RZHA 4LBQB 1L7LA 2J1SA 1ENRA 2P3YA 3BIEA 3BOWA 4I0BA 2OW4A 1WMXA 2C9AA 3ZN6B 5JR2A 1VR3A 1F9KA 2OZJA 5FZ6A 1IG3A 1G8WA 2R061 3FLRA 4QPGB 1OQDA 3KT7A 4EN7B 4L9BA 4QM8A 5DXDA 2Z42A 1Z78A 4AVSA 3AYDA 4GULA 1RUE2 1EUTA 1G6NA 3KV9A 4DFSA 2HLEA 1R093 1VE0A 2WSUA 1A78A 3ZXAC 1ACCA 3JU9A 4A7KA 2BFUS 4CCMA 5ACA3 2ATFA 4XJZA 1E5IA 1LENA 4JDOA 4LBKA 1K5MC 1PM4A 2WQZC 2XWBB 4Y5SA 1XB9A 2Y6FA 1F2NA 5GZCA 1PHMA 1W05A 2WSVA 4K7JA 5L7OB 1Q8PA 3IAQA 5D8AC 3DXUA 2VNOA 2YPJA 3R0RA 4MH0E 3TWIA 2Y6LA 1XYOA 4AI2A 2QVSB 2XBO2 4CU6A 4F7ZA 4DPNA 3I97A 4LA2A 2UY9A 2BU9A 4HZFA 2VG9A 4BISA 4EZHA 2HEWF 1EAH2 1NCQB 5FZ9A 2Y0IA 3SC7X 1VBC3 5FOJB 3AM2A 4LBQD 5IVFA 2WAOA 4QU2A 2PTMA 1PK6A 3QD6A 4Q4V1 3WP6A 5LATA 4AR2A 3U07A 2FCTA 1NA1B 4JTNA 1OT5A 4IEVA 4QXBA 3GHMA 4Z1VA 3AMNA 5FYIA 1W8WA 3WLUA 3NNLA 2PAMA 1DBNA 3WCSA 2YY1A 3MIEA 1ENXA 2C26A 2DBIA 2LALA 2QE3A 4Q4W2 5FK8A 4QKNA 3VKLA 5J3UA 3KSCA 1YI9A 5H9SA 4BIFA 5BXXA 1QXRA 1XBFA 1O5LA 2J7MA 3SHRA 1SLBA 4Z92B 1JOBA 3EB7A 2LROA 3CJXA 2XDVA 4Q0PA 1H1MA 3ZYPA 2W46A 1W8FA 2XVLA 4NAMA 3EBRA 1NLRA 2GMMA 1XJAA 2W2IA 2WZEA 5LBFA 2JDAA 2ZCWA 4JZRA 3THDA 3WVJA 4NIGA 1FOD1 4FP3A 2A7AA 2PLV2 3M70A 1RUG1 1OURA 2D5FA 4I09A 1T6BX 2IFWA 4Y5Z0 3VBHB 4C0HA 3TEWA 3IMMA 2XGXA 2ZGNA 5JDBA 2ZX2A 1U5ZA 3ACHA 4QQOA 5LBEA 3AZXA 2AYHA 3MLJA 2YYOA 1OLQA 1QJY3 4XUPA 3S7EA 1J3RA 5FYYA 2EXKA 2JG9A 3WF2A 3ZFGA 2BBVA 4FXKB 4B8EA 3HNYM 1TNFA 3KMHA 3LWCA 4HN0A 3OPWA 3IZOA 3FMGA 4MUVA 3U1XA 1V6MA 2ZTNA 5FY7A 4BOWA 5F9TA 1RMU3 3IWZA 1FMD1 2D43A 5L19A 5FZMA 3UL2A 4AFAA 2Y38A 4ISRA 4EN6B 4YVWC 3NJXA 2VE1A 5ABJA 3KF5A 4XOGA 1PIV1 2PHWA 3WNKA 4UFKA 4CEYB 5A70A 4BB3A 2NPIA 4HPKB 1RUNA 3WG4A 1I3HA 1QOOA 1SFNA 3WDYA 3VBSC 3D3AA 3WX5A 5LZ6A 2VH9A 1SFYA 3VD9A 5BNOA 3ILRA 2NMNA 5C9AC 3I2GA 5GZFA 5KWRA 3WP5A 3M3OA 4N43B 4GB31 4URTA 3ES1A 3WG1A 3OB8A 4RS5A 3WOGA 1GZ9A 2W3JA 5KC5A 4BPZA 1QJZA 3I2KA 1UY1A 5BNNB 4QPYA 2OIIA 3WUCA 1A8MA 4YG6A 5FY5A 2D97A 2VULA 1VBE2 1W9YA 3SNMA 4A6OA 5CFDA 5F3EA 3LKJA 1RUJ1 3AKPA 2VJXA 1TEIA 2X09A 3FN9A 3AJZA 1DCSA 3VB9A 1Y9MA 4WVMB 1W90A 4HG6B 4Q27A 4BZ4A 4EWDA 2HWF1 2XLAA 1LHNA 1MS0A 4DEQA 5CKMA 5C4WA 2GMEA 5HI0A 2BNNA 2AH2A 1IS6A 2JJ6A 2QQJA 5GLTA 4AEDA 1ALYA 4BXFA 3KLSA 4NROA 3LDKA 4CCLA 4NPMA 2VD7A 4AFCA 1C8NA 1UXZA 4QPGC 5BYNA 1F35A 2Y6JA 3ZSKA 5FXZA 4R9CA 3T1LA 3ZKYA 1L3JA 2XQXA 1AYN2 1W2TA 2A6XA 4L99A 3JBG1 4KL1A 3VBFC 3OBZA 3SH3A 3IB3A 1N3OA 3HD8B 4HVRA 2WABA 5DZEA 5FP3A 3ACFA 3W9AA 3LA2A 4EN9B 2VR4A 1WA4A 4PLNA 4DXRA 2ZEYA 4GKYA 3VV1A 2IWGB 4AK3A 4CUAA 1Q8SA 3O1RA 1HRV1 4BIOA 2JE8A 3HR9A 1WW4A 3SCGA 2CWSA 4IV1B 4ZU4A 3HJRA 5EIYB 2L9LA 3ACGA 4PF1A 1FAYA 2QZ2A 3N7LA 2CTVA 1RUF2 2ZPXA 3SQOA 2O8OA 4CP9A 2BERA 2RS52 2VCAA 4QT6A 4R52A 1NCQC 1Y7BA 3N7JA 1TME1 1PVC2 1RL3A 4YPJA 4YARA 4RGKA 2A73B 4OZXA 5FPVA 3PL0A 5BV6A 1WCSA 2ZX1A 3UNPA 1RUC1 2R043 3O1VA 1CZSA 5E88A 1UY2A 4Y1VA 4E4DX 2QQKA 1LHOA 3H8XA 1KDKA 5K0UA 3ZDVA 1XNCA 2VPVA 3PNAA 1ASJ1 4P9XA 2HWE2 1LRHA 1GFF2 4JCKA 4XVHA 5FP8A 3OUHA 3ZN4A 2XG3A 1QJX2 1H4HA 2W0XA 1JYVA 4IQPA 1GICA 1S0GA 3ME2A 1X33A 5DAXA 2E32A 2VW0A 5ANQA 5BY5A 3LFIA 4HVQA 1R083 1AX1A 2K9ZA 4N53B 1PX3A 1PGL2 1G9FA 5CA6A 1EPZA 1BEV3 3FHAA 1QU0A 2V09A 1SDWA 1W8TA 4CU7A 3A21A 4MGQA 1S4CA 2V4VA 2DTYA 1IPJA 4WZCA 1RUH2 3FLTA 1E5RA 3ZYRA 4LT5A 2OUJA 4QX5A 2ETEA 4CYDA 2CU5A 4RYDA 1W6NA 4IEPA 1W8OA 5T5OA 1CZTA 2HWD3 2IXLA 4XETA 1XPWA 1PK6B 5JSRA 4K20A 3VKNA 4IV3C 2P3KA 4B4QA 5CB7A 1LKNA 4XAEA 5CFCB 1AR71 5F6KA 3EHKA 2OXBA 3M4FA 2BEOA 5LY2A 1TMF3 3M3EA 3AKSA 1OXCA 1DU3D 3IPVA 4Q26A 5FYZA 4BU2A 1CWPA 4M4RA 2NLRA 2E63A 4Q8LA 3DKQA 1SBDA 5AC92 1OSGA 5FOBB 1XRUA 2RS33 2I74A 3POGA 2B4KA 2GH2A 5GLVA 4RFT0 5KHKA 4COVA 2YZ4A 4YZ2A 2VGDA 4Y4YA 3VDDC 1AXKA 4CEYC 5BNPC 3DF0A 1IS5A 4KWUA 1I5ZA 1ZA4A 2Y6GA 4JC1A 3S7IA 1OOPA 3OGSA 2D6KA 1KFXL 2WYFA 3WINE 3H8OA 2D6LX 1RHI3 3GCXA 3OSDA 5JZGA 3BOPA 3A0NA 5H9PA 5FWJA 1JZ5A 3RWKX 4CPBD 2HWB1 2Q0AA 2R6QA 4S2FA 3T3YA 4XUNA 3NW4A 2JKBA 4YM2A 2Y6KA 1DGLA 1VBD3 4N7UA 4MYEA 4UI9L 3T09A 1GLHA 1FNYA 1RUI1 1O91A 2B8MA 1VBC2 2GNTA 1YFWA 2WZPP 4OFGA 1AYM2 5L9VA 3MZHA 1JHJA 1L7RA 1RVF3 1ULPA 2Z79A 3J4UH 3SKJE 1RUD3 1OFNA 1OQEA 3ILNA 3T1MA 3I3MA 3JB4C 4MHUA 2AEYA 5T52A 3VKMA 2WS93 1BZWA 3CJIB 2O8QA 4D69A 4XPVA 1GV9A 1O4TA 4FPLA 4LOTA 4YFZA 2QQIA 2IFRA 4KGQA 3A22A 1C5IA 5BNOB 3BPZA 5GLZA 5LA0A 4KGGA 4RN5A 1AL21 1LHVA 1AR81 5FDBA 1TE1B 2BNMA 4W6XA 4RS5B 3Q8FA 3FFZA 1K5MA 4IL7A 3KV4A 1REDA 2PQSA 1GP5A 2YXSA 1W2AX 1DQ2A 2QDNA 4TN7A 2JKXA 5BNQA 2X05A 4D7SA 1QJFA 1SZBA 4JGYC 3RFRA 5ERLA 3GYDA 5CFDB 1SFPA 3MUZ1 3ZIXA 4YGEA 1WLDA 5JOXA 2RJ2A 5D8AA 1MS3A 3PURA 2YPDA 5FYUA 4Q4Y1 5FZFA 1LU1A 1OBNA 1RC6A 2JDUA 4IXLA 4ZKTB 1LOFC 2YC0A 1PZ8A 3GALA 3O1TA 5CADA 3KVBA 5C4WB 2CGPA 1U12A 1SPPA 2YU2A 1UIKA 4QWNA 4AEDB 1U5XA 4CCOA 1JN2P 2BFUL 5B4NA 2GC2A 5A7PA 3C2UA 2XJPA 2VCCA 5HPOA 1OA3A 4YW3A 3CMGA 4DINB 2GDFA 3MHZA 2WQ8A 3MLKA 4I0WB 4M3CA 3AYEA 1J84A 3JD72 3RNSA 3WNPA 1FYUA 3H1MA 2A3YA 2W68A 4XQWA 3PVOA 2XXZA 4IEZA 1Z7S3 2HWC1 1RMU2 3CBNA 3UJOA 4AHYA 3ALQA 1SBFA 5JOYA 1CJDA 4BQ4A 3I7DA 2ZBJA 1H6XA 2VQ0A 3MFAA 1RINA 4A7YA 5I93A 5JXHA 3K4ZA 3I2DA 4QX3A 4WM8B 2WNOA 5FV3A 4IEXA 4LBLA 2YBPA 3PVBB 4FPCA 3WG2A 5DABA 1J3QA 4N53C 1OI6A 3NJZA 3KHBA 3P6BA 3DYMA 2JE9A 1FPN1 1QJEA 4P00B 5CZKA 2DUQA 3U0ZA 1XNTA 1JMUB 3AC0A 4YW5A 4CP9B 4XF4A 3AP5A 5A3OA 4R4ZA 4NAOA 5DUVA 1YFXA 1W03A 3M3CA 1S2EA 2Q4SA 4Y24A 4COUA 4HSLA 3OG2A 3ZYFA 4AWDA 3RRDA 1J3PA 2K2SA 1NUKA 4PIXA 5F2WA 4TSVA 5IVEA 5FLJA 4KWLA 2V4AA 5K0UB 5T5LA 3URFA 3HEIA 2VXJA 2Z69A 3U11A 5CFCC 5IHRA 4AHXA 4JVAA 1RUE3 3ZXKA 4UF0B 1A34A 4P5HA 4WZFA 1IS4A 1LU2A 3ZXLA 2A3XA 1O7FA 4RR3C 1VB4A 3FBYA 1UOGA 5FTTC 3V65A 2FZ1A 4MXWA 4YVWA 2R1BA 1LAJA 1WMEA 3IDEA 4CRQA 2A75A 2ZABA 2G1MA 3VZNA 3W5NA 1TG7A 2JG8B 5A3PA 2IC1A 1HQWA 3MO4A 2UWAA 3VBSA 4Q1RA 1AR91 1W2UA 2BDRA 1KDMA 3R6SA 2W87A 3DGTA 4QPIB 2Z5WA 1VPHA 1W6NB 2XBO3 2OZ6A 3HQXA 3OEAA 4NPLA 4WM7C 5FZ8A 5C9AA 1X36A 2A1XA 5GZDA 1QKQA 2VECA 1I1EA 1EAH3 2PMWB 2GP3A 1LNSA 2B9VA 3AJYA 5D1IA 2Y60A 2V5DA 4UXAA 1S2BA 1OC1A 5CEHA 4HETA 1POV1 2DU0A 2VUJA 2QQNA 3NO8A 4JQTA 3EXUA 5A6XA 3OGGA 5IJRA 5CISA 4M0NA 2OPKA 3ES4A 2D5HA 3IPVB 1G86A 3RWNA 1APNA 1ZZ6A 3THTA 2GN3A 1YCIA 4Q4W3 3W59A 1UPSA 5IATA 2AEZA 4DXZA 2ZACA 1IHMA 3E97A 3FX3A 3GZUC 2RHPA 5FQ0A 4ZONA 1EP0A 2ARXA 4QHBA 2E33A 1R1A1 2XJVA 3GCWA 3BTZA 3SITA 1AXZA 3G7DA 3CJIC 4QPGA 3AP7A 2XWJB 1C3HA 2WAAA 1OOPB 4XDQA 2W1QA 2WN2A 2LS6A 3R4UA 2BBAA 2GNMA 1BK0A 2AUYA 1SMVA 4CUCA 1D2SA 1Q8QA 1GZCA 3AXEA 3B9CA 2PLV3 2YBKA 1YFYA 2PHDA 4K21A 5JZGB 5G04L 1V6IA 4NHYA 1UOBA 2ADDA 3ZFFC 4JHZA 3VBFA 5DMYA 5KC6A 2FDFA 5ANNA 2HEYF 1W2NA 1T6GC 1S0CA 4IE0A 1ENSA 1VBA1 4NVPA 3VZKA 2VUDA 3SH4A 3VUOA 1HB4A 1UMIA 3D4KA 5JSPA 3K4DA 1AZDA 2WFPA 3PUAA 2R1DA 1V6NA 4LBJA 4O7XA 3FWEA 4COYA 5A3TA 3VDBA 2UURA 1I5PA 4FT8A 2VZOA 1D7PM 4F3JA 4RHV2 1O3TA 3I59A 3PIGA 4B7KA 4KG0A 2D98A 2W9XA 1NCQA 2ARBA 4YZ4A 2D3SA 2YB7A 5AFEA 2FHRA 2RS12 3PTRB 2NM1A 4IE7A 1ND2C 1Q8VA 1ONAA 2WZR1 3LPGA 3KCXA 3ITQA 1EPWA 4RGAA 1Y9QA 1NA1A 3H42B 3RPQA 4A6SA 1TMF1 4NMIA 1MEC1 2WFF3 5JVVA 4EN8B 3O1SA 4XF9A 3SCFA 2OQ6A 1CAVA 1NG0A 5LK7B 2WO1A 3UT0A 4GMP0 4XFBA 4ONUA 4X6QB 3IDCB 5DZFA 1LEDA 3BB6A 3D82A 1F31A 5IVYA 3QBQA 1VRH1 2DUPA 1MQTC 2DVFA 3NV3A 4WM8C 4NRMA 5F5AA 4W4ZA 4PBPA 2VOVA 4QDRA 4LHLA 5FMBA 1GOGA 4DY5A 3BCWA 4XFGA 1VBE3 1QNWA 1PM7A 1POV0 2P3JA 3FBMA 4HSJA 2CL2A 3USUA 1IGOA 3AZZA 4CDWB 1GQPA 1SPPB 2TBVA 5EJ3A 3ZSEA 3D5OA 1D0HA 3H3ZA 3Q8CA 5FZGA 4YSFA 1P8JA 2ID4A 2PAKA 5C3OA 4Q5OA 5L9RA 4IV3A 4FI9A 2VMGA 4M3CB 4BK4A 3I3EA 4CXXA 1QXJA 3UJQA 1ZBA1 2R071 3WW4A 5J98B 3KWVA 3GHNA 1W99A 4DXSA 2DVAA 3VBUC 2P17A 2PAEA 3I3BA 2WLQA 5KXDA 1NXD1 3LSDA 1O3RA 5DDJ2 5FPXA 1H8VA 3GXUA 3O0XA 2WBKA 1F8VA 2WZ8A 4J6GA 3AYAA 1GKBA 4DRRA 3EO6A 5DPNA 2FMDA 4BK5A 2RMU2 1KEXA 3PUQA 4CDXB 3BIWE 1HXS2 3A0KA 3NWKA 5T50A 5FYHA 4LTAA 3VDDA 1CAWA 2JG8C 2BJSA 4CEYA 5BNPA 4HPKA 4AI8A 1AX2A 4V1PA 3Q8AA 1W9SA 1OH4A 2MEV2 1LOEA 1S0DA 1QNYA 3K46A 4QPIC 1LCLA 4HMZA 1RUF3 4HANA 4Z8BA 1D4M1 4HKLA 1CX1A 2RS53 5JXIA 2BW8A 4UW4A 1PVC3 4AEMA 3C7FA 4Y1YA 3LCPA 2XJRA 4E2GA 3NAPC 1QDOA 3FZ3A 1AX0A 4FCAA 4LIUA 4XC9A 1CAXB 3GZAA 3KCCA 4JX0A 4W50A 4WVWA 5HV0A 2WT1A 1UMZA 4Z2AA 2F6BA 4XYXA 1J59A 4WVMA 1LHUA 1XSQA 1YQ6A 2HWE3 4L2NA 4ASMB 3BTYA 3UESA 1ZZ8A 1W8NA 3T2QA 1QJX3 2RDRA 4S2HA 3IIIA 3I8TA 3HBKA 1PO22 4MXWB 1H4GA 3WF1A 4C0BA 1ZRCA 2AACA 2XONA 1BMV1 1D0GA 1VBB1 4YM0A 4XCBA 5JI9A 1EYBA 3AVSA 2VNRA 4ZPIA 3VBSB 1ZZ9A 1JYIA 1X9PA 2OT7A 2SLIA 4FSJA 1Z7S2 2TUNA 3T4VA 1KS4A 2ZHMA 4H7LA 2IXCA 5F3GA 1UZ0A 2RM22 4YW1A 5C9AB 2ZAAA 2E7TA 2NZ9A 4QU1A 1RUH3 4XFFA 4P5YA 1XXNA 1NZIA 1W6PA 5EWSA 2CDPA 2XR4A 2TNFA 1HRI1 5HCBA 3THPA 1EV12 3ZXDA 1SHWB 4V2WA 4JGYA 2ZEWA 1ZVFA 2BWCA 2RR13 5HV4A 4TYSA 4EJRA 5C5TA 3I2JA 5JUVA 1LOFA 1MZ6A 4J1WA 1E57A 4AVVA 3N9NA 1LOGA 3J7HA 2ET1A 4X8PA 1DG6A 1ND3B 1WCDJ 2VCMA 3J8F1 5FQ0B 4CCEA 2D93A 1UZWA 4HBNA 5AC93 1KXGA 1CVNA 3AZVA 2VQTA 3NSTA 3PLQA 5FWEA 5HCFA 1VMHA 2G9GA 1H8TC 4DY3A 3WY6A 3QH6A 4I3PA 1QJU2 1LESA 2PA7A 5IT6A 1WCQA 1UMHA 5FFOC 1RJ8A 4N8MA 3RMXA 5EYYA 4AVBA 1K3IA 3VBFB 3ZMNA 5FZHA 1LOCA 3M2MA 4FFFA 4V2VA 1WBFA 4MLOA 4MX3A 3AMMA 4NIDA 3LIHA 4FPHA 5FJHA 4E2SA 2WIIB 2R062 4N53A 3RI8A 2OKXA 1ZRIA 3VZMA 3RZKA 2J1EA 1SACA 4IEQA 3VDCA 2FZ2A 2QCSB 2QQLA 1GUIA 4OQ8A 1OA2A 1OLRA 3I59B 1DZRA 4CDWC 4YGBA 3ZLIA 5FY1A 1AXYA 2JDKA 1OVPA 1GWLA 3MFCA 4CPBA 1AYM3 1UU6A 2PN5A 5FXVA 3H8UA 4GJYA 1PGW1 4XAAA 3POJA 3WCRA 2MNGA 5CKNA 4UOJA 5SV5A 4I30A 4LBNA 1WBLA 4XILA 2GH8A 1UW8A 4OI0A 3FFQA 1W6MA 3OPTA 5EJ1B 2VBBA 3POFA 5CFCA 4NRPA 4CCCA 3AKTA 5I8YA 2YC2A 1WWYA 2DVBA 1CAVB 2A3WA 3OPZA 1O4ZA 3CKHA 4M3CF 4CCDA 1UX6A 1TZOA 2P6HA 3N36A 2DFBA 5T5PA 1A8DA 3AYCA 2VW2A 3HMYA 4G4FA 3KV6A 4RR3A 2G9ZA 2VMCA 1S0IA 5T5JA 2OS2A 5C3SA 2C9KA 2XL7A 5DAWA 3N9QA 2E53A 4FXGB 2ZX4A 4CDXC 5A1LA 3ENRA 1NX9A 3IDAA 5FZCA 3S0MA 5FZ7A 3APBA 4NIIA 3IBMA 1QIQA 4NE9A 1S0BA 3USUB 4LK6A 4GKXA 3OUIA 3ELNA 2DWRA 3U10A 3UYJA 4E4SA 3K77A 4WM7A 2G9FA 2ZMLA 3DYPA 5CYYA 3WV6A 3LSEA 5I91A 4AYUA 2FCVA 3CQOA 5FPZA 1I6XA 2W1WA 3H0OA 4IV3B 3E5XA 1RIRA 2ZXQA 3QH7A 1POQA 3LPFA 3SCHA 2VZVA 3NKTA 3RQ0A 1HB3A 3W58A 2J1UA 5C71A 4QGMA 5FO9B 3M1HA 3JD73 3ZIWA 1L7QA 1E5HA 5SV8A 1FI2A 4XTPA 1FOD2 3GBGA 3AVRA 1V70A 1RUG2 4KU8A 1NE4A 3T0DA 3VDAA 3ZPOA 5KXCA 4NRQA 1AR61 5C3RA 3U78A 4AFBA 1OA4A 2GALA 3LEGA 1UY4A 2E7QA 1XNDA 2EA7A 4FPEA 1B35C 3EMRA 4FFGA 1OUXA 1X82A 3VDDB 1CAWB 4AHWA 3KV5A 3CJIA 5BNPB 5C8CC 1G9BA 5EQUA 2WFF2 1XYPA 3OBTA 4YWAA 3WQ7A 3RG0A 3ZXFA 1H2KA 2GAUA 2QQOA 5JLVA 3ZFFA 5LBCA 2H0BA 4BQ2A 4LA3A 3HQUA 5FY9A 4DO0A 1XNBA 4XQ4A 1FMD2 1T2XA 4FOWA 4D3WA 4FPGA 2XB6C 1BBT2 3DV8A 4P9LA 3IMNA 3O1PA 3QCWA 2JD4A 3BYWA 2BVBA 2ET7A 1UY3A 2VVFA 3BALA 4GZ9A 4N9IA 4CUGA 4NR1A 1QY4A 2DBNA 4P9WA 3NL1A 3WF4A 1LHWA 2ERFA 4MV2A 3WF0A 3DECA 3BGAA 4R8HA 2JD9A 4BMBA 2JWPA 2JXAA 1RITA 2EAKA 2YC4A 3RYPA 5DUWA 5C70A 3I54A 4EZ4A 3TEZA 3CNAA 1C57A 1H2LA 5IVVA 1ND3C 1DF0A 1UU4A 4GB32 4LO7A 1W0PA 4MGKE 4NJ4A 1UX7A 3C3VA 2ZGUA 1W6OB 4META 1FXZA 1ND2A 3TN91 3INAA 2OQ7A 1OLMA 4FTEA 1IZ3A 1KJLA 2MHFA 4OYUA 1QF3A 4BMEA 2B39A 4QX8A 1PZ9A 4LNVA 4I01A 4YG0A 1RUJ2 2AREA 1GQHA 1AYN1 4AF9A 4I0AA 1W6PB 1FATA 2HWF2 4KMQA 1OUSA 2F4LA 4PF5A 4YM1A 4ES8A 3NJYA 4IUGA 5IK4A 5CKQA 4JGYB 3B94A 4I3GA 4WM8A 3GZEA 4QQLA 4P02B 3RS6A 3ZFEB 1O59A 1QQP2 1ZBE3 3GM8A 4LJHA 2IVIB 4XXPA 4P9GA 1N1TA 4CCNA 3V56A 1Q3EA 3U4XA 2WINB 5A6QA 3M3QA 5DG1A 1O3SA 1AUYA 2ZGRA 3FC0A 1K45A 4S2DA 3WP3A 4B1LA 3H7JA 4GMP3 4IEWA 3T08A 2XMLA 3C7HA 3KGZA 3PVNA 4PT6A 4GIQA 4Q4X1 2ZJCA 4ASLA 5JPNB 2PHLA 3B9IA 3VZOA 1NOVA 3WHUA 4CTEA 5A3LA 3ZSLA 1V9U1 2WNVC 3BN6A 4PI2A 2X5IC 2VQAA 4GXLA 2FQPA 1HRV2 1GP6A 1WMDA 3VBUA 4EWAA 3J7MA 4OMDA 3ST7A 4NN0A 2YFZA 2DU1A 4D6QA 3HNMA 2A71A 4UF0A 1W2OA 4O61A 4BA6A 4FPFA 3MPPG 4XUQA 2Y8KA 5DG2A 1JW6A 2VO5A 5KXEA 3BVCA 2VVDA 5DQ0A 1E5SA 5JWPA 2GC3A 2BTVC 4WBBA 2JG8A 5F5QA 1F4HA 1PO11 2IVJA 2FDIA 3AL6A 5GZGA 4DUVA 1GSLA 2J42A 1KFUL 1ASJ2 2VOWA 4UW5A 4XEZA 4TLGA 2VNVA 5I0DA 3PMSA 4QPIA 2W39A 2DFCA 4IESA 1JH5A 4RHV3 4GWIA 4FAGA 4LQRA 1UYZA 5FREA 5GLUA 3IN9A 2WA4A 2WKKA 3A23A 1UF2C 3ZXGA 4URAA 1W9WA 3U4SA 3V0AB 3HIFA 3LDBA 3BTAA 2RS13 2RR12 4XZUG 1W6MB 4Q0SA 1PZ7A 1OLME 4LKEA 3CO2A 3NAPA 5FZ1A 4JDMA 1WUVA 2WUHA 5BPXA 2CY6A 1UAIA 1DLCA 2YDEA 5IFPA 1JODA 4UYBA 2WRAA 3U75A 1ZRDA 4OMCA 4D7TA 3ECQA 3J9SA 1C1LA 4LITA 4RR3B 2A5ZA 1V0AA 3R4DB 1YUDA 1F5JA 4PJYA 1JOPA 3UGGA 4GA9A 5FZ4A 2CGNA 3I2FA 2WR9A 3POYA 3WP4A 3VL9A 3J7NA 1WW6A 4XDOA 4OHYA 1BVVA 2LW8A 2Q8EA 1RXGA 1TNRA 1C8M3 1R091 2QNKA 4SLIA 2QKDA 1HV1A 4C90A 4WM7B 2WN3A 5FYMA 5HXVA 3RZJA 1F5FA 2Q8OA 5ACA1 5A32B 3ZSMA 3JUUA 1DGWX 2BVVA 1BCXA 5EFUA 4Y3OA 2Y34A 1DQ6A 3P3NA 1F4AA 4HL0A 1JZ8A 2R32A 1KRIA 1QHDA 4MSVA 5LW9A 1HN0A 5A33A 4DEVA 5F7UA 1UYPA 4H7MA 4LHNA 1CPMA 4Q0UA 1CGPA 2WO3A 2E7AA 4JDNA 3G6JB 4QAWA 1YIFA 2LTNA 1WLWA 2YMZA 4XF1A 1VBC1 1LOAA 1HB2A 3UV9A 5JXGA 4QXCA 4QX1A 5IWFA 4O65A 4ZU5A 5DDJ3 3RSJA 4CUBA 3ETPA 1WCKA 4FQZA 1M4WA 5J48A 5FLHA 4XMIA 4FPKA 1OMIA 3KQRA 4QMAA 2JEMA 5F3IA 3IAPA 5FUPA 4KWJA 3SEPA 4AHZA 1JOJA 1GWKA 1H8TA 1YQ5A 2RMU3 4G9SB 1HXS3 3B69A 2NP0A 4YFWA 3N35A 2YG0A 5FZBA 2Y33A 1W6QA 3A7QA 4FOVA 1UO9A 5FXWA 3ZFFB 2UU8A 5FP7A 3WSOA 5J7MA 1XNAA 2MEV3 1UWWA 3WUDA 5F5IA 3DPRC 1YO8A 3W20A 3FHQA 4QX0A 4EROA 2WNUC 4CDQC 2W5FA 4AGGA 2FDHA 1JZ3A 1G7YA 5FZDA 4UFIA 5H9RA 2C6SA 3ZFEC 1HV0A 1DZQA 2PYTA 4LO4B 4XJUA 2JDPA 4FQ4A 4Y4RA 3JCIA 4AI9A 3PIJA 5AVAA 4YNIA 1KD7A 4QKBA 5G05L 1LEMA 5FYTA 4Y20A 1MS9A 4CDWA 3O1MA 5FYSA 4BQYA 5DZGA 1AL22 2ADEA 5FP9A 3WZ1A 5E16A 4ARYA 1AR82 4E8CA 3H8RA 1QJY1 2D7FA 4K40A 4XCAA 3TRSB 3WQBA 1ND2B 3Q8BA 2EXIA 3AMQA 5LWBA 1W8ZA 2FDGA 1PO23 2DTWA 5FK7A 4BQ5A 4NWWA 4B1MA 4DQAA 5LY1A 3E6CC 4UWDA 1DQ5A 4XZPA 2ZGTA 4HOOA 4XBNA 2B7YA 2ZGSA 4Q4Y2 1OD5A 1SLIA 1XOYA 4EV0A 1S55A 1RMU1 3OY8A 3WNMA 2VOXA 1YIPA 2PHRA 4IE6A 1BYHA 2RM23 4OUSA 4ZXEA 4OI1A 1UCXA 2KM2A 1AJOA 3OCPA 3J26N 5F37A 3ZMOA 2YHJA 3KT4A 1MQTB 4Y1UA 1V00A 1UNBA 2GSYA 3VHRA 4QXHA 1EV13 2VCBA 2J22A 5FY0A 2ZX0A 1JU3A 3MV01 4J1XA 4CDXA 5FKCA 4XJWA 1UL9A 1US2A 3V64A 3VHPA 4W6WA 4AAXA 1SCSA 1R1ZA 4LLOA 4LHKA 4PBOA 1X8MA 4XFCA 4FO9A 2HWC2 3SISA 2JIJA 1HJGA 4CSWA 3O0WA 2QZ3A 1UPIA 4QGNA 2ORZA 2P3IA 2GP5A 1UD1A 4ATEA 4CP1A 4DZGA 1MVEA 1DGRA 1YWKA 4A42A 2Y6HA 4XJ8A 4PQQA 3VBUB 2PELA 1Y9GA 1QJU3 3I3DA 4XFAA 1DHKB 1CAXA 2AENA 2Q8CA 1W8HA 1FPN2 2C24A 2VZRA 3PJYA 3HAGA 4AGVA 4D6SA 5J36A 3RYRA 3WQ0A 4PIZA 3MF9A 4AXOA 2KXLA 1AL0G 1YC61 4X6RB 2FBEA 1B35A 3H1WA 1C5HA 5C8CA 3IT8A 2Y26A 5JMCA 3TBDA 3I2IA 1BJQA 3KS7A 2R063 2QQMA 1ENQA 3PJQA 2CHHA 1FT9A 5J1XA 1UIJA 1TQ5A 4QKDA 4YVSC 4RA0A 1ULEA 4DIQA 4NWVA 1VJ2A 2G19A 4DS0A 4FAHA 4QX7A 5FJKA 3NNMA 3DYOA 2Y64A 2QUOA 3WHTA 3AX4A 4H3WA 1R64A 3NAPB 1WA6X 1ZBE2 2WL1A 3LA3A 1QH7A 4M3CE 3POSA 3TAYA 2D6PA 3WR0A 4BJ0A 5T55A 2Q1MA 4LMFA 4XBLA 4Y5TA 2P5BA
chains in the Genus database with same CATH topology
2I07B 5IUQA 4E9KA 5H9QA 4QXKA 3PHMA 2AGSA 1ND3A 3MGUA 2F4PA 1RJ7A 1PNFA 2R041 4TZDA 5FLIA 5F6LB 4AEKA 1SCRA 1FX5A 3N7MA 2ZGQA 4Q4V3 1COV2 3QLQA 3DKWA 2XPJA 3TB0A 3JQXA 1ZM1A 2CAUA 4AE2A 2EXJA 4XF0A 1R081 2CWMA 4EWEA 3CF6E 5A33B 4LE3A 3AKRA 1BEV1 1R1A2 4P14A 3RJ2X 4BYYA 2VNGA 1LULA 5HCAA 2RE9A 3MW2A 4R9BA 1QH6A 1GZWB 4LO8A 2CNAA 2HWD1 3IIAA 4QGLA 1FOD3 1H2MA 1RUG3 4XW3A 4PIYA 4E2QA 4LBOA 1H8TB 1MS8A 2WNVA 1O5UA 1VBA2 4AI0A 4LBMA 4ORFA 2WT2A 2X5IA 4JRAA 2ZKNA 1W6QB 3ZSJA 1GQGA 5IK7A 1LTEA 1NY72 4CDUC 2XLFA 2D3RA 2RS31 3JB8A 4XJAA 1RGSA 5LRRA 2XUMA 3AK0A 3KZ4C 4HLTA 3HT1A 2XVKA 5E89A 1FMD3 2X8KA 1DFQA 1NE6A 2VUAA 4JTOA 3ZDSA 1C8M2 1BBT3 4XIKA 2WZR2 5EXOA 4P9IA 3GBWA 1PIV3 1CESA 3OF1A 4K1ZA 2P2KA 1MEC2 4LUMA 4Y20B 1G9AA 1RHI1 4KH9A 1UZYA 3CEWA 1WLTA 4AW7A 3FUOA 4OUMA 1XNKA 4IETA 5I0UA 1UN1A 2R0FA 4GB33 1WLCA 3VBOB 2WA3A 1VRH2 1VBD1 4GWNA 4COZA 5CIRA 3OY8B 2ZAHA 1RUJ3 2HKXA 5TSWA 1RVF1 1RUD1 3GBFA 3AP4A 4GH4C 1YHFA 4LULA 2HWF3 2WS91 3AFGA 4WV8A 3B93A 3P3PA 4DRVA 4G3YC 2C5DA 4DMIA 1KITA 1HQLA 4NHKA 1IPKA 2R072 5CU1A 4YRDA 1QQP3 4YGDA 4A2UA 3SXWA 5LRSA 5CG8A 3M8LA 3BODA 4NPRA 4FP2A 2YV8A 2VOKA 5FBZA 1HX6A 1XE7A 3JBG3 4XBQA 4R4XA 2ZMKA 4HKOA 4U36A 1DDLA 4BWOA 5GALA 2OUHA 1HRV3 2XKPA 1N1YA 3VBRC 1V6LA 4YZ5A 5K8SA 2QFEA 2WNEA 2ZZQA 1H2NA 1D4M2 1B35B 1XE8A 1CAUA 1WD3A 2SBAA 1A6CA 5C8CB 4QQPA 3OGJA 1W6OA 1URXA 2B45X 4K6BA 1HDKA 3O7OA 4GALA 1C1FA 1O4YA 4O9EA 1GNZA 4P9YA 1Z7S1 3WW3A 2XVGA 1HKDA 2H6BA 4AQ6A 4CP2A 5B2GB 1ASJ3 3L2HA 2UWBA 1ULDA 3CL1A 3DPRA 3D0SA 4BCUA 3GNEA 2N7GA 2WNUA 4RD7A 2D6NA 4CDQA 1FV2A 1SLCA 3ZFEA 4YW2A 4AG4A 1VBB2 4K1YA 3VKOA 3VHOA 4IEYA 2Z2SB 4OHWA 2NN8A 5CNAA 1Y43B 1CD3G 2HJIA 1OQ1A 4DOUA 1HRI2 3SH5A 4TLFA 4W65A 2ZMNA 1SQ4A 1V6OA 4KWKA 3KD4A 4AVTA 2ZHKA 2HYKA 1RUE1 2GMPA 1AR73 1MVQA 5L36A 2GN7A 4BHPA 4ZXKA 1YFUA 4Y22B 3FJSA 4RQPC 5I0SA 2DCKA 3J8F2 1OPMA 1DLLA 3HN1A 4YGCA 4Q1PA 3H1YA 5I0RA 1REFA 3GF6A 1S0EA 4XQDA 2W52A 2R16A 2XBO1 5I0TA 1PNGA 3N7KA 1I9RA 1GBGA 3RMYA 4E27A 2DF7A 5J96B 2BPA2 1EAH1 1NCRC 3H9AA 4B29A 1JBCA 2HEVF 2K0GA 3ATGA 3FLPA 2GNBA 2WNVB 1GR3A 4KNCA 3V0AA 2X5IB 5FCCA 3MDPA 3VBOC 2HWB3 1VAVA 3DL3A 4Z07A 2D3PA 4PDWB 1DIWA 3RDIA 4NO4A 1YI7A 2QJVA 4Q4W1 2ZGLA 3B00A 2XJSA 2ILMA 1RUI3 3VLBB 4Q2FA 2B42B 4K9SA 1NZCA 4PLOA 3ZPYA 2Q1ZB 1PGW2 3LOBA 3LZZA 4Q4V2 4BE3A 4IEOA 1REEA 1WW7A 2DCJA 4AFMA 1QGLA 3V0BA 4S2GA 4YYOA 3AZYA 3Q9OA 2I2SA 4YVSA 2PLV1 4OHVA 5C33A 4HT1T 1X7NA 5A32A 2EXHA 3KGLA 2XHKA 4L8QA 4QQHA 1AL23 1OFSA 1CX4A 4XTMA 1PVXA 3UKVA 1AR83 4INDA 1JXNA 1H1IA 4MGYE 1D2QA 3K48A 4FPOB 1KQRA 4M0HA 1M06G 1A3KA 1CIWA 2RJLA 3VHNA 4NHLA 1XU1A 5J09A 2C1FA 3E6BA 4Q4Y3 3LOIA 3MI8A 3DUIA 3SLIA 2AZ5A 2C0ZA 1S0FA 1BK1A 2H6CA 4KQ7A 2D6MA 4MZUA 3MIBA 3WD5A 3AXDA 4B3NA 4CEWC 3PTYA 2WFF1 2KA3A 3WG3A 2IXKA 3WDXA 1Q5OA 2DCZA 2VW1A 1VIWB 2IXJA 3H3UA 3KT1A 5E8AA 4AQ2A 3KB5A 1H9WA 2HWC3 4FVVA 1LGNA 4LLFA 1AR62 1B09A 1DYPA 1BBT1 3AB0A 5EV7A 4A7ZA 1NQJA 1PIV2 1VBE1 3OTFA 4LO6B 3MF6A 4A3XA 5AVPA 1CONA 3H7YA 1N1SA 4KBBA 1YXWA 5BUVA 1FPN3 5JOZA 2IZWA 3RZZA 2ZGKA 4Y26A 1CAUB 2BUKA 3MW4A 3OBRA 2BQPA 2XLGA 3ROUA 1SEFA 3UKNA 2WC2A 3TYJA 4FTBA 4P9JA 4YLZA 2R0HA 2TEPA 2ZA9A 2EIGA 3TOJA 4CDUA 3DPRB 3OJBA 5JIAA 2WNUB 2WQ4A 4CDQB 4LR4A 2E6VA 1MQTA 3VN4A 1N3PA 3TN92 3ZX7A 4TWTA 1QQP1 4BH9A 4YZ3A 2H0VA 3V0BB 1EY2A 4QD2A 1RUF1 4F83A 5LEJA 1AR93 2RS51 5JCTA 4XHBA 4DB5A 1PVC1 3JBG2 3JZVA 3BU7A 1DGRN 1YJLA 4OHXA 1GANA 4JGZB 4I02A 1D4VB 2PFWA 2A6WA 3RYKA 2PHTA 2JECA 3WDWA 4GWMA 3OYWA 5L7OC 4PDWC 3NV2A 1COV3 1POV3 2HWE1 3RI9A 5E1RA 4MVTA 1SLLA 1QJX1 3LGRA 3MIGA 1N47A 4GH4A 2A70A 2JDZA 1ULFA 1TME2 4Q4X2 2G4IA 2XJQA 4ATFA 4UW6A 1MZEA 1RUC2 1PGL1 1LODA 1V9U2 1IQAA 1X8EA 1R1A3 4UBHA 2OA2A 1NA1C 2DV9A 2VXRA 2UWCA 2OYZA 1RUH1 1JTZX 2NMOA 1BXHA 4AGRA 2RR11 5KHJA 4MGIE 3PVEA 3X29B 3MLLA 4N90A 1VBA3 1Y3TA 2VMHA 2VVEA 2I45A 1PO12 5GZEA 4PQ9A 3VBRA 1MZ5A 3FHIB 1H9PA 1DGWA 1PMIA 2GC0A 1DQ4A 3TNPB 1WMFA 5AC91 3VBHC 1CN1A 3POWA 3PMEA 3L2YA 1OPOA 1UKGA 3VKFC 2PQQA 2UY8A 3WDUA 3VGIA 1Q43A 3ZYIB 1CR7A 1Q56A 4N9HA 3AKQA 1AR72 1IKQA 3IDBB 4RSUA 4YVSB 2WZR3 3NV4A 1W39A 1MEC3 4HFSA 5FMOS 4FBFA 1DQ0A 1VB2A 1LGBA 1OHFA 1VLNA 4H14A 4ES9A 5JI7A 4D7YA 1MACA 1AVBA 5GKAC 4K3UA 3HBZA 1VRH3 4DNYA 1ZZ7A 4M00A 4YM3A 2EF6A 3E6DA 1R092 1GZWA 4PCRA 3FE5A 5GM0A 5ACA2 1AYM1 1J58A 2IXIA 1QWRA 5FRAA 5JR7B 2VY0A 4X8NA 3O12A 5F1RA 2JENA 4N43C 2XH6A 2HWB2 4ZU7A 1VAMA 2JG9B 3D6EA 1C4RA 3ZFGB 1LGCA 1NXMA 5BNNC 2RJKA 1QOSA 2R30A 3B3QE 2OVUA 1ZBA3 2R073 2QDRA 1YLLA 2EVXA 1V6KA 1HLCA 1ZZBA 2ZGOA 3HWJA 4JRLA 5IK8A 3AMPA 1S0JA 1RUI2 4FOQA 1ULGA 1VAKA 3EJKA 4QQ2A 1U0AA 1X50A 3NV1A 3AFKA 4KG8A 4COWA 1LR5A 4RQPA 1FNZA 1VALA 3B01A 3HT2A 5KHHA 1NLSA 2LM3A 5ABJB 2DCYA 4Q0VA 4OLLA 2FMYA 2R49A 2CYFA 2PHUA 2XL9A 1AHSA 4C91A 4MXVA 1YJKA 3WDTA 1RB8G 2CAVA 3ILFA 4N7IA 5T3NA 1NCRA 1KS5A 1IS3A 4BLIA 2YGMA 3B02A 1D4M3 1DYKA 5GJ6A 3VBOA 4JGZC 4AFDA 3JD71 2E9QA 2ZS6B 4IERA 1WGPA 1MS1A 3N3HA 1ZYBA 5C6CA 1ULCA 1FV3A 1MZFA 3MEPA 4HVOA 3SMHA 4CDUB 2D6OX 1HQNA 4IV1C 5CG9A 4XFHA 4KU7A 3S6PA 5FO8B 4U2AA 1QJY2 2ENRA 1OKQA 4JV4A 5AFBA 2QQPA 1LB2A 1C28A 3FUQA 3E5QA 2DCTA 1N3QA 1YYNA 1VBB3 5LK5A 5T54A 2DVGA 3DN7A 1WW5A 3B5LB 4B4PA 4XJ9A 4R9AA 3MW3A 1H30A 2ZZJA 3O0VA 1Q8OA 1CQ9A 2Q30A 3MIHA 1MS5A 1MR5A 4HK8A 4Z2WA 1HRI3 3OYWB 1ZX5A 3IM0A 4RGGA 5LEKA 3L9JT 4Q29A 5EYXA 3N4MA 4B4RA 4GH4B 2GNDA 1UKRA 3R05A 3ZO0B 1XU2A 2CGOA 3ETQA 3WW1A 4LO5B 4LEJA 3J8F3 2DURA 1PK6C 4XE9A 4B7EA 4CEWA 4L11A 1S1AA 1G9DA 1IKPA 4BLJA 2WJSA 4XFIA 1V6JA 4FPJA 3S30A 5JOWA 2V5YA 2A6VA 4JAAA 1RTVA 1DZTA 1ZBE1 1YRZA 2BWAA 1SLAA 3R4SA 2EALA 3VBRB 4AQTA 5L73A 1AR92 4HK9A 4GMP1 3VZJA 5FO7B 2GC1A 3MPBA 4W6YA 5J37A 1IOAA 3T2TA 4BQ1A 3NKGA 2BNOA 4XMAA 4AVCA 1BVP1 2AR6A 3LAGA 4OVEA 1GYKA 2JG9C 3ZFGC 4WVZA 1COV1 4M01A 2XJTA 4L92A 3RJRA 3KCYA 3LB9A 2YGLA 1CPNA 4RL7A 4MGZE 3WW2A 1N1VA 4I2OA 2VMIA 2W08A 5CVRA 1G9CA 1S2KA 1AF9A 4LBQA 4Y22A 1HIXA 4JQRA 3ZN6A 3H50A 2R042 2VU9A 2X53S 3UKTA 5ABJC 4EN0A 2Q5TA 2ZKLA 5A3MA 5I8TA 3ZN5A 4OULA 1J1TA 1SBEA 3KM5A 3VZLA 5K9YA 4HKWA 3TNQA 1JUIA 1SLTA 4CZSA 4RHV1 5BNOC 2X29A 1QXPA 1NYWA 4BM8A 1J1LA 1GNHA 4Q8KA 2RS11 3AP9A 4FOYA 2B46X 4RS5C 1R082 4E4ZA 2O0OA 4AI1A 4SBVA 4OI4A 1BEV2 2GZWA 3IKWA 5KHIA 4Y1ZA 4PDWA 2JICA 5CFDC 5L7OA 2A6ZA 5KXBA 1LJ7A 1XYNA 2JE7A 4NOTA 1NY71 3ACLA 1VP6A 4RQPB 2HWD2 1XQNA 5C4WC 1U5IA 4F8AA 1JYCA 2BGCA 2UYBA 4AEDC 1AR63 3LA7A 1ZZCA 2ZHNA 3B7MA 1C8M1 5CBLA 2A6YA 3QOPA 4ISQA 1ZRFA 1TMF2 3JQWA 1UU5A 3MIFA 1H0BA 1NCRB 1DQ1A 2WWSA 3NVCA 5GLWA 4FPYA 1JHNA 3ZVXA 3D0JA 4NHMA 1K5MB 3WDVA 3ZYJB 3WT3A 2RS32 1NQDA 3CU7A 5HBAA 3EQEA 2EAAA 5KBFA 2NQYA 4UBGA 4GQ7A 5D8AB 2O1QA 3M3IA 4IEUA 1BKZA 4YW4A 2JX9A 2DYCA 4O9GA 1RHI2 4WVVA 5DDJ1 5EZWA 2ES3A 5JAXA 3VBHA 1W0OA 4R9DA 5JIUA 2RMU1 2IXHA 5DUXA 2DVDA 1HXS1 3ZXEA 3ZYGA 4YZ1A 3TN93 4K8FA 3M7AA 1ZBA2 5JSOA 1VBD2 5K0UC 1ZRRA 5I8SA 3VL8A 1H1AA 2MEV1 2Y0OA 2YUEA 3CLPA 3GZTB 4HN1A 3QACA 2E51A 1RVF2 2ZGMA 3AMHA 3D8CA 1AYN3 1PGSA 1RUD2 4UW3A 4Y1XA 2P34A 3O14A 4AVAA 4EROA 4Q0QA 3K51A 1JUHA 2WS92 3AZWA 3O5SA 2CV6A 2ZHLA 3A4UA 1WD4A 1MS4A 1ZNPA 2B5HA 1UZZA 5KHGA 3I4IA 5K7PA 3WQ1A 3UK9A 2UYAA 5C8WA 1YNAA 4XF3A 3MICA 1PO21 5FMOL 4OI2A 3MIDA 4N43A 4Q4X3 1TME3 2MPFA 3OD4A 1LOBA 2D40A 3USSA 4CEWB 1QOTA 5BNNA 2BYVE 1O3QA 1BQPA 1RUC3 1V9U3 2V73A 5FAXA 1U5YA 3OD0A 4XXAA 3ASIA 2RM21 5IK5A 2PHFA 5DUUA 1LECA 4AEJA 3AP6A 1RUOA 4QM9A 1EV11 1CJPA 4L97A 4OHZA 4YVWB 2LUWA 4H55A 4CP0A 4AQSA 2ZOEB 1Z0HA 4D94A 1BMV2 2WT0A 4FTSA 3ZXJA 2P37A 2DUOA 1QDCA 3WNXA 4PLMA 1KJRA 2D44A 3MYXA 2NYYA 4XIOA 1PO13 2YROA 2ZGPA 1OOPC 3E5UA 4Z82A 4C1XA 5JPMB 1HW5A 2XKOA 2PHXA 5JZGC 3WXPA 4XHXA 2B9UA 4LUKA 2GU9A 1AJKA 4ITCA 5CAZA 1QMJA 4LE4A 1ZREA 4JGZA 1QJU1 2XJUA 2WLPA 4YG3A 2ZX3A 4IV1A 4LBQB 1ENRA 3BOWA 4I0BA 2OW4A 3ZN6B 2C9AA 1VR3A 1F9KA 2OZJA 1G8WA 2R061 3FLRA 4QPGB 1OQDA 3KT7A 4EN7B 4L9BA 4QM8A 5DXDA 2Z42A 1Z78A 4AVSA 3AYDA 4GULA 1RUE2 1G6NA 4DFSA 1R093 2WSUA 1A78A 3ZXAC 3JU9A 4A7KA 2BFUS 5ACA3 2ATFA 4XJZA 1LENA 4JDOA 4LBKA 1K5MC 2XWBB 2WQZC 1F2NA 5GZCA 1PHMA 2WSVA 4K7JA 5L7OB 1Q8PA 5D8AC 2VNOA 2YPJA 3R0RA 4MH0E 3TWIA 1XYOA 4AI2A 2QVSB 2XBO2 4F7ZA 4DPNA 4LA2A 2UY9A 4HZFA 2VG9A 2HEWF 1EAH2 1NCQB 2Y0IA 1VBC3 5FOJB 3AM2A 4LBQD 4QU2A 2PTMA 1PK6A 3QD6A 4Q4V1 3WP6A 3U07A 4JTNA 1NA1B 4IEVA 3GHMA 4Z1VA 3AMNA 3WLUA 2PAMA 1DBNA 3WCSA 2YY1A 3MIEA 1ENXA 4Q4W2 2LALA 2QE3A 3VKLA 5J3UA 3KSCA 1YI9A 5H9SA 4BIFA 5BXXA 1QXRA 1O5LA 4Z92B 3SHRA 1SLBA 3CJXA 4Q0PA 1H1MA 3ZYPA 2XVLA 3EBRA 1NLRA 2GMMA 4C1WA 2ZCWA 3WVJA 1FOD1 4FP3A 2A7AA 2PLV2 3M70A 1RUG1 4Y5Z0 2D5FA 4I09A 2IFWA 4C0HA 3VBHB 2XGXA 2ZGNA 5JDBA 2ZX2A 1U5ZA 4QQOA 3AZXA 2AYHA 3MLJA 2YYOA 1OLQA 1QJY3 3S7EA 1J3RA 2EXKA 2JG9A 3ZFGA 2BBVA 4FXKB 4B8EA 1TNFA 3KMHA 3LWCA 4HN0A 3FMGA 4MUVA 1V6MA 2ZTNA 4BOWA 5F9TA 1RMU3 3IWZA 1FMD1 2D43A 5L19A 3UL2A 4AFAA 2Y38A 4ISRA 4EN6B 4YVWC 5ABJA 4XOGA 1PIV1 2PHWA 4CEYB 2NPIA 4HPKB 1RUNA 3WG4A 1I3HA 1QOOA 1SFNA 3WDYA 3VBSC 3WX5A 2VH9A 1SFYA 5BNOA 3ILRA 2NMNA 5C9AC 5GZFA 5KWRA 3WP5A 3M3OA 4N43B 4GB31 4URTA 3ES1A 3WG1A 4RS5A 3WOGA 1GZ9A 5KC5A 4BPZA 1QJZA 5BNNB 4QPYA 2OIIA 3WUCA 1A8MA 4YG6A 2D97A 2VULA 1VBE2 3SNMA 5CFDA 3LKJA 1RUJ1 3AKPA 1TEIA 3AJZA 4WVMB 4BZ4A 4Q27A 4EWDA 2HWF1 2XLAA 1LHNA 1MS0A 5C4WA 2GMEA 5HI0A 2BNNA 2AH2A 1IS6A 2JJ6A 5GLTA 4AEDA 1ALYA 3KLSA 4AFCA 1C8NA 4QPGC 5BYNA 3ZSKA 4R9CA 3T1LA 1L3JA 1AYN2 2A6XA 4L99A 3JBG1 4KL1A 3VBFC 3SH3A 3W9AA 1N3OA 3HD8B 4HVRA 5DZEA 4EN9B 3LA2A 1WA4A 4PLNA 3VV1A 4GKYA 2IWGB 4AK3A 1Q8SA 1HRV1 4BIOA 3HR9A 1WW4A 3SCGA 2CWSA 4IV1B 4ZU4A 1FAYA 2QZ2A 3N7LA 2CTVA 1RUF2 2ZPXA 2O8OA 2RS52 4QT6A 4R52A 1NCQC 1Y7BA 3N7JA 1TME1 1PVC2 1RL3A 4YARA 2A73B 4OZXA 5BV6A 1WCSA 2ZX1A 1RUC1 2R043 5E88A 4Y1VA 4E4DX 1LHOA 1KDKA 5K0UA 1XNCA 2VPVA 3PNAA 1ASJ1 4P9XA 2HWE2 1LRHA 1GFF2 4JCKA 3ZN4A 2XG3A 1QJX2 1H4HA 2W0XA 4IQPA 1GICA 1S0GA 3ME2A 1X33A 2VW0A 5BY5A 4HVQA 1R083 1AX1A 2K9ZA 4N53B 1PGL2 1G9FA 5CA6A 1EPZA 1BEV3 1QU0A 2V09A 1SDWA 2DTYA 1IPJA 4WZCA 1RUH2 3FLTA 3ZYRA 4LT5A 2OUJA 4QX5A 2ETEA 4CYDA 1W6NA 4IEPA 5T5OA 2HWD3 2IXLA 4XETA 1PK6B 5JSRA 4K20A 3VKNA 4IV3C 2P3KA 4B4QA 5CB7A 1LKNA 5CFCB 1AR71 5F6KA 3EHKA 3M4FA 2BEOA 1TMF3