2ET1A

Oxalate oxidase in complex with substrate analogue glycolate
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
201
structure length
201
Chain Sequence
TDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and spectroscopic studies shed light on the mechanism of oxalate oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Oxalate oxidase 1
total genus 44
structure length 201
sequence length 201
ec nomenclature ec 1.2.3.4: Oxalate oxidase.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2et1A00
4HN0A 4AVBA 4HVRA 4BIFA 2IXCA 4EWAA 2XGXA 1LKNA 3LA3A 3HIFA 2KXLA 2CV6A 1O5LA 5FQ0B 1FXZA 3EO6A 2EA7A 4Z82A 4MGKE 4XFBA 5FPXA 1SQ4A 4HLTA 4BYYA 3H3ZA 3NSTA 3CLPA 4IEYA 5JSPA 1LR5A 5KHHA 4HZFA 4HBNA 4IEQA 5KHKA 5JSOA 1X8MA 1CAVA 3UKVA 1CAXA 3LAGA 4HVOA 5KBFA 4IEXA 4X6QB 3ETQA 4JVAA 2QNKA 5LEKA 1ZREA 3UKNA 4I01A 3KSCA 4E2SA 3FFQA 4ZU5A 3UKTA 4EWDA 3NL1A 2ET1A 4AVCA 1L3JA 4GULA 3FWEA 1O4TA 1OMIA 4UBGA 5I0TA 3E5QA 1EYBA 3LA2A 5D1IA 3EBRA 3DKWA 2GC2A 3OGJA 4EROA 2XHKA 1DGRA 4O9GA 5LRSA 1YFUA 3OTFA 3H1MA 4XF1A 1NE6A 4PIYA 1ZX5A 2ETEA 2Q30A 1NXMA 4KWKA 1YHFA 3IIAA 2DCTA 4MX3A 4F7ZA 5C6CA 2BGCA 1J3PA 2H6CA 4HSLA 1WLTA 1ZZBA 2UY9A 4XF4A 4K8FA 4WZCA 1ZRDA 5I93A 4ZU4A 3E6DA 3H9AA 2F4PA 2IXLA 2PQQA 1PMIA 2XKOA 1X7NA 5BY5A 2PYTA 4HSJA 4YNIA 1GQGA 2D5FA 2XL7A 2EAAA 2BEOA 4LUKA 4FBFA 1VJ2A 3H1YA 4ONUA 2MNGA 4XETA 3KGZA 4QGNA 2GC3A 2B8MA 3WW4A 5FLJA 4XFCA 3KCCA 2XKPA 1G6NA 5I0RA 3SHRA 3RZZA 5LRRA 1XE8A 4KU7A 4XF0A 3RNSA 1CGPA 1UIKA 3M70A 5JR7B 1LB2A 2D93A 3H7YA 4MZUA 1XE7A 1NE4A 3CL1A 3PLQA 1O3RA 2H6BA 4UBHA 4BH9A 1O3SA 1J59A 1IPJA 1RC6A 3E97A 4R8HA 1CAXB 1CAVB 1J3QA 4J1WA 4D7SA 4D7TA 2I45A 1UPIA 5E1RA 3H3UA 4TLFA 3BALA 4XFIA 3PNAA 5BUVA 4PJYA 1QWRA 3BB6A 2HJIA 2GH2A 2QCSB 3FHIB 2VQAA 4O9EA 4Z07A 4HN1A 3E5XA 3ZDSA 2PFWA 1CAUA 1X8EA 1I6XA 3E6CC 2IXHA 5E16A 4MH0E 3WW3A 2ZCWA 4DINB 3EJKA 1UW8A 2PHLA 3H7JA 2E9QA 2BYVE 4Q0PA 5BXXA 3SCHA 3I7DA 4LLOA 3FE5A 2BNNA 4KWLA 3S7IA 1FT9A 4I09A 1O5UA 3E5UA 3C3VA 2EVXA 3IDCB 1X82A 2CAVA 1YFYA 2C0ZA 5FDBA 3ROUA 3FX3A 3I54A 3WW1A 2CGPA 3MPBA 5I0SA 1PM7A 4F8AA 2PAMA 1QY4A 4PIZA 4RD7A 2VECA 1DGWA 1XRUA 4QMAA 5F1RA 2O1QA 2GAUA 4MUVA 2O8QA 3ES4A 2GC0A 4QX5A 4ORFA 2BNMA 3U0ZA 3DV8A 1RUOA 5FPZA 4Q0VA 5J3UA 1Q5OA 4IERA 1WA4A 3SMHA 5KHIA 2V09A 2D40A 2GU9A 3H50A 4FAGA 5I8TA 4I0BA 4LA2A 2WC2A 1RGSA 1ZZ7A 3EHKA 4QXKA 4QGMA 4YARA 4I2OA 4KWJA 1CAUB 3S0MA 1RUNA 1Y3TA 4L2NA 4AVAA 3IBMA 5FLIA 2Q4SA 2CAUA 3S7EA 5K8SA 4LEJA 4P9GA 4B29A 3TNPB 4IEUA 2IXKA 4PIXA 4META 1O3QA 2IXJA 1CX4A 3FZ3A 4UXAA 4QGLA 3VHRA 4LULA 1TQ5A 3KMHA 3KGLA 2OA2A 3I59A 4AXOA 3HQXA 4BHPA 4XFFA 4IESA 3IWZA 4XFAA 2Y0OA 5J7MA 2GC1A 3D0JA 4EV0A 3D0SA 4E2QA 2MHFA 5KHJA 1O7FA 3RPQA 4LTAA 1YFXA 2XLFA 4Q0UA 1UD1A 4FAHA 4MGIE 1OD5A 5BV6A 5T3NA 1DZTA 3CF6E 2MPFA 5I8SA 3LZZA 1HW5A 2QVSB 2ATFA 1DZRA 3CEWA 5KHGA 2PTMA 3ES1A 3EQEA 2Q1ZB 1IPKA 2GZWA 2N7GA 4YYOA 2UY8A 1ZZ9A 1NZCA 1SEFA 4YRDA 4AQ6A 5HI0A 3CJXA 1CAWB 1UCXA 1SFNA 5EZWA 1NYWA 1RL3A 2XL9A 3QOPA 1ZRRA 4XFGA 1O3TA 2QJVA 4L11A 1OI6A 3BCWA 4XF3A 2Q0AA 3PVBB 3CO2A 2IC1A 4MGZE 4LUMA 3GYDA 1YLLA 2Z2SB 3E6BA 3OD0A 1JUHA 4MGYE 3HT2A 3USSA 5JAXA 1ZVFA 4IETA 2ZKLA 5CVRA 1EY2A 4MV2A 1H1MA 3RYPA 1VR3A 1ZZ8A 3SCGA 2VPVA 4OFGA 4Q0SA 3OCPA 3B02A 2PAKA 1Y9QA 1ZZCA 3DN7A 4HVQA 1UIJA 3U10A 3BPZA 3N4MA 4IEVA 4XF9A 1OFNA 4IEWA 4E2GA 4A2UA 3ACLA 1ZRFA 3FJSA 3SXWA 4J1XA 4R52A 3H8UA 4N9HA 1I5ZA 2FQPA 3NKTA 3DL3A 3HT1A 4NVPA 4EWEA 1YWKA 4HMZA 4JV4A 5JCTA 4FT8A 4WVZA 4IEOA 1GQHA 3I59B 3TNQA 3ELNA 2H0VA 5LEJA 2UYAA 3NVCA 3RYRA 3D82A 3O14A 2IXIA 3G7DA 2BNOA 5J48A 4LA3A 4ZU7A 4WBBA 5BPXA 1ZRCA 5CADA 2FMYA 1U12A 3ST7A 2OZJA 2PHDA 2K9ZA 1EPZA 1J1LA 4JTOA 4I3PA 3R6SA 3RYKA 1YUDA 2PA7A 5FQ0A 1RTVA 2WFPA 4AQ2A 1YFWA 3NJZA 5I91A 1FI2A 4KL1A 4KU8A 1J3RA 4YSFA 2B5HA 4Q29A 5I8YA 4XEZA 1CAWA 2UYBA 4I0AA 2OPKA 1WGPA 4QM8A 1VP6A 3BU7A 1LRHA 1QXJA 1EP0A 1QXRA 1Q3EA 2XLGA 3WW2A 3M3IA 5C8WA 3L2HA 3H1WA 5CU1A 3QACA 1H1IA 3NW4A 3MYXA 1V70A 2ET7A 5JSRA 4Q0QA 4JTNA 1J58A 2HKXA 2P17A 4N9IA 5AVPA 1Q43A 2XLAA 4OLLA 2QDRA 3LOIA 1ZNPA 3SCFA 2K0GA 3JZVA 4QM9A 3MDPA 4H7LA 2B9UA 2OYZA 2D5HA 3RDIA 4IEZA 3U11A 4IEPA 3OF1A 2OZ6A 4XFHA 2Z69A 3GBFA 3LA7A 3LWCA 3IDBB 2PAEA 4I02A 5EFUA 4CYDA 4X6RB 5I0UA 5FCCA 1ZZ6A 3MZHA 5FLHA
chains in the Genus database with same CATH superfamily
3ZOIA 4LLFA 3ZFFB 1DCSA 2IXCA 2XGXA 1LKNA 3S6PA 4K1YA 4QD2A 2D6OX 2PHUA 2BGPA 2VZQA 2CV6A 2ZGRA 3MIGA 1AL0G 1OF3A 4FCAA 5FFOC 3BTXA 1KS4A 4MHRA 3RJ2X 1RUF3 4XZPA 2QQOA 2FDFA 3J8F1 1FATA 2FZ1A 2VY0A 1O8SA 2NMNA 2R32A 1DQ4A 4CCCA 2VTXJ 4PI2A 3GZUC 1EAH3 1R1A2 4OMDA 4QX0A 4DXRA 3AXDA 2D6NA 3H3ZA 4A7YA 4DOUA 3U78A 3NMBA 5KC5A 1JW6A 2GP3A 2ZTNA 2BP6A 2R0FA 5CKQA 4BE3A 2VOKA 4RGKA 4HZFA 1BZWA 4XQDA 1W6PB 4D3WA 2HBUA 2PLV1 2VNRA 4IEQA 2VZ1A 1X8MA 4ZZ8A 4GMP1 1FOD2 4HVOA 5FPVA 1GYKA 1W6NB 2RDNA 2V72A 3B94A 3ETQA 4WM8C 5EJZB 4BLIA 3WUDA 3VB9A 4NRQA 3DYMA 3KSCA 5CFDC 2Z5WA 3FFQA 3I49A 4QQLA 4E4ZA 2ET1A 1O91A 4SBVA 4AVCA 1RVF1 2OUJA 1KJRA 3THCA 1W6QA 3BTZA 1C3HA 5T54A 3VD7A 2ID4A 2BFUL 4IGOA 4KI5M 2WSVA 4UBGA 3U07A 3NKGA 3E5QA 4YVWA 1UXXX 4EN0A 4R4ZA 2UWAA 1ULGA 2ZBJA 3TOJA 3VBSA 2FDHA 4W8JA 4LBKA 4EROA 2VOVA 1D2SA 2XHKA 3AYAA 4O9GA 4IDZA 1Y4WA 1YFUA 3OTFA 3H1MA 1LTEA 2VMCA 3W9AA 2XJSA 4RA0A 3RFRA 2PQSA 2WT1A 4PIYA 1UU5A 4YG6A 5APAA 3RJRA 3IKWA 2VW1A 1YQ6A 4PDWB 5IFPA 5K0UB 5LA1A 3AP5A 4XAAA 2Q30A 2VCAA 2WQ4A 2DUQA 4XABA 2W92A 5CB7A 3WNPA 4AI8A 4CDXA 1T6GC 4CCLA 4QPIC 2UY9A 4DXZA 2DVFA 4R9AA 5C9AC 2V73A 2QBXA 3HWJA 3K3OA 1S4CA 4K8FA 3JBG3 3SISA 4JGYB 2RMU2 3C7HA 2CTVA 5I93A 3WINE 4E4HA 4XBLA 2RDRA 3E6DA 2IXLA 1PGW1 3I2HA 1XJAA 5DZFA 3IDEA 4M4RA 4AQSA 1PGL1 2D5FA 2XL7A 4LUKA 5IWFA 1K5MB 1UXZA 1PZ7A 4XJAA 2Q1FA 3DXTA 2E26A 2WT0A 4Q4W2 4GWNA 4XETA 1W06A 2CGOA 2V5YA 5FP3A 1LHVA 3PU3A 4YZ1A 2GC3A 4IE7A 5JMOA 1AYM3 2ZEZA 5FYVA 2GNTA 1H9PA 1P8JA 2G19A 5DAXA 3WF3A 2TBVA 5KC6A 1IHMA 5FZCA 2LROA 1H2MA 2LALA 4JC1A 1URXA 4A44A 1POV0 4XUTA 2RVAA 1U5YA 2R063 1G6NA 2WLPA 2WZEA 3VBOC 4ZKTB 2PELA 2XBO1 4XMAA 1GWLA 1JTZX 5LRRA 4IW3A 2WNEA 1HV1A 5A3PA 2DUPA 4FPCA 3NRUA 4CXWA 1XE8A 3LDBA 2CHHA 3M3OA 4CU7A 2R061 4GWJA 1DDLA 4QHZA 3RNSA 1CGPA 4QDQA 2A3YA 4AK3A 2XB6C 1UYPA 4D0QA 5F2WA 2A6WA 5FMBA 1O3RA 1UOGA 1QIQA 4YW7A 4XDOA 4U2AA 5FPLA 4COYA 1X33A 1IPJA 4FOYA 1HRI1 4W6YA 1ZYBA 1MR5A 4MGQA 2K2SA 4R8HA 2JB4A 3ZYJB 3N9NA 2EIDA 2BVVA 2I45A 4YFWA 1UPIA 5E1RA 3H3UA 3BALA 3C7GA 3MI8A 1VMHA 4FXKB 4BZ4A 3PNAA 4PJYA 1F5JA 2HJIA 2QCSB 2E63A 2QQMA 3FHIB 3T2PA 1AJOA 1GUIA 3HN3A 4BQXA 2ARXA 2A6ZA 1LU1A 1GLHA 1H4GA 1W6QB 1G7YA 2CGNA 2VW0A 2W5FA 1CAUA 3A7QA 3WNKA 1IGOA 3OYWB 4AL9A 1AXYA 1QKQA 4E4SA 3JBG1 5E16A 5GKAC 1HX6A 4NIGA 1ND2B 3WW3A 1V6LA 2ZCWA 4Y24A 5CKMA 3M8LA 3FMGA 3N9MA 3POFA 1H0BA 2E9QA 5T55A 5HV0A 2BV4A 4GB33 4Q0PA 1YCIA 4XPVA 5BNPC 4FPYA 5FZ6A 4QPGA 3O0WA 5CFDA 5LY1A 2W94A 4Q2FA 4AQTA 3E5UA 2VE1A 2EVXA 3R0RA 1AR73 4UT5A 4DRRA 2BOJA 1HQNA 5FPAA 1S0JA 5GZFA 4C91A 3MUZ1 3MEPA 4YVWC 3MW2A 1C4RA 4J6GA 5F5AA 2ORZA 1R1A1 3B01A 3MPBA 5D8AC 3NJXA 4MGSA 2DFBA 3ALQA 1QDCA 1YQ2A 3VDDB 4F8AA 1OPOA 2P6HA 1E5RA 2V4VA 1DBNA 4QKFA 1VMJA 4RD7A 3ZKYA 2VECA 4G9SB 1XRUA 4LK7A 4P00B 1NCQB 2DU1A 1OXCA 1CESA 4DNYA 2PLV2 5GM0A 2ZX4A 5F1RA 4GB32 2Y6FA 2Y60A 5GJ6A 4P02B 5JOZA 1AR63 2JDYA 1ULFA 2XONA 2ZKNA 4BDVB 3FUQA 1Z7S2 1TE1B 3U0ZA 5ABJB 4S2FA 3GZAA 4QPIA 1OSGA 3DV8A 1TNFA 1SPPB 4RFRB 3ZFEB 3FHAA 1OQDA 3MPPG 4BQ1A 1HRV2 2J1RA 4IERA 3JU9A 1WA4A 2P3JA 2V09A 2GU9A 3R4SA 3M1HA 5FYIA 2D7FA 3DKQA 4K21A 2WN2A 4BOWA 2YMZA 5I8TA 1R64A 2E51A 2A6YA 1W6NA 1VBA2 4PDWC 3AYEA 1L7LA 4URTA 4L97A 1LHUA 4I2OA 2BDRA 1G9CA 3R05A 1F4HA 3APBA 1CAUB 2WFF2 3MUY1 1RUNA 1AYN2 3AKQA 4AI1A 4MXWA 3WCRA 4JGZB 1BBT2 2Q8OA 3TAYA 2HLEA 4XYXA 2Q4SA 5DAVA 4CEYA 1EV11 2CWMA 4LHSA 1FOD1 4P9WA 1JN2P 1RUJ1 2JG8C 2C1FA 5FZ0A 1CPMA 5A70A 3ZYFA 2XH6A 3IIIA 5F5IA 3POIA 1BXHA 4QQOA 3TEWA 2BZDA 3AK0A 3F2ZA 3KHBA 3VBFA 2IXKA 4ZY9A 4MYEA 5A7NA 3T2TA 1VRH3 2BPA2 4N43B 3J8F2 1HRI3 2YDEA 3IZOA 3MIFA 1WA6X 2XDVA 2G9ZA 5FAXA 5AC93 5C4WA 1QJY3 5IVYA 5FY9A 2LW8A 1CN1A 2WS91 4KNCA 2R6QA 5C70A 3HJRA 1BBT1 2VC9A 1OF4A 1UZWA 5FMOL 1C8M1 4DY5A 2EF6A 1XNTA 2NYYA 3LEMA 3OBTA 1W03A 3OG2A 3R4UA 1VB4A 3KMHA 4WM8B 4OQ8A 4JGYA 3HQXA 4NIHA 3B9CA 3ZFEA 4PQQA 1PMHX 4IESA 2F17A 4YW5A 2WINB 4NR1A 5FMCA 1KD7A 1OKOA 1HLCA 3CZUA 2GC1A 1W9WA 5FMDA 2JB8A 3DUIA 4PBOA 3D0SA 4FPGA 4BPZA 5CNAA 4ES9A 2HYKA 5F7UA 4OUEA 1JHJA 4CEYC 2GNDA 3KLSA 4FPOB 1QNYA 3KV9A 4DEQA 1AYM1 3ZXEA 4IV1A 1UD1A 1CONA 4LPLA 2B4KA 1AVBA 4Q4Y3 2FDIA 5A7QA 4YM0A 1C1FA 5ERLA 1HKDA 1NCRA 3VLBB 4GZ9A 4W4ZA 1GANA 2L9LA 1C8M2 2MPFA 4AFDA 4N90A 1ALYA 1HW5A 3HN1A 1PGW2 1Q8VA 2ATFA 4HXCA 4TLGA 4XJUA 2J1SA 2O8OA 3LDRA 1DZRA 2VQUA 1GSLA 3CEWA 1QNWA 3S57A 4QB6A 3SH3A 2W0XA 3ZO0B 5C4WC 1V6KA 5FXZA 4SLIA 3AJZA 1H2LA 1XNKA 5FYZA 1UQXA 2XG3A 4ARXA 4NAOA 2PHFA 1UU6A 1LOEA 3QOPA 5K0UC 4JGYC 4EN9B 3GCXA 3ZYRA 1G9AA 4AFMA 4BXFA 2JICA 1UMIA 2QJVA 4L11A 1A78A 4OULA 4QQHA 2VMHA 3WDXA 4UFLA 2IC1A 4EZ4A 2CNAA 4Z8BA 5F6LB 1LNSA 5E8AA 3WXPA 4UWDA 2Z2SB 2DVDA 4RQPB 3E6BA 4NPMA 1KFUL 4RSUA 4MGYE 2YU2A 4BQ4A 5JAXA 1ZVFA 1JU4A 1SCSA 1EY2A 2JKXA 1H1MA 4PF1A 4D69A 5L7OB 2YB7A 4CDUB 4JGZA 1SACA 2YG0A 3J9SA 2J1TA 1XU1A 1UY2A 2C26A 4ZS2A 3SCGA 5BNNB 4BQ3A 2VL4A 3OYWA 3VUOA 1PM4A 2D6MA 2C24A 2JJ6A 2Q5TA 4Q0SA 1O6UA 3WZ1A 3MIEA 2PAKA 4R9BA 5F3GA 2ZX2A 2YFZA 3NO8A 1QGLA 1W6MA 5D2AA 1DF0A 1B35C 4OI2A 2QQPA 4IV3C 3BPZA 3N4MA 1WD3A 4XF9A 3PUIA 2LM3A 1XE0A 4E2GA 4RHV1 2Z79A 4D6SA 4AGVA 4BXSV 3ACLA 2PLV3 2XJTA 4WVMA 3FJSA 1VRH2 2B42B 4J1XA 5ABJC 3T09A 2GALA 1IQAA 3H8UA 2ZZQA 2BGOA 2VMDA 2RV9A 4PT6A 3HT1A 1OA3A 4XC9A 1DGLA 5DZEA 3ZXAC 1UZVA 1YWKA 3JQXA 1F31A 5JCTA 5CBLA 1GOHA 5FR3A 4X8NA 4FT8A 2HYXA 4WVZA 4Y20A 1JUIA 1GQHA 2D6LX 5DUUA 5FZOB 3I59B 3TNQA 3K48A 5FZ8A 3ELNA 4N7UA 3SH4A 1PZ9A 3VDDA 2H0VA 2KR2A 2W1SA 4LO7A 5SV5A 5FP8A 1PIV2 2E7TA 1WCDJ 2IVIB 4AEKA 3OBRA 3MLLA 3RMYA 3ZM8A 1H6YA 2IXIA 2BNOA 4YZ2A 2YBPA 4LITA 4Q1PA 3CJIA 3AFGA 3WV6A 2WUHA 1AL23 5KXDA 4I30A 2BWAA 3Q9OA 2P3KA 3FHQA 4M0HA 4QXCA 4M3CB 1UL9A 1K5JA 4DS0A 4TXWA 2A5ZA 3OSDA 4C8DA 5FP9A 1H8VA 5A33A 3VKLA 3BKZA 3MV01 1ZBA1 3M3EA 4QKNA 1REFA 1QF3A 4LBNA 4BQYA 5DDJ1 4NMIA 2Y8KA 1GOGA 1AXKA 1I3HA 2BERA 4GH4C 3RYKA 1RUF1 4CRQA 3I97A 3K4AA 3NJZA 5I91A 4L99A 1CZVA 4N8MA 5DDJ3 1J3RA 4Q29A 1UMHA 5BNPB 1CAWA 3VHPA 1U5ZA 1V9U2 2ZX3A 4CZSA 3T0DA 2MEV3 1N1TA 2RS11 3J7MA 2WDBA 3A23A 2GH8A 3SQOA 3WW2A 4PCRA 4CDQC 5C8WA 2DURA 4AHWA 3VKNA 2HWE2 4Q4V1 2HWD2 2JD4A 1LCLA 2B46X 1BK1A 3AP7A 4ZPIA 4PLMA 5E6HA 4LHLA 3IPVB 2XR4A 2JIGA 4IUGA 3MYXA 4WVMB 2VUCA 2ET7A 1JOJA 5JSRA 4Q0QA 1YJLA 4OHVA 4NIIA 1LOAA 5BYNA 4N9IA 3K46A 3I3DA 3BVCA 3LQCA 2EIEA 2NPIA 4OLLA 3RVHA 2CU5A 3SCFA 4Q4Y2 2K0GA 3JZVA 4HT1T 3MDPA 1PK6A 1VBB1 1WMDA 1Y9GA 2RR12 4H7LA 2B9UA 2D5HA 2R071 4HK9A 4Y20B 5FZOA 5IVVA 1Z7S1 3POWA 3U11A 4K6BA 4IEPA 3OF1A 3W59A 1WLCA 3VBUC 5HV4A 4PLOA 2WSUA 1IPSA 1GNYA 3ZYBA 5A3UA 3AZZA 3AKPA 4HOOA 4JHTA 4B7EA 3IDBB 2XPJA 3UT0A 2J7MA 3VV1A 2GN7A 4CYDA 4OUMA 3T08A 2B45X 1IS4A 1K3IA 2DTYA 2VMEA 3DECA 5CISA 4LOSA 4GH4B 2X09A 3KD4A 1UY3A 5JWPA 1CZSA 5F5CA 3OUHA 5C3OA 2Z42A 1O4YA 5FLHA 3WDYA 2X29A 2BU9A 3VDBA 2FHRA 4RS5B 4NUBA 1QJY2 2ENRA 4Y1UA 4EWAA 1YIFA 3LA3A 2ZMNA 3HIFA 5C3QA 3RZMA 4OQ9A 1PGL2 1QQP1 1JYCA 2DCYA 2WIIB 2GN3A 3UETA 5A1AA 3EO6A 2H0BA 2EA7A 5CA6A 2HH9A 4CUCA 4Q4X2 1S2EA 1OQEA 2GNBA 4ES8A 1VBB3 2A3XA 4LE4A 4MGKE 1HIXA 2Y6JA 3ZIXA 4AAPA 5L7OC 1PK6C 5FPXA 5FV3A 2E6VA 1JH5A 2ZZJA 4AW7A 3PVOA 4XXPA 4BYYA 4DUWA 1APNA 2X5IA 2K46A 2RJLA 3T0BA 2XQXA 2ZEYA 2DU0A 3IM0A 5FZDA 2XJUA 4HBNA 1WCQA 3UGGA 4C1XA 1CAVA 1W6OA 4FPHA 4Q5OA 3N9LA 1R081 1B35B 1COV3 1YIPA 4BB3A 4YLZA 2VUJA 3AYDA 4XW3A 2ZGPA 3WG3A 4AHYA 3LEGA 5F9TA 1CZTA 4GMP0 5JPMB 5LEKA 1YI7A 4RQPA 3HMYA 2VNVA 2ZHMA 3POSA 3UKNA 4I01A 4QDSA 4UOJA 1XB9A 4QKBA 4GQ7A 3UKTA 4EWDA 4WM7B 3CJIC 3C7OA 4TYSA 3I3EA 3U4SA 3UGHA 1MZ6A 4BISA 5C9AB 4QU2A 1SHWB 1O4TA 1OMIA 2RJ2A 2I2SA 1AYM2 1UZ0A 4UF0A 3RS6A 1EYBA 2W3JA 3LA2A 2RM21 1W8HA 3N7MA 3PVEA 2GC2A 1F15A 1LULA 1OD3A 3FN9A 1KGYA 1WMFA 5LRSA 5IVEA 1A3KA 4XF1A 1H8TC 4GH4A 1NE6A 2KD7A 3Q8EA 4NWVA 4RN5A 4JAAA 3BIEA 2JDHA 1UZZA 1ZX5A 4TTGA 4LJHA 2ETEA 5AC92 5CFDB 4F7ZA 5C6CA 2BGCA 5T50A 2DVBA 3VBRB 4XF4A 1QOOA 3POJA 2OUHA 1DHKB 2BWCA 4AVVA 3W21A 4CUAA 5IAVA 1OH3A 2DVAA 5IVCA 2F4PA 4A4AA 2VMIA 1PMIA 1LGBA 1X7NA 4AWDA 2CY6A 1CPNA 2PYTA 3AKRA 3J26N 4HSJA 5CFCB 2VMFA 1GQGA 1H9WA 1OOPA 2BEOA 1NLRA 2P6CA 3V0AA 2XUMA 1W0NA 3MF6A 3NNFA 4QB2A 3NNJA 5F3IA 4CPBA 1GZ9A 2RG4A 1C5HA 5CEHA 5FZ9A 5KXBA 1W6OB 3Q8AA 2B8MA 4M3CA 1UY0A 4XAEA 1FOD3 4J25A 1F8VA 1AYN1 3OGSA 4NWWA 3IB3A 3T30A 4E8CA 4XFCA 1ASJ1 4COWA 5F37A 1RUC1 2QKDA 5LASA 5DG2A 1QJX2 3LIHA 2XKPA 3VBUA 3BU0A 5I0RA 2DDUA 1MS0A 1SG3A 3SHRA 3RZZA 3HNMA 4COZA 1SCRA 4Q27A 2Y6HA 1MS3A 5D21A 1XXNA 3HNYM 2JDZA 4KU7A 3SITA 4XF0A 5B4NA 2C9KA 1LGCA 4CEYB 2F6BA 5J98B 2HEWF 1IKPA 4U36A 4XCBA 5A3LA 4N53B 1LB2A 1ND2C 4ZHNA 2EIBA 1W39A 4IQPA 3VBSB 5C33A 2WAOA 3PLQA 1DG6A 2H6BA 3WCSA 1OPMA 4OYUA 4UBHA 1X50A 2NM1A 1XNBA 1AR82 4IGQA 4J1WA 2NP0A 1V0AA 1E5SA 3VD5A 1WKYA 3JQWA 3OGVA 3KB5A 5DUWA 1VBB2 3OEBA 4ISRA 4TLFA 4ZXEA 2UWCA 1FPN3 1NLSA 1PVC1 2P3IA 3DYOA 4M3CE 4XBQA 3VZNA 5FZ1A 4TWTA 1UYZA 4Z07A 3ZFEC 3EB7A 2VOWA 4XACA 5CFCC 2JWPA 4H7MA 3ZDSA 1ULDA 2G4IA 1PO23 4MH0E 2OXBA 2P37A 1JXNA 3RI9A 1JZ4A 2DF7A 2PHLA 1XC6A 1H30A 1KXGA 4JQRA 2BYVE 1S0BA 2AEYA 1S0EA 5FTTC 4A3ZA 3D4KA 1K5MA 3RWNA 3X29B 4W6XA 4YZ5A 3SCHA 1CX1A 1HXS1 4AFBA 4YW3A 1RUI3 3HNBM 2BNNA 4RQPC 5KXCA 4KWLA 1H6XA 4DY3A 3V56A 5FKCA 1O5UA 1GNHA 4D94A 1NCRB 3C3VA 5FXVA 2W95A 2QQWA 3VBRA 1W9FA 3TEXA 3WOGA 5FZFA 3VGIA 3MW4A 4RGAA 2CGPA 1W90A 3A0NA 4H3WA 4XDQA 2IZWA 3ZYGA 1WLDA 1ODNA 5JZGB 1UYYA 4PIZA 2PXJA 5CFCA 2OX0A 3UK9A 4BMBA 2JDAA 1JZ6A 3FLRA 2O1QA 2GAUA 1FAYA 2ILMA 4UYBA 1GZWB 1W3XA 3B3QE 2A3WA 3ES4A 1ZRIA 4QX5A 4RL7A 4ORFA 2BNMA 3IT8A 5HXVA 2D3RA 1SLLA 3P5BA 5JDBA 4AVTA 1GP5A 2JG8B 2LS6A 1RUOA 5JMCA 3U14A 4P9JA 4B8EA 5LBBA 3M7AA 4K1ZA 5C71A 5FYCA 3ZKUA 3N7KA 5C5TA 1N1VA 4I0BA 4QU1A 4AI3A 3UGFA 4EN6B 5C3RA 2WC2A 1EV13 3KF3A 3VBHB 1QOTA 5A3NA 1LHNA 1ZZ7A 4YVSC 1N3OA 1WW7A 3LF7A 1SFYA 4LKFA 1OT5A 1UYXA 4NPLA 3ZX7A 4BK4A 1RVF3 5FLIA 2OS2A 3AMNA 3ZR5A 2CAUA 2JX9A 3KCXA 2WO2A 4QWNA 1W8UA 5FY0A 3W20A 3S30A 4LEJA 2Z4FA 5LB6A 1RUI2 4OI1A 3KCYA 3VKOA 3V0BA 1ODMA 1QJEA 2OVUA 3OOXA 4XJ9A 4RGGA 4JQTA 4JDOA 1MQTC 2RMU3 2JE8A 1DQ6A 3O1TA 4PIXA 5G05L 3SLIA 2R16A 1W9TA 3LPGA 2XJVA 2EIGA 1AR61 2VUDA 4YWAA 5FYBA 3V65A 1GKBA 5FXWA 1NA1C 1IG0A 5J37A 3WVJA 2QQIA 1W8OA 4O7XA 4Y1XA 4LULA 1TQ5A 1DGRN 5IT6A 4YW2A 1OLQA 3AZWA 3RZJA 2OA2A 1UMZA 4AXOA 3POBA 4BHPA 3U4XA 2X10A 2ZHNA 1DQ1A 1CIYA 3B69A 3ECQA 3IWZA 4XFAA 5FPBA 1W8ZA 3VBOB 2XHNA 3WF0A 1AX2A 3PTRB 3QBQA 5FY5A 5J7MA 3GCWA 3I2JA 1IG3A 2EXHA 2Y64A 3K4DA 4JRAA 3T4VA 4EV0A 1GZWA 3THTA 1D0GA 1RUC3 5KHJA 4Y1ZA 1KEXA 1O7FA 1A8DA 4XDPA 1JYIA 2AACA 1YFXA 1AYN3 4G3YC 2XLFA 4IE6A 3T1MA 4URAA 1JYVA 3RGBA 1QMJA 1KITA 1OD5A 2XQRA 4KGQA 4MGIE 1W05A 2ZA9A 1TMF1 4Q4V3 4XIOA 3ZFGC 4KMQA 5BV6A 3NAPB 2Q8CA 5IJRA 3KHCA 1UOFA 1MQTA 3FLPA 3LZZA 5IK7A 4DUXA 2MEV1 2RS13 1OBNA 4GB31 5A3MA 4DXTA 3AYCA 5KHGA 4P9YA 2PTMA 5A7WB 2Y34A 3ES1A 4QX8A 2Q1ZB 1XNCA 5GZCA 2GZWA 2N7GA 2AZ5A 2DUOA 3FUOA 4YYOA 2UY8A 4Y22A 1NUKA 4Q4V2 4RHV2 4NRMA 5GLUA 4CDXC 1HRV1 1HB2A 4AQ6A 1GNZA 3BOWA 3ZXDA 4CDUC 4CDWC 1SFNA 4OHYA 1VBE3 2WA3A 1RL3A 4N43C 1NX9A 4HONA 1UO9A 2CL2A 5LBFA 4PBPA 1ENQA 1TMF2 1ZBA3 2FDGA 3ZPYA 3OUJA 4YGCA 1ENRA 2BTVC 5IHRA 1GZTA 1C28A 2WNVB 4CE8A 3C8XA 1K45A 3BCWA 1H2KA 4V1PA 1RUF2 4DEVA 1JU3A 4MGZE 4QKDA 4FTEA 3P1IA 4LUMA 2VZ3A 2LRPA 4IV3B 4AEDC 1GU3A 5FY7A 1RUE2 1GZCA 1ACCA 4R4XA 1CJDA 1LESA 3BPSA 1VBE1 3JB4C 3I3BA 3NV2A 1UPSA 5CVRA 3JB8A 2RE9A 2E33A 2W87A 3VKFC 4UW3A 5IK5A 2AGSA 3WG1A 2ZEWA 4UI9L 2AREA 1AUYA 2YYOA 5GZDA 3ZSKA 4OFGA 5FZGA 3AP6A 1FV3A 3POYA 4WV8A 1HN1A 1H4HA 1DYOA 1VLNA 2ORXA 5KWRA 1V6JA 1ZZCA 4JKMA 4QB1A 4Y3OA 2R041 2VBBA 1YNAA 2ZABA 4YZ4A 1SBEA 2JXAA 1FX5A 4QXHA 2HWC1 3USUB 1BK0A 1OFNA 3N9PA 4IEWA 3O1PA 3ACFA 1MS4A 3PU8A 2RM23 2VUAA 3NAPA 4ZZ5A 1MVQA 2DCZA 2WZ8A 2JDUA 3SXWA 1AX0A 4R52A 3ZFFA 4C1WA 2RS12 4CCNA 4IE4A 4N9HA 3WDWA 2BUKA 5BNOA 4A3XA 5B4XA 1GBGA 1VMFA 3DL3A 4NVPA 5E88A 3WUCA 4AEDA 4YW6A 1VBD1 2SLIA 4EWEA 4MHUA 2HWF1 4O61A 2HWD1 4JV4A 2LTNA 4YGDA 1POV3 5FZHA 5FZ3A 4UFMA 5EV7A 4NROA 1JOPA 2B9VA 4COUA 4GIQA 5C3SA 2I07B 4AZZA 3H8RA 5DN2A 3D82A 3O14A 3SEEA 2XBO2 3G7DA 3PTYA 4LA3A 2ZGUA 1OLRA 1VBD3 1VPHA 2ZGOA 2NN8A 5FWEA 5EJ1B 1WCUA 4AI2A 3RZHA 4C90A 5CADA 1T6BX 3GZTB 1BKZA 1U12A 2ZGSA 3N7JA 2VCBA 5JI9A 3M2MA 4LKDA 4N7IA 3RG0A 5A6XA 2D98A 3PUHA 1UWWA 2TNFA 4OZXA 3JXSA 2K9ZA 3G6JB 4YGBA 1EPZA 5A7SA 1RUH1 1US2A 1MS1A 4JHZA 2OT7A 3NQHA 5FK7A 3K77A 3R6SA 3TYJA 2AYHA 2PA7A 4DXSA 1W2AX 4BCUA 1TEIA 3S5AA 4LXLA 5A3TA 2D97A 4NN0A 5LK5A 2XOMA 1W8TA 1MZ5A 4KL1A 4M3CF 3N36A 3LSEA 2B5HA 1SDDB 4UF0B 5FY8A 1C8NA 3VN4A 1PO11 1UZYA 2A70A 3H0OA 4LQRA 5C9AA 5JLVA 3MIHA 1WGPA 3BU7A 1LRHA 5H9SA 1QXRA 1ULOA 3MV11 2RR13 3DYPA 5C8CB 3L2HA 2WT2A 3PURA 5CU1A 1NOVA 2XUEA 2R49A 3VHOA 3QACA 4FQZA 4INDA 3WP4A 1DU3D 5FIXA 4X8PA 4GWIA 1V70A 3KQRA 2WWUA 1SLAA 4HL0A 1EUTA 1V00A 4YG0A 1FPN2 5F8PA 4XUOA 1J58A 2RJKA 3OY8A 4XXAA 1L7QA 5AVPA 4JCKA 1HB4A 1Q43A 2R073 1PX3A 3LOIA 1EAH1 1U5XA 2HWD3 4GJYA 4QM9A 1BEV3 3VD4A 3QD6A 1S2KA 4OVEA 1QU0A 4XCAA 2OZ6A 3J8F3 1BBT3 4CEWB 4LKSA 1V9U3 4XURA 2G9FA 2Z69A 3IMNA 3VBOA 4CPBD 3JUUA 1QJU2 3P3PA 2VCCA 2PAEA 1NQDA 5EFUA 1JBCA 3KWVA 4Y5Z0 5AFBA 3HPNA 4X6RB 5JPNB 1OOPB 5JOXA 3WF4A 1VRBA 2BQPA 5HCHA 1BMV2 2W1UA 1CWPA 5LA9A 5BNOB 3K4ZA 1J59A 3CIHA 1LOCA 5FZLA 2PHWA 4HN0A 4KGGA 2B39A 4AVBA 5GZEA 4EN7B 4HVRA 1CR7A 4BIFA 3ZMNA 1ND3B 3I2IA 4P5HA 1OA2A 2YPJA 5CZKA 2C6SA 5FYUA 1JZ2A 5FJKA 3TRSB 1H1AA 5KR7A 1LHOA 3OJBA 5HPOA 4YZ3A 5IVFA 1JS9A 4Z82A 3N7LA 1W8NA 1W9SA 3BGAA 4Z2AA 1JZ7A 5FRAA 4XHBA 4XFBA 1OLMA 5FUIA 1JZ5A 2ZX1A 1ASJ2 1SQ4A 1RB8G 5LA2A 1QHDA 3NNGA 4GXLA 3CLPA 3A21A 4LMFA 5JSPA 1LR5A 5A1FA 1RUC2 1PZ8A 3VD9A 5BNOC 3N35A 5FBJA 2VZTA 1RUG3 4LBQD 5JSOA 4Y5SA 1LOFA 5JI7A 1RXFA 1MPXA 2RDSA 4UFKA 4AR2A 3UKVA 4B7KA 5GALA 1CAXA 1GOFA 5IW0A 4IEXA 4KWUA 4JDMA 1YO8A 5LW9A 1QH7A 4LORA 2HWE1 2QNKA 1D0HA 3R4DB 3H8XA 1ZREA 2E31A 4QPGC 3IN9A 3NJYA 2QQNA 4JX0A 2YZ4A 5SV8A 1E5HA 2P1BA 3GJBA 1L3JA 4XZUG 1UOBA 5L36A 4MLOA 1JMUB 1RUD1 5I0TA 5DDJ2 1NY72 1R092 1F5FA 2XVGA 3JD73 4LR4A 4B1LA 5JXHA 4ITCA 4LBQB 5HXMA 3VBFC 1SLBA 1DLCA 2AEZA 3SNMA 1K42A 1W6MB 4P9IA 3IAPA 1W9YA 1AJKA 1W2NA 4A7ZA 3ZN5A 1DFQA 2SBAA 3GZEA 2PMWB 2JKBA 5FZAA 4KWKA 1YHFA 3WQ0A 3IIAA 3ZSJA 4AHZA 4BWOA 3VL9A 2WYFA 4MX3A 2NLRA 2TEPA 3WNNA 1LOFC 1UF2C 2J1VA 1HV0A 1J3PA 2CWSA 3OGGA 2P5BA 1UKGA 3GBGA 1HXS2 1W3VA 2CYFA 2WN3A 4ISQA 5DXDA 5L9VA 1LEMA 3AM2A 1WMEA 2WABA 4WZCA 3WQ1A 1NG0A 1JYWA 2ARCA 1O8PA 4LT5A 5FO8B 4ZU4A 1HQWA 4E4DX 3GALA 5A6ZA 2GNMA 3LE0A 1Y43B 2PQQA 3LFMA 5A1LA 2QUOA 2WO7A 1L7RA 3N3HA 4PF5A 4XUPA 5DZGA 5F32A 3E1F1 3WHUA 4XTMA 5BY5A 4FFGA 5FOJB 1G86A 5JZGA 1IKQA 4GJZA 2X5IB 4LO4B 2A7AA 2AENA 5FO7B 1V6MA 3M3QA 4WVWA 5BNNC 1F9KA 4S2DA 2R072 4BQ5A 1XOYA 2WO1A 2MNGA 3KGZA 4HK8A 5T52A 1PNGA 2DFCA 4QGNA 5CAZA 2DV9A 2W68A 5FLJA 5F3EA 1QDOA 4QDRA 1WLWA 1VBC3 1JYNA 2R043 2UWBA 1RMU1 4DPNA 2FMDA 2ZOEB 5FPUA 2OIIA 1ZBE3 4CCEA 1XU2A 1RXGA 2OQ7A 3DEMA 1JODA 1R082 2VZOA 3EYPA 4NJ4A 3NJVA 1W2TA 1PO21 1C8M3 1UY1A 2IFWA 3CU7A 5G04L 3H8OA 1D4M2 3JD72 1AL22 3M70A 2VOXA 1VBC1 2D93A 3LB9A 2WO3A 2WS93 1XE7A 1NE4A 3CL1A 3HBZA 4XIKA 3ZSEA 5B2GB 3I3MA 1AF9A 5JIUA 2JDPA 4BH9A 1ZBE2 1N3PA 1FPN1 5C8CA 1Q8OA 4P9LA 1D2QA 1RC6A 4JKLA 3E97A 3O1UA 4LBJA 1CAXB 1J3QA 5EQUA 1OA4A 1FV2A 4D7SA 4D7TA 1AR91 4GD4A 3SKJE 2YROA 2FCTA 3HD8B 4BMEA 5JXGA 2YPDA 5BUVA 3BB6A 4KG8A 3QLQA 2GH2A 2RS51 4LE3A 2VQAA 2Y38A 1Z78A 4HN1A 1XYNA 2W08A 3E5XA 4PI0A 3LD8A 3JD71 5FYYA 4A7KA 4CXYA 1O59A 4NHXA 4IE5A 2WBKA 1RUD3 4Q1RA 3DCQA 4YG3A 4QHOA 5CG9A 3ZN6B 1W8FA 4DINB 2OW4A 1UW8A 2JEMA 2JG9B 2WNVC 2VZPA 3C7FA 3H7JA 2PN5A 4LBQA 4CEWA 1S2BA 3CNAA 5FY4A 5LBEA 4FXGB 3I7DA 1RUH2 4XUQA 4LLOA 3LOBA 5DUVA 5H9QA 5FK8A 4IV1B 3S7IA 1FT9A 2UU8A 4PLNA 4FTBA 2PHRA 3CMGA 2PHXA 3GXUA 1Y9MA 1LEDA 3T1LA 2DWRA 3CZJA 1MEC2 2WNUB 3IDCB 2CAVA 3MO4A 1GV9A 1QJX3 2C0ZA 4FOWA 4RS5A 4FTSA 1JI6A 1PO12 1UX7A 3FX3A 4YM3A 3O7OA 1HB1A 2VTXA 2VJXA 3QH7A 3N9OA 4LBOA 4YW1A 3OPWA 1Z7S3 4GA9A 3VBSC 3MLJA 3NNLA 5I0SA 4QX7A 4CDQB 1OUSA 3MBWA 1QY4A 4YVSB 4MO3M 2VOTA 1LENA 1YRZA 1DQ2A 4QMAA 2W1WA 1SZBA 1SDWA 4JGZC 2GC0A 1QJX1 2VXJA 4QHBA 3HEIA 1G9DA 3WQ7A 2WNVA 2QTWB 1AHSA 5L19A 1GP4A 5JXIA 3AKSA 4HKOA 5E89A 5FPZA 4EN8B 5F39A 1UN1A 5J3UA 1B09A 2VMGA 1ONAA 4DRVA 5JOWA 2ZAHA 3EMRA 3H42B 3POGA 5FYMA 1B35A 3AMPA 3KV5A 5D8AB 4FAGA 4LA2A 3AP4A 4AGRA 1GWMA 4HG6B 5A80A 1RGSA 3EHKA 5JZGC 1WW4A 2AUYA 3J7NA 4QGMA 1X9TA 2E53A 5EXOA 4MOAA 1DYKA 2ERFA 3FBYA 1Y3TA 4L2NA 2R0HA 4RS5C 3T3YA 2UURA 5BNNA 4WM7A 1ND3C 2FCUA 4AVAA 3C2UA 4NHMA 4PQ9A 3LGRA 3FL7A 4V2VA 2OPWA 3VL8A 5JUVA 3A0KA 4QQPA 3S7EA 4MXVA 2X8KA 4KBBA 5LA0A 1WCKA 4P9XA 3TNPB 4IEUA 3USUA 2YFUA 3WT3A 5FY1A 2IWGB 5FZMA 3PVNA 4QT6A 4B3NA 4IL7A 3AXEA 1COV1 1O3QA 1C57A 1SLTA 1R083 1RVF2 2HWB1 2ZPXA 1SFPA 3C7EA 1ULCA 1CX4A 2G1MA 3FZ3A 1YQCA 2CSGA 4UXAA 3ZFGB 1LGNA 4FO9A 5EHDA 3W58A 1D4VB 2OQ6A 3ATGA 3MGUA 4RFT0 3ZXFA 4H55A 4AGGA 2ZJCA 1DQ0A 1TME2 3PIGA 4FPKA 1RJ7A 4QPYA 1OVSA 4UFHA 3VZMA 3ZN6A 3KGLA 2DCKA 3I59A 4H2AA 3RMXA 1OUXA 4XFFA 1RHI2 2JECA 4E8DA 5C8CC 1XSQA 3NWKA 5ACA3 5F3CA 4Q8LA 2XBO3 1XNAA 2VGDA 3D0JA 1AX1A 3MF9A 2YV8A 3KV4A 1A8MA 2W46A 3M3CA 4WM7C 3TBDA 2MHFA 1LECA 4E2QA 3ILFA 4HPKA 3RPQA 1TZOA 1BEV2 4LTAA 3V0AB 2WKKA 4L8QA 4QPGB 5FYHA 2AC1A 2JG8A 4Q4X3 3Q8CA 1IS5A 3RQ0A 5IFTA 3WP6A 1W99A 1WBLA 1YJKA 5I8SA 1HXS3 1RHI3 2J22A 5FJHA 1NAEA 4HKLA 4L92A 4FP2A 3D8CA 1S0GA 4JDNA 1PVXA 4AYUA 4CEWC 1GMMA 3VBUB 2FZ2A 4YGEA 4Q4W3 5HBAA 2QDNA 3AP9A 3GF6A 4M01A 2CDPA 3UJOA 1ULEA 3LDKA 3ZR6A 1SEFA 2VVDA 3AMQA 4YRDA 5BNPA 2VM9A 1QEXA 4B1MA 3CJXA 1CAWB 4NO4A 4AEJA 4OI4A 1WW6A 5H9RA 2ZGTA 2HWF3 4QPWA 1PVC3 1ZRRA 1W04A 4XFGA 3UV9A 1T2XA 2YBSA 3V0BB 3URFA 3ITQA 2J42A 4M00A 4AHXA 4QPIB 3PVBB 1CIWA 3UYJA 5D8AA 4EE2A 2VZUA 4B4QA 3OD0A 4IV1C 3I2OA 1JUHA 3OY8B 2PHTA 3DXUA 1X36A 3HT2A 3USSA 4XQ4A 4IETA 2YGLA 4RYDA 1NCRC 2F4LA 3RYPA 1VR3A 2HEVF 1WD4A 1OQ1A 1ZZ8A 2D6PA 5H9PA 1GWKA 1W28A 1WBFA 2XWJB 3PJYA 1RUG2 5ACA2 3T2OA 4Y1YA 1YEWA 3OCPA 4AI0A 3INAA 2GSYA 2ZHKA 4LO8A 4XTPA 3PMSA 5DUXA 3WG4A 2VH9A 2WWSA 4HFSA 2HWE3 5FZKA 3DN7A 1POQA 4A6SA 1AR83 5FYSA 5DAPA 4HPKB 5DMYA 1UIJA 2XJRA 4FFIA 3U10A 2RS32 5KXEA 4IEVA 4AF9A 5L9RA 4PDWA 5K0UA 5FKBA 4XILA 3ENRA 4A2UA 3CKHA 2WLQA 2WZR2 1ZRFA 4M0NA 1SLCA 3ASIA 1DIWA 1ND3A 1Q8SA 1I5ZA 1VALA 1REDA 2FQPA 4OHZA 3V64A 4Y33A 4CDWB 3WEZA 3MFAA 4HANA 1AL21 5A32B 3WNOA 5ACA1 3RI8A 3KT4A 2A6XA 5LK7B 2A75A 3O1SA 4HMZA 1N1YA 3AZXA 3GHMA 2X05A 4LHKA 1J84A 1BMV1 2D3SA 2UYAA 3GDBA 3NVCA 3GHNA 2WA4A 4BJ0A 1I9RA 2P34A 3RYRA 2WAAA 3AKTA 2WRAA 5J48A 2C9AA 2GMEA 3PUSA 4FFHA 4Y26A 4ZU7A 5BPXA 2EICA 1G9BA 4C0HA 3O1RA 4DMIA 2R7EB 4FFFA 3QH6A 4Q26A 4O65A 2ZACA 3D6EA 5A7OA 1FMD1 3KM5A 5FP7A 3UJQA 3DGTA 5J09A 4CTEA 1WCSA 4DFSA 4IV3A 2PHDA 4CP9B 3ZYHA 5CIRA 1NXD1 3WHTA 1KJLA 5M0TA 4CXXA 2A73B 1QJFA 5FQ0A 1RTVA 2E32A 2JE7A 1PIV1 2VG9A 3VBHA 1YFWA 4AQ2A 1BYHA 4FSJA 1FI2A 1VAVA 1S0DA 5A6QA 4KU8A 3WLUA 4YSFA 3T4HB 1DQ5A 1VBE2 2UYBA 4I0AA 3Q8BA 1YC61 4KH9A 4OI0A 2QFEA 1MS5A 3VZKA 1EP0A 1Q3EA 2XLGA 4E27A 3S5QA 4MSVA 2WJSA 3H1WA 1WMXA 4EQVA 1QXPA 1W6PA 4ATFA 4CP1A 1KS5A 3AFKA 2WFF3 3PHMA 2X53S 5LATA 1OURA 1TNRA 3NW4A 1OOPC 1VBA3 3ZIWA 3PMEA 1HN0A 4OHWA 1VE0A 3O1VA 1MZFA 1SBDA 2P3YA 2RHPA 2HKXA 1NY71 1R091 3HQUA 1G9FA 5EYXA 4LBMA 4Y1VA 2QDRA 1JOBA 1ZNPA 5L7OA 4DZGA 1WWYA 3GM8A 4CSWA 1HQLA 2I74A 4XQWA 3RDIA 4XVHA 1OKQA 1XPWA 4ET7A 4XFHA 2JDMA 2VAUA 3VBHC 2YY1A 1BVVA 5IUQA 4BA6A 1JZ3A 4QX3A 1UKRA 4OZOA 4CCJA 2QE3A 1VBD2 3GBFA 3LA7A 3LWCA 3ZYPA 1E57A 1RUH3 3HQRA 4OHXA 4B4PA 4A45A 2VVEA 2D44A 3TN93 5T5LA 2Q8DA 2YXSA 4YM1A 2RMU1 3HAGA 1HDKA 1XYOA 5FCCA 5C3PA 2QQJA 1ZZ6A 2XVLA 3A22A 4NHYA 4LIUA 1NT0A 3MZHA 2R1DA 2ZMKA 5K4LA 1Q56A 4S2HA 3POEA 2BJSA 3K3NA 1DYPA 4KG0A 4Q4Y1 2YU1A 3TN91 5EWSA 2R1BA 2R062 3SH5A 3BODA 2DTWA 1MQTB 1MZEA 1H8TB 2JE9A 2KXLA 5JVVA 4S2GA 4AG4A 1O5LA 1U5IA 1W0PA 2JENA 4FP3A 4W50A 5FQ0B 2YC4A 1FXZA 1U0AA 1ULPA 1N1SA 1YI9A 2JG9C 3OGRA 4LNVA 2VBPA 4FOVA 3OEAA 3D5OA 3WDTA 2IVJA 4KQ7A 3AVSA 1CD3G 1POV1 4YPJA 2ZX0A 3ZXJA 1M4WA 2P4EA 1TG7A 2XXZA 2HBTA 4HLTA 1XSRA 3Q8FA 3NSTA 2ARBA 4MVTA 4IEYA 5ABJA 4ZONA 4PHZA 5KHHA 1KDMA 4RR3B 4F3JA 1JZ8A 2WS92 3B93A 1XQNA 3OD4A 2VR4A 2QZ2A 4QQ2A 3P3NA 5EIYB 2BRTA 4XE9A 5KHKA 3ZXGA 3KF5A 3O1MA 1ZA4A 3B5LB 5DQ0A 3K2OA 4V2WA 3MHZA 3NNMA 4CP2A 4D8MA 1SLIA 2YGMA 3U37A 3LAGA 5KBFA 1D4M1 4X6QB 5A3WA 1UNBA 1BCXA 3MLKA 1F4AA 4JVAA 3VDDC 1RUI1 5T5JA 4EJRA 5K7PA 2EAKA 3VZLA 3MFCA 1K12A 2EALA 5F5QA 4E2SA 2ES3A 2Y6LA 4Q4W1 4ZU5A 1LODA 2JDKA 4MXWB 3SC7X 4NIDA 3NL1A 3B9IA 4GULA 1WW5A 1PHMA 1KFXL 1ZBE1 2CDOA 1PMJX 2E7QA 3M4FA 3FWEA 1HRI2 1V6OA 3FLTA 2MEV2 3ZSLA 1QOSA 4GKXA 2JG9A 3KT7A 3ORJA 4L9BA 3ZYIB 5D1IA 3EBRA 4FQ4A 1ST8A 3WX5A 3DKWA 3HVDA 5HCFA 1RMU2 3OGJA 5J36A 3LCPA 1DGRA 2IFRA 1OFSA 3LEKA 1TME3 1PNFA 5IVJA 2X5IC 4FOQA 4CCDA 4CU8A 3K51A 4BIOA 4CU6A 1LOBA 1VIWB 2V4AA 3IPVA 3SEPA 5JXJA 2V5DA 1QJU1 4D6RA 1NXMA 2ZGQA 3LEIA 1PX4A 2DCTA 3WSOA 5IAXA 2VVFA 2J1EA 4Z2WA 5DPNA 2WZPP 2EXJA 2ADDA 2H6CA 4HSLA 1WLTA 1ZZBA 2QQLA 2VZRA 2QQUA 3H3LA 2WNOA 1RYYA 1ZRDA 4AEDB 3WR0A 1C1LA 1HRV3 4CDQA 1RUE1 2JD9A 1CVNA 2RS31 3H9AA 1W2OA 4FI9A 2XKOA 3WNXA 2EXKA 3ZN4A 1VAKA 4YVSA 4YNIA 1RINA 1VRH1 1EAH2 1R1A3 2EAAA 4FBFA 4DUVA 3ZSMA 5A6YA 1VJ2A 5T5PA 3WY6A 3H1YA 3OB8A 1UAIA 4ONUA 4AAXA 4YFZA 2BBAA 3IAQA 1AR71 3TEYA 1XYPA 2J1UA 1RUJ3 2KA3A 1STMA 3WW4A 3I4IA 1HJGA 3WP5A 3FFZA 4QX2A 4AEMA 4BM8A 4LO6B 4XHXA 1H8TA 3I8TA 5J96B 3KCCA 1AR81 3ZXLA 4ARYA 2W1QA 2VULA 2ZAAA 5FZBA 4K20A 4GWMA 4DIQA 2DBNA 2QZ3A 3OUIA 1IS3A 2KM2A 2WYSA 3LFIA 3OPTA 1ZA7A 2XJQA 4DO0A 2WNUC 1K5MC 2ZS6B 1I5PA 4MADA 5GLZA 2W39A 1FMD2 3A4UA 1BLZA 4JRLA 1WUVA 3BTAA 3ZDVA 1UIKA 5EJ3A 4AE2A 3O0XA 2J1AA 5JR7B 2YC0A 1TMF3 1ZBA2 2DVGA 3H7YA 4MZUA 3BYWA 3RZKA 3RRDA 1X9PA 4ASMB 1O3SA 4G4FA 1EUUA 3VBRC 1CAVB 2VO5A 1QH6A 4JKKA 2NZ9A 2VW2A 5JOYA 2R042 4XFIA 5IVBA 1MEC3 3ACGA 2ADEA 4NOTA 1QWRA 5GZGA 3BTYA 4O9EA 1EV12 2ZHLA 5EYYA 4FPJA 4NIAA 2PFWA 4QAWA 1X8EA 3ZLIA 1I6XA 3ILNA 1RJ8A 2IXHA 3L9JT 3E6CC 2VNGA 5F6KA 1WZXA 1Q8PA 3VZJA 3BIWE 3EJKA 4XUNA 4NRPA 1RIRA 5ISLA 4CP0A 2Q1MA 4CVUA 5BXXA 4LKEA 4FPFA 2YHJA 4CA9A 1NCQC 1RMU3 2VNOA 4K9SA 1MVEA 3FE5A 4GKYA 4QXBA 3TN92 4A41A 5A7PA 3RZLA 1YQ8A 4I09A 3I3QA 1GR3A 1TME1 3I2GA 4OCTA 5EP9A 3AZVA 3AL5A 2AR6A 3HR9A 3WNLA 2P2KA 4AFCA 2HWC2 2VU9A 1X82A 2Y6GA 2BOIA 1UOJA 1YFYA 1F2NA 4CDXB 5FDBA 3ROUA 1V9U1 3I54A 5A7WA 2GP5A 3WW1A 2YBKA 4Y5TA 1IZ3A 1NLQA 5FXXA 3DPRB 5GLWA 5DAWA 5K9YA 1PGSA 5LBCA 4Y22B 1PM7A 5AFEA 5CYYA 4E9KA 1M06G 1BEV1 2PAMA 1HJFA 4H14A 1AR92 2YUEA 2D43A 1NA1B 1DGWA 4R9CA 5GLTA 2HWB2 2HWF2 2Y26A 3CJIB 4HKWA 4P08A 4MUVA 2O8QA 4LHNA 1D4M3 2RS52 3KQ4B 4ZS3A 1GFF2 2GDFA 2VTFA 1QJY1 2FDKA 3HBKA 2FD8A 3HOBA 2VZVA 5A33B 3THDA 5LZ6A 1PO22 1JYTA 4Y4YA 1S0FA 1NKGA 4Q0VA 3D3AA 1Q5OA 1IS6A 3SMHA 4XBNA 5KHIA 1VBC2 2D40A 3GGLA 3H50A 4I0WB 5DABA 4Z92B 5AVAA 1W0OA 2VD7A 3DPRC 4HETA 3WDVA 4OUSA 5FUPA 2BW8A 5HCAA 3AJYA 4TSVA 1GP6A 4QXKA 4YARA 4K8RB 2BVBA 3OPZA 4KWJA 2NQYA 3RZGA 1D7PM 4IE0A 3S0MA 1DP0A 2BFUS 4P5YA 4COVA 3UNPA 1QQP3 3CDZB 3IDAA 5IYYA 3IBMA 5ANQA 4UFJA 5L73A 3U75A 5FZ4A 5C5UA 2BBVA 1Z0HA 3KVAA 4N53A 5K8SA 3WP3A 4EZHA 1GICA 4P9GA 3PDQA 1AZDA 4B29A 1G8WA 1OC1A 2VCMA 4DQAA 1N3QA 3THPA 1DZQA 5ANNA 4LBLA 2YC2A 2AH2A 4META 4F83A 1BJQA 3NV3A 2OKXA 3ZVXA 3U1XA 2IXJA 1S0CA 1XNDA 2VXRA 4RR3C 4MG2A 3AL6A 2WNUA 3OBAA 4AI9A 4QGLA 3WF2A 2XVKA 4ATEA 3AB0A 3LPFA 5CKNA 5T5OA 1PK6B 1W2UA 3VHRA 5FWJA 1N47A 5FZEA 1REEA 4GALA 2VZSA 1ND2A 3DPRA 4CDWA 3PIJA 4LOTA 1UY4A 3B00A 1ZM1A 2O14A 1VAMA 1MEC1 3JCIA 4NE9A 2Y0OA 1E5IA 1A6CA 1R093 2ZGLA 3LIGA 1AXZA 4Y4RA 4AVSA 2EXIA 1V6NA 1PIV3 2R30A 2WR9A 3RWKX 4ASLA 3VHNA 1S1AA 4B4RA 3W5NA 3LKJA 4A42A 2A6VA 1AR62 4Q0UA 1RUD2 4FVVA 3CQOA 4FAHA 4ASKA 3KZ4C 5L9BA 3O12A 1OH4A 5T3NA 3SKVA 4CP9A 1DZTA 4AFAA 3CF6E 3B7MA 1BVP1 1FMD3 2W9XA 3AVRA 4D6QA 2QVSB 3AX4A 2ZGKA 4C0BA 1YQ5A 4A6OA 1JYXA 2GMPA 5I0DA 5FZ7A 2FBEA 1UU4A 2XWBB 4BQ2A 4CUGA 3EQEA 5JIAA 1IPKA 5BNQA 1NA1A 2FDJA 1ZZ9A 1TVGA 1NCQA 1RUE3 4NAMA 1NZCA 5FBZA 3ETPA 4FPEA 1BQPA 5FOBB 3TEZA 1YYNA 1YXWA 4IXLA 1AR72 4NHLA 3TWIA 5HI0A 1ASJ3 2ZGNA 1Q8QA 3BN6A 1UCXA 4XJZA 5EZWA 1NYWA 2A71A 2Q8EA 2RS53 2XL9A 1XBFA 1V6IA 3NV4A 3ILRA 1SPPA 3W5MA 3IMMA 3NAPC 2VBDA 3OBZA 4K40A 1JHNA 1OI6A 3ZFFC 1O3TA 3RSJA 1AR93 4K7JA 4XF3A 1CQ9A 2Q0AA 3CO2A 1SMVA 5EPAA 5GLVA 2JDNA 1W8WA 1DGWX 2IUWA 2VQTA 3GYDA 4LO5B 4CCMA 1YLLA 4RHV3 5IATA 1A34A 3AC0A 3ZFGA 3VZOA 4W65A 2RS33 5FMOS 4CCOA 2XMLA 2ZKLA 1NQJA 5LCWL 4MV2A 5FP4A 4CUBA 2XJPA 3T2QA 4WVVA 4YW4A 2VPVA 1OHFA 1COV2 4YVWB 1IQDC 2WZR3 4DB5A 2O0OA 3B02A 1QJU3 1Y9QA 2G9GA 3CBNA 3ON7A 4JZRA 3UL2A 4Z1VA 4TN7A 4YM2A 3NV1A 4FPLA 1GQPA 3J7LA 4HVQA 2WWJA 3WG2A 3VBFB 3K75B 3ACIA 4L0PA 4N43A 2LUWA 3J4UH 1QQP2 4NPRA 1MS8A 3KS7A 4Q8KA 5C4WB 1CJPA 1LOGA 3N9QA 2QQVA 4IGPA 5IK8A 1ENSA 3ME2A 3VDAA 3MIBA 1C5IA 2TUNA 3AZYA 5FYTA 1KQRA 1RUJ2 2WQ8A 5FREA 5CG8A 1LU2A 3NKTA 4R9DA 3WDUA 3I2FA 3MW3A 4EYUA 1H2NA 3FC0A 3L2YA 1QJZA 4N53C 4ZXKA 4CU9A 3PUAA 4IEOA 4WM8A 4D7YA 2W52A 3I2KA 4XMIA 5C7GA 3KV6A 3KT1A 5LEJA 1LJ7A 3PUQA 5LWBA 1R1ZA 1FYUA 2DYCA 4P14A 4WBBA 4XOGA 3UESA 5TSWA 1NZIA 3PJQA 4RR3A 2WQZC 3JBG2 1PVC2 1O4ZA 3I2DA 1ZRCA 1RHI1 3VDCA 4XJ8A 2RR11 2FMYA 3ST7A 5FO9B 3ZMOA 3EXUA 3J7HA 2OZJA 4Q4X1 4WZFA 1PO13 2HEYF 2HWC3 4AOCA 1LAJA 4UW6A 1J1LA 1RITA 4JTOA 1MACA 4I3PA 3PL0A 3O0VA 3MICA 1YUDA 4MGTA 2WFPA 2C4XA 2JIJA 1KRIA 1EPWA 4QX1A 1J1TA 2ZGMA 3VKMA 4UFIA 3FBMA 2WZR1 2ZMLA 3MIDA 4LK6A 1S0IA 4XJWA 2DBIA 5FUNA 2W2IA 3P6BA 2Y6KA 4XEZA 1HB3A 5I8YA 1OLME 3ZXKA 2OPKA 4BQWA 1I1EA 1DLLA 1KDKA 5JR2A 1S55A 1VP6A 4QM8A 1QXJA 1SBFA 4UW4A 3T0AA 3QCWA 3M3IA 2VQ0A 3O1OA 5DG1A 2Y0IA 2Y33A 3WNMA 4BK5A 1IOAA 1BHGA 1J83A 1MS9A 4GMP3 4NHKA 4W6WA 1OVPA 2ZXQA 1Y7BA 4K3UA 2ZEXA 1H1IA 3GNEA 1RUG1 3ABZA 3BUCA 1FNZA 3LSDA 2C5DA 3VD3A 2RDQA 3CHXA 3AMMA 3O5SA 3GBWA 4KBZA 2E7AA 4JTNA 3BI3A 2RM22 3WF1A 2P17A 2D3PA 3F95A 4CDUA 1VB2A 2XLAA 5IK4A 5A32A 5F2SA 5HCBA 5A3OA 5DAQA 2D6KA 2W47A 4M4PA 3WQBA 4CCKA 2OYZA 4IEZA 4TZDA 2GMMA 4BU2A 2A1XA 2QQKA 3BOPA 3DF0A 5LY2A 2DCJA 1ENXA 1VBA1 2NMOA 1UX6A 3ACHA 3WD5A 2W91A 4OMCA 3AMHA 4I02A 4LIVA 5AC91 2HWB3 4GAZA 4I3GA 2WFF1 5FZIA 4UAPA 3GJAA 5J1XA 4BLJA 3ZPOA 4UW5A 1FNYA 5I0UA 2FCVA 2WL1A 2ARAA 3TB0A 1US3A 1LHWA 1F35A 3KVBA 2B7YA
chains in the Genus database with same CATH topology
4LLFA 3ZFFB 2IXCA 3S6PA 2XGXA 1LKNA 4K1YA 4QD2A 2D6OX 2PHUA 2CV6A 2ZGRA 3MIGA 1AL0G 4FCAA 5FFOC 1KS4A 3RJ2X 1RUF3 4XZPA 3J8F1 1FATA 2FZ1A 2VY0A 2NMNA 2R32A 1DQ4A 3GZUC 1EAH3 1R1A2 3AXDA 2D6NA 3H3ZA 4A7YA 4DOUA 5KC5A 1JW6A 2ZTNA 2R0FA 4BE3A 2VOKA 4HZFA 1BZWA 4XQDA 1W6PB 4D3WA 2VNRA 2PLV1 4IEQA 1X8MA 4GMP1 1FOD2 4HVOA 1GYKA 1W6NB 3B94A 4WM8C 3ETQA 4BLIA 3WUDA 3KSCA 5CFDC 2Z5WA 3FFQA 4QQLA 4E4ZA 2ET1A 1O91A 4SBVA 4AVCA 1RVF1 2OUJA 1KJRA 1W6QA 1C3HA 5T54A 2BFUL 4UBGA 2WSVA 3U07A 3NKGA 3E5QA 4YVWA 4EN0A 4R4ZA 2UWAA 1ULGA 2ZBJA 3TOJA 3VBSA 4LBKA 4EROA 2VOVA 1D2SA 2XHKA 3AYAA 4O9GA 1YFUA 3OTFA 3H1MA 1LTEA 3W9AA 2XJSA 4RA0A 2WT1A 4PIYA 4YG6A 1UU5A 4AGRA 3RJRA 3IKWA 2VW1A 4PDWB 5K0UB 3AP5A 2Q30A 2WQ4A 5CB7A 2DUQA 4AI8A 4CDXA 1T6GC 4QPIC 2UY9A 4DXZA 2DVFA 4R9AA 5C9AC 2V73A 3HWJA 4K8FA 3JBG3 3SISA 4JGYB 2RMU2 5I93A 2CTVA 3WINE 4XBLA 3E6DA 2IXLA 1PGW1 5DZFA 3IDEA 4AQSA 1PGL1 2D5FA 2XL7A 4LUKA 1K5MB 1PZ7A 4XJAA 2WT0A 4Q4W2 4GWNA 4XETA 2CGOA 2V5YA 1LHVA 4YZ1A 2GC3A 1AYM3 2GNTA 1H9PA 2TBVA 5KC6A 1IHMA 1H2MA 2LALA 4JC1A 1URXA 1POV0 1U5YA 2R063 1G6NA 2WLPA 3VBOC 4ZKTB 2PELA 2XBO1 4XMAA 1JTZX 5LRRA 2WNEA 1HV1A 2DUPA 4FPCA 1XE8A 3M3OA 2R061 1DDLA 3RNSA 1CGPA 4AK3A 2A3YA 2XB6C 2A6WA 1O3RA 4U2AA 4COYA 1X33A 1IPJA 4FOYA 1HRI1 4W6YA 1ZYBA 1MR5A 4R8HA 2K2SA 3ZYJB 2I45A 2BVVA 4YFWA 1UPIA 5E1RA 3H3UA 3BALA 3MI8A 4FXKB 4BZ4A 3PNAA 4PJYA 1F5JA 2HJIA 2QCSB 2E63A 3FHIB 1AJOA 2ARXA 2A6ZA 1LU1A 1GLHA 1H4GA 1W6QB 1G7YA 2CGNA 2VW0A 1CAUA 4E4SA 1IGOA 3OYWB 1AXYA 1QKQA 3JBG1 5E16A 5GKAC 1HX6A 1ND2B 3WW3A 1V6LA 2ZCWA 4Y24A 3M8LA 3FMGA 1H0BA 2E9QA 5T55A 4Q0PA 4GB33 1YCIA 4XPVA 5BNPC 4FPYA 4QPGA 3O0WA 5CFDA 4Q2FA 4AQTA 3E5UA 2EVXA 3R0RA 1AR73 1HQNA 1S0JA 5GZFA 4C91A 4YVWC 3MEPA 3MW2A 1C4RA 4J6GA 1R1A1 3B01A 3MPBA 5D8AC 2DFBA 3ALQA 1QDCA 3VDDB 4F8AA 1OPOA 1DBNA 4RD7A 2VECA 4G9SB 1XRUA 1NCQB 2DU1A 1CESA 4DNYA 2PLV2 5GM0A 2ZX4A 5F1RA 4GB32 5GJ6A 5JOZA 1AR63 1ULFA 2ZKNA 3FUQA 1Z7S2 1TE1B 3U0ZA 5ABJB 4S2FA 3GZAA 4QPIA 1OSGA 3DV8A 1TNFA 3ZFEB 1OQDA 3MPPG 4BQ1A 1HRV2 4IERA 3JU9A 1WA4A 2P3JA 2V09A 2GU9A 3R4SA 3M1HA 2D7FA 4K21A 5I8TA 4BOWA 2YMZA 2E51A 2A6YA 1W6NA 1VBA2 4PDWC 3AYEA 4URTA 4L97A 1LHUA 4I2OA 1G9CA 3R05A 3APBA 1CAUB 2WFF2 1RUNA 1AYN2 3AKQA 4AI1A 4MXWA 3WCRA 4JGZB 1BBT2 2Q8OA 3TAYA 4XYXA 2Q4SA 4CEYA 1EV11 2CWMA 1FOD1 4P9WA 1JN2P 1RUJ1 2JG8C 2C1FA 1CPMA 2XH6A 4QQOA 1BXHA 3AK0A 3VBFA 2IXKA 3T2TA 4MYEA 2BPA2 1VRH3 4N43B 3J8F2 1HRI3 2YDEA 3MIFA 5FAXA 5AC93 5C4WA 1QJY3 1CN1A 2WS91 4KNCA 2R6QA 1BBT1 5FMOL 1C8M1 4DY5A 2EF6A 3R4UA 2NYYA 3OBTA 1VB4A 3KMHA 4WM8B 4JGYA 3HQXA 3B9CA 4YW5A 4IESA 2WINB 4NR1A 1KD7A 1HLCA 2GC1A 3DUIA 4PBOA 3D0SA 4FPGA 4BPZA 5CNAA 4ES9A 2HYKA 4CEYC 2GNDA 3KLSA 4FPOB 1QNYA 1AYM1 3ZXEA 4IV1A 1UD1A 1CONA 4Q4Y3 1AVBA 4YM0A 1C1FA 1HKDA 1NCRA 3VLBB 1GANA 4AFDA 1C8M2 2MPFA 4N90A 1ALYA 1HW5A 3HN1A 1PGW2 1Q8VA 2ATFA 4XJUA 3VBFC 2O8OA 1DZRA 3CEWA 1GSLA 1QNWA 3SH3A 2W0XA 3ZO0B 5C4WC 1V6KA 4SLIA 3AJZA 1H2LA 1XNKA 2XG3A 2PHFA 1UU6A 1LOEA 3QOPA 5K0UC 4JGYC 4EN9B 3ZYRA 1G9AA 4AFMA 2JICA 2QJVA 4L11A 1A78A 4OULA 4QQHA 2VMHA 3WDXA 2IC1A 4Z8BA 2CNAA 5F6LB 5E8AA 3WXPA 2Z2SB 2DVDA 4RQPB 3E6BA 1KFUL 4RSUA 4MGYE 5JAXA 1ZVFA 1SCSA 1EY2A 4D69A 1H1MA 5L7OB 4CDUB 4JGZA 1SACA 3J9SA 1XU1A 3SCGA 5BNNB 3OYWA 3VUOA 2D6MA 2Q5TA 2JJ6A 4Q0SA 3WZ1A 3MIEA 2PAKA 4R9BA 2ZX2A 3NO8A 1QGLA 1W6MA 1DF0A 1B35C 4OI2A 2QQPA 4IV3C 3BPZA 3N4MA 1WD3A 4XF9A 2LM3A 4E2GA 4RHV1 2Z79A 4AGVA 3ACLA 2PLV3 2XJTA 4WVMA 3FJSA 1VRH2 2B42B 4J1XA 5ABJC 2GALA 1IQAA 3H8UA 2ZZQA 3HT1A 1OA3A 1DGLA 5DZEA 3ZXAC 1YWKA 3JQXA 1F31A 5JCTA 5CBLA 4X8NA 4FT8A 4WVZA 4Y20A 1JUIA 1GQHA 2D6LX 5DUUA 3VHPA 3I59B 3TNQA 3K48A 3ELNA 4N7UA 3SH4A 1PZ9A 3VDDA 2H0VA 4LO7A 5SV5A 1PIV2 2E7TA 1WCDJ 4AEKA 3OBRA 3MLLA 3RMYA 2IXIA 4YZ2A 2BNOA 4Q1PA 3CJIA 3AFGA 3WV6A 5KXDA 1AL23 4I30A 2BWAA 3Q9OA 2P3KA 4M0HA 4M3CB 1UL9A 4DS0A 2A5ZA 1H8VA 5A33A 3VKLA 1ZBA1 3M3EA 1REFA 1QF3A 4LBNA 5DDJ1 1I3HA 1AXKA 4GH4C 3RYKA 1RUF1 4CRQA 3NJZA 5I91A 4L99A 5DDJ3 1J3RA 4Q29A 5BNPB 1CAWA 1U5ZA 2ZX3A 1V9U2 4CZSA 2MEV3 1N1TA 2RS11 2GH8A 3WW2A 4PCRA 4CDQC 5C8WA 2DURA 4AHWA 3VKNA 2HWE2 4Q4V1 2HWD2 2JD4A 1LCLA 2B46X 1BK1A 3AP7A 4PLMA 4LHLA 3IPVB 3MYXA 4WVMB 2ET7A 1JOJA 5JSRA 4Q0QA 1YJLA 4OHVA 1LOAA 5BYNA 4N9IA 2NPIA 4OLLA 3SCFA 4Q4Y2 2K0GA 3JZVA 4HT1T 3MDPA 1PK6A 1VBB1 1WMDA 2RR12 4H7LA 2B9UA 2D5HA 2R071 4HK9A 4Y20B 1Z7S1 3POWA 3U11A 4K6BA 4IEPA 3OF1A 3W59A 1WLCA 3VBUC 4PLOA 2WSUA 3AZZA 3AKPA 4B7EA 3IDBB 2XPJA 3VV1A 2GN7A 4CYDA 4OUMA 2B45X 1IS4A 2DTYA 4GH4B 3KD4A 5JWPA 2Z42A 1O4YA 5FLHA 3WDYA 2X29A 2FHRA 4RS5B 1QJY2 2ENRA 4Y1UA 4EWAA 1YIFA 3LA3A 2ZMNA 3HIFA 1PGL2 1QQP1 1JYCA 2DCYA 2WIIB 2GN3A 3EO6A 2H0BA 2EA7A 5CA6A 4Q4X2 1OQEA 2GNBA 4ES8A 1VBB3 2A3XA 4LE4A 4MGKE 1HIXA 3ZIXA 5L7OC 1PK6C 5FPXA 2E6VA 1JH5A 2ZZJA 4AW7A 3PVOA 4XXPA 4BYYA 1APNA 2X5IA 2RJLA 2DU0A 3IM0A 2XJUA 4HBNA 4C1XA 1CAVA 1W6OA 4FPHA 1R081 1B35B 1COV3 1YIPA 4YLZA 2VUJA 3AYDA 4XW3A 2ZGPA 3WG3A 4AHYA 5F9TA 5JPMB 4GMP0 5LEKA 1YI7A 4RQPA 3HMYA 2ZHMA 3UKNA 3POSA 4I01A 4GQ7A 3UKTA 4EWDA 4WM7B 3CJIC 4TYSA 1MZ6A 5C9AB 4QU2A 1O4TA 1OMIA 2I2SA 1AYM2 3RS6A 1EYBA 3LA2A 2RM21 3N7MA 3PVEA 2GC2A 1LULA 1WMFA 5LRSA 1A3KA 4XF1A 1H8TC 4GH4A 1NE6A 4NWVA 4JAAA 1UZZA 1ZX5A 2ETEA 5AC92 5CFDB 4F7ZA 5C6CA 2BGCA 5T50A 2DVBA 3VBRB 4XF4A 1QOOA 2OUHA 1DHKB 2BWCA 4AVVA 2DVAA 2F4PA 2VMIA 1PMIA 1LGBA 1X7NA 4AWDA 2CY6A 1CPNA 2PYTA 3AKRA 3J26N 4HSJA 5CFCB 1GQGA 1H9WA 1OOPA 2BEOA 1NLRA 3V0AA 2XUMA 3MF6A 1GZ9A 1C5HA 5KXBA 1W6OB 2B8MA 4M3CA 1FOD3 1F8VA 1AYN1 4NWWA 4XFCA 1ASJ1 4COWA 1RUC1 2QKDA 3VBUA 5DG2A 1QJX2 2XKPA 5I0RA 1MS0A 3SHRA 3RZZA 4COZA 1SCRA 4Q27A 1MS3A 1XXNA 2JDZA 4KU7A 3SITA 4XF0A 1LGCA 4CEYB 2F6BA 5J98B 2HEWF 1IKPA 4U36A 5A3LA 1LB2A 4N53B 1ND2C 3VBSB 1W39A 4IQPA 5C33A 3PLQA 1DG6A 2H6BA 3WCSA 1OPMA 4UBHA 1X50A 2NM1A 1XNBA 1AR82 4J1WA 2NP0A 3JQWA 5DUWA 3KB5A 1VBB2 4TLFA 4ISRA 2UWCA 1FPN3 1NLSA 1PVC1 2P3IA 4M3CE 4XBQA 3VZNA 4TWTA 4Z07A 3ZFEC 2VOWA 5CFCC 4H7MA 3ZDSA 1ULDA 2G4IA 1PO23 4MH0E 2P37A 1JXNA 3RI9A 2DF7A 2PHLA 1H30A 1KXGA 4JQRA 2BYVE 1S0BA 5FTTC 1S0EA 3D4KA 1K5MA 3RWNA 3X29B 4W6XA 4YZ5A 3SCHA 1HXS1 4AFBA 4YW3A 1RUI3 2BNNA 4RQPC 5KXCA 4KWLA 4DY3A 3V56A 1O5UA 1GNHA 4D94A 1NCRB 3C3VA 3VBRA 3WOGA 3VGIA 3MW4A 4RGAA 2CGPA 4H3WA 3A0NA 4XDQA 2IZWA 3ZYGA 1WLDA 5JZGB 4PIZA 5CFCA 3UK9A 3FLRA 2O1QA 2GAUA 1FAYA 2ILMA 1GZWB 3B3QE 3ES4A 2A3WA 4QX5A 4RL7A 4ORFA 2BNMA 3IT8A 5HXVA 2D3RA 1SLLA 5JDBA 4AVTA 2JG8B 1RUOA 5JMCA 4P9JA 4B8EA 3M7AA 4K1ZA 3N7KA 1N1VA 4I0BA 4AI3A 4EN6B 2WC2A 1EV13 3VBHB 1QOTA 1LHNA 1ZZ7A 4YVSC 1N3OA 1WW7A 1SFYA 3ZX7A 1RVF3 5FLIA 3AMNA 2CAUA 2JX9A 3KCXA 3S30A 4LEJA 3VKOA 3V0BA 1RUI2 4OI1A 3KCYA 2OVUA 4XJ9A 4RGGA 4JDOA 1MQTC 2RMU3 1DQ6A 4PIXA 3SLIA 2R16A 2XJVA 2EIGA 1AR61 3V65A 1GKBA 5J37A 1NA1C 3WVJA 4Y1XA 4LULA 1TQ5A 1DGRN 5IT6A 4YW2A 1OLQA 3AZWA 2OA2A 1UMZA 4AXOA 4BHPA 3U4XA 2ZHNA 3B69A 1DQ1A 3VBOB 3IWZA 3ECQA 4XFAA 3ZXJA 1AX2A 3QBQA 5J7MA 2EXHA 4JRAA 4EV0A 1GZWA 3THTA 1D0GA 1RUC3 5KHJA 4Y1ZA 1JYIA 1O7FA 1A8DA 1YFXA 1AYN3 4G3YC 2XLFA 3T1MA 3ZFEA 1QMJA 1KITA 1OD5A 4MGIE 4KGQA 4Q4V3 2ZA9A 4XIOA 1TMF1 3ZFGC 5BV6A 3NAPB 1MQTA 3FLPA 3LZZA 5IK7A 2MEV1 2RS13 4GB31 5A3MA 3AYCA 5KHGA 4P9YA 2PTMA 3ES1A 2Q1ZB 1XNCA 5GZCA 2GZWA 2N7GA 2AZ5A 2DUOA 3FUOA 4YYOA 2UY8A 4Y22A 4Q4V2 4RHV2 5GLUA 1HRV1 4AQ6A 1GNZA 3BOWA 3ZXDA 4CDUC 4CDWC 1SFNA 4OHYA 1VBE3 2WA3A 1RL3A 4N43C 2CL2A 4PBPA 1ENQA 1TMF2 1ZBA3 3ZPYA 4YGCA 1ENRA 2BTVC 1C28A 2WNVB 3BCWA 1H2KA 4V1PA 1RUF2 4MGZE 4FTEA 4LUMA 4IV3B 4AEDC 1RUE2 1GZCA 4R4XA 1CJDA 1LESA 3JB4C 1VBE1 3NV2A 1UPSA 5CVRA 3JB8A 2RE9A 3VKFC 4UW3A 5IK5A 2AGSA 3WG1A 2AREA 1AUYA 2YYOA 5GZDA 3ZSKA 4OFGA 3AP6A 1FV3A 3POYA 4WV8A 1H4HA 1VLNA 5KWRA 1V6JA 1ZZCA 2R041 1YNAA 2ZABA 4YZ4A 1SBEA 2JXAA 1FX5A 2HWC1 3USUB 1OFNA 4IEWA 1MS4A 2RM23 2VUAA 3NAPA 1MVQA 2DCZA 3SXWA 3ZFFA 1AX0A 4R52A 4C1WA 2RS12 4N9HA 5BNOA 3WDWA 2BUKA 4A3XA 1GBGA 3DL3A 4NVPA 5E88A 3WUCA 4AEDA 1VBD1 2SLIA 4EWEA 2HWF1 2HWD1 4JV4A 2LTNA 4YGDA 1POV3 5EV7A 4COUA 4GIQA 2I07B 3D82A 3O14A 2XBO2 3G7DA 3PTYA 4LA3A 2ZGUA 1OLRA 1VBD3 2ZGOA 2NN8A 4AI2A 4C90A 5CADA 3GZTB 1BKZA 1U12A 2ZGSA 3N7JA 5JI9A 3M2MA 4N7IA 3RG0A 2D98A 4OZXA 2TNFA 2K9ZA 3G6JB 4YGBA 1EPZA 1RUH1 1MS1A 3TYJA 3R6SA 2AYHA 2PA7A 4BCUA 1TEIA 2D97A 4NN0A 5LK5A 1MZ5A 4KL1A 4M3CF 3N36A 3LSEA 2B5HA 1C8NA 3VN4A 1PO11 1UZYA 2A70A 3H0OA 5JLVA 5C9AA 3MIHA 1WGPA 3BU7A 1LRHA 5H9SA 1QXRA 5C8CB 2RR13 3L2HA 2WT2A 5CU1A 1NOVA 2R49A 3VHOA 3QACA 4FQZA 4INDA 3WP4A 1DU3D 4X8PA 1V70A 3KQRA 4HL0A 1SLAA 1V00A 4YG0A 1FPN2 1J58A 2RJKA 3OY8A 4XXAA 5AVPA 4JCKA 1Q43A 2R073 3LOIA 1EAH1 1U5XA 2HWD3 4QM9A 1BEV3 3QD6A 1S2KA 4OVEA 1QU0A 2OZ6A 3J8F3 1BBT3 4CEWB 1V9U3 2G9FA 2Z69A 3IMNA 3VBOA 3JUUA 1QJU2 3P3PA 2PAEA 1NQDA 5EFUA 1JBCA 4Y5Z0 5AFBA 4X6RB 5JPNB 1OOPB 5JOXA 2BQPA 1BMV2 5BNOB 1J59A 1LOCA 2PHWA 4HN0A 4KGGA 2B39A 4AVBA 5GZEA 4EN7B 4HVRA 1CR7A 4BIFA 3ZMNA 1ND3B 4P5HA 1OA2A 2YPJA 3TRSB 1H1AA 1LHOA 3OJBA 4YZ3A 4Z82A 3N7LA 5FRAA 4XHBA 4XFBA 2ZX1A 1ASJ2 1SQ4A 1RB8G 1QHDA 4GXLA 3CLPA 5JSPA 1LR5A 1RUC2 1PZ8A 5BNOC 3N35A 1RUG3 4LBQD 5JSOA 1LOFA 5JI7A 3UKVA 4B7KA 5GALA 1CAXA 4IEXA 4JDMA 1YO8A 1QH7A 2HWE1 2QNKA 1D0HA 3R4DB 1ZREA 4QPGC 3IN9A 2YZ4A 5SV8A 1L3JA 5L36A 4MLOA 1RUD1 5I0TA 5DDJ2 1NY72 1R092 1F5FA 2XVGA 3JD73 4LR4A 4ITCA 4LBQB 1SLBA 3SNMA 1W6MB 4P9IA 1AJKA 4A7ZA 3ZN5A 1DFQA 2SBAA 2JKBA 4KWKA 1YHFA 3WQ0A 3IIAA 3ZSJA 4AHZA 4BWOA 3VL9A 4MX3A 2NLRA 2TEPA 1LOFC 1UF2C 1HV0A 1J3PA 2CWSA 3OGGA 1UKGA 3GBGA 1HXS2 2CYFA 4ISQA 5DXDA 1LEMA 3AM2A 1WMEA 4WZCA 3WQ1A 1NG0A 4LT5A 5FO8B 4ZU4A 1HQWA 4E4DX 3GALA 2GNMA 1Y43B 2PQQA 2QUOA 4PF5A 3N3HA 5DZGA 3WHUA 4AEJA 5BY5A 5JZGA 4XTMA 5FOJB 1G86A 1IKQA 4LO4B 2X5IB 2A7AA 2AENA 5FO7B 1V6MA 3M3QA 4WVWA 5BNNC 1F9KA 4S2DA 2R072 2MNGA 3KGZA 4HK8A 5T52A 1PNGA 2DFCA 4QGNA 5CAZA 2DV9A 2W68A 5FLJA 1QDOA 1WLWA 1VBC3 2R043 2UWBA 1RMU1 4DPNA 2FMDA 2ZOEB 2OIIA 1ZBE3 1XU2A 1R082 1PO21 1C8M3 2IFWA 3CU7A 1D4M2 3JD72 1AL22 3M70A 2VOXA 1VBC1 2D93A 3LB9A 2WS93 1XE7A 1NE4A 3CL1A 3HBZA 4XIKA 3ZSEA 5B2GB 1AF9A 5JIUA 4BH9A 1ZBE2 1N3PA 1FPN1 5C8CA 1Q8OA 4P9LA 1D2QA 1RC6A 3E97A 4LBJA 1CAXB 1J3QA 4D7SA 1OA4A 1FV2A 4D7TA