2ET1A

Oxalate oxidase in complex with substrate analogue glycolate
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
201
structure length
201
Chain Sequence
TDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and spectroscopic studies shed light on the mechanism of oxalate oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Oxalate oxidase 1
total genus 44
structure length 201
sequence length 201
ec nomenclature ec 1.2.3.4: Oxalate oxidase.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2et1A00
1XE8A 4HVOA 1O4TA 3BPZA 1SFNA 3LA2A 2CV6A 5E1RA 1I6XA 1DGRA 1UCXA 2QNKA 2IXLA 3LOIA 5K8SA 5KHGA 3I7DA 4I09A 4EV0A 2PA7A 3HQXA 1X7NA 2PAKA 3IBMA 2V09A 1XE7A 5F1RA 1G6NA 1YFYA 3ACLA 3H3ZA 1NYWA 1ZNPA 1Y3TA 4MH0E 3WW4A 4I0BA 4I2OA 1CAXA 3H7YA 4YSFA 2EA7A 2GU9A 1FT9A 3TNPB 2PYTA 1YUDA 2BEOA 2IXIA 3H9AA 1O7FA 2Q0AA 4XF3A 2UYAA 2OYZA 1QWRA 1IPKA 3UKVA 4CYDA 3EHKA 3ST7A 3OD0A 3ETQA 3CO2A 1GQGA 4IEUA 4XFGA 2ZCWA 1RUNA 1OMIA 4HSJA 2QCSB 4JTOA 3H7JA 1ZRDA 2BNNA 3HIFA 3OF1A 4N9IA 1DGWA 3VHRA 4QGNA 1YFUA 1WLTA 2HJIA 4L2NA 3FX3A 5FCCA 2OZJA 4META 2Y0OA 3E5UA 2PHDA 2H6BA 2P17A 4IEXA 2VPVA 4A2UA 2MNGA 4IEVA 4IEZA 2GZWA 2GC0A 2XHKA 3RNSA 3SCGA 1L3JA 3BU7A 4H7LA 4E2QA 1GQHA 2CGPA 3BCWA 4QM9A 2IC1A 3DL3A 3R6SA 2PFWA 1X8MA 1OFNA 5CVRA 4ONUA 3RYRA 3MDPA 4P9GA 3LZZA 3UKTA 1ZZ8A 4L11A 2C0ZA 2D93A 1CX4A 4AQ6A 3OTFA 4HBNA 1CAVB 3FZ3A 2IXHA 3MYXA 1CAUB 2MHFA 2O8QA 3D82A 4B29A 4FT8A 4E2GA 1YFWA 5J3UA 4WVZA 3CJXA 4Q0PA 3SMHA 4OLLA 1HW5A 1EY2A 4Q0UA 1U12A 4LA2A 1NE4A 1SEFA 1ZZ7A 5BY5A 1NXMA 4J1XA 1WGPA 3SCFA 2VQAA 1OD5A 2XLFA 3ES4A 5C8WA 4BYYA 1CAWA 2H0VA 3CEWA 3H1YA 3CF6E 3S7IA 1YLLA 4EWAA 1ZRFA 5T3NA 3H1WA 2XLAA 3PLQA 3MPBA 2KXLA 4I3PA 4YARA 1RGSA 2XGXA 2GC2A 4ZU7A 4Q0QA 1LR5A 1J1LA 2IXCA 1OI6A 4Z82A 4IEOA 5JSOA 4MZUA 2PTMA 3I54A 2UY8A 2ZKLA 5FQ0B 4MGKE 5CU1A 3U11A 4XETA 3GBFA 1Y9QA 1ZZ9A 4Q0SA 4Q0VA 1XRUA 4IESA 3IDBB 1O3TA 5FLIA 3JZVA 3NKTA 2B9UA 4TLFA 4X6QB 4HN0A 1CAVA 5LRRA 5J48A 5KHKA 4BIFA 5FLHA 4MGZE 1NE6A 3H1MA 4ZU4A 1CAUA 4FAHA 4AVAA 3LA3A 4JTNA 1JUHA 3GYDA 2H6CA 5I8SA 4XF9A 1SQ4A 2DCTA 4Z07A 4EROA 4F7ZA 4E2SA 3D0JA 3KMHA 4AVCA 2XKOA 4LLOA 4JV4A 4J1WA 1LB2A 4QGMA 4F8AA 4HLTA 3UKNA 4LULA 1FXZA 4XFHA 3WW3A 1UD1A 3LA7A 3NJZA 4ZU5A 3QACA 3SCHA 3E6DA 2ET1A 4NVPA 5I91A 1O3QA 2QVSB 1UPIA 2GC1A 4HMZA 3DV8A 4EWDA 4HSLA 2PQQA 1ZZ6A 1X82A 2FMYA 4HZFA 1YWKA 1CAXB 2D40A 4MX3A 1NZCA 2BNMA 4IEQA 5FQ0A 5FDBA 2WFPA 3EO6A 3IDCB 4MGYE 4XFAA 3ROUA 4QM8A 5JSPA 3SXWA 5FPXA 5BXXA 3LAGA 1YHFA 2E9QA 2Q1ZB 1O3SA 1ZX5A 4PIYA 2MPFA 1WA4A 4I0AA 3FWEA 2VECA 3ELNA 1EP0A 3MZHA 5AVPA 1J3QA 2EVXA 1J59A 1J3PA 4PIXA 5I8TA 1LRHA 2GAUA 4KWLA 3IWZA 4BH9A 3NSTA 5J7MA 3FFQA 1DZTA 1CAWB 3BB6A 2I45A 2F4PA 2Q30A 3KGLA 3L2HA 4IEWA 4HN1A 1ZREA 3M3IA 1EYBA 4LUKA 4Q29A 1LKNA 4AXOA 2UY9A 3DN7A 4LA3A 4OFGA 4XF0A 3H3UA 3TNQA 4KL1A 3FHIB 4MGIE 1VJ2A 4X6RB 3SHRA 1ZZBA 2Z2SB 2IXJA 4MV2A 2B8MA 1RC6A 1O3RA 5D1IA 4XFFA 3RZZA 3KCCA 1J58A 4PIZA 1Q43A 3S7EA 1RTVA 4O9GA 1J3RA 2B5HA 3RPQA 1YFXA 4D7TA 4IEYA 4EWEA 1Q5OA 2Q4SA 3OCPA 5BV6A 2PAMA 3D0SA 5I0UA 3RYKA 4QGLA 3USSA 5LRSA 3FE5A 1FI2A 4KU7A 4XFBA 2BNOA 4HVRA 3EQEA 5KBFA 1VR3A 1QXJA 1I5ZA 2HKXA 1ZZCA 4FAGA 4FBFA 1PM7A 3NL1A 1H1IA 3HT1A 3ES1A 2OPKA 4QXKA 2XL9A 2EAAA 2ET7A 4IEPA 4I02A 5KHJA 4XF4A 4ORFA 1ZVFA 4LUMA 4LEJA 4I01A 3FJSA 4XF1A 3RYPA 3CLPA 3H8UA 3HT2A 1X8EA 3NW4A 1H1MA 5C6CA 2ETEA 4XEZA 2UYBA 3EBRA 4AQ2A 1DZRA 1QXRA 4HVQA 5KHIA 4YRDA 4DINB 2BGCA 2ATFA 2OA2A 5I0SA 5I0TA 1ZRRA 2XLGA 3RDIA 1V70A 2O1QA 2PHLA 4N9HA 1RL3A 4YYOA 3WW1A 4IETA 1UW8A 3KSCA 3M70A 3IIAA 4WBBA 4XFIA 2K0GA 1Q3EA 4D7SA 1UIKA 4QX5A 5JR7B 2IXKA 2GH2A 1TQ5A 1RUOA 2XL7A 2CAVA 5I93A 3N4MA 3B02A 1UIJA 4JVAA 1PMIA 4QMAA 5EZWA 3NVCA 3I59B 4UBGA 5I8YA 1O5UA 4IERA 3WW2A 5BUVA 2Z69A 4GULA 4UBHA 1CGPA 3E97A 4KWKA 4AVBA 5EFUA 2WC2A 3I59A 3EJKA 4PJYA 3BALA 5FLJA 5BPXA 2BYVE 2CAUA 3O14A 2OZ6A 3U0ZA 2N7GA 4K8FA 3KGZA 4BHPA 5FPZA 1VP6A 3S0MA 3E6CC 4YNIA 4XFCA 2QJVA 3CL1A 5KHHA 5I0RA 5JAXA 5LEJA 3E5XA 3H50A 2D5FA 3OGJA 2GC3A 4KWJA 3DKWA 4RD7A 4WZCA 5HI0A 2D5HA 1EPZA 2FQPA 5JSRA 5CADA 2QDRA 3E5QA 1O5LA 3LWCA 4UXAA 3ZDSA 3G7DA 5E16A 3C3VA 3U10A 2K9ZA 1QY4A 3QOPA 1IPJA 5JCTA 4KU8A 4LTAA 3PVBB 4O9EA 2PAEA 3E6BA 2XKPA 4R52A 1ZRCA 3PNAA 5LEKA 4MUVA 4R8HA
chains in the Genus database with same CATH superfamily
4YFZA 1XE8A 5C71A 2Y6FA 3LFIA 3JD72 5AVAA 2RG4A 2VXRA 3WR0A 4JGZC 2CV6A 5FWEA 1C4RA 4ARYA 4MLOA 2RS33 4KGGA 3ZYGA 3GZEA 4BQYA 4CP1A 1VRH1 2IXLA 3KCXA 4DY3A 1RUD1 1TMF3 5FPUA 5FZOA 3DYPA 1ASJ2 3HQXA 3K75B 4WM8A 2HWF3 3KVAA 3IBMA 2EXKA 5ANQA 2OXBA 1WMEA 4JDMA 5F1RA 4LE4A 2F4LA 5A32A 1ST8A 4AEDA 3H3ZA 1H8TB 1HRI2 4MH0E 1W39A 5CYYA 2RS13 2JE9A 3WG1A 3P1IA 2VU9A 4LIVA 2R061 4SBVA 1HB1A 3TNPB 1NCQB 2RS11 4ZPIA 1CONA 1DFQA 1YUDA 2JIGA 2BRTA 3VN4A 3WNLA 2WFF2 2DVBA 2Q0AA 1U5ZA 5FMBA 2AEZA 2ZMKA 2E31A 3WNXA 1IPKA 1S0CA 2J1AA 3UKVA 3HOBA 2IFRA 3B5LB 3EHKA 2WWUA 2IVJA 2QQLA 1REFA 3ETQA 2UURA 1PIV3 1GQGA 4OI2A 5GJ6A 1L7RA 1RUNA 4YW4A 5G04L 5L9VA 1H2NA 3O12A 3HN3A 1GQPA 2GP3A 3H7JA 4D6SA 1ZRDA 1F31A 1PMJX 3ZOIA 1ACCA 4N9IA 2OVUA 3GBWA 2WZR1 2W87A 4NWWA 4YGEA 5H9PA 3USUA 1RVF3 2V5YA 3FX3A 1VPHA 3ZXFA 4META 3K4AA 4BISA 2Y0OA 2XVKA 2JKBA 4K7JA 4LO8A 5LBEA 2DCJA 2VPVA 4OUEA 1UNBA 4IEVA 4IEZA 4S2DA 5T55A 3T30A 1GICA 1DZQA 1NQJA 2GZWA 2YROA 4GJZA 1NOVA 3RNSA 2XBO3 1JTZX 2KM2A 3I3BA 4RGGA 1H6XA 1YC61 4GWIA 3T2PA 2A6WA 1Y9MA 3BCWA 3DL3A 5CFDB 3IPVB 2XWJB 2PFWA 2C26A 5CVRA 4ONUA 4IQPA 2BU9A 4HKWA 5JI7A 3HD8B 1PO13 1C5IA 1W06A 1ZZ8A 4LBKA 1HXS3 2XB6C 2C0ZA 5DUWA 3IAQA 3MO4A 1PNGA 4HBNA 3FZ3A 2YDEA 5CG8A 3GCWA 5F5QA 4P9XA 1GZWB 3HNYM 5L73A 3QLQA 2A3XA 3D82A 3R4SA 3UGGA 4XPVA 2YZ4A 3H0OA 1NA1B 5A6YA 1QNWA 4FT8A 1YFWA 3ME2A 1IS5A 4CCNA 1JODA 5J3UA 4DEQA 4WVZA 3CJXA 2E6VA 4JDNA 4DZGA 5DAXA 1EY2A 3UJOA 4ZXKA 1A6CA 2DURA 1NE4A 3OBAA 1Q8PA 4P9LA 1UQXA 5DUVA 1B35C 3ZFEC 1W9FA 1NLQA 4QPIA 1GFF2 1PHMA 2W92A 5C8WA 3J9SA 1G9CA 4EWAA 5EWSA 3ZIWA 3ASIA 2W39A 1UF2C 1VMFA 1EV11 4XOGA 5HPOA 5HXVA 5IK5A 1HXS1 1YQ5A 3MW2A 4FOVA 2ARXA 2OUHA 1MS5A 1JZ3A 5EJ1B 3RZJA 1FPN1 2W1SA 4B4QA 2XLAA 2NQYA 4E8DA 1OLMA 2D3SA 3KV5A 5BNNC 2OUJA 1LECA 1S0IA 4XZUG 5C4WB 4FI9A 2DVAA 1ND2A 4RR3C 3WF2A 2OQ7A 4LR4A 1AX1A 4FQZA 4UW5A 5EIYB 4XURA 1A34A 1JUIA 2XGXA 1WCUA 5T5OA 3FMGA 4M3CB 1TNRA 2GC2A 2R062 4ZU7A 2H0BA 1LR5A 1J1LA 4ZY9A 3U14A 1UYZA 2VUAA 5CNAA 4CEWB 4KH9A 1JYTA 1F4AA 1OA3A 1QF3A 3SC7X 1ZYBA 2BVVA 2YPDA 4LKEA 4LOSA 4QX0A 4CTEA 5FR3A 3IKWA 4DEVA 1DCSA 2DU1A 2WWSA 4HPKA 4ASLA 1C3HA 3HJRA 5SV5A 1V00A 2XUMA 3AXEA 3ZSKA 4BMBA 2JX9A 4MGKE 5CU1A 1HN1A 4XETA 3I3QA 1W0PA 5KXDA 3M1HA 2YU1A 3BOPA 1W2AX 2LW8A 1AR61 2QFEA 1C8M2 3JZVA 1HB4A 1VIWB 2C9KA 2D44A 3KT7A 3GJAA 4TLFA 5LRRA 4HG6B 4IGOA 4KBBA 1RUE1 1LTEA 3DGTA 5A1FA 1OH3A 5FLHA 3JCIA 4X8PA 1CAUA 4LE3A 3EMRA 1IKPA 4AVAA 5JUVA 4COVA 2WZR3 1CIYA 1OA4A 1MEC1 4O7XA 5FZ4A 2OQ6A 2H6CA 1H8TA 3AP5A 5FY0A 2R071 2P3KA 1BHGA 5FO8B 3O1RA 4Z07A 5FYSA 2R49A 3D0JA 4AVCA 1OQ1A 3A21A 4CXXA 3J7NA 4A3XA 1C1LA 4LLOA 1YXWA 4HT1T 1VB4A 1IKQA 2XMLA 3PMEA 2HH9A 1W6NA 1W2OA 2XJQA 2ORXA 4QGMA 4XUOA 3ZXJA 3ZDVA 4LULA 3VD9A 1KS4A 4XBLA 2VQUA 5GZEA 1DQ1A 3NJYA 1AR93 5FXVA 4CZSA 2RS53 1O3QA 4ES9A 3VKLA 3KV6A 1MS3A 1ULOA 2AACA 4GJYA 3ZM8A 2A6VA 4NIHA 3LGRA 1W6MB 3NNFA 4HMZA 1F15A 5AFEA 3IMNA 4HSLA 4Y1ZA 1RUG1 2P3IA 4NIIA 1ZZ6A 1JYXA 3ACFA 2QQMA 4HZFA 2B4KA 1VBA3 3WDUA 4FVVA 5ABJC 1NZCA 1R1ZA 4NJ4A 3VBUA 2VMHA 3IDCB 1G9AA 4Q4V3 3ROUA 2HWC1 1REDA 5D8AC 2W2IA 5D8AB 3PU8A 5GZGA 4YZ2A 3I3EA 3GXUA 2VMDA 4DNYA 1XJAA 1FMD3 3ATGA 3ZYBA 1ULFA 4CEWA 1W2TA 3I2JA 3LAGA 4BPZA 3TBDA 1YHFA 4YZ4A 5T5LA 3Q8BA 1LEMA 5JXHA 4PIYA 1ENQA 1RVF2 1U5XA 1YIFA 1MZEA 4YG6A 4GZ9A 4AEMA 2AENA 3R4DB 4DO0A 2ZGOA 3MUY1 2W68A 5FBJA 4I0AA 1REEA 1SDDB 3J4UH 1DF0A 2BBVA 1NY72 4AGGA 4DXTA 1ND2B 4QU1A 3H8OA 1WCSA 3W20A 3NMBA 1J3QA 4Y3OA 1K5MB 3MF6A 5IVCA 1BBT3 1WBLA 3LDBA 4UF0B 1J3PA 1UY4A 5HCAA 2HWE3 5IYYA 3SKJE 1FPN3 3DPRB 5IW0A 3SCFA 2QQKA 3P5BA 4Y33A 3IWZA 4BH9A 3FFQA 1OH4A 1G9FA 3T09A 5APAA 3WHUA 2VY0A 3BB6A 2P34A 5DG2A 1GANA 1VMHA 3F2ZA 2WZ8A 4Y5SA 5A3NA 3PL0A 2I45A 4DIQA 1FOD1 4TSVA 3T1LA 5FJKA 4IEWA 1AYN3 4OHWA 1EYBA 1HQLA 3PTRB 2UY9A 1COV1 1HQNA 5C4WA 2V72A 4IV1C 1O8PA 3DN7A 2ZMNA 4LA3A 3OSDA 4OFGA 3RSJA 4ZONA 4XF0A 4QHOA 3MIDA 5BYNA 1WA6X 1LOCA 2RR12 2B8MA 3O0WA 1W03A 3ILFA 5L9BA 5JVVA 4CU6A 3AYEA 5FPLA 4J25A 4XFFA 1RUJ1 2X5IC 3KCCA 4OHXA 1POV1 4GAZA 1RTVA 2HWB3 1S0BA 1PVC2 2B5HA 5F5IA 4DUVA 1EAH1 2E7TA 4GH4A 1W6OB 3K4ZA 3RPQA 1RXGA 5FZ7A 1PM4A 5FZAA 4ET7A 1DQ0A 1U5YA 1YFXA 2UWAA 5D8AA 4OHZA 4JKMA 2EXHA 1FOD3 4PHZA 4EWEA 2Q4SA 1D0HA 1GOGA 1GLHA 4CEWC 4Q4Y1 3HQUA 1VBB3 1VBE1 4XUQA 3GF6A 3QH7A 4JKKA 5A3LA 1BBT1 1AR73 3PTYA 1K45A 1KGYA 1Q8QA 1OSGA 4XHXA 2GNBA 1GV9A 3POJA 3RI8A 1VR3A 3O5SA 4AFDA 1DQ2A 2JD4A 4IV3B 4LKFA 4XUNA 5LBFA 3SH4A 4DUXA 5F6LB 4EZ4A 1AXKA 4NHXA 3NJXA 1H1IA 2Q8EA 2BZDA 1ZA7A 3U75A 1HRV2 3BTXA 3WOGA 2OPKA 4KBZA 1R64A 1COV3 2XL9A 2ET7A 5DDJ1 3O1PA 3DYMA 4I02A 1IS6A 4QX7A 1Y9GA 4QQOA 4XF4A 5FWJA 5KHJA 1WW7A 4HETA 1ZVFA 2VZPA 2Y60A 4Q5OA 1CZSA 2FHRA 4LUMA 5T54A 2ZX3A 4CP2A 2V73A 5DPNA 1MS0A 2VMFA 5FP7A 3U4XA 3WD5A 3APBA 4HKLA 3GZTB 4XF1A 4Y4YA 2Y64A 3POBA 3CLPA 1TZOA 3HT2A 4Q4W1 2Y26A 1CR7A 4M0NA 3KS7A 2ETEA 2Q1FA 4MHRA 4AQSA 3VZOA 3DKQA 3WF4A 1QXRA 5FZMA 5GZFA 4GWJA 4IV1A 2GN7A 2PMWB 1RXFA 1W6NB 2HWB1 1XNCA 2X29A 4DINB 2ATFA 5C33A 1D2SA 1V6JA 1YJLA 2EF6A 2XVLA 3LDRA 1HRI1 5CB7A 4CCDA 2UU8A 1W6PA 2GMPA 3AMHA 4A45A 2GNDA 3K3OA 1SLLA 4LBMA 1RL3A 4GH4C 5KWRA 2FCTA 2VGDA 2VJXA 3VGIA 4CCKA 4OMCA 2GH8A 4BQ5A 4WBBA 2JDKA 2K0GA 1Q3EA 5LATA 4IE6A 2CDOA 1UIKA 1NA1C 5CFDA 3ZKUA 1OOPB 4KG8A 1NKGA 4XDQA 4AHXA 2P37A 2IXKA 4AQTA 5IUQA 1TQ5A 4M3CA 2CAVA 3CHXA 3I3MA 3N4MA 3B02A 1UIJA 3UETA 3I2IA 2ZHMA 3V65A 5H9QA 4K3UA 2VTXJ 3PU3A 4ITCA 4ZZ5A 3CZJA 1JMUB 4CCEA 4XJ8A 3TEZA 4CXWA 3ZFEA 3AP4A 2ZS6B 4H14A 5A6ZA 1QKQA 3OGVA 5JLVA 1IPSA 3I2GA 3RVHA 3VHPA 3WW2A 5BUVA 2YUEA 2JB4A 2GP5A 4CPBD 1YQ8A 4D3WA 4RFT0 5JR2A 1AR72 5D2AA 1PZ9A 3KV9A 2V4AA 5IFTA 2HWD3 1OFSA 1C8NA 4P5HA 2B39A 2JDZA 4ZS3A 2DYCA 3MIHA 4AVVA 5BPXA 1PGW1 2LM3A 2Q8DA 3I97A 2CAUA 2OZ6A 4DS0A 1QJFA 4BHPA 5A6QA 1SCSA 5LWBA 3W5MA 5DAWA 2D7FA 4RR3A 5J96B 1RUE3 2JICA 4Z2AA 4XFCA 5FY5A 1S2KA 2RDSA 2QJVA 2SLIA 1VBE2 3E5XA 2VH9A 2YMZA 2RHPA 3AK0A 1QU0A 1UOFA 4CDUC 3AKSA 4BU2A 2GC3A 3T2OA 4KWJA 3DKWA 1YIPA 2W91A 1TNFA 3VBUC 3ZIXA 1PVXA 1XYNA 2XPJA 1RUG2 3I49A 2TBVA 4NAMA 3TEYA 1QQP2 3EYPA 2JG8B 1OA2A 3LEIA 1R1A3 2ZGRA 1XYPA 1Z78A 3LCPA 1WZXA 3LE0A 4N7IA 3AZWA 4PBOA 1AL21 3ZDSA 5ACA2 5CA6A 5K0UC 5J09A 5K0UB 3BTZA 2YBSA 3JQWA 4C0HA 2C9AA 5E16A 5JPMB 4IV3C 3U10A 4LKDA 1NUKA 1O59A 1IPJA 3MLLA 3QOPA 4HK8A 4LTAA 4EE2A 5JCTA 3PVBB 3VBOA 2VBPA 1K12A 2EIDA 2WSUA 5DZGA 2ADDA 3VDDC 1KS5A 1RUI1 5LEKA 1R081 1KFUL 2PLV1 4BE3A 3VBHA 4NO4A 2AYHA 4C1WA 3BPZA 4LHKA 5CKMA 5IT6A 4GWMA 1EAH2 2F17A 4WZFA 4ZXEA 4BIOA 3LA2A 1AYM3 5E1RA 4DXZA 5GLVA 1DGRA 4N43C 1UL9A 3K4DA 1UCXA 2W9XA 5HV0A 2P6HA 4CSWA 3ZR5A 4NAOA 3GDBA 4AI9A 4YM3A 5K8SA 5KHGA 4FTBA 2PA7A 2Y6JA 4IXLA 1LHNA 2HWD1 5FUNA 2C5DA 2R042 4OZOA 3Q8EA 3WDWA 1RUH1 4Q4W3 1WD3A 2LRPA 5JIAA 2X53S 4CDWA 1NYWA 1ZNPA 1Y3TA 3VL8A 3JB8A 3NAPA 4I0BA 4NHMA 4NROA 5A7QA 4I2OA 3H7YA 5GZCA 1D4M1 1GYKA 1BMV1 3OY8B 4Q4V2 4K6BA 4BM8A 4BXSV 3Q8AA 2PYTA 1AJOA 3POIA 3TN93 4AL9A 1MQTB 2K46A 3H3LA 1GU3A 2OIIA 1ZBE2 2GMEA 3H9AA 4COYA 4OQ9A 2OYZA 1RIRA 1LOBA 2Z4FA 2QBXA 1BK0A 1C28A 3Q9OA 1YQ2A 2WZPP 5A7SA 3CO2A 5EV7A 4YM2A 3AP6A 4KGQA 2J7MA 4IEUA 3AVSA 1KEXA 4XFGA 1IQDC 1OMIA 1IQAA 4JHTA 1UYPA 4HK9A 2QCSB 1V9U1 4NPRA 1XU2A 4SLIA 4BK4A 4LBQB 4K8RB 1AR92 4QQ2A 4WM8C 3MUZ1 2HBTA 2PHXA 5FZOB 1GP5A 1DGWA 2F6BA 3AKRA 3DECA 2VZQA 3VBHB 5JPNB 3KWVA 1SBDA 1YFUA 3AMQA 3BIWE 2HJIA 1KQRA 2OZJA 2WO1A 4D8MA 2J1EA 2XJRA 1W8NA 4E9KA 1AYM1 2EIGA 2H6BA 3I2DA 1UYYA 4XW3A 3N3HA 5LY1A 2MNGA 2X09A 3FUOA 3O7OA 4ZHNA 3VBOC 1H0BA 2Y6HA 3ZFFB 4AW7A 4NIDA 3H42B 1LJ7A 1ZRIA 2RDRA 5FJHA 2P3JA 4MXVA 3UJQA 5KXCA 1JZ6A 3C8XA 4QKNA 1QOSA 3BU7A 1F9KA 4H7LA 4K40A 1GQHA 1UY1A 4E2QA 2CSGA 1ZBA3 2CGPA 4XMAA 5FPAA 2IC1A 3R6SA 1TMF1 1LOGA 4OHVA 3INAA 4QKFA 2ZTNA 4QXCA 3T0DA 1UOBA 1X8MA 2B42B 2VOWA 2RJLA 3OEAA 4G3YC 4LO6B 1FYUA 2P2KA 4K20A 1ZBE3 4FPLA 4RQPA 1IG3A 5FP3A 3VBFC 4MO3M 3N7JA 2GALA 3OTFA 2PXJA 2IXHA 4CPBA 3AZYA 1K5MA 1W0NA 2ZEWA 3IDEA 2RV9A 4B29A 2LUWA 2KA3A 2WUHA 3ZXEA 2XXZA 1DIWA 5FBZA 2C4XA 2YBKA 4E2GA 1AX0A 3BVCA 4UYBA 5LA2A 1FX5A 1JW6A 3EB7A 3KV4A 5FIXA 1PGW2 2PHRA 4AFBA 3VUOA 3PUHA 1BVP1 1RMU2 5FZ8A 2HWC2 5C8CA 4IUGA 1JYIA 1QJU3 3ZYHA 1JYCA 3B3QE 2P5BA 2ZMLA 3JD73 4QKDA 4RL7A 3O1MA 2Z79A 3RQ0A 2VQAA 2VOTA 2XLFA 3ES4A 3THDA 3ZO0B 3WNKA 1H4GA 1Y4WA 2H0VA 2W1UA 3CF6E 1LODA 3H1YA 4INDA 4ISQA 2WNUB 2Z42A 4PF5A 5T3NA 1W3VA 2NYYA 5FYUA 2JIJA 5DZEA 2P4EA 1GUIA 3K51A 1YEWA 2ZZJA 3AFGA 5DABA 3M3OA 3JUUA 4RA0A 1KXGA 1HKDA 3JU9A 1JYVA 4CDQA 1OUXA 2Y6GA 3WDXA 4DPNA 3MPBA 3QH6A 5F8PA 3N36A 5JXJA 3N35A 4MXWA 3URFA 4XTMA 2W5FA 5FREA 3KM5A 3S57A 1NA1A 1T2XA 5K7PA 2VMIA 1EUUA 4Q0QA 1JYWA 2ZGKA 3PMSA 3ZXDA 2HWE2 1UZ0A 1FNZA 3WNMA 2X5IB 3LPGA 2R073 5A32B 1OI6A 2PQSA 4O61A 1D4M3 3AYDA 4BDVB 1NLSA 3GM8A 5T5JA 1POV0 3WY6A 2PTMA 1LHWA 3I54A 3ILRA 3MW4A 2ZKLA 3LEMA 3NV1A 5E89A 2D98A 3I3DA 4OI4A 1AR91 3M3EA 4Q0SA 2NLRA 4AYUA 1UOJA 1XRUA 2ZA9A 1LU2A 4IESA 1DGRN 2DTYA 2HBUA 2VCMA 1D2QA 1X50A 4WVMA 4X6QB 1POV3 4HN0A 5J48A 5KHKA 2YFUA 1WLCA 3FUQA 4W4ZA 1RITA 4OVEA 1V6KA 4MGZE 3KHBA 5CZKA 4NRPA 2J1VA 4ZU4A 1QNYA 1W8HA 4A7YA 3GYDA 4PT6A 4YW3A 5DDJ2 5FZDA 5JOXA 4P9IA 3A4UA 1SQ4A 2DCTA 4IL7A 2VNOA 4XF9A 4XJWA 1ODNA 3KMHA 1O4ZA 4CCMA 4CUCA 2ZGUA 2VUCA 5CKQA 2X05A 2WJSA 1Q8SA 4J1WA 4F8AA 2BQPA 2CYFA 4P9YA 5DUUA 2KD7A 2HEWF 4AEDC 3WW3A 4IE0A 1LOEA 1NG0A 2VO5A 4PCRA 4GMP1 1QH6A 4YW2A 5IJRA 4PBPA 1UZZA 1V6IA 2ET1A 2LALA 5BNNB 2CY6A 4PLNA 2GC1A 1QDOA 2VZ1A 4PLOA 4UFMA 5FXZA 5JZGA 1IGOA 5JMCA 4EWDA 2J22A 2V5DA 1UY0A 5FYCA 3LDKA 1Z0HA 5F5AA 3LB9A 1YWKA 1CAXB 4MX3A 4Q8LA 3IB3A 2DFCA 1GWKA 2BNMA 1SBFA 4E4DX 2NZ9A 2VR4A 1ULPA 1RUI2 2WAAA 2YBPA 4NPMA 4XJUA 4CU9A 5C3PA 5FK7A 1JU4A 2QTWB 4MGYE 2WNUA 1SFPA 5A3OA 5JSPA 2WIIB 1AL23 3C7HA 2A6ZA 1LHOA 5FZGA 1BMV2 3OBTA 1S0GA 2Y8KA 3VZNA 5C3RA 2WN3A 4HFSA 5BXXA 4A3ZA 4LO7A 1FAYA 3T2QA 5F3IA 2WNEA 1JOPA 5C3SA 4NHKA 2ZX1A 3O0XA 2BJSA 2G1MA 2MPFA 2BOJA 2R041 3M3QA 3U78A 4CUGA 2ZHNA 2VECA 4L9BA 3AP7A 1WW4A 3ELNA 1V6NA 1OBNA 2WRAA 3UNPA 3MZHA 3IIIA 4DRVA 5FYYA 1TMF2 4OI0A 2O0OA 1QOTA 2ZAAA 4KMQA 3THTA 5C5TA 1RMU1 4BJ0A 5I8TA 5DAVA 1W8WA 4KWLA 4M3CF 3LEGA 5J7MA 1DZTA 4XDOA 4D7YA 4QDRA 3UV9A 5L7OC 5L7OB 4L99A 3T3YA 2A71A 4Q1PA 5JXGA 1CPNA 1XNTA 4B4RA 2TEPA 3KGLA 3N9OA 3T2TA 3DXUA 2IZWA 5A33B 1QDCA 4HN1A 3V64A 3S5QA 1ZREA 2VBDA 5LK5A 4CDUB 3M3IA 3ETPA 1RUH2 2VMCA 4LUKA 4Q29A 3N9MA 2JKXA 4W50A 4C1XA 2VVEA 4AXOA 2YG0A 5ACA1 5C9AB 1AR82 3AKPA 3ZN6A 1BXHA 3V0AA 3HAGA 1GZ9A 1FPN2 1IHMA 4IGQA 1JH5A 3KHCA 2YXSA 4GKYA 4QAWA 1XU1A 5A7WA 1S0EA 5JZGC 5F3CA 1SLBA 1OHFA 3RWKX 3SHRA 5F9TA 1ZZBA 4AF9A 2D43A 1KD7A 2Z2SB 4MV2A 4R4ZA 1RC6A 1QMJA 3JXSA 3OPZA 2SBAA 3RZLA 1O3RA 1RUC1 2HWC3 4MYEA 3RZZA 1W0OA 2PHUA 1C5HA 1J58A 4PIZA 4A6OA 5LY2A 5CBLA 2IUWA 1Z7S2 2Z5WA 1WD4A 1DQ4A 3GHMA 4LBQA 3VKMA 4W65A 4MG2A 2BPA2 1BK1A 2BWCA 3OUIA 1M4WA 1QHDA 2BTVC 4URAA 1K5JA 3LOBA 1Q5OA 1W9YA 4LBOA 3H8RA 4NRQA 3N9NA 4DB5A 2E7AA 3RYKA 3USSA 3O1VA 2VMGA 2ZGPA 3HPNA 3CKHA 5F2SA 4N43B 1BQPA 1AR63 4IE7A 4KU7A 2JE8A 2BNOA 2GSYA 4FFFA 3BIEA 1NCRA 4GKXA 3RZGA 1R1A1 3WF3A 3EQEA 4JGYC 4DY5A 1RUD2 2QQPA 2R6QA 2HKXA 1CX1A 4IE4A 1UAIA 2YFZA 5LA9A 4V1PA 1D0GA 3TN92 1C57A 2A6YA 3WNNA 4FBFA 4KI5M 2DCKA 2FCVA 4P9WA 5BNPB 4TWTA 1RUD3 3L2YA 2FBEA 2QKDA 3MIGA 4MGSA 5FP4A 1ZBA1 3IM0A 1PX4A 2EAAA 4XJZA 1J83A 3TAYA 2OW4A 4YGDA 5FY7A 2D6LX 5EP9A 4AVSA 3TRSB 4ORFA 5D21A 2BW8A 1NQDA 4FPJA 5LB6A 4NE9A 3RJRA 3UK9A 1JZ5A 4YZ1A 4LEJA 4PQQA 2DVFA 5M0TA 3AM2A 1UKRA 3FJSA 1HJGA 5FMOS 3MIFA 1S55A 4FPYA 1CESA 1U5IA 4FAGA 1H1MA 1QJX1 4XEZA 3M4FA 4A44A 3PJQA 2Q8CA 4ATFA 4Z8BA 2E33A 1DZRA 4RS5A 4AQ2A 1QJX2 4QPIC 5KHIA 3GCXA 1O6UA 5TSWA 5IK4A 1NY71 4YRDA 1TE1B 1OVSA 5E8AA 3MLKA 3PUIA 2BGCA 2WA3A 5L19A 1Y43B 1GZWA 3AJZA 1QOOA 3VD3A 4A7KA 4PDWA 3RDIA 3NKGA 3WQ7A 1V70A 4QXBA 1ND3C 4RQPC 5J98B 1CZVA 1HN0A 1E5RA 4XILA 1GBGA 4EN7B 2W3JA 1MS9A 4YYOA 5FZ9A 2JENA 4AVTA 1WCKA 1VE0A 2BV4A 1JOJA 1S0FA 4DRRA 4D7SA 1AR71 1OPOA 5LBCA 2EIEA 3ZFGA 2JG9C 2GH2A 4XDPA 1Z7S3 5A7WB 1RUOA 4JCKA 4YVWC 2YC2A 4N90A 4Q4Y3 1A8MA 1E57A 3DUIA 5FK8A 4EN9B 1OQDA 1VBE3 2RJ2A 4QMAA 5EHDA 1C1FA 3ZVXA 4ASMB 5BNOB 4OHYA 1SHWB 2RR13 5GLWA 5C5UA 1KITA 1BZWA 1AXZA 3GALA 4JGYA 4ATEA 2XBO1 3NWKA 5A3UA 2RDQA 2ORZA 4QPGB 1XSRA 4QPGC 1S1AA 3WHTA 4UBHA 1Y7BA 4ASKA 4UW6A 5KC6A 4BCUA 1MVQA 3RZKA 4K9SA 5AC91 1EV13 1AYN2 3WSOA 4R9AA 2BWAA 5H9RA 4I0WB 1SG3A 4RYDA 3MHZA 2W47A 2WT1A 2CDPA 2N7GA 4CCCA 3NNGA 3OY8A 3S0MA 1TVGA 4JDOA 4XMIA 4EQVA 1YCIA 3CL1A 3ZXLA 5JAXA 5LEJA 3RZMA 1FV3A 3OGJA 1M06G 3J8F3 2ZBJA 5A3PA 3FBMA 3KB5A 4AZZA 1UY2A 2YC0A 2JDPA 5LBBA 3V0BA 1LGBA 5A7NA 3KVBA 5FOJB 4A42A 5FTTC 1AUYA 3POFA 3C7EA 3WUCA 2XHNA 1JU3A 5JIUA 1HV1A 3KT1A 4H7MA 2XJTA 3B00A 1OPMA 3LWCA 1ENRA 4LK7A 4XXPA 4PDWC 3VLBB 2BERA 2VVDA 3THPA 3SEPA 1QY4A 3RGBA 1MZFA 4KU8A 5A80A 3KLSA 2R0HA 2Y33A 3PHMA 4O9EA 1XYOA 3E6BA 4B1LA 5CFCC 1JYNA 5DN2A 5F6KA 4PLMA 2J1RA 1GNHA 1VMJA 1RUC2 5ABJA 1W8UA 3POWA 4MUVA 3WQ1A 1RUJ2 4R8HA 2VG9A 3WCSA 4R9BA 3WUDA 3I2FA 3ZFGC 4HVOA 3T4HB 5LCWL 1O4TA 3WP6A 2JE7A 2VNVA 2ZGSA 3KF3A 5HCHA 3GGLA 2WS92 5FUPA 2NM1A 1I6XA 2ZGLA 3LSDA 2CWSA 4IGPA 4LORA 5F2WA 1ZBA2 5FY4A 1MEC3 4A7ZA 3AMPA 3I7DA 4DQAA 3V56A 2JECA 3BODA 4Y1XA 1WMXA 1UZVA 2D6MA 4BXFA 2V09A 1XE7A 4IV3A 1G6NA 1WLWA 1YFYA 2G9GA 3ACLA 3KZ4C 1MVEA 5AFBA 2ZHKA 3WW4A 3A7QA 5EPAA 2BBAA 4QB6A 1MACA 4YSFA 1W6QB 1B35B 2EA7A 3RS6A 3BPSA 2YHJA 4RR3B 1PNFA 3D8CA 2FDJA 3QBQA 3ENRA 2BEOA 2IXIA 4KG0A 1PGL2 1O7FA 4N7UA 4XF3A 5FKBA 1HRV3 2VTXA 1QWRA 2A75A 2GN3A 1BKZA 2WYSA 3S5AA 3ST7A 1NZIA 3OD0A 4O65A 2GNTA 4N43A 3FL7A 1WCDJ 4LO4B 5FV3A 5FZHA 4C0BA 1LESA 2ZCWA 1VBB2 1RUC3 5FZEA 4HSJA 2A73B 4JTOA 3ZYPA 2VNRA 3M8LA 2HYXA 2JJ6A 2ZGMA 4F3JA 2HWF1 3HIFA 3AP9A 3VHRA 3VBSB 1N1VA 2P6CA 1XQNA 3AZVA 3FHAA 4QPIB 5EYXA 4CP0A 4E8CA 1AVBA 4AEJA 4B7EA 5IVEA 4Q2FA 2RS31 1DGWX 1PVC3 5C4WC 5ACA3 5JOWA 2DWRA 2PHDA 2P17A 4GB31 4LMFA 4YM0A 4A2UA 3LPFA 2WDBA 3PUSA 2GC0A 4Y1VA 4YWAA 3SCGA 3PURA 3CZUA 1N3QA 1UWWA 2A7AA 2R072 5FUIA 3WCRA 1DYKA 4YVSC 3S30A 4OI1A 3BU0A 3MEPA 3U07A 3CDZB 5GLUA 3ABZA 3A22A 3Q8FA 4QM9A 2Q8OA 1F35A 5A3WA 2DFBA 4FPOB 1ALYA 4UWDA 1RUE2 4CA9A 1EAH3 2WFF3 1X9TA 1YQCA 2FDIA 1BYHA 1E5IA 3R05A 4HANA 1C8M1 2QQOA 2D93A 3J8F1 3HMYA 3VL9A 5A7PA 1CAVB 3SNMA 1RVF1 3KF5A 2HYKA 4UFKA 5GLTA 1MS1A 2QQNA 1FOD2 3J26N 3J7MA 4XJAA 4E27A 1CAUB 1FV2A 2E7QA 4D6QA 4E4ZA 5C8CB 4MADA 2MHFA 3CMGA 4CP9B 4CUAA 4EN8B 2NPIA 3OYWB 4D6RA 1LOFC 2B9VA 4GALA 1OF4A 3OYWA 1QJY1 1S4CA 4M0HA 2G19A 1HW5A 1PK6C 4OLLA 4Q0UA 1U12A 1BJQA 4BQ3A 2WAOA 5BY5A 2WLPA 3H8XA 1SBEA 2ZEXA 4M00A 1G86A 2R1BA 4J1XA 1WGPA 4S2FA 1OD5A 2A6XA 1RJ7A 4TLGA 4UFHA 5FZBA 4BYYA 4U2AA 1CAWA 1W05A 3CEWA 3K48A 5FYVA 3S7IA 2QQJA 2A1XA 2W52A 1XOYA 4PI2A 1RHI1 5GKAC 3B7MA 3WG4A 1H9PA 2GMMA 3BI3A 2WL1A 4NHLA 3H1WA 2RMU1 1UXXX 2BGPA 1ASJ1 5F5CA 2DBIA 4XBNA 2CL2A 3RWNA 4OQ8A 4PQ9A 2XJPA 3PLQA 3GZUC 2VCCA 4WM7B 4XAEA 4JZRA 2DF7A 1W9TA 3AFKA 4OZXA 2RM22 3LEKA 2E26A 1FMD2 4I3PA 5LA0A 3ZMOA 4YARA 1F4HA 5B2GB 3TOJA 3ZFFA 4ES8A 5FYZA 1VLNA 4YFWA 4J6GA 3CJIB 2IXCA 3D3AA 1RUJ3 2Q1MA 4XQ4A 3SISA 5FOBB 3VB9A 1FATA 1GWLA 4WVWA 1W2UA 2AC1A 3OGSA 4Z82A 2RS52 5FAXA 1GZCA 2IVIB 4P9JA 3K77A 3LSEA 2W1WA 3WF1A 4MZUA 2BFUL 5BNOA 1GP6A 2PELA 2OPWA 3NJVA 4GWNA 4YW7A 4ZKTB 2JXAA 2PN5A 1OKOA 3C7FA 4XXAA 3HN1A 5CFDC 1Y9QA 3PVNA 1UMZA 2J1SA 1VBC2 4Q0VA 1QEXA 3VDDA 4YGCA 1S2BA 3ZSJA 1O3TA 3HQRA 4UI9L 5FLIA 4C91A 5CIRA 3NKTA 3MV11 3WQBA 1CAVA 4MHUA 5C9AA 1OQEA 1OUSA 1RUF3 4OMDA 3ECQA 1NE6A 1MEC2 3H1MA 4UFLA 3T1MA 4FAHA 1PVC1 4AR2A 3LA3A 1W9WA 3B9IA 1JUHA 4JTNA 1PK6A 3RZHA 3HBKA 3BN6A 2VCAA 1KDMA 2JDAA 4H3WA 4RHV1 4C8DA 4EN6B 2RM23 4AHZA 4EROA 1H1AA 4XBQA 4B7KA 3V0BB 2LS6A 2WNUC 3DYOA 3OG2A 3WNPA 4JV4A 1AHSA 4W6XA 3OGRA 4YVSB 3ZX7A 5FY8A 4HLTA 2AR6A 3BKZA 4XFHA 1FXZA 2VZSA 3NJZA 3OOXA 1COV2 3N7LA 4ZU5A 1V9U2 4E4HA 2A3WA 2XOMA 4NVPA 2FDHA 2QVSB 1GOFA 1UPIA 2NMNA 1A8DA 4EYUA 2O14A 1OVPA 3DV8A 2FZ1A 2VW2A 3ZSEA 3ZLIA 3O1OA 1AJKA 1X82A 2FMYA 2WSVA 2LROA 3MIBA 4YM1A 3FLTA 1F8VA 5IVFA 5FRAA 2CGNA 5DXDA 2R30A 1UMIA 5FDBA 1SCRA 5A7OA 2WFPA 3RI9A 4COZA 1S2EA 3VBFB 1YQ6A 2CWMA 2I07B 2VXJA 4GA9A 3I4IA 4QM8A 4XCBA 5FZKA 2XJUA 5K0UA 3PDQA 3SXWA 4QX1A 5A3TA 4Y22B 2R1DA 4BMEA 2VZ3A 3N9QA 1K42A 4XIKA 1W8ZA 2E9QA 1SPPA 2Q1ZB 3N7KA 5BNOC 1SLTA 4JRAA 2RS51 1ULCA 3CIHA 4GB32 1L7QA 2HLEA 1OOPA 1PO23 2ES3A 4X8NA 3ZYRA 1A3KA 4QB2A 5F3GA 2DTWA 4GMP0 1MS8A 2D6PA 3ACHA 3AL6A 4I3GA 3VDDB 1EP0A 3IAPA 5CISA 5FO7B 5JWPA 1PX3A 1ASJ3 1J59A 1CQ9A 4UT5A 1LAJA 2RM21 5EQUA 3POEA 3B93A 4PIXA 4CDWB 4LNVA 1LULA 4UOJA 4TXWA 1UY3A 5A33A 1LRHA 4COWA 4I30A 1HX6A 3AKTA 3NSTA 1RMU3 2D97A 2QDNA 2WT0A 3HNBM 3OB8A 1QJZA 5FKCA 4NIAA 5JOYA 1CAWB 1UO9A 3JQXA 3WQ0A 2QQWA 1KJRA 2C6SA 3B01A 3VBRA 4GH4B 5G05L 4Y26A 3MI8A 1WW5A 2F4PA 2RE9A 2WINB 3AB0A 2Q30A 3ZMNA 2FDKA 1W28A 4NMIA 5FYBA 4Q27A 4W8JA 4XUPA 3OJBA 4KQ7A 1GR3A 4KNCA 4AWDA 4B1MA 3ZYJB 1LKNA 4C90A 3ZYIB 3K2OA 3ZSMA 4M4PA 2YGLA 2YV8A 3CQOA 1WMFA 4FPEA 5EJ3A 2NMOA 1VBC1 1RUI3 3ZFGB 3SH3A 1XNBA 4AHYA 4XC9A 3TNQA 1BEV2 4KL1A 4MGIE 1VJ2A 1W04A 3DCQA 2B45X 5BNQA 2PLV2 2IXJA 4YG0A 4D69A 4FTSA 4Z2WA 1VBD1 2W94A 4DXRA 5D1IA 2TNFA 1JI6A 1W2NA 4UFJA 3ZXAC 2X10A 3C2UA 4JGZA 4EJRA 1G7YA 1BEV3 3S7EA 1Q43A 1SZBA 2VOVA 2DV9A 5CFCB 4FPCA 4NN0A 4O9GA 1J3RA 2RJKA 1OKQA 2ZACA 1R093 2WNOA 4FOWA 1OLQA 4EZHA 4Z1VA 2CGOA 4PDWB 1XPWA 1WCQA 2JEMA 4V2WA 2ZOEB 4D7TA 4P00B 2BUKA 3AVRA 1OC1A 4GQ7A 3OCPA 4XQDA 1VAKA 5FPVA 4RGKA 5I0UA 4CU7A 5FYMA 2QZ3A 4S2HA 4DOUA 4QDQA 1TG7A 2RVAA 3TB0A 3T08A 1UYXA 1OLME 4FXKB 1H30A 1K3IA 2OT7A 3OBRA 4XFBA 4HKOA 1MPXA 4MSVA 5L9RA 2ZEZA 1QJEA 3ZXKA 4CCOA 1D4M2 1CVNA 3NV3A 5EYYA 3K3NA 3TWIA 2K2SA 4URTA 3ZPOA 1DLCA 1H6YA 3NL1A 2BGOA 5DMYA 4UFIA 3VBFA 4ARXA 1MR5A 1W6QA 3AKQA 1N1YA 2NP0A 1UU6A 3HT1A 4DXSA 4QXKA 2AEYA 4HOOA 2WN2A 3RJ2X 3NNMA 4AE2A 2A3YA 5FZ3A 4TYSA 5T5PA 2HWF2 3M3CA 4G4FA 3GHNA 5IWFA 3W59A 3ZFEB 1HDKA 2DDUA 1ODMA 4AI1A 2EAKA 4QPYA 1R1A2 4LHNA 4LT5A 1QQP3 2ID4A 2WR9A 4M01A 3H8UA 4QX8A 2YB7A 4FQ4A 1YJKA 3EXUA 4AFAA 1X8EA 3NW4A 4LOTA 3SITA 4ZZ8A 1ND2C 1E5HA 5EXOA 1O91A 1A78A 4Y20A 4BQWA 1ULGA 5GZDA 1LNSA 3D5OA 1QJU1 1PGL1 1VBA1 4YVSA 1OLRA 5IATA 1PO21 2GNMA 2FZ2A 1UN1A 5DAPA 5KC5A 1QJU2 2J1TA 4FFGA 2OA2A 1N47A 4L8QA 5I0SA 2JWPA 1ZRRA 3KQRA 3VDAA 3DPRA 4Q4Y2 4NPLA 4UW3A 2XLGA 2BP6A 1U0AA 5CAZA 3T0BA 1OF3A 2YY1A 2RS12 4FOQA 4MVTA 3WW1A 4IETA 3KSCA 4NOTA 1V9U3 4N53A 1UX7A 3IIAA 1GP4A 1AL22 3SLIA 4XFIA 3B69A 5FP9A 5FYTA 4Y5Z0 3SQOA 4MGQA 2XVGA 3ZKYA 1DGLA 2BVBA 1UPSA 3WG3A 2HWB2 1VB2A 2WNVC 3ZYFA 5I93A 1GNZA 2AUYA 1L7LA 1UKGA 4JQTA 2AZ5A 4AAPA 5DZFA 2W08A 1GOHA 3GBGA 5JOZA 2W1QA 2WQ4A 3AMNA 4FPHA 2VULA 3NVCA 4UBGA 4CDQB 5C3QA 3LF7A 5I8YA 4GD4A 1GKBA 2R7EB 1OURA 1OT5A 4HONA 5JXIA 1W90A 4NUBA 1ZBE1 5HBAA 1J84A 1WBFA 2E51A 3JD71 4GULA 4HL0A 4XQWA 2I2SA 3RMYA 3BUCA 2ZJCA 2NN8A 4CEYA 3BYWA 5B4NA 4P02B 1MS4A 4JC1A 2QQUA 2WNVB 2XJVA 2WS91 3I59A 4PJYA 3B9CA 3BALA 2VBBA 4LITA 4FTEA 4L0PA 1IOAA 2I74A 1AR81 3R4UA 3VKOA 3ZXGA 2DUOA 2WLQA 5FXXA 2BYVE 3FBYA 2PHWA 3JBG2 1VRBA 1R091 2XUEA 4LPLA 3WF0A 2HWD2 5BNNA 1MQTC 1F5FA 3P3NA 2VM9A 2ZPXA 3IDAA 3R0RA 5F32A 3E6CC 2VE1A 4AI2A 3FLPA 5A70A 3H50A 4LLFA 4JQRA 2VUJA 4CUBA 3TEWA 2UWBA 5FXWA 5A3MA 2CTVA 4IDZA 2XDVA 3RRDA 1BBT2 4MGTA 5FYHA 1YYNA 1PMHX 1H2LA 4YW5A 4WV8A 5FMDA 3Q8CA 1VBA2 2ARAA 5HI0A 3LD8A 2RMU3 2D5HA 4RN5A 1EPZA 5IFPA 5L7OA 5JSRA 2QDRA 1AF9A 5FMCA 4FPGA 1X33A 2EIBA 1Q8OA 4FPKA 4UXAA 1VAVA 1XSQA 1CD3G 2C1FA 5C3OA 4BLIA 3G7DA 4BA6A 1X36A 2DBNA 1SACA 1CJPA 3O1SA 3CJIC 1F5JA 3VV1A 2W46A 1PZ8A 2AREA 3AZZA 4WM7C 4R52A 1QIQA 2C24A 3I8TA 1ZRCA 1US2A 3PNAA 1HV0A 1OOPC 2CNAA 4H55A 4UW4A 3LFMA 4XVHA 1JHNA 1I5PA 2ZZQA 3T0AA 1ULDA 3AXDA 5FP8A 2OS2A 3ZPYA 4OULA 4HPKB 2WNVA 4A6SA 1G8WA 1SFNA 2D6KA 2MEV1 4CCJA 5DDJ3 2ZGNA 5BNPC 4TTGA 4QDSA 3W21A 2JG8A 5FY9A 2QNKA 3LOIA 3F95A 4I09A 5FY1A 1PO22 2WA4A 4CDXA 4EV0A 1X7NA 2XH6A 2XR4A 2PAKA 2XBO2 1K5MC 2D3PA 1JXNA 4AI3A 3VDBA 2DUPA 4BK5A 4DUWA 4AHWA 1GZTA 1LEDA 1XXNA 4DFSA 5JMOA 3PJYA 4RS5B 1CAXA 3KCYA 4LJHA 2GU9A 1ENXA 2VAUA 4CCLA 4U36A 1FT9A 3D6EA 4R9CA 1UOGA 3UYJA 5JDBA 3RFRA 2UWCA 3UT0A 4HXCA 3AL5A 4Y1UA 4P08A 1JOBA 4M3CE 1MQTA 2UYAA 1DLLA 5K9YA 4QQHA 1YI9A 4CYDA 3T4VA 2AH2A 3S6PA 2MEV3 1H4HA 3DF0A 3RMXA 3OUHA 5A6XA 3VKFC 4QX2A 4RGAA 3IT8A 1BEV1 4QHZA 1C8M3 2BNNA 1RUH3 4TZDA 3OF1A 4BQ1A 4ISRA 4FXGB 4QGNA 4CEYB 1CIWA 4AG4A 1PK6B 2FDGA 3WP3A 4CDQC 3AC0A 4Y20B 4AFMA 1WLTA 1US3A 1XC6A 4L2NA 1DYOA 2QZ2A 5FCCA 3VBUB 1JHJA 1JZ2A 3E5UA 1KDKA 4XJ9A 4IEXA 5CEHA 1RHI2 4LIUA 3MF9A 4LBLA 4RHV3 1RUG3 2WO2A 4WVMB 2XHKA 2HEYF 5ISLA 4QHBA 2E63A 4Y5TA 5J36A 4YGBA 3ZN5A 3WLUA 1L3JA 1T6BX 3W58A 2ZAHA 3ACIA 3U1XA 1W3XA 3P6BA 1LHVA 2JDNA 1RYYA 3FFZA 3SKVA 3ACGA 3TEXA 1IG0A 2O8OA 2R063 4QPWA 3ZN6B 3QCWA 3POSA 2ZEYA 3WEZA 3OGGA 1OFNA 1QJY2 5CG9A 3ON7A 1TEIA 4N53B 5GLZA 2GDFA 3RYRA 5KXBA 1W6OA 2DVDA 3MIEA 4LO5B 3MDPA 5BNPA 2QQIA 4P9GA 3SH5A 3MBWA 3LZZA 4JX0A 3UKTA 3MICA 2JG8C 2PHTA 3GNEA 4L11A 3WDYA 3TYJA 5F7UA 1CX4A 3UGFA 2ZABA 2Y38A 1NLRA 1GWMA 4AQ6A 4OUMA 3VBRC 4CDXC 4Q4X2 1TME3 1UU4A 1X9PA 2X8KA 2D6NA 2D3RA 3MV01 3MYXA 3I2HA 4FP2A 4IW3A 5FYIA 2O8QA 4CDWC 4B8EA 2QUOA 3POYA 3OPTA 1NX9A 4YZ3A 3BTYA 1JBCA 1R092 2YU2A 3MGUA 5CKNA 1DU3D 1NT0A 1WWYA 4W6YA 3K46A 4Q0PA 3OPWA 3SMHA 4AI8A 2FDFA 1BLZA 1SPPB 1ULEA 4LA2A 5FZ0A 5HCBA 1SEFA 1SLCA 1ZZ7A 4LXLA 4Y22A 1XNAA 2JB8A 4AK3A 1AL0G 2VC9A 5FO9B 1NXD1 1NXMA 2YC4A 3C7OA 4DMIA 3N9PA 2X5IA 2VL4A 1ZRFA 1YLLA 4AGRA 1I1EA 2PHFA 2WBKA 5DAQA 1E5SA 1V6MA 1JS9A 1SLAA 3VD5A 4R4XA 5ANNA 4Z92B 3L9JT 4FCAA 2VQ0A 1NCQA 1HJFA 1URXA 2QQVA 5F39A 2JDMA 1XNDA 3J7HA 2E32A 3NNLA 2FCUA 4NRMA 1PO12 2KXLA 1VBD3 1F2NA 3VZKA 4P14A 3WG2A 1DQ6A 2KR2A 4RSUA 1RGSA 4XTPA 2VZUA 1AYM2 3M2MA 4Q4V1 4B4PA 2RDNA 4D94A 4XYXA 1B35A 2EICA 4ZS2A 1YRZA 2ZKNA 3CU7A 1H2MA 5FMOL 4A41A 1ND3A 4QWNA 3U37A 4P5YA 1QH7A 2VW1A 4IEOA 1RHI3 5JSOA 2IFWA 1HQWA 5K4LA 5F37A 2UY8A 5FQ0B 4FPFA 3U11A 1W8TA 2DCZA 3AJYA 2JDYA 4XAAA 1P8JA 3GBFA 1ZZ9A 2OKXA 4Q8KA 5CFCA 4EN0A 3IN9A 2Y6KA 3MW3A 3AYCA 2ZGTA 1BCXA 3IDBB 4XCAA 4YVWA 1J1TA 1QJY3 2HWE1 4Q4X3 2B9UA 1W6MA 5B4XA 2VQTA 3ZFFC 5JZGB 4BZ4A 5LA1A 4BIFA 3RG0A 1WMDA 4Y24A 3QD6A 2CHHA 2FD8A 3D4KA 2G4IA 4XABA 2EALA 1LGNA 3OEBA 2Q5TA 4LHLA 4N8MA 2VZOA 2ZX0A 5I8SA 4BQ4A 1GSLA 4CDUA 1QXPA 4F7ZA 4E2SA 1LCLA 5L36A 2VCBA 2XKOA 4CRQA 2L9LA 1W99A 4FOYA 4JHZA 3HNMA 4QU2A 1JN2P 2WQZC 4OYUA 1LB2A 4LQRA 4XHBA 3O1TA 4QXHA 1FMD1 1AR83 3UKNA 2WO3A 3AZXA 3OD4A 4CE8A 1MZ6A 3IPVA 5J1XA 5KR7A 1R083 1UD1A 3LA7A 1EV12 3QACA 5JI9A 5T50A 4LK6A 2IWGB 3SCHA 1VALA 3E6DA 3A0KA 3HR9A 4N53C 4CDXB 5I91A 2R32A 2WABA 3P3PA 5AC93 1UZWA 3ZSLA 1NCQC 4WM7A 3VBSA 2MEV2 3WT3A 2Y0IA 1HIXA 4S2GA 5IVVA 2PQQA 4RFRB 3PUAA 2W0XA 3NO8A 1V6OA 1AXYA 1CN1A 3VD4A 2D40A 2G9FA 4FP3A 1O4YA 4AGVA 3VZMA 2P1BA 2ZX4A 3FLRA 3LIGA 2VZRA 4IEQA 5A1AA 1QJX3 3EO6A 4XFAA 5SV8A 1WKYA 2VZVA 3MPPG 1IS4A 2XG3A 4YLZA 1H9WA 4XIOA 4JAAA 2HEVF 2R0FA 4GIQA 4QX3A 5EJZB 1WUVA 5FPXA 1VBD2 5FZCA 1VBC3 4D0QA 1V0AA 1ENSA 1NCRB 4JGYB 5FFOC 1O3SA 2XJSA 1VRH2 1ZX5A 1AYN1 3CNAA 4Q4X1 1W9SA 2ARCA 1HXS2 5IVJA 3VD7A 3JB4C 1ZA4A 5E6HA 2Y34A 3FHQA 3NAPC 1WA4A 3ILNA 3NAPB 4H2AA 4MXWB 1UU5A 1ZM1A 4GXLA 4FSJA 2RMU2 3FWEA 4AEKA 4BWOA 5FPBA 1DDLA 3LQCA 4CP9A 1W8OA 3OUJA 3VHNA 5AVPA 3FC0A 5IHRA 2D6OX 2EVXA 1LOAA 3PUQA 5IK7A 1W6PB 3AX4A 3VBRB 3VDCA 4A4AA 1APNA 5H9SA 3C7GA 4YW6A 2A70A 2GAUA 1IS3A 4KWUA 4WM8B 4XZPA 1I9RA 1XNKA 5FZIA 1AZDA 3WVJA 3VZLA 1VAMA 1AR62 3WV6A 3JBG3 5LK7B 1G9DA 5E88A 2WZEA 3N7MA 4Q1RA 4K1YA 5ABJB 1UX6A 1N1SA 3L2HA 4QKBA 2JDHA 2YGMA 3I2OA 2Y6LA 1O8SA 3WX5A 3VBOB 2ERFA 2TUNA 1DBNA 4WVVA 1LOFA 2E53A 4YVWB 3WXPA 4NHYA 1IZ3A 1PGSA 3H3UA 3MLJA 5FZLA 1LHUA 4PI0A 1B09A 3FHIB 4X6RB 3ZN4A 3VBHC 3VBSC 1G9BA 3O1UA 2VUDA 2YYOA 2WS93 4L97A 2WZR2 4LHSA 1HB2A 1KRIA 1LU1A 1UMHA 3IZOA 4CXYA 4B3NA 4NIGA 4LBJA 4K1ZA 3NV4A 2DCYA 1ND3B 5IVYA 2WWJA 3PVOA 4F83A 3HEIA 1SMVA 3MFCA 1SFYA 1S0DA 2ENRA 5T52A 3JBG1 4QT6A 2WYFA 3HWJA 3OBZA 5LASA 3DXTA 1I3HA 2WO7A 2G9ZA 4IEYA 3FN9A 4BB3A 1N1TA 1RUF1 2PAMA 5BV6A 3D0SA 3LKJA 1S0JA 4OUSA 2JG9A 4FFHA 2FMDA 4QGLA 5LRSA 1EPWA 5DUXA 3B94A 2JG9B 3FE5A 1FI2A 4XACA 1POQA 4G9SB 3W5NA 5DG1A 1T6GC 1DYPA 1Q56A 2CU5A 4NWVA 4HVRA 2ZHLA 2ADEA 4BOWA 5IK8A 1STMA 5KBFA 5FZ6A 1ONAA 1I5ZA 1QXJA 3DEMA 1WLDA 2WKKA 2ZX2A 1ZZCA 4QPGA 4XE9A 1PIV2 1PM7A 3GZAA 4BQ2A 2XQRA 1QGLA 3HVDA 5GM0A 5C8CC 5AC92 3WDVA 3BOWA 1CWPA 1RINA 2DU0A 3A0NA 1V6LA 2LTNA 3ES1A 2VMEA 2VTFA 3A23A 1HRI3 4FO9A 4RHV2 1H8VA 4R9DA 4IEPA 3VKNA 3VHOA 1DP0A 4CVUA 2EXJA 4M4RA 3WP4A 4JKLA 3HBZA 5FZFA 4YZ5A 4LKSA 3VZJA 4AI0A 4I01A 2RR11 5HCFA 3ORJA 5KXEA 2VNGA 3E1F1 1LENA 2RS32 4Y1YA 4V2VA 2A5ZA 2ARBA 5C9AC 3RYPA 1W8FA 5I0DA 5C6CA 1Z7S1 3ALQA 3WINE 3PIJA 3WZ1A 2UYBA 3EBRA 4MOAA 4AOCA 2DVGA 4HVQA 1YO8A 3WNOA 2EXIA 4PF1A 1H8TC 1VBB1 1CZTA 2J1UA 3IMMA 5LW9A 5I0TA 5FQ0A 2VVFA 3W9AA 3N9LA 3UGHA 1AX2A 1XB9A 2PHLA 1SDWA 2O1QA 3POGA 2WQ8A 2P3YA 4N9HA 4UF0A 1UXZA 2BDRA 4CEYC 3USUB 4GMP3 5ERLA 1CJDA 3BGAA 1SLIA 3WP5A 5IVBA 3KT4A 5GALA 1XE0A 1UW8A 3M70A 1EUTA 1D4VB 3ITQA 5FZ1A 3J7LA 5F3EA 1N3PA 1TME1 2B46X 3MFAA 3LIHA 4BQXA 1BVVA 2VOKA 3SEEA 3GJBA 3WDTA 1PIV1 3AMMA 4XUTA 3UESA 5J37A 3KD4A 4L92A 4QX5A 5JR7B 5IAXA 2XL7A 1OXCA 4W6WA 4CU8A 1N3OA 2XQXA 1JZ8A 4IE5A 4JVAA 1PMIA 5EZWA 5C70A 1LGCA 1HLCA 4YW1A 1YI7A 1NCRC 3I59B 2ZGQA 2W95A 4QD2A 1PZ7A 1O5UA 4IERA 3CBNA 2YPJA 4NR1A 3DPRC 3ZR6A 2WFF1 2Z69A 1UZYA 4JRLA 4COUA 1RUF2 4E4SA 4AFCA 4UAPA 4LBQD 3KQ4B 3UL2A 1CGPA 2B7YA 3E97A 4FFIA 4KWKA 2WT2A 3X29B 4AVBA 5C7GA 3BTAA 5EFUA 1KJLA 2WC2A 1H2KA 3TN91 3EJKA 1XBFA 1QQP1 4Q4W2 5HXMA 2VZTA 5FLJA 2R043 3THCA 5A1LA 1VRH3 4QQLA 2VOXA 3CJIA 3O14A 3U4SA 3NRUA 2BOIA 4LBNA 4OCTA 3U0ZA 4K8FA 1NAEA 3KGZA 4K21A 2ILMA 4QQPA 1RJ8A 2R16A 1VP6A 5FPZA 1GMMA 4YNIA 1DHKB 2BFUS 3NNJA 1PO11 5KHHA 5I0RA 1FNYA 1HB3A 2AGSA 2PLV3 3NV2A 5LZ6A 2D5FA 3AYAA 4AEDB 4QB1A 2V4VA 4AAXA 2JD9A 3J8F2 1MZ5A 4RS5C 1KFXL 3NQHA 3PVEA 2VD7A 2J42A 1DG6A 4RD7A 5HV4A 3M7AA 4WZCA 3I2KA 2FQPA 4YPJA 2DUQA 1YNAA 4BLJA 3PIGA 5CADA 3E5QA 3G6JB 1O5LA 1TME2 2OX0A 5IAVA 4RQPB 4GB33 2ZXQA 4JGZB 2XWBB 3C3VA 1HRV1 2K9ZA 1DQ5A 2JDUA 4TN7A 4Q26A 4Y4RA 3O0VA 4YG3A 5DQ0A 3V0AB 1Q8VA 2PAEA 1R082 2XKPA 1D7PM 1JZ4A 1CPMA 2QE3A 1RB8G 1GNYA 2VW0A 1OD3A 4IV1B 1WW6A 1JZ7A 2XONA
chains in the Genus database with same CATH topology
4YFZA 1XE8A 3JD72 5AVAA 2VXRA 3WR0A 4JGZC 2CV6A 1C4RA 4MLOA 2RS33 4KGGA 3ZYGA 4CP1A 1VRH1 2IXLA 3KCXA 4DY3A 1RUD1 1TMF3 1ASJ2 3HQXA 4WM8A 2HWF3 3IBMA 2EXKA 1WMEA 4JDMA 5F1RA 4LE4A 5A32A 4AEDA 3H3ZA 1H8TB 1HRI2 4MH0E 1W39A 2RS13 2JE9A 3WG1A 2VU9A 2R061 4SBVA 3TNPB 1NCQB 2RS11 1CONA 1DFQA 1YUDA 3VN4A 2WFF2 2DVBA 2Q0AA 1U5ZA 2ZMKA 3WNXA 1IPKA 1S0CA 3UKVA 2IFRA 3B5LB 3EHKA 1REFA 3ETQA 2UURA 1PIV3 1GQGA 4OI2A 5GJ6A 1RUNA 4YW4A 1H2NA 3O12A 3H7JA 1ZRDA 1F31A 4N9IA 2OVUA 3GBWA 2WZR1 4NWWA 4YGEA 5H9PA 3USUA 1RVF3 2V5YA 3FX3A 3ZXFA 4META 2Y0OA 2XVKA 2JKBA 4K7JA 4LO8A 2DCJA 2VPVA 5T55A 4IEVA 4IEZA 4S2DA 1GICA 1DZQA 1NQJA 2GZWA 2YROA 1NOVA 3RNSA 2XBO3 1JTZX 2KM2A 4RGGA 2A6WA 3BCWA 3DL3A 5CFDB 3IPVB 2XWJB 2PFWA 5CVRA 4ONUA 4IQPA 4HKWA 5JI7A 3HD8B 1PO13 1C5IA 1ZZ8A 4LBKA 1HXS3 2XB6C 2C0ZA 5DUWA 1PNGA 4HBNA 3FZ3A 2YDEA 5CG8A 5F5QA 4P9XA 1GZWB 5L73A 3QLQA 2A3XA 3D82A 3R4SA 4XPVA 2YZ4A 3H0OA 1NA1B 1QNWA 4FT8A 1YFWA 3ME2A 1IS5A 5J3UA 4WVZA 3CJXA 2E6VA 4JDNA 4DZGA 1EY2A 3UJOA 4ZXKA 1A6CA 1NE4A 2DURA 5DUVA 1Q8PA 4P9LA 3ZFEC 4AVTA 1B35C 4QPIA 1GFF2 1PHMA 5C8WA 3J9SA 1G9CA 4EWAA 5EWSA 3ZIWA 3ASIA 2W39A 1UF2C 1EV11 5HXVA 5IK5A 1HXS1 3MW2A 4FOVA 2ARXA 2OUHA 1MS5A 1FPN1 4B4QA 2XLAA 2NQYA 2D3SA 5BNNC 2OUJA 1LECA 1S0IA 5C4WB 2DVAA 1ND2A 4RR3C 4LR4A 1AX1A 4FQZA 4UW5A 1JUIA 2XGXA 5T5OA 3FMGA 4M3CB 1TNRA 2GC2A 2R062 4ZU7A 2H0BA 1LR5A 1J1LA 2VUAA 5CNAA 4CEWB 4KH9A 1OA3A 1QF3A 1ZYBA 2BVVA 4CTEA 3IKWA 2WWSA 2DU1A 4HPKA 4ASLA 1C3HA 5SV5A 1V00A 2XUMA 3AXEA 3ZSKA 4BMBA 2JX9A 4MGKE 5CU1A 4XETA 5KXDA 1W0PA 3M1HA 3BOPA 1AR61 2QFEA 1C8M2 3JZVA 1VIWB 2D44A 3KT7A 4TLFA 5LRRA 4KBBA 1RUE1 1LTEA 3DGTA 5FLHA 3JCIA 4X8PA 1CAUA 4LE3A 1IKPA 4AVAA 4COVA 2WZR3 1OA4A 1MEC1 2H6CA 1H8TA 3AP5A 2R071 2P3KA 5FO8B 4Z07A 2R49A 3D0JA 4AVCA 1OQ1A 4A3XA 1C1LA 4LLOA 1YXWA 4HT1T 1VB4A 1IKQA 3PMEA 4QGMA 1W6NA 2XJQA 3ZXJA 4LULA 1KS4A 4XBLA 5GZEA 1DQ1A 1AR93 4CZSA 2RS53 1O3QA 4ES9A 3VKLA 1MS3A 2A6VA 3LGRA 1W6MB 4HMZA 5AFEA 3IMNA 4HSLA 4Y1ZA 1RUG1 2P3IA 1ZZ6A 4HZFA 1VBA3 3WDUA 4FVVA 5ABJC 1NZCA 1R1ZA 3VBUA 2VMHA 3IDCB 1G9AA 4Q4V3 3ROUA 2HWC1 1REDA 5D8AC 5D8AB 5GZGA 4YZ2A 4DNYA 1FMD3 3ATGA 1ULFA 4CEWA 3LAGA 4BPZA 3TBDA 1YHFA 4YZ4A 5T5LA 1LEMA 4PIYA 1ENQA 1RVF2 1U5XA 1YIFA 1MZEA 4YG6A 4AEMA 2AENA 3R4DB 2ZGOA 2W68A 4I0AA 1REEA 3J4UH 1DF0A 2BBVA 1NY72 4AGGA 1ND2B 1WCSA 1J3QA 1K5MB 3MF6A 1BBT3 1WBLA 1J3PA 5HCAA 2HWE3 1FPN3 3DPRB 4BH9A 3IWZA 3FFQA 1G9FA 3WHUA 2VY0A 3BB6A 2P34A 5DG2A 1GANA 2I45A 1FOD1 4TSVA 3T1LA 4IEWA 1AYN3 4OHWA 1EYBA 1HQLA 2UY9A 1COV1 1HQNA 5C4WA 4IV1C 3RSJA 3DN7A 2ZMNA 4LA3A 4OFGA 4XF0A 3MIDA 5BYNA 1LOCA 2RR12 2B8MA 3O0WA 3ILFA 5JVVA 3AYEA 4XFFA 1RUJ1 2X5IC 3KCCA 4OHXA 1POV1 1RTVA 2HWB3 1S0BA 1PVC2 2B5HA 1EAH1 2E7TA 4GH4A 1W6OB 3RPQA 1DQ0A 1U5YA 1YFXA 2UWAA 5D8AA 4OHZA 2EXHA 1FOD3 4EWEA 2Q4SA 1D0HA 1GLHA 4CEWC 4Q4Y1 1VBB3 1VBE1 3GF6A 3QH7A 5A3LA 1BBT1 1AR73 3PTYA 1Q8QA 1OSGA 4XHXA 2GNBA 1GV9A 3RI8A 1VR3A 3O5SA 4AFDA 1DQ2A 2JD4A 4IV3B 3SH4A 5F6LB 1AXKA 1H1IA 1HRV2 3WOGA 2OPKA 2XL9A 1COV3 2ET7A 5DDJ1 4I02A 1IS6A 4XF4A 4QQOA 5KHJA 1WW7A 4HETA 1ZVFA 4CP2A 5T54A 2FHRA 4LUMA 2ZX3A 2V73A 1MS0A 3U4XA 3WD5A 3APBA 4HKLA 3GZTB 4XF1A 4Y4YA 3CLPA 3HT2A 4Q4W1 2Y26A 1CR7A 4M0NA 3KS7A 2ETEA 4AQSA 3VZOA 1QXRA 5GZFA 4IV1A 2GN7A 1W6NB 2HWB1 1XNCA 2X29A 4DINB 2ATFA 5C33A 1D2SA 1V6JA 1YJLA 2EF6A 2XVLA 5CB7A 1HRI1 2UU8A 1W6PA 2GMPA 3AMHA 2GNDA 4LBMA 1SLLA 1RL3A 4GH4C 5KWRA 3VGIA 2VGDA 2GH8A 4WBBA 2K0GA 1Q3EA 5CFDA 1UIKA 1NA1C 1OOPB 4KG8A 4XDQA 4AHXA 2P37A 2IXKA 4AQTA 5IUQA 1TQ5A 4M3CA 2CAVA 3N4MA 3B02A 1UIJA 2ZHMA 3V65A 5H9QA 4K3UA 4ITCA 4XJ8A 3ZFEA 3AP4A 2ZS6B 4H14A 1QKQA 5JLVA 3VHPA 3WW2A 5BUVA 2YUEA 4D3WA 4RFT0 1AR72 1PZ9A 2HWD3 1OFSA 1C8NA 4P5HA 2B39A 2JDZA 2DYCA 3MIHA 4AVVA 5BPXA 1PGW1 2LM3A 2CAUA 2OZ6A 4DS0A 4BHPA 1SCSA 2D7FA 4RR3A 5J96B 1RUE3 2JICA 4XFCA 1S2KA 2QJVA 2SLIA 1VBE2 3E5XA 2VH9A 2YMZA 2RHPA 3AK0A 1QU0A 4CDUC 3AKSA 2GC3A 4KWJA 3DKWA 1YIPA 1TNFA 3VBUC 3ZIXA 1PVXA 1XYNA 2XPJA 1RUG2 2TBVA 1QQP2 2JG8B 1OA2A 1R1A3 2ZGRA 1XYPA 1Z78A 3LCPA 4N7IA 4PBOA 3AZWA 3ZDSA 1AL21 5ACA2 5CA6A 5K0UC 5J09A 5K0UB 3JQWA 4C0HA 2C9AA 5E16A 5JPMB 4IV3C 3U10A 3QOPA 5JCTA 1IPJA 3MLLA 4HK8A 4LTAA 3PVBB 3VBOA 5DZGA 2WSUA 3VDDC 1KS5A 1RUI1 5LEKA 1R081 1KFUL 2PLV1 4BE3A 3VBHA 4NO4A 2AYHA 4C1WA 3BPZA 4LHKA 5IT6A 4GWMA 1EAH2 4WZFA 4BIOA 3LA2A 1AYM3 5E1RA 4DXZA 5GLVA 1DGRA 4N43C 1UL9A 1UCXA 4YM3A 5K8SA 5KHGA 4FTBA 2PA7A 4IXLA 1LHNA 2HWD1 2C5DA 2R042 3WDWA 1RUH1 4Q4W3 1WD3A 5JIAA 2X53S 4CDWA 1NYWA 1ZNPA 1Y3TA 3VL8A 3JB8A 3NAPA 4I0BA 4NHMA 4I2OA 3H7YA 5GZCA 1D4M1 1GYKA 1BMV1 3OY8B 4Q4V2 4K6BA 4BM8A 2PYTA 1AJOA 3TN93 1MQTB 2OIIA 1ZBE2 2GMEA 3H9AA 4COYA 2OYZA 1RIRA 1LOBA 1C28A 3Q9OA 2WZPP 3CO2A 5EV7A 4YM2A 3AP6A 4KGQA 4IEUA 4XFGA 1OMIA 1IQAA 4HK9A 2QCSB 1V9U1 4NPRA 1XU2A 4SLIA 4LBQB 4QQ2A 1AR92 4WM8C 2PHXA 1DGWA 2F6BA 3AKRA 3VBHB 5JPNB 1SBDA 1YFUA 3AMQA 3BIWE 2HJIA 1KQRA 2OZJA 2XJRA 4E9KA 1AYM1 2EIGA 2H6BA 3I2DA 4XW3A 3N3HA 2MNGA 3FUOA 3O7OA 3VBOC 1H0BA 3ZFFB 4AW7A 1LJ7A 3UJQA 5KXCA 2P3JA 4MXVA 1QOSA 3BU7A 1F9KA 4H7LA 4K40A 1GQHA 4E2QA 2CGPA 1ZBA3 4XMAA 2IC1A 3R6SA 1TMF1 1LOGA 4OHVA 3INAA 2ZTNA 1X8MA 2B42B 2VOWA 4G3YC 2RJLA 4LO6B 1FYUA 2P2KA 4K20A 1ZBE3 4FPLA 4RQPA 3VBFC 3N7JA 2GALA 3OTFA 2IXHA 3AZYA 1K5MA 3IDEA 4B29A 2LUWA 2KA3A 3ZXEA 1DIWA 5FBZA 4E2GA 1AX0A 1FX5A 1JW6A 1PGW2 2PHRA 4AFBA 3VUOA 1BVP1 1RMU2 2HWC2 5C8CA 1JYIA 1QJU3 1JYCA 3B3QE 3JD73 2ZMLA 4RL7A 2Z79A 3RQ0A 2VQAA 3ZO0B 2XLFA 3ES4A 1H4GA 2H0VA 3H1YA 3CF6E 4INDA 1LODA 4ISQA 2WNUB 2Z42A 4PF5A 5T3NA 2NYYA 5DZEA 3K51A 2ZZJA 3AFGA 3M3OA 3JUUA 4RA0A 1KXGA 1HKDA 3JU9A 4CDQA 4DPNA 3WDXA 3MPBA 3QH6A 3N36A 3N35A 4MXWA 3URFA 4XTMA 5FREA 3KM5A 1NA1A 5K7PA 2VMIA 4Q0QA 2ZGKA 3PMSA 3ZXDA 2HWE2 1FNZA 2X5IB 2R073 5A32B 1OI6A 1D4M3 3AYDA 1NLSA 5T5JA 1POV0 3WY6A 2PTMA 1LHWA 3I54A 3ILRA 3MW4A 2ZKLA 3NV1A 5E89A 2D98A 4OI4A 1AR91 3M3EA 4Q0SA 2NLRA 4AYUA 1XRUA 2ZA9A 1LU2A 4IESA 1DGRN 2DTYA 1D2QA 1X50A 4WVMA 4X6QB 1POV3 4HN0A 5J48A 5KHKA 3FUQA 1WLCA 1RITA 4OVEA 1V6KA 4MGZE 4ZU4A 1QNYA 4A7YA 3GYDA 4YW3A 5DDJ2 5JOXA 4P9IA 3A4UA 1SQ4A 2DCTA 4IL7A 2VNOA 4XF9A 4XJWA 3KMHA 1O4ZA 2ZGUA 2WJSA 1Q8SA 4J1WA 4F8AA 2BQPA 2CYFA 4P9YA 5DUUA 2HEWF 4AEDC 3WW3A 1LOEA 1NG0A 4PCRA 4GMP1 1QH6A 4YW2A 4PBPA 1UZZA 1V6IA 2ET1A 2LALA 5BNNB 2CY6A 4PLNA 2GC1A 1QDOA 4PLOA 5JZGA 1IGOA 5JMCA 4EWDA 1Z0HA 3LB9A 1YWKA 1CAXB 4MX3A 4Q8LA 2DFCA 2BNMA 1SBFA 4E4DX 2NZ9A 4XJUA 5FQ0A 1RUI2 4MGYE 2WNUA 5JSPA 2WIIB 1AL23 2A6ZA 1LHOA 1BMV2 3OBTA 1S0GA 3VZNA 5BXXA 4HFSA 4LO7A 1FAYA 2WNEA 4NHKA 2ZX1A 3O0XA 2MPFA 2R041 3M3QA 2ZHNA 2VECA 4L9BA 3AP7A 1WW4A 3ELNA 1V6NA 3MZHA 4DRVA 1TMF2 4OI0A 2O0OA 1QOTA 2ZAAA 3THTA 1RMU1 5I8TA 4KWLA 4M3CF 5J7MA 1DZTA 4D7YA 3UV9A 5L7OC 5L7OB 4L99A 2A71A 4Q1PA 1CPNA 4B4RA 2TEPA 3KGLA 3T2TA 2IZWA 5A33B 1QDCA 4HN1A 3V64A 1ZREA 5LK5A 4CDUB 3M3IA 1RUH2 4LUKA 4Q29A 5ACA1 5C9AB 4C1XA 2VVEA 4AXOA 3V0AA 3AKPA 1AR82 3ZN6A 1BXHA 3HAGA 1GZ9A 1FPN2 1IHMA 1JH5A 2YXSA 4GKYA 1XU1A 5JZGC 1S0EA 1SLBA 1OHFA 3SHRA 5F9TA 1ZZBA 4AF9A 2Z2SB 2D43A 1KD7A 4MV2A 4R4ZA 1RC6A 1QMJA 1O3RA 3OPZA 2SBAA 1RUC1 2HWC3 4MYEA 3RZZA 1W0OA 2PHUA 1C5HA 1J58A 4PIZA 5CBLA 4LBQA 1Z7S2 2Z5WA 1WD4A 1DQ4A 3GHMA 3VKMA 4W65A 2BPA2 1BK1A 2BWCA 1M4WA 1QHDA 2BTVC 3LOBA 1Q5OA 4LBOA 4DB5A 2E7AA 3RYKA 3USSA 2VMGA 2ZGPA 4N43B 1BQPA 1AR63 4KU7A 2BNOA 2GSYA 1NCRA 4GKXA 1R1A1 3EQEA 4JGYC 4DY5A 1RUD2 2QQPA 2R6QA 2HKXA 1UAIA 4V1PA 1D0GA 3TN92 1C57A 2A6YA 4FBFA 2DCKA 4P9WA 5BNPB 4TWTA 1RUD3 3L2YA 2FBEA 2QKDA 3MIGA 1ZBA1 3IM0A 2EAAA 4XJZA 3TAYA 2OW4A 4YGDA 4AVSA 2D6LX 3TRSB 4ORFA 2BW8A 1NQDA 4FPJA 3UK9A 3RJRA 4YZ1A 4LEJA 2DVFA 3AM2A 1UKRA 3FJSA 5FMOS 3MIFA 1S55A 4FPYA 1CESA 1U5IA 1H1MA 1QJX1 4XEZA 3M4FA 3PJQA 4ATFA 4Z8BA 4AQ2A 1DZRA 4RS5A 1QJX2 4QPIC 5KHIA 5TSWA 5IK4A 1NY71 4YRDA 1TE1B 5E8AA 3MLKA 5L19A 2BGCA 2WA3A 1Y43B 1GZWA 3AJZA 1QOOA 4A7KA 4PDWA 3RDIA 3NKGA 3WQ7A 1V70A 4RQPC 1ND3C 5J98B 4XILA 1GBGA 4EN7B 1MS9A 4YYOA 2JENA 1WCKA 1JOJA 1S0FA 4DRRA 4D7SA 1AR71 1OPOA 3ZFGA 2GH2A 2JG9C 1RUOA 1Z7S3 4JCKA 4YVWC 4N90A 4Q4Y3 1A8MA 1E57A 3DUIA 4EN9B 1OQDA 1VBE3 4QMAA 1C1FA 3ZVXA 4ASMB 5BNOB 4OHYA 2RR13 5GLWA 1KITA 1BZWA 1AXZA 3GALA 4JGYA 4ATEA 2XBO1 3NWKA 4QPGB 4QPGC 1S1AA 3WHTA 4UBHA 1Y7BA 5KC6A 4UW6A 4BCUA 1MVQA 4K9SA 5AC91 1EV13 1AYN2 4R9AA 2BWAA 5H9RA 4I0WB 2WT1A 2N7GA 3OY8A 3S0MA 4JDOA 4XMIA 5LEJA 1YCIA 3CL1A 3ZXLA 5JAXA 1FV3A 3OGJA 1M06G 3J8F3 2ZBJA 3FBMA 3KB5A 2YC0A 3V0BA 1LGBA 5FOJB 5FTTC 1AUYA 3WUCA 5JIUA 1HV1A 3KT1A 4H7MA 3B00A 2XJTA 1OPMA 3LWCA 1ENRA 4XXPA 4PDWC 3VLBB 2VVDA 3THPA 1QY4A 1MZFA 4KU8A 3KLSA 2R0HA 3PHMA 4O9EA 5CFCC 1XYOA 3E6BA 5F6KA 4PLMA 1GNHA 1RUC2 5ABJA 3POWA 4MUVA 3WQ1A 1RUJ2 4R8HA 2VG9A 3WCSA 4R9BA 3WUDA 3ZFGC 4HVOA 1O4TA 3WP6A 2JE7A 2ZGSA 2WS92 2NM1A 1I6XA 2ZGLA 3LSDA 2CWSA 1ZBA2 1MEC3 4A7ZA 3AMPA 3I7DA 4DQAA 3V56A 2JECA 3BODA 4Y1XA 2D6MA 2V09A 1XE7A 4IV3A 1G6NA 1WLWA 1YFYA 2G9GA 3ACLA 3KZ4C 1MVEA 5AFBA 2ZHKA 3WW4A 1MACA 4YSFA 1W6QB 1B35B 2EA7A 3RS6A 2YHJA 4RR3B 1PNFA 3D8CA 3QBQA 3ENRA 2BEOA 2IXIA 4KG0A 1PGL2 1O7FA 4N7UA 4XF3A 1HRV3 1QWRA 2A75A 2GN3A 1BKZA 3ST7A 3OD0A 2GNTA 4N43A 4LO4B 1WCDJ 4C0BA 1LESA 2ZCWA 1VBB2 1RUC3 4HSJA 2A73B 4JTOA 3ZYPA 2VNRA 3M8LA 2JJ6A 2ZGMA 4F3JA 2HWF1 3HIFA 3AP9A 3VHRA 3VBSB 1N1VA 3AZVA 1XQNA 4QPIB 5EYXA 4CP0A 1AVBA 4AEJA 4B7EA 4Q2FA 2RS31 1DGWX 1PVC3 5C4WC 5ACA3 5JOWA 2DWRA 2PHDA 2P17A 4GB31 4YM0A 4A2UA 2GC0A 4Y1VA 3SCGA 1N3QA 2A7AA 2R072 3WCRA 1DYKA 4YVSC 3S30A 4OI1A 3MEPA 3U07A 5GLUA 4QM9A 2Q8OA 2DFBA 4FPOB 1ALYA 1RUE2 1EAH3 2WFF3 1BYHA 3R05A 4HANA 1C8M1 2D93A 3J8F1 3HMYA 3VL9A 1CAVB 3SNMA 1RVF1 5GLTA 2HYKA 1MS1A 1FOD2 3J26N 4E27A 4XJAA 1CAUB 1FV2A 2E7QA 4E4ZA 5C8CB 2MHFA 4EN8B 2NPIA 3OYWB 1LOFC 4GALA 3OYWA 1QJY1 4M0HA 4OLLA 1HW5A 1PK6C 4Q0UA 1U12A 1BJQA 5BY5A 2WLPA 1SBEA 4M00A 1G86A 2R1BA 4J1XA 1WGPA 4S2FA 1OD5A 2A6XA 1RJ7A 3SCFA 3USUB 4BYYA 4U2AA 1CAWA 3CEWA 3K48A 3S7IA 2W52A 1RHI1 5GKAC 3B7MA 3WG4A 1H9PA 2GMMA 2WL1A 4NHLA 3H1WA 2RMU1 1ASJ1 3RWNA 4XBNA 2CL2A 4PQ9A 2XJPA 3PLQA 3GZUC 4WM7B 2DF7A 3AFKA 4OZXA 2RM22 1FMD2 4I3PA 3ZMOA 4YARA 5B2GB 3TOJA 3ZFFA 4ES8A 1VLNA 4YFWA 4J6GA 3CJIB 2IXCA 1RUJ3 2Q1MA