2ET7A

Structural and spectroscopic insights into the mechanism of oxalate oxidase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
201
structure length
201
Chain Sequence
SDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMARVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxalate oxidase 1
publication title Structural and spectroscopic studies shed light on the mechanism of oxalate oxidase
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Oxidoreductase
total genus 46
structure length 201
sequence length 201
ec nomenclature ec 1.2.3.4: Oxalate oxidase.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2et7A00
3HT2A 5I0RA 3MZHA 3IIAA 2ATFA 2D93A 4PIZA 5BUVA 4XF3A 3HQXA 1CAWA 1ZRDA 1ZREA 3DV8A 4MGIE 5I93A 1J58A 2ETEA 1OFNA 1CAUA 2OA2A 4Q0VA 4XETA 1O5UA 2CV6A 4AVBA 2ZCWA 2GC0A 2GU9A 4QXKA 3E5QA 2EVXA 5EZWA 1Q5OA 4I01A 2UY9A 3I59A 4LEJA 3ES4A 3G7DA 4X6RB 2GC2A 1SFNA 3WW2A 3ETQA 4I2OA 4R52A 2GZWA 2IXHA 1CAXA 4H7LA 4OLLA 5KHHA 5KHKA 3U0ZA 3O14A 4WZCA 5I0UA 5D1IA 3H1YA 3MPBA 2PHDA 3CJXA 3S7EA 1VJ2A 2MHFA 2KXLA 4QGMA 3LA3A 4WVZA 4D7TA 2XLAA 1I5ZA 2D5HA 3H1WA 4QM8A 4XFFA 3WW1A 4EWAA 2IXIA 3SXWA 3NSTA 3UKNA 4XF9A 4XFIA 4XFBA 1UW8A 2VQAA 2VPVA 2B5HA 4HVQA 1H1MA 3C3VA 1ZZ7A 2E9QA 4PJYA 3M3IA 4MGYE 1OMIA 4IEWA 4XF0A 4I02A 4QMAA 2OZJA 3CL1A 4Q0PA 4E2QA 1YFWA 4ONUA 2HKXA 5BPXA 3FJSA 4QGNA 5JSRA 4KL1A 5I8TA 2UYBA 3BPZA 4AXOA 1YWKA 1UIJA 3OF1A 2PAEA 2F4PA 3LOIA 1V70A 1YFYA 2H0VA 2Q30A 2XLGA 4DINB 3WW3A 1HW5A 4NVPA 3ROUA 1NE4A 1UIKA 3QACA 4XFGA 1UPIA 1YLLA 2B8MA 1EPZA 1QXRA 3BB6A 2PAKA 3LAGA 1NYWA 1ZZCA 2UY8A 1RL3A 2OYZA 3ZDSA 1CAWB 4AQ2A 4I0BA 5I0SA 1ZZ6A 4IEYA 1LRHA 3E5XA 5LEKA 3FWEA 1CX4A 4EV0A 4P9GA 3SCGA 4I0AA 4LULA 3L2HA 3OGJA 3I59B 3UKVA 2CGPA 4YSFA 5FQ0A 1J3QA 4BYYA 1UCXA 1OI6A 2BGCA 4Z82A 2EAAA 3FFQA 2HJIA 4CYDA 5KHGA 5C8WA 3OTFA 2MPFA 4MH0E 1CAXB 3E97A 3I7DA 5E16A 4HLTA 1WA4A 2IXKA 5C6CA 5I0TA 3MYXA 2XLFA 5FPXA 1NZCA 3KCCA 1Y9QA 3HIFA 1YUDA 4IETA 4E2SA 4AQ6A 2OPKA 2FQPA 1RUOA 3HT1A 3S0MA 3E6BA 3RYKA 3LWCA 3ST7A 2EA7A 4Z07A 3TNPB 2WC2A 2OZ6A 1UD1A 1FI2A 3U11A 4J1XA 4Q29A 2QVSB 3FX3A 4IEUA 3DN7A 4UXAA 1ZRCA 1QXJA 3LA2A 4YNIA 2QCSB 4JTOA 4Q0SA 1ZZ9A 4FBFA 1Q43A 4IEXA 1O3SA 5BXXA 4EWEA 2PHLA 3PVBB 4QX5A 5CVRA 4E2GA 4EROA 4O9EA 3JZVA 1Q3EA 1GQHA 2H6BA 1Y3TA 4KU8A 4KU7A 3VHRA 1YFXA 5F1RA 4ORFA 3QOPA 4ZU7A 1CGPA 4MUVA 3H7JA 3CEWA 2Y0OA 3SHRA 4PIYA 5JSOA 1EYBA 3UKTA 1X82A 3M70A 3R6SA 2K0GA 1FT9A 4UBHA 1ZRFA 4LLOA 4XF4A 5I91A 3EHKA 4MGZE 4F7ZA 2Q0AA 2UYAA 4GULA 2XL9A 3RDIA 3D0JA 4A2UA 1CAVA 3H9AA 5K8SA 5LEJA 2P17A 2IXJA 2N7GA 4XFHA 3KMHA 3OCPA 5HI0A 3RYPA 4YARA 4EWDA 1RC6A 5FQ0B 1DGRA 4UBGA 4HVRA 1ZVFA 3FHIB 3PNAA 2ZKLA 4KWJA 4LTAA 5KHIA 1WLTA 5EFUA 2O8QA 2DCTA 5FLHA 4XFCA 2Q4SA 4X6QB 4R8HA 2I45A 2XKOA 3CF6E 4HBNA 1RTVA 1IPJA 4XFAA 4RD7A 5J3UA 5LRSA 1J3RA 3USSA 1NXMA 1DZRA 1ZZ8A 2PYTA 4L11A 3FZ3A 1IPKA 2XL7A 4IEPA 2ET1A 2FMYA 1L3JA 3H7YA 5JAXA 1O3RA 4HSLA 1LR5A 2XKPA 4I09A 5CADA 1WGPA 3BU7A 2QNKA 3NJZA 3OD0A 4MGKE 2MNGA 4JTNA 3H8UA 1O7FA 2XHKA 4IEVA 4HN1A 4AVAA 1PM7A 4YYOA 1JUHA 2BYVE 2ET7A 2PQQA 1SEFA 2VECA 2GC1A 3KGLA 1DZTA 5I8YA 5AVPA 5FLIA 2WFPA 4F8AA 1ZZBA 4MX3A 1X8MA 2GC3A 4L2NA 3BCWA 4LUKA 2IC1A 2Z2SB 1O5LA 4ZU5A 4KWKA 1OD5A 1YFUA 3IDCB 3DL3A 4K8FA 4MZUA 3H50A 4IEQA 4HVOA 2C0ZA 3LZZA 4JV4A 1ZRRA 3ELNA 5JR7B 4JVAA 3ACLA 2IXCA 4HMZA 1J3PA 4LA3A 1CAVB 3FE5A 5LRRA 3H3UA 1VP6A 3E5UA 1U12A 4LUMA 2D40A 5BV6A 4O9GA 2GAUA 3CLPA 1O4TA 4YRDA 1O3TA 1ZX5A 4BIFA 4B29A 4LA2A 1X7NA 1RUNA 5FCCA 1XRUA 5J7MA 3I54A 5E1RA 4MV2A 2V09A 3SCFA 1GQGA 2PAMA 1J1LA 3NVCA 1NE6A 1O3QA 3NW4A 4IEZA 2BNNA 2GH2A 2CAVA 2PA7A 3D0SA 1FXZA 3D82A 4IERA 3E6CC 3LA7A 5I8SA 4D7SA 1VR3A 3DKWA 4HSJA 4FAHA 4TLFA 4QGLA 1H1IA 5FDBA 3IDBB 3KSCA 5FPZA 4I3PA 4J1WA 1YHFA 1G6NA 3GYDA 4PIXA 3EQEA 4OFGA 1J59A 2H6CA 3U10A 3MDPA 5T3NA 2IXLA 3SCHA 5CU1A 4BH9A 4FAGA 5BY5A 2PFWA 1DGWA 1XE7A 2PTMA 5JCTA 1X8EA 1RGSA 4FT8A 1XE8A 2BNOA 1QY4A 3EO6A 2Z69A 5KHJA 2CAUA 1SQ4A 3B02A 2QJVA 3RNSA 3KGZA 3GBFA 2D5FA 3S7IA 2BNMA 3EJKA 1LB2A 4QM9A 3SMHA 4IEOA 4BHPA 2O1QA 4XEZA 3E6DA 1TQ5A 4KWLA 3H3ZA 3IWZA 1PMIA 4WBBA 4ZU4A 4HZFA 3CO2A 1CAUB 4N9HA 4IESA 1LKNA 1ZNPA 1I6XA 3TNQA 2K9ZA 4HN0A 4XF1A 4Q0QA 1QWRA 4N9IA 3RPQA 2Q1ZB 2XGXA 5KBFA 2BEOA 3RYRA 4META 3PLQA 5J48A 3ES1A 2QDRA 3BALA 1EY2A 5FLJA 4Q0UA 3EBRA 5JSPA 2B9UA 4AVCA 3N4MA 3RZZA 1EP0A 3H1MA 3WW4A 3IBMA 3NKTA 3NL1A
chains in the Genus database with same CATH superfamily
4N43C 2R073 1NA1B 2XVLA 4Q5OA 4JGYC 3V64A 1PHMA 3N9QA 1PMHX 3KT7A 1PZ8A 4PIZA 3WP3A 5F9TA 4OUSA 1ZA4A 2W95A 3K48A 3PVEA 2GSYA 2VM9A 1CAWA 1H8TB 2AH2A 4IXLA 1ZM1A 4AAPA 3POGA 4XC9A 3KV4A 1AR62 1CJDA 2ETEA 3RI8A 4Q0VA 1OPMA 1M06G 1CVNA 5HBAA 2XVKA 4K7JA 5DUUA 2GC0A 2KD7A 2LALA 4MHUA 5EZWA 2WLPA 4I01A 2J1RA 4YGBA 3T3YA 4LEJA 1RXFA 2JDKA 5A7QA 3K4DA 3AXEA 1ALYA 1AF9A 3FL7A 2OVUA 1SFPA 2QUOA 3ETQA 3M7AA 1IS6A 4I2OA 4R52A 1VBB1 3PIGA 3UGGA 3VDAA 4CE8A 5FMOL 4EN9B 4NIHA 1CAXA 3UT0A 1AL0G 1AYM2 1XJAA 5KHKA 3U0ZA 2VZVA 3O14A 4KNCA 2AENA 3BTXA 3WG3A 5I0UA 2VOVA 2HWF2 1D4M3 1JN2P 3C7FA 3H1YA 1RUC1 4S2GA 3WCRA 3OEBA 4AGGA 2DCJA 3BKZA 1VJ2A 2MHFA 2KXLA 1S2BA 2JDMA 3LCPA 1NCQA 1OOPC 2A71A 1VB4A 2WQ4A 3VBRA 3OPZA 1UYYA 2VUJA 4GMP3 2D5HA 4QM8A 4FOWA 4AF9A 4EWAA 2JKBA 2WA4A 2WNUA 1DF0A 3HMYA 4XACA 1AYN1 3GCWA 1NA1C 1QGLA 3T0BA 2F6BA 4XFIA 3BUCA 5IVJA 1SHWB 2VQAA 2E31A 2ZPXA 3CQOA 1BZWA 1ZZ7A 4XPVA 1HRI1 3AMPA 1VE0A 1W05A 2P37A 1LHNA 3UV9A 5CKQA 1WA6X 2PHRA 4YG3A 1CZVA 2OZJA 4E2QA 1YFWA 2Z42A 1SMVA 4PT6A 4LBQB 1AR91 5BPXA 3VHNA 3AKRA 1F5FA 1IGOA 2F17A 3AVRA 5FPUA 3ZDVA 3PU8A 4AVTA 2FCTA 4M4RA 3AFKA 4DY5A 3VBSB 3ZMNA 5I8TA 1W8TA 1KRIA 1QQP1 1YWKA 1RMU3 2VW2A 3LSEA 5DN2A 2PAEA 2F4PA 3AZZA 2XJPA 4P9JA 5JOZA 1FPN2 4KBZA 1O6UA 3U1XA 1BJQA 2G9GA 4HKOA 3RZMA 3WW3A 1QJZA 2RHPA 1XYPA 1HW5A 2DF7A 4NVPA 2BRTA 5K4LA 2UWBA 5LASA 2VMHA 4M4PA 4O65A 4EJRA 2CDOA 5FO7B 1TMF1 5ABJC 1POQA 4NHYA 4XAAA 2NLRA 3OBTA 2ZBJA 3KZ4C 2FCUA 2TBVA 2RR12 2WNEA 4KWUA 2XUEA 2YU1A 3JU9A 1JZ7A 1EPZA 2VZSA 3ENRA 2VUCA 4B7EA 3BB6A 5BNPA 1ACCA 3WF2A 1W2UA 5BNQA 1VBE2 3LAGA 5FY4A 1MS4A 4GH4A 1ZZCA 3BODA 1RL3A 1CAWB 1YIFA 3ZLIA 4FFIA 5FP4A 3LFMA 2WZ8A 4UFIA 3U4XA 5I0SA 4IEYA 5FZKA 1V6IA 1CESA 2XBO3 4BQ3A 2FD8A 1VALA 5FZAA 3SCGA 3I2DA 2DBIA 1D0HA 1R092 2GMMA 5LA1A 2ZX1A 3UKVA 5JXGA 3VUOA 1TVGA 5FYCA 2R062 1UCXA 2RM23 1OI6A 3C7HA 3MLJA 1UU6A 3PUQA 3UL2A 1FAYA 4JDMA 4TN7A 1FX5A 1OPOA 2EAAA 3ZXGA 4AL9A 4CYDA 3F2ZA 4Q4Y2 2VZPA 1CAXB 3WNOA 3I7DA 1Z7S2 4Y33A 1BMV2 4EN0A 5FZHA 2PLV3 1QJX2 4LHKA 3Q8EA 3V65A 5IVEA 4UOJA 4PQ9A 2P3YA 3K46A 4GAZA 2EICA 2RS11 5I0TA 2FMDA 2XLFA 1NZCA 2WJSA 2EIBA 1CIYA 2OPKA 1RUOA 1D2SA 1NCQB 2ZGOA 3HT1A 2HWD3 3T1MA 4LBLA 3RYKA 5FMBA 2WNUB 4K20A 4UFLA 3WQ0A 4ARYA 4Z07A 3U4SA 3TNPB 4Q4X1 2WQZC 3ETPA 1BXHA 5IAXA 3AFGA 3I3BA 4P08A 5DUVA 4GB31 5CFDB 4Q29A 2RJLA 3W59A 5JXHA 3FX3A 2ZX4A 5IHRA 1D2QA 1QXJA 4B4QA 2ARAA 4KQ7A 5FPBA 2FDKA 2JICA 1ZZ9A 3RJ2X 1KDKA 4IEXA 4LHNA 5A3UA 5L36A 2GNMA 2ZEXA 1SZBA 2JWPA 2R0HA 3EXUA 2OPWA 1ZBE3 4O9EA 5FY8A 3WDXA 3JBG3 3SH3A 5J09A 2B42B 3KV5A 1GQHA 2H6BA 2YG0A 1ULGA 1W04A 3HD8B 2YC2A 1XU2A 2DFCA 4R9BA 2BZDA 2ORZA 4KU7A 1IZ3A 5ANQA 4QWNA 5A7PA 3QOPA 3GALA 3JB8A 1H1AA 1ZYBA 3O1MA 5L9BA 1ENXA 2JD9A 1VBC1 3CEWA 4HPKA 4E27A 3O1PA 4GWJA 4PIYA 1WMXA 1NY71 1VAKA 1XSRA 2J1AA 3VDDA 1BKZA 5BNPB 5JSOA 1ZBA2 3K4AA 2AUYA 1EYBA 2LS6A 1VB2A 2WWSA 3UKTA 4DFSA 2CHHA 2ZEZA 4GH4B 1JTZX 1NCQC 2W2IA 3B93A 3HBKA 1RUF2 1C28A 1GV9A 1C8M1 3LD8A 4XF4A 3POFA 3EHKA 1F2NA 4MGZE 4F7ZA 2Q0AA 5LY1A 1HV1A 4W6WA 1W0NA 4GULA 1F9KA 1H2MA 2PMWB 4BQ1A 3H0OA 2HWE3 3RDIA 3V0AB 3O1RA 4CEWA 3H9AA 3K3NA 1S2EA 2P17A 2W39A 4IGOA 4AVSA 2ZGTA 1W8HA 4X6RB 5CFDC 4AI9A 2BVBA 5L9RA 4RQPB 1L7QA 3KV6A 1NZIA 1STMA 3IIIA 2R042 3EMRA 3FLRA 5CNAA 4HL0A 2VBBA 3PNAA 2ZKLA 3HNYM 2CWMA 4XZPA 2WT1A 1ASJ1 1V6LA 2W1QA 1COV1 4EYUA 3ZSJA 4E8DA 2WAOA 3PJQA 2I45A 4QU1A 1HDKA 4D94A 1RTVA 5FY7A 1LOEA 1W6NB 3DYPA 4RD7A 2YBSA 1J3RA 5IAVA 2DU0A 1NXMA 3BYWA 1DZRA 3VLBB 4ZZ8A 2AGSA 4L11A 2BFUL 2JENA 3WNMA 1HRV2 1GP4A 1UZ0A 4LBMA 3VBUA 1IPKA 2YMZA 1MZ6A 2JDYA 2XL7A 4IEPA 3KCXA 4AG4A 1K5MA 3PL0A 1L3JA 1FMD2 3OOXA 4RR3A 4AFAA 3H7YA 5CYYA 4C91A 3LEGA 5CZKA 1R1A3 4E4HA 1RUG3 4FOYA 2VTXA 1KFUL 4FQ4A 3VKFC 5DG2A 5FUIA 3B3QE 5BNPC 1RUE1 5D21A 5FZOA 4ZY9A 3VD9A 1AR83 2VNOA 4LKFA 3R4UA 4GH4C 5JXJA 1QJY3 2QNKA 1DU3D 1GFF2 4LR4A 5T5PA 5AFEA 5A7NA 5A32B 4LKSA 2B39A 3GHNA 3H8UA 3UETA 3J8F3 2QQVA 2XVGA 4XW3A 4HN1A 2K2SA 5BNOA 1H6XA 4YZ4A 5JMOA 1L7LA 1UMZA 5JOXA 1GOGA 2V5DA 2NMOA 4BLIA 1JZ2A 3H8XA 2VVEA 4XJZA 3WF3A 4JZRA 3ACIA 4RQPC 2P3KA 1F15A 1G9FA 2GC1A 2WAAA 5FPLA 4ATEA 2D6OX 2ZGLA 3KGLA 3OY8B 5I8YA 2WFF3 3LQCA 5FLIA 3T2TA 4EQVA 3ZVXA 1RHI3 3TN91 1REDA 4LBOA 3WF4A 5GM0A 2HBTA 2SBAA 4LUKA 4BE3A 2A5ZA 2IC1A 3ILNA 4HKLA 5T5OA 1B35A 1GZWB 4KGGA 1RUH1 4LBJA 1O5LA 3L2YA 2DCKA 1G86A 3O1TA 5CG9A 2RE9A 1FV2A 5IVFA 1YFUA 1YI7A 3GXUA 2VMDA 1AX1A 4LIVA 3IAPA 3B7MA 4MZUA 4R4ZA 4A3XA 3LZZA 4ASLA 4JV4A 2JDUA 5LY2A 1UMIA 1S2KA 4JVAA 3ACLA 3EB7A 3SLIA 2IXCA 4DO0A 3J7LA 4A44A 1AR73 2RS52 2PHFA 3USUA 3H8OA 5LRRA 5F3IA 1PIV3 1VMJA 3I97A 5FCCA 4Q2FA 2OKXA 3OYWA 5EPAA 1X36A 1DCSA 4YW6A 3ZN6B 2D40A 5IK4A 2BWCA 2D6PA 4O9GA 4Q4V3 1ZA7A 2GAUA 5C7GA 5F3GA 4Y1YA 5A7SA 3CDZB 5DZGA 1PO11 2HWB1 1AX0A 2JDNA 1SBDA 2YROA 3QCWA 4RN5A 4XUQA 5FWJA 1RUD3 2E32A 1JZ8A 4BIFA 1GNYA 2WWJA 2VU9A 1HQLA 3V56A 1XRUA 2YHJA 5LBBA 2VOXA 5J7MA 2AACA 1Y7BA 1QDOA 2ZXQA 3AP7A 4XIOA 4RHV3 1J1LA 3NVCA 1JYTA 1W2AX 4NE9A 1NE6A 4FCAA 2C4XA 3K77A 5KC5A 2EF6A 3NW4A 3AZXA 3PTRB 3RJRA 1PMJX 3MIEA 3HNBM 4IEZA 4S2FA 1XSQA 1DG6A 1K5MB 2CAVA 5T5JA 4UW3A 4RR3B 1BBT2 5FOBB 3E6CC 2PHUA 2P3JA 3I2FA 2A3WA 1O59A 4D7SA 3TEWA 3HBZA 1T6GC 2JG9A 2P5BA 4HSJA 4UW4A 5D2AA 5FZOB 2HWC2 4L92A 5F8PA 1ENRA 1PZ7A 3I3DA 1MS5A 1N1YA 4QDRA 1SBEA 1TE1B 3KSCA 4ZONA 1HJFA 4OI0A 1YHFA 3AM2A 1EUUA 1RUJ1 1EV12 1W6PA 2FZ1A 1V6NA 5DAWA 4CUBA 4K6BA 5JVVA 3QLQA 5BNOB 4QKBA 2JE7A 4OFGA 4X8NA 3WNXA 3M2MA 4Q4W2 2Y64A 2H6CA 2DVFA 1DQ0A 1CWPA 2BVVA 3ON7A 4MLOA 3MDPA 1HXS1 4AK3A 1MVQA 4XUPA 3TAYA 1AZDA 1YXWA 2ERFA 3J9SA 5EYYA 4DPNA 2IXLA 3W58A 2QQPA 1COV2 2R1DA 3LB9A 5EP9A 1R1ZA 2QQKA 5IJRA 2PFWA 1GWKA 2AR6A 1O4YA 3KVAA 3DGTA 3NNJA 1DFQA 1GQPA 1H0BA 2VOKA 2PTMA 1W2TA 4C90A 4D8MA 4LIUA 3WHTA 1FOD3 5JCTA 2XWJB 2DVDA 3BU0A 2QQWA 5H9SA 2B45X 2Z69A 4COZA 2CAUA 1UU5A 4OHVA 4XJUA 1SQ4A 4ZKTB 2QQUA 1W28A 4AHXA 5A6ZA 4NPLA 3W9AA 1DQ1A 4YW1A 1GUIA 3MIFA 5FZDA 1W8ZA 5FYYA 1LB2A 5LATA 5FY9A 2R7EB 4HFSA 4G4FA 5E6HA 4IEOA 1K5MC 3SMHA 4FFFA 4ZS3A 1UX7A 3ZYFA 3ZXKA 3WNKA 4BHPA 2O1QA 3E6DA 3MICA 2W9XA 1QKQA 2VZQA 4GKXA 3MW4A 4WBBA 4ZU4A 1GLHA 1W2OA 3MHZA 4A7ZA 1OT5A 3WQ1A 1T2XA 1DQ4A 1WBFA 3K3OA 5A3OA 1LKNA 1ODMA 1ZNPA 2VW0A 3HEIA 1H4HA 1I6XA 4IQPA 4NR1A 2QBXA 3BIWE 3ZFFA 2W3JA 3OYWB 2GH8A 3M1HA 4CUCA 4Q0QA 3RPQA 2A7AA 4N43A 1D0GA 4YW3A 2B7YA 2OS2A 2W0XA 3QH6A 3VKNA 2JE8A 1UOBA 1RUI3 1W39A 3AK0A 5FJKA 4M00A 4Q0UA 5FV3A 1J1TA 2VQ0A 3OPWA 1SLAA 3VL8A 4FPJA 1UU4A 1QH7A 3GCXA 3H1MA 1GU3A 4NRPA 4XMIA 3NKTA 4EWEA 1L7RA 2JB8A 3HT2A 3N7LA 5F2SA 5G04L 3IIAA 3Q8AA 2ATFA 5JI9A 2CTVA 1PGW1 3S57A 1RVF1 1JYXA 5BUVA 5JZGB 1UO9A 1LTEA 4E4SA 5F6KA 3A7QA 1LOGA 5T55A 2GP5A 1W6QB 2VNVA 4ISRA 2X29A 4FFHA 2Q8EA 2ZZJA 1PGL1 1LHVA 1EAH3 1CAUA 1REEA 2DBNA 2C24A 2OA2A 1TNRA 1S55A 2JG9B 4P9IA 5JIUA 1UAIA 3B9IA 2FDGA 4A6OA 4AVBA 4CXXA 2GU9A 1CZTA 1NLRA 3E5QA 2EVXA 1BEV1 2DU1A 2XOMA 4YWAA 4IE7A 1DQ2A 3I59A 3WUDA 5AC93 2VTFA 3ES4A 3NO8A 4WVWA 3G7DA 1V9U3 1YCIA 2OT7A 3LE0A 4LITA 4AEDB 3WDTA 4R9AA 1KS4A 2J1SA 2J1VA 2WS91 2WABA 4IDZA 4DUVA 5GZGA 2JIJA 3WINE 3ATGA 1OHFA 3PHMA 4Y1UA 2IXHA 1OOPA 2ADEA 4YZ1A 2DTWA 4H7LA 1E5SA 3IDEA 5IVYA 1VBD2 1ZRIA 3PTYA 3ME2A 5KHHA 3O1OA 4FPEA 1N1VA 5T50A 2WO1A 1NA1A 1AXYA 4XQWA 1NG0A 1V6MA 2W94A 5IFTA 2BW8A 3S7EA 1Y43B 1OSGA 3SNMA 4CVUA 3LA3A 4WVZA 2J22A 4ET7A 1ULOA 2YZ4A 2HEVF 3ZFGA 4W8JA 2MEV1 3H1WA 3MGUA 4XFFA 1SLLA 1MEC1 3DYOA 2IXIA 3SXWA 3N9OA 2XWBB 4CP9A 3NSTA 4E8CA 3RWKX 3OGRA 4MADA 3J4UH 1HJGA 1YO8A 4IGQA 4JCKA 1A8MA 3Q9OA 2YPDA 2YB7A 5GZDA 1UW8A 5F37A 1POV0 2ZA9A 1DGLA 2B5HA 4L0PA 4AFBA 2Y0IA 5JZGC 5FYTA 2Y33A 2QFEA 2NP0A 1OMIA 1YQCA 2BBAA 3SC7X 1TME3 4IEWA 2R071 3I8TA 4PBPA 1IKQA 1WMFA 2EXIA 1C1LA 4EN7B 2QQNA 4GIQA 3POJA 1TEIA 2IFWA 4QDSA 4KGQA 5DDJ2 1IG3A 2BWAA 3N9MA 4AI1A 2Z4FA 5EHDA 3T4VA 3ZFFB 5ABJA 2FDHA 4OHYA 1G9CA 1GMMA 1LNSA 3ZKUA 4JX0A 4AEDC 3VKMA 2G9FA 5SV5A 1N3PA 5FZ4A 3R4DB 4H2AA 5DUXA 1OQDA 1KS5A 4H7MA 1PGSA 1UIKA 2DCYA 3FHAA 4XFGA 4B4RA 3LEMA 4B8EA 2ZOEB 4QB1A 1AR63 3FMGA 2DV9A 3FUOA 1DLCA 2HEYF 4XE9A 1CPNA 1NCRA 2YC0A 5JLVA 3TRSB 3TEYA 4RS5C 1JZ3A 2PAKA 3QD6A 5DUWA 3OB8A 2OUJA 1PO22 1LU1A 4B1LA 4BA6A 2FHRA 1NYWA 3T0AA 1AX2A 3P5BA 4HK8A 3ZFEB 4A45A 4AQ2A 5DAPA 1D4M1 2LUWA 5CISA 5HCBA 3ABZA 3BN6A 4I0BA 1I1EA 1JYIA 4LBQA 2O8OA 1A34A 1G9AA 3O12A 4GJZA 5JOWA 1W8OA 4D69A 2QZ3A 3LKJA 4L9BA 5E8AA 2XMLA 5FZGA 4TXWA 1CX4A 4EV0A 3TYJA 2XQXA 4I0AA 5GLVA 3ILRA 4GMP1 2LRPA 1AYM3 5JI7A 2J1TA 3I59B 1J83A 3OPTA 4BU2A 2CGPA 1AL22 1J3QA 2QKDA 1K3IA 2BGCA 2HWF3 1OLQA 1PVC2 2CY6A 3FFQA 4AFDA 5LCWL 3ZYRA 4B4PA 3ZSLA 4TTGA 4BB3A 2W52A 3ZFFC 4BZ4A 3ZXEA 2UU8A 4OQ9A 5FR3A 2XJSA 1O8SA 2VW1A 4BWOA 2WKKA 1WA4A 4BOWA 1JYNA 3VGIA 2VUDA 2FBEA 2RJKA 3MYXA 1OH3A 2VMGA 3DKQA 3KCCA 4LOSA 1R64A 1RMU1 4IETA 3TEZA 2ZGSA 4NHKA 4XUTA 3LGRA 4CU8A 4KG0A 3ZFGB 3E6BA 4FVVA 1UX6A 3VZOA 3LWCA 3ST7A 2P6HA 4CP9B 4LBNA 5C4WC 1OD3A 2JJ6A 3CJIC 4DXZA 2Q1FA 4JKMA 4Y22B 5FP9A 2QVSB 5FZ6A 1PGL2 2JD4A 3DN7A 3ZR5A 4DXRA 3ZFEC 3POIA 3DXUA 5CFCC 1FPN3 2D6MA 4SBVA 4IUGA 4ZPIA 4KBBA 1QEXA 4R9CA 4DEVA 4FBFA 1BQPA 2VJXA 1ND2B 2XHNA 5BXXA 4AOCA 3UYJA 5L9VA 4QX5A 3PVBB 4CEYB 4EROA 2R6QA 5ABJB 3T30A 4LO6B 3RZGA 1Q3EA 3MF6A 1TNFA 4QX8A 4WM7A 4O61A 2Y34A 4DY3A 2XBO1 1Y3TA 2RR13 2A6XA 4QXHA 4WZFA 3LPFA 3BTYA 1YQ6A 1W6OA 4QX7A 1LHUA 1REFA 1VBE3 3AP6A 4X8PA 5DPNA 1JS9A 1CPMA 1DHKB 1QJU2 2RM21 4MUVA 5A1FA 3R05A 4LXLA 4EE2A 3LSDA 4WVMA 5FZFA 3ZSEA 5FZ7A 2AYHA 1NCRB 1RJ7A 3SHRA 1VBA2 2BTVC 2QQMA 4PHZA 1FNZA 1APNA 1HIXA 3URFA 2BOIA 2WLQA 1MZEA 5CFDA 4NUBA 5FK7A 4I0WB 1X82A 2V5YA 2PLV1 1R093 4ZXKA 1LOBA 1YI9A 2JEMA 2D44A 4CP1A 2GN3A 4GZ9A 2JDZA 4UBHA 1W8WA 5EQUA 1LULA 2W1WA 2R063 3AZYA 2UWCA 4LLOA 3ZFGC 4BQ5A 5JPNB 4XXAA 3WG1A 2X05A 4BPZA 2RJ2A 4K3UA 4A7KA 4Q4Y3 1U5IA 2HWD1 4XBNA 2R072 2N7GA 3OCPA 3U75A 5L7OA 1IOAA 1U5YA 1UXXX 1Z7S3 2WZR2 4QDQA 3RYPA 4KG8A 4EWDA 1WW5A 5BNNB 1POV3 1QJX3 3WQ7A 3WF1A 1RC6A 4CDWC 4LHLA 1GP5A 3FHIB 1I5PA 1WD3A 1BLZA 2GN7A 1ND2C 1XBFA 1QMJA 2GMEA 2O8QA 4AI3A 5FLHA 1LU2A 2R0FA 3GGLA 4XFCA 3NRUA 4CEYC 4BXSV 5GZCA 1OQ1A 1JH5A 1OVSA 4X6QB 5FOJB 1ND3A 4OULA 3LPGA 3AVSA 3VZMA 3IAQA 4W6YA 1C5HA 1GNHA 1S0CA 2VG9A 1N47A 1VRH2 1ZBE1 2VMFA 3B94A 3JBG1 3NAPB 3GZTB 3ZXFA 5A6XA 1MPXA 5HV4A 3CBNA 4G9SB 2KM2A 4RA0A 1PVXA 2RVAA 1JU4A 3POSA 1R082 2ZKNA 4QB2A 5FYVA 1NCRC 5F6LB 3V0AA 4H3WA 1U0AA 1LR5A 4QQHA 2XKPA 3A0NA 5K7PA 1NX9A 4QXCA 4D6QA 1Q8PA 1UL9A 1UXZA 4IE4A 4RQPA 3UJQA 5CADA 1JOJA 3ZKYA 1GR3A 3WP4A 5ACA2 4E4ZA 4K1ZA 1D7PM 2MNGA 3AP4A 4YM2A 4ASMB 4YGCA 1JYVA 1Q8OA 2XJRA 5SV8A 4IEVA 4M01A 1W9TA 4AVAA 1HB1A 1PM7A 5TSWA 4COWA 2VUAA 3WDWA 2VAUA 5FP3A 2SLIA 4XJ9A 1JUHA 2P2KA 2RDSA 4MHRA 2BYVE 2ET7A 4XJAA 5FREA 3VHPA 1W6NA 2XQRA 4WM7B 1SEFA 3JD72 3WVJA 5BNNC 3LOBA 3VV1A 1IS3A 1DGRN 2HWE1 2QZ2A 5J96B 1OURA 2A6VA 3AYEA 5H9PA 1EUTA 1SBFA 2B9VA 2ZX2A 1NQDA 1W6OB 1ZBA3 2WFPA 2WNVB 4FTEA 5A1AA 4YZ2A 4ES8A 3PIJA 1RUF3 2GC3A 3BCWA 3S5AA 4MYEA 1IQAA 1RYYA 4J25A 2ZGNA 1W8UA 2JG8B 1CN1A 4PDWB 4WVMB 3WF0A 1SLBA 5L19A 3VKOA 4KWKA 1N3QA 1W06A 4LO8A 3LEKA 1OD5A 4YFZA 4U2AA 3NAPC 3DL3A 4FPLA 3ZOIA 3JUUA 5FY5A 4K8FA 1C3HA 1ENSA 5FO8B 2C0ZA 5A32A 1WZXA 2XJVA 2EAKA 1ZRRA 4INDA 2R043 4JHTA 5GLTA 1QDCA 4YG0A 1FATA 5C33A 1JOPA 1S4CA 3B5LB 4LA3A 3KHBA 1A3KA 4HETA 3WT3A 1UKGA 1XNAA 3U14A 4ZZ5A 3H3UA 1VPHA 1S0BA 2WT0A 5L7OB 1VBB2 3KV9A 1R1A1 1G8WA 4XCBA 4LUMA 4AR2A 1RUG1 3OY8A 3RZLA 1IS5A 3WDVA 4LPLA 2K46A 2G1MA 3OUIA 3IMMA 3O1VA 1AR81 1WCDJ 1JZ6A 1O4TA 1HRV3 1MS9A 2X09A 2DTYA 3UNPA 2X5IA 1QJY1 1LEMA 5FMDA 1UY4A 3HOBA 1RUC2 1ND3B 3G6JB 4B29A 1UMHA 1RUNA 2WT2A 1H30A 1GZWA 1NLSA 1FMD3 2W5FA 4JRLA 1AUYA 1UOJA 4WM7C 3J8F1 4A42A 4C0HA 1UY2A 3NV3A 5IATA 3GJAA 4P9YA 2RS33 5GZFA 1WW4A 2OW4A 3P3PA 4IE6A 2PAMA 3NNMA 5I0DA 2WNVC 2Y6GA 1O3QA 5GLUA 3GJBA 3RWNA 1UWWA 1AYN2 2A6WA 4Q8LA 1HB3A 3I2HA 2C1FA 2BNNA 4XABA 2GH2A 2PA7A 3HWJA 3DUIA 1PM4A 2X53S 1FXZA 1HLCA 3D82A 4IERA 2JG8C 2WFF1 2HYXA 4PDWC 4TYSA 3I3MA 1HRI2 1KJRA 4TSVA 1RHI1 1VR3A 3HN1A 4HONA 4NHXA 4OMCA 3ZPYA 2CWSA 5A6YA 4FAHA 1KJLA 4DQAA 2A1XA 1AR92 2J42A 5F3EA 2XJTA 3ZN6A 5C3RA 3BGAA 3H8RA 2EIDA 5FPZA 1LOAA 3O1UA 4QX2A 4MXVA 4M3CE 4V2VA 1G6NA 2I74A 2YXSA 2J1UA 1QQP2 4GQ7A 3MO4A 3ALQA 4PIXA 4COYA 2A6YA 1T6BX 4Y3OA 3D8CA 3EQEA 4XXPA 4Y1VA 5C9AB 1J59A 3U10A 4PLMA 3NNGA 5L7OC 3CKHA 1JU3A 3ZX7A 2VOTA 2RMU3 4FPKA 5CEHA 2VH9A 1JZ4A 3SCHA 4OUEA 5CU1A 1AR71 3X29B 4CXYA 1TMF2 3VL9A 2RDQA 4IV1B 5T52A 2YPJA 3S6PA 4DMIA 3ZYBA 5F32A 1PIV1 1GOHA 2DUQA 5FUPA 5BYNA 5HCAA 2NN8A 3HJRA 3QH7A 1W9FA 2QQLA 1ND3C 1KFXL 1XE8A 2BNOA 1UN1A 1QY4A 3WP5A 1DP0A 4Q4V1 1UY1A 3AB0A 4Z8BA 5FXVA 4UW6A 3POBA 4NIDA 1XNKA 3KQRA 3OGSA 4RYDA 2VOWA 3K51A 1RUD1 5A33B 2ZTNA 2ZHMA 1JODA 2C5DA 2D3SA 2RS53 3GBFA 3RNSA 1M4WA 4LT5A 1W90A 1PNGA 3BIEA 4ZXEA 4QXBA 4CUAA 3LF7A 1UZWA 3D5OA 1B09A 3AC0A 4JKKA 2BERA 3PVOA 4RHV1 3P1IA 4P14A 2XJUA 2IUWA 3O0VA 3CO2A 2Y6LA 3TWIA 3VD5A 2VO5A 3P3NA 3MUY1 3ZM8A 2JB4A 4AGVA 2IVJA 5GZEA 5FIXA 4Z92B 1SLIA 4Z2WA 4HN0A 4CRQA 4LORA 2XJQA 5FP7A 1QWRA 4AI2A 3ZYIB 5KBFA 3MEPA 2EALA 1W9YA 4PLOA 1H2KA 1W99A 3B01A 5J48A 5C9AC 2ENRA 2X5IB 2QDRA 4A4AA 3RZKA 2CGOA 2QDNA 2GDFA 2RS12 1OQEA 2VGDA 3EBRA 2NMNA 4YVWA 5FAXA 5LA2A 1BBT3 4AVCA 4CA9A 1JI6A 2ZAHA 3AL5A 3N4MA 2E63A 5F5AA 1EP0A 1QJFA 2O14A 4Y5Z0 3RZZA 4CU9A 3DCQA 4UFMA 4BMEA 4D6SA 4IV1C 2WINB 5DQ0A 4OHZA 5I0RA 3T1LA 3WDYA 4GWIA 4D3WA 2HWC3 2P3IA 1W0OA 4Q4X2 3APBA 2E7TA 4URAA 4XF3A 2ILMA 3ECQA 4FOQA 4OHXA 1DBNA 1ZRDA 4AWDA 2VBPA 1US3A 3DV8A 4GB32 4GD4A 4JDNA 4Y20B 1ZREA 2XUMA 2BGPA 1EV13 2NZ9A 4MGIE 1WMDA 5EJ3A 1J58A 2R32A 5FXXA 1OFNA 1X9TA 1XXNA 4OQ8A 1IS4A 1MS3A 3WG4A 4CCJA 1O5UA 2FDIA 2CV6A 1FOD1 2YFUA 1K12A 4QXKA 4Q4W3 2G19A 3VD4A 1H8VA 4BQYA 5FZBA 2UY9A 1ULDA 4OZOA 4QKNA 1UZYA 4YPJA 3THPA 4C8DA 3JCIA 4NAOA 4RFRB 2WIIB 5A6QA 2XB6C 1NXD1 3WD5A 2Y60A 4W6XA 4DNYA 2WA3A 2GZWA 5HXVA 4CZSA 1MQTC 3DPRA 4NROA 3T2PA 4OLLA 1XYNA 1SFYA 4AW7A 2R49A 3F95A 1QF3A 2VCCA 3KQ4B 3RMXA 4WZCA 4AHYA 3ACFA 3VBHA 4OHWA 4Q8KA 2Y6JA 2ZGPA 2OQ7A 1VBC2 5D1IA 2ES3A 5JZGA 2H0BA 2PHDA 2WN3A 2X5IC 3NNLA 1UYZA 2Y6HA 5A3PA 1NY72 4AYUA 5A3TA 1W6QA 4QGMA 4A3ZA 5FPAA 3CU7A 4D7TA 4BDVB 3ZYPA 2XLAA 2F4LA 4QKFA 3OJBA 1RUI1 4CDXA 1C8M2 1W8FA 1UPSA 3NV2A 3I49A 5ISLA 1W6MA 3VHOA 2VPVA 1I3HA 2WL1A 4C0BA 4XHXA 4Y1XA 1H1MA 2YGLA 3C3VA 4DUXA 2E9QA 3JXSA 4PJYA 3ORJA 4MGYE 4AEDA 4OZXA 3KB5A 4RSUA 5EJ1B 4XF0A 3GZEA 3NQHA 5FKCA 4I02A 4QMAA 1HQWA 3HVDA 4P02B 4N53A 2BOJA 4BQ2A 2EXJA 3FJSA 5GJ6A 2RG4A 4CDUB 3VBFA 4BQXA 3J26N 5K0UB 2E7QA 4C1WA 2RDRA 5JSRA 3N7MA 2QQJA 1F31A 2V4AA 2ZGQA 4KL1A 5FTTC 5KR7A 1ASJ2 3BPZA 1X33A 5C3QA 2XH6A 1EAH1 1UIJA 1BK0A 1V70A 1YFYA 4LBQD 2H0VA 3O5SA 2Q30A 4FPCA 4RS5A 4XDOA 5FMOS 3ASIA 5HCFA 4CSWA 4DINB 1WCQA 1S0DA 1A6CA 2E33A 4AQSA 3OGVA 2WO7A 3M3EA 5IVVA 3ROUA 5C3PA 1MR5A 5AC91 1NE4A 3AXDA 1V9U1 4LHSA 3OEAA 4YVWB 5FZ0A 1UPIA 5KXCA 1ULEA 1QU0A 3ACGA 1GYKA 1A8DA 2B8MA 2CDPA 3MFCA 1YQ8A 3PVNA 4QHBA 1QXRA 2GNBA 1UKRA 3WV6A 4LJHA 3TB0A 3MIGA 4RGGA 4Z1VA 2A75A 2CL2A 3ZXLA 3RQ0A 3ZDSA 3VZJA 1RUD2 1RUE2 5A80A 1DGWX 3D6EA 5A1LA 3HAGA 1KD7A 5FMCA 4MSVA 4P9XA 4GWMA 3H42B 1WCKA 3AKTA 2ZS6B 3MI8A 4IV3B 5LEKA 2VVDA 3FN9A 4N7IA 5JIAA 1WW6A 3RFRA 4LULA 3L2HA 1VBD3 3WEZA 3S5QA 4HXCA 4P00B 2NQYA 5FQ0A 4BYYA 4LKEA 2VNGA 4AEMA 4TWTA 1F5JA 5HV0A 5KXBA 5KHGA 1N1SA 1D4VB 4H55A 5K0UC 4CDUC 4YZ5A 3OTFA 3DPRB 4MH0E 1TME1 3E97A 4LK7A 3GZAA 4NHLA 3BOPA 3GBWA 3AJZA 4HLTA 3TN92 3WNPA 1OKQA 1KDMA 1KGYA 5C4WA 4UYBA 3VBHB 5IYYA 2YDEA 3CJIA 4XUOA 3WLUA 1OA2A 2PHXA 1RUH2 2W47A 2WN2A 3SH5A 5FPXA 4Y5SA 1Y9QA 3HIFA 1YUDA 4UFKA 4E2SA 1QNWA 2GNDA 2ZGKA 3ZFEA 5JPMB 2DCZA 2ARXA 4YVWC 5CFCA 3L9JT 4AVVA 3KLSA 5FJHA 4BLJA 5FZMA 1HN0A 3ZN5A 2P4EA 1CZSA 2EA7A 4CDXB 1YQ2A 3ZIWA 5DDJ3 1UD1A 1W6MB 4ASKA 3U11A 3MLLA 3LDBA 4ZHNA 1AR61 3IDAA 4IEUA 4CDQA 4LK6A 1ZRCA 3LEIA 4NPRA 1H6YA 4XDQA 3LA2A 4S2DA 2QCSB 4YNIA 5C5TA 4Q0SA 3UJOA 3WHUA 4CP2A 4N53B 1O3SA 1S0EA 4IV3C 2PHLA 3VBFB 1JOBA 1LEDA 4Y5TA 5IVCA 3EYPA 1UYPA 1PO12 2HWB2 3JZVA 4PI0A 1UYXA 2DUPA 1KEXA 4XCAA 4OI2A 3ZMOA 2VTXJ 4Y26A 1W9WA 2A3YA 4RS5B 5B2GB 3N9LA 4KU8A 4CCNA 4XTMA 5C8CB 1LGNA 5F2WA 3U37A 1AYM1 4MOAA 2AREA 5F1RA 5A3LA 1DZQA 1PO23 3DPRC 4ORFA 4D0QA 4ZU7A 1CGPA 3I2KA 5FBJA 1SLTA 4GA9A 4GMP0 3RGBA 2HWF1 4DOUA 3GDBA 3PMEA 4CU7A 4CU6A 3VBHC 3K75B 4GKYA 2VCMA 4B7KA 2HEWF 5DMYA 4R9DA 4URTA 3ZXJA 1JYWA 2WQ8A 4Y22A 4NMIA 4XMAA 3B9CA 3R6SA 2K0GA 4QKDA 5A3WA 4CDWA 1FT9A 1AL23 5I91A 3KHCA 5FYBA 1ND2A 1PVC3 4JQRA 4CDXC 2ZMKA 1LODA 5ERLA 2XL9A 4ARXA 4CEYA 3D0JA 1KXGA 1LCLA 3T2QA 4A2UA 1RUJ2 1SACA 5LEJA 2ZABA 4YW4A 4UI9L 2IXJA 5D8AB 1W2NA 5EWSA 4XFHA 3BVCA 5LB6A 5HXMA 1JMUB 3VB9A 3O1SA 3MFAA 2L9LA 4U36A 3TEXA 5FQ0B 1DGRA 5FZCA 4CTEA 1HXS2 3P6BA 2A6ZA 1V00A 1YEWA 3PUSA 4N53C 1WLTA 3IT8A 2BUKA 3VBFC 2WNOA 4Q27A 2WWUA 4CCMA 4R8HA 1PNFA 3KVBA 1FPN1 3PUIA 2XKOA 3VZLA 3LDRA 3SKJE 3T2OA 3WNLA 4CCEA 1XNTA 3A22A 4XFAA 4AGRA 4ATFA 3WY6A 5J3UA 5LRSA 5C4WB 3VDBA 3USSA 5C8CC 1ZZ8A 3M4FA 2CU5A 2ZGRA 2WUHA 3CJIB 3DYMA 4AQTA 2IWGB 4FI9A 1A78A 5J98B 1RB8G 4ITCA 2ZX3A 3FZ3A 4AFMA 1SDWA 2JDHA 4JGZB 2RR11 4IE5A 5CFCB 3KS7A 2CSGA 3I2OA 1XPWA 3HPNA 4FPYA 5C70A 2Y26A 4DEQA 4BMBA 1SLCA 1VBE1 2I2SA 4LE3A 4BM8A 5FYZA 4XIKA 3K2OA 3WR0A 1JYCA 1PX3A 3NMBA 4I09A 5BNNA 2VULA 4CDQB 1P8JA 5FY0A 4H14A 2NYYA 3RS6A 3WQBA 5KXDA 3MIDA 1HB4A 1UOGA 4B3NA 3HQRA 3KT4A 2XPJA 4AEKA 2Y6FA 1AHSA 4YYOA 4AI0A 1R091 1RINA 1S1AA 3SEPA 4E4DX 2P6CA 5CB7A 3IN9A 5D8AC 3U78A 2R061 4JDOA 1QJU3 2X8KA 2R30A 2VXRA 3PJYA 1CJPA 4R4XA 3ZXDA 2VECA 2BPA2 2BU9A 2V4VA 3M3QA 4Q4Y1 3NJXA 3NAPA 1VBA3 1GWLA 2PXJA 2DFBA 2PN5A 2WBKA 3KF3A 4F3JA 5AVPA 1MS0A 4O7XA 1Z7S1 2Y6KA 4WVVA 4DRVA 3HR9A 2C9AA 4F8AA 3I2GA 1POV1 1QJX1 5FZ9A 2JXAA 1X8MA 4MX3A 5A7WB 1PGW2 3O7OA 1RVF2 4L2NA 5F7UA 2VMEA 2IVIB 2EXKA 3AMHA 2ZACA 4UW5A 4YZ3A 3C7GA 1YQ5A 5LBCA 1Q8SA 1Y4WA 2VCAA 3E1F1 4QQLA 1OA4A 4ZU5A 1W03A 4CPBA 4JRAA 3LIGA 4YG6A 2JIGA 2WO2A 4MG2A 3VKLA 4ISQA 2P1BA 1HN1A 4OI4A 5LK5A 3FBMA 2WZR3 2CNAA 4JGZC 4NN0A 1GOFA 4CDWB 1BEV2 1OUXA 1UQXA 5JR7B 4DUWA 3OBZA 1WCUA 1YJKA 4HMZA 4QPYA 1J3PA 4OI1A 3IZOA 3D3AA 3BOWA 3BTAA 3FE5A 2WS92 2Y8KA 1VP6A 3GM8A 3PDQA 3E5UA 4CDQC 3Q8BA 2VNRA 2LROA 3DEMA 4CUGA 1V6KA 3ZIXA 2RV9A 3INAA 3RMYA 2AEZA 4IL7A 5A3NA 2WNVA 5AVAA 1VRH3 4SLIA 4AEJA 3WSOA 5KXEA 2BGOA 1ZX5A 2PELA 3VBOB 4LA2A 1X7NA 2W91A 2ZHKA 3JB4C 3OG2A 2JG8A 3A4UA 4PDWA 2YC4A 5FZ3A 3WUCA 1R083 3JQWA 1UY3A 3SKVA 2LM3A 1ODNA 4CCOA 4GJYA 3POEA 1G7YA 4MV2A 1S0FA 4MXWA 5LA9A 4NO4A 3SCFA 1G9BA 1GQGA 2MEV2 2W92A 5FXZA 2D7FA 1MEC2 2Q8OA 4BCUA 4QHOA 1LGBA 3OUHA 1H9WA 5C3OA 3SISA 1AXKA 5ACA3 3RZJA 1WLDA 3FBYA 1W3VA 3OGGA 1DYPA 1LOFC 2KR2A 1NT0A 3I3EA 1PK6B 4FP2A 3ILFA 3LA7A 4PBOA 4WV8A 1ZBA1 4CCDA 2ZAAA 1DYKA 4GWNA 4LO4B 4FP3A 3WZ1A 3OSDA 1NQJA 4TLFA 1RUF1 5CBLA 2DVBA 2GALA 1QXPA 1F4HA 5FDBA 1F35A 3JD73 3PUHA 4Q1RA 5CA6A 3CNAA 4I3PA 5DXDA 1H9PA 3HN3A 4NPMA 1H8TC 4LE4A 5F39A 3K4ZA 1TG7A 3AX4A 4DRRA 1Y9MA 3GYDA 1WBLA 3HNMA 3MF9A 2C6SA 4N7UA 1UZZA 1GP6A 5FXWA 2NPIA 4I30A 4CCLA 4P5YA 2R041 4AHWA 4K40A 3MV11 1O4ZA 1U5ZA 4HOOA 4B1MA 4JAAA 1QOTA 5F5CA 3THDA 1N1TA 3ITQA 2VD7A 1ONAA 1DGWA 1MZ5A 4EZ4A 1XE7A 3WOGA 3WP6A 3VBOC 4FT8A 2OIIA 3PU3A 3EO6A 1PZ9A 2A70A 4YGEA 2JDAA 1H4GA 1HRV1 3B02A 3CMGA 3W5MA 1D4M2 2QJVA 4YW2A 2ZHNA 4AI8A 4N90A 1FMD1 3R0RA 5T54A 4NJ4A 1VBB3 2TNFA 3AZVA 5IT6A 1BK1A 3POWA 1VMFA 2RS31 4Q26A 5C3SA 1PK6C 3JQXA 4NRQA 1TQ5A 4GALA 2PHWA 4QQPA 4QPGA 1O8PA 3H3ZA 4COVA 2B46X 4FPGA 2Y38A 4XAEA 1E5RA 2GP3A 2WZEA 2PHTA 2Q5TA 4HZFA 1OA3A 4N9HA 4IESA 1SCSA 5FFOC 2CYFA 4AHZA 2K9ZA 5GLWA 1RUC3 1DDLA 3LIHA 1YRZA 5FYMA 3VD3A 2ZZQA 4XF1A 5FP8A 5T5LA 3W21A 4N9IA 1ULCA 4P9LA 3RSJA 4IV1A 2XGXA 1IKPA 2E51A 1K45A 2BEOA 4TLGA 3RYRA 4META 5FWEA 2WYFA 1XNDA 2W1UA 2ZMLA 3SEEA 3ES1A 3ZO0B 1EY2A 1AYN3 5CIRA 3C7EA 1XNBA 3IMNA 4AZZA 2HH9A 1US2A 1JXNA 1RMU2 2B9UA 5JWPA 3VBSC 2NM1A 4S2HA 1JBCA 5A33A 3THTA 1HRI3 4MXWB 3IBMA 4UFJA 1Q8VA 1XC6A 2I07B 2JKXA 4FFGA 4NIGA 5EJZB 2D93A 2RMU1 1AR93 2D43A 2RDNA 3MIBA 4UAPA 3HQXA 3ZSMA 2DURA 3VBRB 1XB9A 4L97A 4XBQA 2VZTA 5I93A 1QQP3 4XETA 5DZEA 4EZHA 1MQTA 2ZGUA 1OF4A 3N9NA 1VIWB 2GMPA 2YY1A 2ZCWA 5IWFA 2BBVA 3MZHA 1Q5OA 1IQDC 3I2JA 1LAJA 4XTPA 2ARCA 5FYIA 3N7KA 1BVP1 1FYUA 1SFNA 2GC2A 2RS51 4Q1PA 3N9PA 3AYCA 1TMF3 1AVBA 1YIPA 3NKGA 4LNVA 5DAXA 4YVSA 1BCXA 2QE3A 2J1EA 3WW2A 2XBO2 2JDPA 5HPOA 3ZPOA 5IUQA 3KF5A 1QHDA 4LBKA 2J7MA 4XBLA 1C1FA 1LENA 4I3GA 4W50A 1DIWA 4YM3A 2ADDA 5AFBA 5DG1A 2RM22 4QPIA 5EV7A 4A7YA 4CCKA 3C2UA 2XONA 1MVEA 4XILA 3MPBA 3CJXA 1V0AA 4N8MA 1IHMA 5EIYB 2VE1A 3N35A 4Y20A 2VZRA 4LLFA 2PLV2 1I5ZA 1MACA 3WW1A 5G05L 5GALA 4P9WA 3MIHA 2YYOA 3GBGA 4PCRA 3UGFA 5KWRA 1KITA 4A41A 3UKNA 1N3OA 4HT1T 4XF9A 2BV4A 2YV8A 3N7JA 4LO5B 5B4XA 4XFBA 1BBT1 1QJEA 1WD4A 4HVQA 1OLME 3ZSKA 3RI9A 1OFSA 2HWD2 3M3IA 4P5HA 3VBRC 1OVPA 1H2NA 4QPGB 3CL1A 4Q0PA 2HWC1 4W4ZA 4ONUA 2HKXA 2WNUC 4FSJA 5FYHA 1WMEA 5HCHA 4OUMA 4NWWA 1IPSA 2RS13 4QGNA 3C8XA 1HB2A 2AEYA 4UWDA 2UYBA 3MW2A 2ZHLA 1EV11 4AFCA 4K1YA 4AXOA 1VAVA 2OX0A 3OF1A 1AXZA 3LOIA 2DDUA 4COUA 1QIQA 2XLGA 4OCTA 5A7OA 2W68A 4Q4W1 5FZ1A 2OUHA 1BVVA 3AMNA 3MUZ1 2BQPA 5JUVA 4BK4A 1FNYA 4LO7A 4Q4X3 2WRAA 4HANA 1ZBE2 3QACA 2BJSA 3JBG2 1YNAA 1OH4A 3AZWA 4OMDA 2OQ6A 2WZPP 2HLEA 4GB33 5FZEA 4PF5A 4BXFA 2DUOA 1YLLA 3LFIA 1IG0A 4DB5A 1UF2C 2VXJA 1Z0HA 3OBRA 1WKYA 2C9KA 1SDDB 1S0IA 4L8QA 1G9DA 3PURA 4D7YA 4HK9A 5IVBA 2UY8A 5H9QA 2OYZA 5IK5A 4QB6A 1K42A 4UFHA 1HQNA 2A3XA 5FZ8A 4QQOA 1HKDA 2V72A 1WWYA 1WW7A 1W8NA 1NKGA 1ZZ6A 2W1SA 5K0UA 4NIIA 1LRHA 4CDUA 5APAA 4LQRA 3R4SA 1MQTB 1H2LA 2XXZA 3E5XA 4W65A 2RS32 3AP5A 4YW5A 1SG3A 5GKAC 3FWEA 5H9RA 2BP6A 4P9GA 3FFZA 2OXBA 1BHGA 3KCYA 3OGJA 4QQ2A 2E7AA 4BQ4A 3CHXA 1AJOA 1MZFA 4FQZA 4UF0A 4YSFA 4DXSA 1Q8QA 3MBWA 1W9SA 4QPGC 4Z82A 4YVSB 1GNZA 1VBC3 2Q1MA 4QPWA 1JUIA 2HJIA 1RXGA 5CKMA 2HWE2 5CAZA 5C8WA 3B00A 3T0DA 2MPFA 1F4AA 3AMMA 3A23A 4JC1A 2VQTA 3TOJA 1KQRA 2D6KA 5E16A 1NLQA 4YFWA 2E26A 4YGDA 4CP0A 4TZDA 4QPIB 2IXKA 1VRBA 2FDJA 5C6CA 1C8M3 3UK9A 1GKBA 3DECA 4DZGA 4LMFA 4HG6B 4A6SA 4MGTA 1NOVA 1CONA 1LHOA 4AQ6A 2FQPA 4K8RB 3THCA 3S0MA 5CG8A 1DQ6A 1LOCA 3IB3A 5C5UA 2RMU2 1OLRA 2YFZA 4IV3A 5IK7A 4HPKB 2PQSA 1GSLA 3I2IA 1SPPA 2WC2A 1URXA 2OZ6A 2VZOA 1WLCA 3UGHA 1FI2A 3VDDB 4V2WA 5LZ6A 4J1XA 3J7MA 1ASJ3 2ID4A 3AYDA 4IE0A 3ZYGA 3NV1A 4UXAA 4XJ8A 1COV3 3AKPA 1BMV1 4K21A 3MPPG 5FUNA 4JTOA 4DXTA 1R1A2 3ZR6A 3VZNA 1Q43A 1RUG2 3Q8FA 1OLMA 2IFRA 2VL4A 4M3CA 3ZYHA 1JW6A 5CVRA 3OBAA 4XVHA 4FXKB 2V73A 3FHQA 2Q8DA 4E2GA 4CEWB 1AR82 1QJY2 1CIWA 3M8LA 4MGSA 1GBGA 1DYOA 4E9KA 4FXGB 2E6VA 2JECA 1WLWA 2VVFA 2XG3A 3C7OA 3CIHA 3KM5A 2VCBA 4LKDA 4KI5M 4XDPA 4YVSC 2QQIA 5FRAA 3J8F2 5LBFA 1Q56A 3VHRA 1QH6A 1VBD1 1LJ7A 1YFXA 2EIGA 2ZEWA 4BISA 5JXIA 4EN6B 5FYUA 5DAVA 1W0PA 1RUE3 1CX1A 2VC9A 3H7JA 4AE2A 4LOTA 2Y0OA 3W20A 4QPIC 2FZ2A 1V6OA 2D6NA 2WFF2 3N3HA 2D6LX 4AAXA 2VQUA 4QX1A 2X10A 5F5IA 1RHI2 5EYXA 3M70A 3VBUB 5F5QA 4Y24A 3DF0A 1WUVA 1ZRFA 2B4KA 4IW3A 4KH9A 1VLNA 2UYAA 3O0WA 4XURA 1X50A 3FLPA 4NAMA 1Y9GA 3RVHA 3OUJA 3U07A 4CCCA 5A3MA 1LESA 1CAVA 1BYHA 4QAWA 3USUB 5K8SA 2W87A 3TBDA 3VDDC 1O91A 5J36A 2D3RA 2FDFA 2UURA 4PQQA 3KMHA 5HI0A 4JHZA 4YARA 3T09A 5F3CA 3TN93 4FTSA 5C8CA 4UF0B 4UBGA 5DDJ1 4HVRA 1ZVFA 4KWJA 4LTAA 3NJYA 5KHIA 3WDUA 5DZFA 3V0BA 1RUH3 5EFUA 1AR72 2DCTA 5FO9B 5L73A 2Q4SA 4J6GA 1DLLA 4QHZA 5EXOA 5CKNA 4CEWC 4BQWA 1PIV2 4KMQA 3CF6E 4HBNA 1IPJA 1XE0A 4FO9A 2BDRA 3OD4A 4OYUA 3Q8CA 3KT1A 4Q4V2 2PYTA 3IM0A 4C1XA 4YLZA 1I9RA 2O0OA 1JHJA 1W3XA 5IW0A 4M0HA 3MV01 2KA3A 2ET1A 2A73B 2FMYA 4YM0A 4QD2A 4HKWA 4EN8B 3J7NA 3D4KA 4PF1A 5JAXA 1O3RA 2ARBA 1S0GA 2VMCA 1B35B 4HSLA 2G4IA 3AL6A 1GANA 1PO21 1SPPB 2VZ3A 4RHV2 5E88A 5D8AA 4MGQA 1OC1A 4WM8A 1RITA 1PO13 1WGPA 1CD3G 2HWB3 3BU7A 2E53A 3VBUC 1SCRA 1ENQA 3NJZA 3OD0A 4MGKE 2YU2A 4NOTA 3VD7A 4JTNA 2YBPA 4CPBD 1TZOA 3AKQA 4QX0A 1RIRA 4RR3C 5FYSA 1O7FA 5KC6A 5LWBA 2XHKA 3IPVA 4M3CB 3A0KA 2VZ1A 1YJLA 4GXLA 2Z79A 4M0NA 4BIOA 3WNNA 1AL21 2PQQA 1XQNA 2D98A 5C71A 2VR4A 5FBZA 4Y1ZA 5DAQA 4FPFA 5K9YA 1PVC1 4NRMA 2ORXA 2Z5WA 4NWVA 4FPHA 1LGCA 1DZTA 3VDCA 1GWMA 3N36A 4RFT0 2LW8A 1QOSA 1GICA 4JGYA 1S0JA 3O0XA 4NIAA 4JGZA 2DYCA 2HYKA 2WSVA 3PUAA 5BNOC 3LDKA 1ZZBA 2IZWA 4Y4RA 5A70A 3WXPA 1GZCA 1OBNA 3GF6A 4XQDA 1F8VA 3AKSA 3RRDA 3ZXAC 1ULPA 4YM1A 2Z2SB 3S30A 4PI2A 4XYXA 4F83A 1XYOA 3BTZA 4ZS2A 5FY1A 3BPSA 3I4IA 3IKWA 3IDCB 3KD4A 5FZIA 5IK8A 1RUJ3 4V1PA 1XU1A 5M0TA 3ACHA 4FOVA 1C8NA 4RGKA 3H50A 4IEQA 4HVOA 1E57A 3VN4A 1FOD2 1JZ5A 5J1XA 1VMHA 1OKOA 3NWKA 1CQ9A 4XHBA 1HXS3 3ELNA 4JKLA 5JOYA 2DVGA 1B35C 3T4HB 3B69A 1CAVB 2WSUA 1ST8A 3M3CA 5LW9A 3SITA 4CXWA 2TUNA 2ZEYA 2VZUA 3AP9A 1U12A 3WW4A 5B4NA 1YYNA 3AJYA 2WR9A 5BV6A 3GHMA 1MS8A 3CLPA 3WG2A 1W6PB 5FKBA 3V0BB 2WYSA 4RGAA 2QQOA 4YRDA 1O3TA 5A7WA 3H3LA 1LOFA 1UY0A 1GZTA 2R16A 4JQTA 4Y4YA 3I54A 3FLTA 1NUKA 2D97A 5E1RA 4FPOB 2ZGMA 2V09A 1UZVA 4BK5A 2YGMA 1RUI2 2EIEA 2LTNA 1QJU1 2VY0A 3AMQA 3W5NA 2Q8CA 1JHNA 3NJVA 5FPVA 1E5HA 1Z78A 1H8TA 1XNCA 3D0SA 1RJ8A 1VBA1 4PLNA 2JE9A 2GNTA 5I8SA 5ANNA 5E89A 1DQ5A 3DKWA 5JMCA 1NAEA 2W46A 5GLZA 2ZX0A 2ZMNA 1XOYA 5J37A 1OF3A 2XDVA 4QGLA 3MLKA 1J84A 4WM8B 1H1IA 3IDBB 2AC1A 2WO3A 3POYA 2EXHA 1OXCA 1HV0A 3PMSA 4K9SA 4J1WA 4QT6A 3GZUC 1EAH2 3IPVB 1FV3A 1C57A 1MS1A 2WZR1 1YC61 3VBOA 1U5XA 2JG9C 5FK8A 2HBUA 2TEPA 4FTBA 2QTWB 2VMIA 1RVF3 3I3QA 5AC92 5T3NA 5LK7B 4MO3M 1K5JA 3GNEA 1V9U2 4BH9A 2AZ5A 3HQUA 4FAGA 1HX6A 2G9ZA 1X9PA 5BY5A 4Z2AA 4N43B 3KWVA 3J7HA 3M3OA 4JGYB 1E5IA 3SQOA 3FC0A 1GZ9A 4QX3A 4ES9A 1X8EA 1EPWA 1RGSA 3UESA 2WDBA 3NNFA 5C9AA 3RZHA 3AYAA 1UNBA 1PK6A 2W08A 1BEV3 5JR2A 5JDBA 5KHJA 2YBKA 1QOOA 1VRH1 3WCSA 1C5IA 3QBQA 3ZYJB 3WX5A 4XUNA 3KGZA 3VZKA 1AJKA 2D5FA 3S7IA 4D6RA 2DVAA 2BNMA 2WS93 2ZJCA 2YUEA 3EJKA 3MW3A 4QU2A 4YW7A 1R081 4QM9A 4NHMA 2C26A 1ULFA 4G3YC 4OVEA 1OUSA 5LA0A 2CGNA 3T08A 4XEZA 3ZN4A 1CR7A 4KWLA 2FCVA 3IWZA 1PMIA 4BJ0A 1V6JA 3DXTA 1CAUB 5ACA1 2D3PA 3FUQA 4RL7A 4MVTA 3NV4A 3TNQA 4WM8C 1PX4A 4UT5A 3VBSA 2R1BA 1WCSA 1VAMA 3CZUA 5LBEA 4IGPA 1TME2 4DIQA 2Q1ZB 1LHWA 1C4RA 3SH4A 2VBDA 1QNYA 2MEV3 3PLQA 2JX9A 1MEC3 4M3CF 5FZLA 5IFPA 3BI3A 3A21A 3JD71 3CZJA 3BALA 2XR4A 5FLJA 2BFUS 2UWAA 3RG0A 1OOPB 4XOGA 2DWRA 5JSPA 2P34A 4L99A 4DS0A 5DABA 4XJWA 4XQ4A 4XZUG 1LECA 1UOFA 3NL1A
chains in the Genus database with same CATH topology
4N43C 2R073 1NA1B 2XVLA 4JGYC 3V64A 1PHMA 3WP3A 5F9TA 3KT7A 1PZ8A 4PIZA 4OUSA 1ZA4A 3K48A 3PVEA 2GSYA 1CAWA 1H8TB 2AH2A 4IXLA 1ZM1A 1AR62 1CJDA 2ETEA 3RI8A 4Q0VA 1OPMA 1M06G 1CVNA 5HBAA 2XVKA 4K7JA 5DUUA 2GC0A 2LALA 5EZWA 2WLPA 4I01A 4YGBA 4LEJA 3AXEA 1ALYA 1AF9A 2OVUA 2QUOA 3ETQA 3M7AA 1IS6A 4I2OA 4R52A 1VBB1 5FMOL 4EN9B 1CAXA 1AL0G 1AYM2 5KHKA 3U0ZA 3O14A 4KNCA 2AENA 3WG3A 5I0UA 2VOVA 2HWF2 1D4M3 1JN2P 3H1YA 1RUC1 4S2GA 3WCRA 4AGGA 2DCJA 1VJ2A 2MHFA 2KXLA 1S2BA 3LCPA 1NCQA 1OOPC 2A71A 1VB4A 2WQ4A 3VBRA 3OPZA 4GMP3 2VUJA 2D5HA 4QM8A 4FOWA 4AF9A 4EWAA 2JKBA 2WA4A 2WNUA 1DF0A 3HMYA 1AYN1 1NA1C 1QGLA 2F6BA 4XFIA 2VQAA 2ZPXA 1BZWA 1ZZ7A 4XPVA 1HRI1 3AMPA 2P37A 1LHNA 3UV9A 2PHRA 4YG3A 2OZJA 4E2QA 1YFWA 2Z42A 1SMVA 4LBQB 1AR91 5BPXA 3VHNA 3AKRA 1F5FA 1IGOA 4AVTA 4DY5A 3AFKA 5I8TA 3VBSB 3ZMNA 1KRIA 1QQP1 1RMU3 1YWKA 2VW2A 3LSEA 4ATFA 2PAEA 2F4PA 3AZZA 2XJPA 4P9JA 5JOZA 1FPN2 1BJQA 2G9GA 4HKOA 3WW3A 1QJZA 2RHPA 1XYPA 1HW5A 2DF7A 4NVPA 2UWBA 2VMHA 4EJRA 5FO7B 1TMF1 5ABJC 2NLRA 3OBTA 2ZBJA 3KZ4C 2TBVA 2RR12 2WNEA 3JU9A 1EPZA 3ENRA 4B7EA 3BB6A 5BNPA 1W2UA 5BNQA 1VBE2 3LAGA 1MS4A 4GH4A 1ZZCA 3BODA 1RL3A 1CAWB 1YIFA 3U4XA 5I0SA 4IEYA 1V6IA 1CESA 2XBO3 1VALA 3SCGA 3I2DA 1D0HA 1R092 2GMMA 2ZX1A 3UKVA 3VUOA 2R062 1UCXA 2RM23 1OI6A 3MLJA 3UL2A 1UU6A 1FAYA 4JDMA 3ZXGA 1FX5A 1OPOA 2EAAA 4CYDA 4Q4Y2 1CAXB 3I7DA 1Z7S2 4EN0A 2PLV3 1QJX2 4LHKA 3V65A 4PQ9A 2RS11 5I0TA 2FMDA 2XLFA 1NZCA 2WJSA 2OPKA 1RUOA 1D2SA 1NCQB 2ZGOA 3HT1A 2HWD3 3T1MA 4LBLA 3RYKA 2WNUB 4K20A 3WQ0A 4Z07A 3TNPB 4Q4X1 2WQZC 1BXHA 3AFGA 5DUVA 4GB31 5CFDB 4Q29A 2RJLA 3W59A 3FX3A 2ZX4A 1D2QA 1QXJA 4KQ7A 2JICA 1ZZ9A 3RJ2X 1KDKA 4IEXA 4LHNA 5L36A 2GNMA 2R0HA 3EXUA 1ZBE3 4O9EA 3WDXA 3JBG3 3SH3A 5J09A 2B42B 1GQHA 2H6BA 1ULGA 3HD8B 1XU2A 2DFCA 4R9BA 4KU7A 1IZ3A 3QOPA 3GALA 3JB8A 1H1AA 1ZYBA 1ENXA 1VBC1 3CEWA 4HPKA 4E27A 4PIYA 1NY71 1VAKA 3VDDA 1BKZA 5BNPB 5JSOA 1ZBA2 2AUYA 1EYBA 3UKTA 1VB2A 2WWSA 4DFSA 4GH4B 1JTZX 1NCQC 3B93A 1RUF2 1C28A 1GV9A 1C8M1 4XF4A 5JI9A 3EHKA 1F2NA 4MGZE 4F7ZA 2Q0AA 1HV1A 4W6WA 4GULA 1F9KA 1H2MA 4BQ1A 3H0OA 2HWE3 3RDIA 3V0AB 4CEWA 3H9AA 2P17A 2W39A 4AVSA 2ZGTA 5CFDC 2BVBA 4RQPB 2R042 3FLRA 5CNAA 4HL0A 3PNAA 2ZKLA 2CWMA 4XZPA 2WT1A 1ASJ1 1V6LA 1COV1 3ZSJA 3PJQA 2I45A 1HDKA 4D94A 1RTVA 1LOEA 1W6NB 4RD7A 1J3RA 2DU0A 1NXMA 3VLBB 1DZRA 2AGSA 4L11A 2BFUL 2JENA 1HRV2 4LBMA 3VBUA 1IPKA 2YMZA 1MZ6A 2XL7A 4IEPA 3KCXA 4AG4A 1K5MA 1L3JA 1FMD2 4RR3A 4AFAA 3H7YA 4C91A 1R1A3 1RUG3 4FOYA 1KFUL 4FQ4A 3VKFC 5DG2A 3B3QE 5BNPC 1RUE1 1AR83 2VNOA 3R4UA 4GH4C 1QJY3 2QNKA 1DU3D 1GFF2 4LR4A 5T5PA 5AFEA 5A32B 2B39A 3GHNA 3H8UA 1LECA 3J8F3 2XVGA 4XW3A 4HN1A 2K2SA 5BNOA 4YZ4A 1UMZA 5JOXA 2NMOA 4BLIA 2VVEA 4XJZA 4RQPC 2P3KA 2GC1A 1G9FA 4ATEA 2D6OX 2ZGLA 3KGLA 3OY8B 5I8YA 2WFF3 5FLIA 3T2TA 3ZVXA 1RHI3 3TN91 1REDA 4LBOA 5GM0A 2SBAA 4LUKA 4BE3A 2A5ZA 2IC1A 3ILNA 4HKLA 5T5OA 1B35A 1GZWB 4KGGA 1RUH1 4LBJA 1O5LA 3L2YA 2DCKA 1G86A 5CG9A 2RE9A 1FV2A 1YFUA 1YI7A 1AX1A 3B7MA 4MZUA 4R4ZA 4A3XA 3LZZA 4ASLA 4JV4A 1S2KA 4JVAA 3ACLA 3SLIA 2IXCA 1AR73 2RS52 2PHFA 3USUA 5LRRA 1PIV3 4Q2FA 3OYWA 1X36A 3ZN6B 2D40A 5IK4A 2BWCA 2D6PA 4O9GA 4Q4V3 2GAUA 4Y1YA 5DZGA 2YROA 1PO11 1AX0A 2HWB1 1SBDA 3QCWA 1RUD3 4BIFA 2VU9A 1HQLA 3V56A 1XRUA 2YHJA 5J7MA 2VOXA 1Y7BA 1QDOA 3AP7A 4XIOA 4RHV3 1J1LA 3NVCA 1NE6A 4FCAA 5KC5A 2EF6A 3NW4A 3AZXA 3RJRA 3MIEA 4IEZA 4S2FA 1DG6A 1K5MB 2CAVA 5T5JA 4UW3A 4RR3B 1BBT2 5FOBB 3E6CC 2PHUA 2P3JA 2A3WA 4D7SA 3HBZA 1T6GC 2JG9A 4HSJA 4UW4A 2HWC2 4L92A 1ENRA 1PZ7A 1MS5A 1N1YA 1SBEA 1TE1B 3KSCA 4OI0A 1YHFA 3AM2A 1W6PA 1RUJ1 1EV12 2FZ1A 1V6NA 4K6BA 5JVVA 3QLQA 5BNOB 2JE7A 4OFGA 4X8NA 3WNXA 3M2MA 4Q4W2 2H6CA 2DVFA 1DQ0A 2BVVA 4MLOA 3MDPA 1HXS1 4AK3A 1MVQA 3TAYA 1AZDA 1YXWA 2ERFA 3J9SA 5EYYA 4DPNA 2IXLA 3W58A 2QQPA 1COV2 2R1DA 3LB9A 1R1ZA 2PFWA 2AR6A 1O4YA 3DGTA 1DFQA 1H0BA 2VOKA 4C90A 2PTMA 5JCTA 3WHTA 1FOD3 2XWJB 2DVDA 5H9SA 2B45X 2Z69A 4COZA 2CAUA 1UU5A 4OHVA 4XJUA 1SQ4A 4ZKTB 4AHXA 3W9AA 1DQ1A 4YW1A 3MIFA 1LB2A 4HFSA 4G4FA 3SMHA 4IEOA 1K5MC 3ZXKA 4BHPA 2O1QA 3E6DA 3MICA 1QKQA 4GKXA 3MW4A 4WBBA 4ZU4A 1GLHA 4A7ZA 3WQ1A 1DQ4A 1WBFA 3USUB 1LKNA 2VW0A 1ZNPA 3ZFFA 1H4HA 1I6XA 4IQPA 4NR1A 3BIWE 3OYWB 2GH8A 3M1HA 4Q0QA 3RPQA 2A7AA 4N43A 1D0GA 4YW3A 2B7YA 2W0XA 3QH6A 3VKNA 1RUI3 1W39A 3AK0A 4M00A 4Q0UA 1J1TA 2VQ0A 1SLAA 3VL8A 4FPJA 1UU4A 1QH7A 3H1MA 4XMIA 4EWEA 3NKTA 3HT2A 3N7LA 3MZHA 3IIAA 2ATFA 2CTVA 1PGW1 1RVF1 5BUVA 5JZGB 4E4SA 1LTEA 5F6KA 1LOGA 5T55A 1W6QB 4ISRA 2X29A 2ZZJA 1PGL1 1LHVA 1EAH3 1CAUA 1REEA 2OA2A 1BMV2 1TNRA 1S55A 2JG9B 4P9IA 5JIUA 1UAIA 3B9IA 4AVBA 2GU9A 1NLRA 3E5QA 2EVXA 1BEV1 2DU1A 1DQ2A 3I59A 3WUDA 5AC93 3ES4A 3NO8A 4WVWA 3G7DA 1V9U3 1YCIA 4AEDB 3WDTA 4R9AA 1KS4A 2WS91 5GZGA 3WINE 3ATGA 1OHFA 3PHMA 4Y1UA 2IXHA 1OOPA 4YZ1A 2DTWA 4H7LA 5KHHA 3IDEA 1VBD2 3PTYA 3ME2A 4FPEA 1N1VA 5T50A 1NA1A 1AXYA 4XQWA 1NG0A 1V6MA 2BW8A 3S7EA 1Y43B 1OSGA 3SNMA 3LA3A 4WVZA 2YZ4A 2HEVF 3ZFGA 2MEV1 3H1WA 3MGUA 4XFFA 1SLLA 1MEC1 2IXIA 3SXWA 2XWBB 3NSTA 3J4UH 1YO8A 4JCKA 1A8MA 3Q9OA 5GZDA 1UW8A 5JZGC 1POV0 2ZA9A 1DGLA 2B5HA 2Y0IA 2NP0A 2QFEA 1OMIA 1TME3 4IEWA 2R071 3I8TA 4PBPA 1IKQA 1WMFA 2EXIA 1C1LA 4EN7B 4GIQA 1TEIA 2IFWA 4KGQA 5DDJ2 2BWAA 4AI1A 3ZFFB 5ABJA 4OHYA 1G9CA 4AEDC 3VKMA 2G9FA 5SV5A 1N3PA 3R4DB 5DUXA 1OQDA 1KS5A 4H7MA 1PGSA 1UIKA 2DCYA 4XFGA 4B4RA 4B8EA 2ZOEB 1AR63 3FMGA 2DV9A 3FUOA 2HEYF 4XE9A 1CPNA 1NCRA 2YC0A 5JLVA 3TRSB 4RS5C 2PAKA 3QD6A 5DUWA 1PO22 1LU1A 4BA6A 2FHRA 1NYWA 1AX2A 4HK8A 3ZFEB 4AQ2A 1D4M1 2LUWA 5HCBA 1I1EA 1JYIA 4I0BA 4LBQA 2O8OA 1G9AA 3O12A 5JOWA 4D69A 2QZ3A 3LKJA 4L9BA 5E8AA 4EV0A 1CX4A 3TYJA 4I0AA 5GLVA 3ILRA 4GMP1 1AYM3 5JI7A 3I59B 2CGPA 1AL22 1J3QA 2QKDA 2BGCA 2HWF3 1OLQA 1PVC2 2CY6A 3FFQA 4AFDA 3ZYRA 4B4PA 3ZSLA 2W52A 3ZFFC 4BZ4A 3ZXEA 2UU8A 2XJSA 2VW1A 4BWOA 2WKKA 1WA4A 4BOWA 3VGIA 2FBEA 2RJKA 3MYXA 2VMGA 3KCCA 4IETA 1RMU1 2ZGSA 4NHKA 3LGRA 4KG0A 3ZFGB 3E6BA 4FVVA 1UX6A 3VZOA 3LWCA 3ST7A 4LBNA 5C4WC 2JJ6A 3CJIC 4DXZA 4Y22B 1PGL2 2QVSB 2JD4A 3DN7A 3ZFEC 5CFCC 1FPN3 2D6MA 4SBVA 4KBBA 4R9CA 4FBFA 1BQPA 1ND2B 5BXXA 4QX5A 3PVBB 4CEYB 4EROA 2R6QA 5ABJB 4LO6B 1Q3EA 3MF6A 1TNFA 4WM7A 4DY3A 2XBO1 1Y3TA 2RR13 2A6XA 4WZFA 1W6OA 1LHUA 1REFA 1VBE3 3AP6A 4X8PA 1CPMA 1DHKB 1QJU2 2RM21 4MUVA 3R05A 3LSDA 4WVMA 3ZSEA 2AYHA 1NCRB 1RJ7A 3SHRA 1VBA2 2BTVC 1FNZA 1APNA 1HIXA 3URFA 2WLQA 1MZEA 5CFDA 4I0WB 1X82A 2V5YA 2PLV1 1R093 4ZXKA 1LOBA 1YI9A 2JEMA 2D44A 4CP1A 2GN3A 4UBHA 2JDZA 1LULA 4LLOA 2R063 3AZYA 2UWCA 3ZFGC 5JPNB 4XXAA 3WG1A 4BPZA 4K3UA 4A7KA 4Q4Y3 1U5IA 2HWD1 4XBNA 2R072 2N7GA 3OCPA 5L7OA 1IOAA 1U5YA 2WZR2 1Z7S3 3RYPA 4KG8A 4EWDA 1WW5A 5BNNB 1POV3 1QJX3 3WQ7A 1RC6A 4CDWC 4LHLA 3FHIB 1WD3A 2GN7A 1ND2C 1QMJA 2GMEA 2O8QA 4AI3A 5FLHA 1LU2A 2R0FA 4XFCA 4CEYC 5GZCA 1OQ1A 1JH5A 4X6QB 5FOJB 1ND3A 4OULA 3VZMA 4W6YA 1C5HA 1GNHA 1S0CA 2VG9A 1N47A 1VRH2 1ZBE1 3B94A 3NAPB 3JBG1 3ZXFA 3GZTB 4G9SB 2KM2A 4RA0A 1PVXA 3POSA 1R082 2ZKNA 1NCRC 5F6LB 3V0AA 4H3WA 1U0AA 1LR5A 4QQHA 2XKPA 3A0NA 5K7PA 1Q8PA 1UL9A 3UJQA 4RQPA 5CADA 1JOJA 5ACA2 1GR3A 3WP4A 4E4ZA 4K1ZA 2MNGA 3AP4A 4YM2A 4ASMB 4YGCA 1Q8OA 2XJRA 5SV8A 4IEVA 4M01A 4AVAA 1PM7A 5TSWA 4COWA 2VUAA 3WDWA 2SLIA 4XJ9A 1JUHA 2P2KA 4XJAA 5FREA 2BYVE 2ET7A 3VHPA 1W6NA 4WM7B 1SEFA 3JD72 3WVJA 5BNNC 3LOBA 3VV1A 1IS3A 1DGRN 2HWE1 2QZ2A 5J96B 2A6VA 3AYEA 5H9PA 1SBFA 2ZX2A 1NQDA 1W6OB 1ZBA3 2WFPA 2WNVB 4FTEA 4YZ2A 4ES8A 1RUF3 2GC3A 3BCWA 4MYEA 1IQAA 4WVMB 4PDWB 2ZGNA 2JG8B 1CN1A 1SLBA 5L19A 3VKOA 4KWKA 1N3QA 4LO8A 4YFZA 1OD5A 4U2AA 3NAPC 3DL3A 4FPLA 3JUUA 4K8FA 1C3HA 1ENSA 5FO8B 2C0ZA 5A32A 2XJVA 2EAKA 1ZRRA 4INDA 2R043 5GLTA 1QDCA 4YG0A 1FATA 5C33A 3B5LB 4LA3A 1A3KA 4HETA 3WT3A 1UKGA 3H3UA 1S0BA 2WT0A 5L7OB 1VBB2 1R1A1 1G8WA 4LUMA 1RUG1 3OY8A 1IS5A 3WDVA 1AR81 1WCDJ 1O4TA 1HRV3 1MS9A 2DTYA 2X5IA 1QJY1 1LEMA 1RUC2 1ND3B 3G6JB 4B29A 1RUNA 2WT2A 1H30A 1GZWA 1NLSA 1FMD3 4JRLA 4WM7C 1AUYA 5FCCA 4C0HA 3J8F1 3NV3A 5GZFA 4P9YA 2RS33 1WW4A 2OW4A 3P3PA 2PAMA 2WNVC 1O3QA 5GLUA 3RWNA 1AYN2 2A6WA 4Q8LA 2BNNA 2C1FA 2GH2A 2PA7A 3HWJA 3DUIA 2X53S 1FXZA 1HLCA 3D82A 4IERA 2JG8C 2WFF1 4PDWC 4TYSA 1HRI2 1KJRA 4TSVA 1RHI1 1VR3A 3HN1A 3ZPYA 2CWSA 4FAHA 1KJLA 4DQAA 1AR92 2XJTA 3ZN6A 5FPZA 1LOAA 4MXVA 4M3CE 1G6NA 2I74A 2YXSA 1QQP2 4GQ7A 4PIXA 3ALQA 4COYA 2A6YA 3D8CA 3EQEA 4XXPA 4Y1VA 5C9AB 1J59A 3U10A 4PLMA 5L7OC 3ZX7A 2RMU3 4FPKA 2VH9A 3SCHA 5CU1A 1AR71 3X29B 1TMF2 3VL9A 4IV1B 5T52A 2YPJA 3S6PA 4DMIA 1PIV1 2DUQA 5BYNA 5HCAA 2NN8A 3QH7A 1ND3C 1KFXL 1XE8A 2BNOA 1UN1A 1QY4A 3WP5A 4Q4V1 3AB0A 4Z8BA 4UW6A 1XNKA 3KQRA 2VOWA 3K51A 1RUD1 5A33B 2ZTNA 2ZHMA 3RNSA 2C5DA 2D3SA 2RS53 3GBFA 4LT5A 1M4WA 1PNGA 3D5OA 1B09A 4RHV1 3PVOA 4P14A 2XJUA 3TWIA 3O0VA 3CO2A 3P3NA 4AGVA 5GZEA 4Z92B 1SLIA 4Z2WA 4HN0A 4CRQA 2XJQA 1QWRA 4AI2A 3ZYIB 5KBFA 3MEPA 2EALA 4PLOA 1H2KA 3B01A 5J48A 5C9AC 2ENRA 2X5IB 2QDRA 2VGDA 2CGOA 2GDFA 2QDNA 1OQEA 2RS12 3EBRA 2NMNA 4YVWA 5FAXA 1BBT3 4AVCA 2ZAHA 3N4MA 2E63A 3RZZA 1EP0A 4Y5Z0 4BMEA 4IV1C 2WINB 4OHZA 5I0RA 3T1LA 3WDYA 4D3WA 2HWC3 2P3IA 1W0OA 4Q4X2 3APBA 2E7TA 4XF3A 2ILMA 3ECQA 4FOQA 4OHXA 1DBNA 1ZRDA 4AWDA 1ZREA 3DV8A 4GB32 4JDNA 4Y20B 2XUMA 2NZ9A 1EV13 5EJ3A 4MGIE 1WMDA 1J58A 2R32A 1OFNA 1XXNA 1IS4A 1MS3A 3WG4A 1O5UA 2CV6A 1FOD1 4QXKA 4Q4W3 1H8VA 2UY9A 1ULDA 1UZYA 3THPA 3JCIA 2WIIB 2XB6C 1NXD1 3WD5A 4W6XA 4DNYA 2WA3A 2GZWA 5HXVA 4CZSA 1MQTC 3DPRA 4OLLA 1XYNA 1SFYA 4AW7A 2R49A 1QF3A 3RMXA 4WZCA 4AHYA 3VBHA 4OHWA 4Q8KA 2ZGPA 1VBC2 5D1IA 2ES3A 5JZGA 2H0BA 2PHDA 2X5IC 1NY72 4AYUA 1W6QA 4QGMA 3CU7A 4D7TA 3ZYPA 2XLAA 3OJBA 1RUI1 4CDXA 1C8M2 1UPSA 3NV2A 1W6MA 3VHOA 2VPVA 1I3HA 2WL1A 4C0BA 4XHXA 4Y1XA 1H1MA 2YGLA 3C3VA 2E9QA 4PJYA 4MGYE 4AEDA 4OZXA 3KB5A 4RSUA 4XF0A 4I02A 4QMAA 1HQWA 4N53A 5K0UB 2EXJA 3FJSA 5GJ6A 4CDUB 3VBFA 3J26N 2E7QA 4C1WA 5JSRA 3N7MA 2ZGQA 1F31A 4KL1A 5FTTC 1ASJ2 3BPZA 1X33A 2XH6A 1EAH1 1UIJA 1V70A 1YFYA 4LBQD 2H0VA 3O5SA 2Q30A 4FPCA 4RS5A 5FMOS 5HCFA 3ASIA 4DINB 1S0DA 1A6CA 4AQSA 3M3EA 3ROUA 1MR5A 5AC91 1NE4A 3AXDA 1V9U1 4YVWB 1UPIA 5KXCA 1ULEA 1QU0A 1GYKA 1A8DA 2B8MA 3MFCA 3PVNA 3WV6A 4QHBA 1QXRA 2GNBA 1UKRA 3TB0A 3MIGA 4RGGA 4Z1VA 2A75A