2ET7A

Structural and spectroscopic insights into the mechanism of oxalate oxidase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
201
structure length
201
Chain Sequence
SDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMARVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and spectroscopic studies shed light on the mechanism of oxalate oxidase
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Oxidoreductase
molecule keywords Oxalate oxidase 1
total genus 46
structure length 201
sequence length 201
ec nomenclature ec 1.2.3.4: Oxalate oxidase.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00190 Cupin_1 Cupin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2et7A00
1YFWA 4IEPA 4KWJA 4AQ2A 4EV0A 3KMHA 2BNNA 5E1RA 1VJ2A 4PJYA 5KBFA 2VPVA 2PFWA 1WLTA 4MGZE 1U12A 2CAUA 3H9AA 2XKOA 4WZCA 4MX3A 2GC0A 5JR7B 4P9GA 4L2NA 2OZ6A 5E16A 2BEOA 2IXHA 3IIAA 5FLIA 5KHHA 4PIXA 2BGCA 3EBRA 4QMAA 1PM7A 2ETEA 2QVSB 3KSCA 5BUVA 3FFQA 4UBGA 1GQHA 1Y3TA 4AQ6A 4UBHA 2D93A 4ZU7A 4EWDA 5JCTA 2PYTA 4LA3A 3RYPA 3H3UA 3M3IA 4I2OA 2PA7A 1UIJA 5BV6A 2PTMA 5I0TA 2D5HA 1Q3EA 2HJIA 5FDBA 1O4TA 1QXJA 1SEFA 2B9UA 1ZZCA 4YYOA 4FAHA 4XF0A 4HVOA 2OZJA 3G7DA 5BPXA 5BY5A 1XE8A 4LEJA 3UKNA 5J48A 5KHIA 4BIFA 3RNSA 2Y0OA 1HW5A 3M70A 2ET7A 3LAGA 4N9HA 3BU7A 1LKNA 1YUDA 2EVXA 4E2GA 1PMIA 1UW8A 1UCXA 5KHGA 1DZTA 4WBBA 5C8WA 5I8YA 3D0SA 3NVCA 4KU8A 1Q43A 5FQ0A 3E97A 4MUVA 3PLQA 2WC2A 4I0BA 5JSPA 3O14A 3WW2A 4RD7A 1O3RA 4YNIA 2IXKA 3RZZA 3JZVA 3KCCA 4QGLA 2XGXA 1RUNA 2B8MA 1O3QA 2BNOA 3ES4A 4HSJA 3U0ZA 3TNQA 1FT9A 2UY9A 2IXJA 1UIKA 1J58A 3E5XA 1LRHA 3RYKA 3L2HA 4LUMA 4MGYE 3BB6A 1ZRFA 3CJXA 1O3TA 2OA2A 1CAWA 3WW4A 3FE5A 1TQ5A 2VQAA 3DKWA 4I3PA 2GC3A 4MH0E 5EFUA 3USSA 1ZRCA 3ACLA 2O1QA 1ZRDA 5CU1A 1IPJA 2GC2A 5HI0A 1QY4A 4IEOA 3GBFA 4JVAA 5JAXA 3BPZA 4AXOA 3I7DA 3ES1A 3OGJA 4HBNA 1IPKA 3E6CC 1I6XA 4FAGA 4OFGA 4CYDA 2PHDA 3ZDSA 5KHJA 4J1WA 4Q29A 4QGNA 3UKVA 3H1YA 2K0GA 3I59B 2WFPA 3RPQA 4ZU5A 3E5QA 1YFUA 4I01A 5J7MA 1ZVFA 3D0JA 2H6CA 2O8QA 1H1MA 4I02A 1CAUB 3TNPB 1J3RA 2FMYA 4KL1A 1GQGA 2UYAA 3MDPA 2OPKA 4F7ZA 2UYBA 2VECA 1UD1A 4XFGA 1NZCA 4MGKE 2XLAA 5I0RA 5D1IA 2Q30A 3DL3A 4LLOA 2KXLA 4QM9A 4DINB 3IDBB 4HN1A 2XLGA 1Y9QA 4FBFA 5FLHA 3E6BA 3MPBA 3NL1A 3FZ3A 3SXWA 2GAUA 1YFYA 2DCTA 4IEVA 3SMHA 3DV8A 3EHKA 2IXLA 4XF4A 5KHKA 4XFCA 2Q4SA 4X6RB 4XF9A 2Q1ZB 4QM8A 4Q0PA 5I0UA 2BNMA 1UPIA 2ZKLA 3E5UA 3WW1A 1JUHA 4IESA 1J3QA 3H3ZA 2Z69A 4Z82A 4Q0VA 3IBMA 1ZREA 2XL9A 3MZHA 2XL7A 1VR3A 4LA2A 3SHRA 2MNGA 3HQXA 3BALA 1VP6A 1L3JA 3KGZA 4N9IA 3MYXA 4XFHA 3WW3A 3S7EA 3U10A 3I59A 4A2UA 3EJKA 4BHPA 4LUKA 2UY8A 4O9GA 4Q0SA 4JTNA 4OLLA 1NE4A 4IEUA 3PVBB 4GULA 5I0SA 2C0ZA 2H0VA 5J3UA 1WA4A 2D5FA 2EAAA 2N7GA 4META 2P17A 2I45A 4AVBA 4JV4A 5LRRA 1CAVA 1EYBA 3FHIB 3CO2A 2Q0AA 4J1XA 3N4MA 3OTFA 2PAMA 3EO6A 5I8TA 2E9QA 4XFFA 4YRDA 4I09A 4QX5A 5JSRA 1G6NA 4QGMA 2QNKA 1LB2A 1CGPA 4ORFA 3ST7A 4UXAA 3FX3A 3OD0A 2QJVA 4IEWA 4PIZA 1I5ZA 4Z07A 5FPZA 4LULA 2PHLA 3B02A 3VHRA 3IWZA 3GYDA 2PQQA 4EROA 1NE6A 3LZZA 1YLLA 2QDRA 4K8FA 3CLPA 4MZUA 1CAXB 3HT2A 5I8SA 4ZU4A 4L11A 4X6QB 4IEXA 3LA3A 2GZWA 4HSLA 3D82A 4IEZA 4XETA 4O9EA 2QCSB 5LEKA 3S7IA 4XEZA 1YHFA 1RUOA 3S0MA 2GU9A 4HLTA 3CL1A 3LWCA 3NW4A 1CAWB 1H1IA 4KU7A 4PIYA 2Z2SB 2ATFA 1ZRRA 1CX4A 3FJSA 4ONUA 5LEJA 3BCWA 4BYYA 4YSFA 2PAKA 2EA7A 5I91A 1DGWA 5K8SA 2XKPA 2CGPA 4E2QA 4H7LA 3I54A 5AVPA 4IETA 2XLFA 1CAUA 2ZCWA 4IEQA 1FXZA 4D7TA 1J1LA 5JSOA 4I0AA 4LTAA 1OFNA 5FPXA 1RTVA 4XFIA 3OCPA 1OI6A 1SFNA 1XRUA 1X8MA 3KGLA 1CAXA 2IC1A 3ELNA 3H50A 1DZRA 3SCHA 1O5LA 3R6SA 1QWRA 3H1MA 1EY2A 1X8EA 3HIFA 4Q0QA 3QACA 1ZZ6A 3SCFA 2H6BA 2PAEA 3NKTA 3OF1A 2IXCA 3RYRA 4D7SA 2CAVA 4FT8A 1FI2A 1RGSA 4HZFA 1X7NA 1J59A 4BH9A 5F1RA 2B5HA 5T3NA 4IEYA 1DGRA 3U11A 4HVQA 2GH2A 3H7YA 1ZZ8A 1XE7A 5CVRA 2CV6A 5C6CA 2D40A 1EPZA 4HVRA 1ZZ7A 4IERA 4XF3A 4KWLA 1J3PA 1OMIA 5FCCA 1X82A 3LOIA 4AVCA 4YARA 2FQPA 3PNAA 1O5UA 3H7JA 1ZZ9A 1YFXA 3NSTA 4XFAA 5LRSA 3QOPA 2IXIA 2HKXA 4QXKA 4HN0A 3SCGA 3LA7A 4MV2A 2GC1A 2F4PA 5FQ0B 1V70A 3IDCB 3NJZA 1SQ4A 4EWEA 2OYZA 2ET1A 4NVPA 1O7FA 3LA2A 4JTOA 1ZNPA 2XHKA 5CADA 2BYVE 5FLJA 4XF1A 4XFBA 4HMZA 1ZX5A 5I93A 1NYWA 4R8HA 3ROUA 1CAVB 3H8UA 1RC6A 4KWKA 1NXMA 4B29A 4TLFA 2K9ZA 3E6DA 3CF6E 3DN7A 3C3VA 3RDIA 4R52A 2V09A 3EQEA 3CEWA 2MPFA 4AVAA 4WVZA 5BXXA 4F8AA 3H1WA 5EZWA 1O3SA 1ZZBA 1WGPA 1LR5A 4EWAA 3FWEA 4Q0UA 2MHFA 1RL3A 4E2SA 1EP0A 1QXRA 4MGIE 3UKTA 1OD5A 1Q5OA 3ETQA 3HT1A 1YWKA
chains in the Genus database with same CATH superfamily
2VZ1A 3VV1A 4K6BA 2WYFA 3TBDA 5JXJA 1O4ZA 2ZHKA 4DEQA 4AQ2A 2ZEYA 4EV0A 2NZ9A 2BNNA 1HB4A 2WO1A 3ZFEA 2X5IC 2XONA 1LHUA 2QQKA 2JKBA 2PN5A 2HBTA 1E5HA 4CCKA 1UZVA 4AG4A 1IS6A 5B2GB 2AREA 4P9XA 1GOHA 1SPPA 4C1XA 1PVC1 4P9WA 4MX3A 4DIQA 2JG8C 5JR7B 2UWCA 5AFBA 5CISA 1PIV2 2R30A 5DPNA 3AK0A 1S0CA 4LNVA 2V5YA 1CJPA 3I8TA 2OZ6A 3C7FA 3KQRA 3IIAA 4YW5A 5FYVA 1UU4A 4PIXA 5T5PA 2HWE2 1ST8A 3EBRA 1JW6A 5HPOA 3VBRB 5FYTA 2VCMA 2ZMNA 2BFUL 3FFQA 3AYEA 3WHTA 4AQ6A 1X9TA 1Y3TA 2Y6FA 3AJZA 5GKAC 2D93A 1Y4WA 4ZU7A 1HB3A 4EWDA 5FZ6A 3ZPYA 4LA3A 4RQPA 2YV8A 4JDMA 1KJRA 4CDWB 4ZONA 1RIRA 1T6GC 1UIJA 4ASMB 3OGSA 1RXFA 2WQZC 5APAA 3H8RA 3PTRB 4KH9A 2D5HA 5FDBA 5DDJ1 5DUXA 4OCTA 4KQ7A 3SLIA 4YYOA 4QQOA 4FAHA 4XF0A 3U78A 3BTXA 5F6KA 3LQCA 2E53A 1PGL2 1C8M3 1HN1A 2W2IA 2RS53 2XJQA 4LEJA 2D6KA 3UESA 1F2NA 4LHLA 4LOSA 1LHNA 4BIFA 5J48A 3MPPG 3WY6A 4QX2A 1SLBA 2Y0OA 1ND3B 3WX5A 3M70A 2WUHA 2V72A 1CX1A 4XZUG 1PMHX 4XC9A 2HWF3 1JS9A 3LDRA 5EJ3A 4CP0A 2WNUC 1APNA 4WV8A 3RZHA 1AR82 4XDPA 2XJRA 3VZJA 2EVXA 5JIAA 5IAXA 1S0GA 4OHXA 2A73B 1W05A 3AFGA 3AZWA 4C90A 2WS93 3U37A 1W3VA 3K3OA 3ZXJA 1OOPB 4OHYA 3D0SA 2QQUA 2A5ZA 3NVCA 1OUXA 1W0OA 3MFAA 4AE2A 1ZRIA 2TBVA 4YZ4A 4YZ1A 4Q4X1 1COV1 2IFRA 4MUVA 4QQLA 4EYUA 1HQWA 3N9PA 1YCIA 1YI9A 4L92A 5JSPA 4JQRA 1PO21 2DF7A 3CDZB 4IW3A 4YNIA 1UF2C 1O3RA 4U2AA 4XHXA 1K5JA 4CEWC 2IXKA 1QNWA 5I0DA 4NR1A 5LCWL 2X29A 2VAUA 3JZVA 4H2AA 4QGLA 3IMNA 1W28A 3B5LB 4R9DA 3FBYA 4NRQA 2B45X 3LOBA 5A3MA 3M7AA 5LA2A 1RUE3 1MACA 5DZFA 2VXRA 2DWRA 1GYKA 2DCYA 1B09A 5GLWA 3ZPOA 1NCQC 2YMZA 4M00A 4YVWC 3ATGA 1CZVA 1V9U3 5CZKA 1LOFA 1KFUL 1O3TA 4A45A 2VNOA 1UKGA 1JYIA 2BBVA 4NE9A 3GCXA 3WNPA 2VVDA 4XUOA 2VQAA 1CJDA 2GC3A 5KWRA 2E32A 3CZJA 5BNNA 1ZRDA 4RR3B 5IK7A 3IN9A 2VQUA 2E33A 4ZZ5A 4Q4V3 2WT2A 4D69A 3WQ7A 1AJOA 3AMNA 3GBFA 3MEPA 2EF6A 5JAXA 3PUHA 2IFWA 1W6MA 3GBWA 4DB5A 1KS5A 4YM2A 2W68A 3ES1A 5BNPC 4LMFA 2GN7A 4RGAA 1IPKA 3E6CC 3KLSA 4CYDA 5IVVA 2VXJA 5FZIA 5KHJA 2E7QA 5GZDA 4PDWB 2QQLA 3WF3A 2XOMA 1D2SA 2JDZA 2ZX1A 2VU9A 5ERLA 5JXIA 2K0GA 4D6SA 4DMIA 1AX0A 3PURA 4YLZA 2V73A 2YGLA 4CUCA 2R043 4I0WB 3RZJA 1H6XA 4LIVA 5FPUA 3JD71 4NIDA 3LGRA 2XJVA 2YC2A 5L9VA 1L7LA 4QX0A 1G9AA 4Q4V1 3ZMNA 4N8MA 3TEWA 5G04L 5A3TA 3RZKA 4YM1A 3I4IA 1GQGA 2UYAA 1AR71 5FZ4A 1RXGA 3ENRA 1MZ5A 1RUH1 4RHV2 2Q1MA 4CU9A 2DU0A 4CEWA 1D4M2 2NQYA 2YUEA 1PK6B 2OKXA 2ZGMA 1I1EA 2PLV2 3UL2A 1PMJX 1HRI2 2VUJA 4QAWA 4QHOA 5D1IA 3DL3A 4C0BA 2KXLA 4QM9A 1QJFA 3IDBB 3AX4A 3U4SA 4BQ1A 1S0JA 5FFOC 5K0UC 2XLGA 1TME3 1Y9QA 3UK9A 4XMIA 1VIWB 3MPBA 3NL1A 1MS5A 2A75A 4O61A 3D4KA 4PBOA 5BNOA 4JKMA 4YZ5A 1RVF3 3ZYIB 2F4LA 1ZBE1 1BQPA 3EHKA 3LDBA 3QH7A 2ES3A 2ID4A 3B3QE 4GKYA 3KT7A 3U07A 3VKOA 3VKFC 4D0QA 3LFMA 3CZUA 4CCDA 1SLLA 5KHKA 5DAWA 4AEMA 2BPA2 2P1BA 2RHPA 2JG8A 3ECQA 3OBZA 4XBLA 2X05A 5FK7A 4HPKB 4GQ7A 3JB4C 3DXTA 4AF9A 3ILFA 2GNBA 3IM0A 1WMDA 1CVNA 1QGLA 2ZKLA 2RS32 4WM7A 3VBHC 3H8XA 1JUHA 1Y9GA 4LKFA 1J3QA 2XPJA 2QQMA 2QQNA 2QUOA 4Z82A 1AR92 3W9AA 2BFUS 4FPKA 2A3XA 2YXSA 1WBFA 5FYSA 4QD2A 2P6CA 1GP6A 1HRV1 1RUJ1 3RMYA 4OHVA 2DBIA 3KGZA 3PU3A 5EIYB 1YEWA 1QU0A 3MYXA 2BP6A 2PELA 2OS2A 4N7IA 2YROA 3I59A 4A2UA 2ZZJA 5FZOA 2CWSA 5H9PA 1PZ9A 4YZ2A 1EAH1 2B42B 4GIQA 1G8WA 4JC1A 4O9GA 4Q0SA 1PHMA 2EXKA 5F6LB 2FDIA 2KA3A 4P9YA 4RR3C 4XW3A 2XH6A 3PVBB 1ODMA 3HEIA 3ZYRA 5M0TA 2D97A 5FJHA 5I0SA 3LPFA 2C0ZA 2VQTA 3UYJA 5FMCA 3NWKA 4LK7A 3DPRA 1UYZA 3WF0A 4JV4A 1LHVA 3MI8A 4LBQB 2Y6HA 3AP4A 4B4RA 3RZMA 3VBSB 3NNJA 2ARBA 3N4MA 4AEDA 5IT6A 1YYNA 5A7WA 5AC92 4E8CA 3EO6A 1RVF2 2WS91 2VCAA 3ZYFA 4YW7A 4WM7C 3O1SA 2VZQA 4E4HA 5A3PA 4YRDA 1RUJ3 1TZOA 1AUYA 2DUQA 2ZXQA 2A71A 2QNKA 5DN2A 3PMSA 4ORFA 4UFIA 4G9SB 5K0UA 4JRAA 2W08A 2ZGRA 4URAA 3FX3A 4INDA 4IEWA 4PIZA 3JXSA 5FZBA 3WCRA 3O1PA 1HB2A 1I5ZA 2C6SA 3OPWA 5FPZA 5BNQA 3B02A 2WSVA 2E6VA 1AR93 4B1LA 2VR4A 4FQ4A 1NKGA 4IV3B 2ENRA 4DUVA 1V00A 1W6PA 2VBDA 2W46A 3BTAA 4F3JA 2QDRA 3AKTA 1CAXB 2AR6A 5I8SA 1RJ7A 4MADA 4X6QB 2X5IB 5DMYA 2GZWA 2LS6A 2VUDA 5FYIA 1ULOA 2E7AA 3BN6A 2WWSA 4XQDA 2VBBA 2ZA9A 3RG0A 1S2EA 3O1MA 4JAAA 1RUOA 5LBBA 5TSWA 1WLDA 2GU9A 4XJWA 5FK8A 3AP6A 4OI4A 4HLTA 4LBNA 3VBRA 4ZS2A 3NNLA 2BV4A 2UWBA 1HRV2 1OFSA 5L9BA 3APBA 1CAWB 1H1IA 5LA1A 2CGOA 1RUI2 3IT8A 3P6BA 1BK0A 1DLLA 4KU7A 5DDJ2 5A7PA 3RFRA 4AI0A 4PIYA 3VD9A 2TEPA 1AYM2 4Y24A 1N1VA 2QKDA 1ACCA 2R1BA 4ONUA 1MS9A 3WF4A 4Z8BA 4YWAA 1D4M3 1LGBA 2BQPA 3AVSA 4YW2A 2X09A 2PAKA 5I91A 2Q8DA 1DGWA 4X8NA 1DU3D 4MSVA 2O14A 4AVTA 5K8SA 2HWE3 4LO8A 3USUB 4AVVA 2WT1A 3BPSA 2CGPA 4NIAA 5A6ZA 1NLRA 2XJUA 5FREA 4DXSA 1TMF3 3I54A 1PX3A 5FXVA 4MLOA 4IETA 2ZEWA 1F15A 3SEPA 4CDXA 4LBMA 1CAUA 1J1LA 1ZBA1 4MO3M 2R041 4IV1A 3SH3A 4BQXA 3TEYA 4Y1YA 5FPXA 1O91A 4Q4W1 5GM0A 1F35A 5A3NA 3VBFC 1FNZA 1VALA 4CEYB 5ACA3 2QZ3A 3OPTA 3OCPA 4XMAA 2HWC2 1GZ9A 1GZCA 4BQYA 1D0GA 1W6OA 1X8MA 2SBAA 4GMP1 1BHGA 3A21A 1QJU1 4S2HA 3VDBA 1PO12 1O5LA 4Y33A 1QWRA 2JDHA 1HLCA 5DUWA 1X8EA 2JICA 2HWE1 3WUDA 4COVA 3HIFA 3Q8EA 3VBSC 5C9AC 3WF2A 1GNHA 2AEZA 4MGQA 1W04A 5FMOS 5FY1A 4OHZA 2H6BA 5F2SA 5IJRA 4CTEA 2J1VA 1OVPA 4UT5A 5GLUA 3RYRA 4D7SA 1STMA 4HETA 1LHOA 4M4PA 4QPIC 1W9YA 5CFCA 4OI0A 1KFXL 4K9SA 5DAXA 1H8TC 3MIFA 4CDQB 4LBJA 4BH9A 2DVFA 4HK9A 2QQVA 2B5HA 5T3NA 4IEYA 1F8VA 2FCUA 1BVVA 2WFF2 3N9LA 4IGQA 3U11A 3JUUA 2R49A 3RQ0A 3H7YA 2FBEA 2LW8A 1VBD3 1XE7A 3I2JA 2X5IA 2CSGA 1W03A 4NPLA 3S6PA 4CU8A 1KDMA 4YVWB 1DBNA 4IERA 3T0DA 1QKQA 1N47A 4NHKA 5D21A 4XF3A 4KWLA 3R4UA 3WQ0A 2RS52 4CCMA 3J26N 3P3NA 4GB32 4DY5A 3AZXA 4TYSA 5FP4A 5C8CB 1ZBA3 4Q5OA 2VMCA 2VVFA 4NO4A 2HWD2 4AVCA 2A70A 3N3HA 3O1VA 3I3MA 3RZGA 3K4AA 5HCAA 1GNYA 1SLTA 3H7JA 3MO4A 5IFPA 1ZZ9A 3A23A 3NSTA 5JMCA 1VB4A 2NM1A 3RWNA 1GOGA 2BUKA 5FZEA 2CHHA 4QXKA 4MV2A 4YVSC 3I49A 2D7FA 2GC1A 3TEXA 3OOXA 2ZX4A 2NMOA 1UO9A 3ZFFC 2ET1A 2G9ZA 4NVPA 4BISA 2E7TA 3OEAA 1KXGA 4BDVB 1S0IA 3KF5A 2PLV1 5FP3A 4TZDA 2ZPXA 3IDEA 5CADA 1AR61 3MICA 3T2TA 2P3KA 4KBZA 5F7UA 5A6XA 2XHNA 3NJVA 4IGPA 2ZABA 4LBQA 4QB1A 3D6EA 1JHNA 4LO4B 4OI1A 3MLKA 4TTGA 4KG8A 4LLFA 1OF4A 1OXCA 1QH7A 4TLFA 4FTEA 1V6MA 3TN92 2R042 1TME1 2R0HA 4RYDA 3DN7A 4AFCA 3BI3A 2YFUA 5FIXA 3HQRA 4LHNA 1KDKA 2V09A 3LPGA 4XUQA 4YM3A 5C3PA 4WVZA 1NA1C 1US3A 5BXXA 3PVNA 1GSLA 4WVVA 5A3OA 1F4AA 4JGZC 2O8OA 2D3PA 3KD4A 1ZZBA 4IL7A 1O3SA 5JI9A 2A3WA 2GMPA 1EPWA 1SDDB 3VHPA 5KC6A 2XVGA 1RL3A 3A7QA 3KHBA 4K40A 4E2SA 1WD4A 2NP0A 4MGIE 1Q8QA 1D0HA 1QDOA 1BZWA 1JZ3A 4COZA 3U14A 1YWKA 4I30A 3VL8A 4FVVA 3EB7A 5D8AC 3C7OA 3D8CA 3KMHA 2DTWA 1ULDA 1DQ4A 2WNVB 5E1RA 1DG6A 1YRZA 5A33B 4URTA 2AACA 1ULGA 1W2OA 4PJYA 1YI7A 3TN93 1PVC2 2PFWA 2RDRA 1OA3A 2VPVA 3J4UH 4MGZE 3CHXA 3H9AA 2FMDA 4NUBA 3B00A 4WZFA 5IFTA 3C7GA 3GBGA 2PHTA 4MHRA 3F2ZA 4QPIB 2PQSA 1JYWA 4P9GA 3VLBB 1OT5A 4QKFA 1HXS2 3WDXA 1UYPA 5FLIA 4BIOA 2BGCA 3AL6A 2DVBA 1FOD3 3Q8FA 1PM7A 3KF3A 1PNFA 1REFA 3OD4A 4Y3OA 3WNKA 1QXPA 3GCWA 3HPNA 5FMOL 5LY2A 5FY5A 4J6GA 1GQHA 3J8F3 4BA6A 3ZFGC 1E5RA 4A3ZA 3O5SA 2FDKA 3BKZA 4PLNA 1FYUA 4EN9B 3NNFA 3VB9A 4XIKA 1XQNA 2DBNA 2R6QA 1ND2B 3A0NA 5I0TA 2PMWB 3CJIC 2ORXA 1BK1A 4KI5M 2QQOA 1QXJA 4LBQD 3OUHA 1H8TA 2X10A 1S55A 4EJRA 4HVOA 1XU1A 3PVEA 4FOVA 1DYPA 2IZWA 1WCUA 4FFHA 1NG0A 2D6LX 3VZLA 1DGLA 2F6BA 5EYXA 3UKNA 1K5MB 4Q4W3 1AL0G 1H2NA 2VNVA 4N53C 4YVSB 3RZLA 5A6YA 5HXVA 3A4UA 3RNSA 4BB3A 4Z1VA 1HW5A 4W6WA 3WNLA 3B9IA 1VBD2 4N9HA 3BU7A 3F95A 5H9RA 2WZR1 1HRI3 2FCTA 2PLV3 4NIGA 4JZRA 4LXLA 4E2GA 1PMIA 1WCKA 1O6UA 3VKMA 2PHRA 4XAEA 3ZLIA 3MLLA 2VTFA 2YZ4A 4WBBA 4Y4RA 3V0BB 4IQPA 1PNGA 3K77A 4RGGA 1C8M2 1LOCA 4HT1T 5FUNA 4UFKA 5FQ0A 1GMMA 3PLQA 1OKQA 4HXCA 2AUYA 2GNMA 1DQ2A 3TEZA 1RMU3 5HV0A 4ZXKA 3CJIA 4DUWA 4Y26A 1UX6A 1RUJ2 4L9BA 1QNYA 2VOWA 5L36A 2Y6LA 5A80A 4ARXA 3A22A 4CDUC 3RZZA 3WP6A 2WQ8A 3FHQA 2ZTNA 3KCCA 1RUE2 1V6IA 4RS5C 2HWF1 1MQTA 4AEDC 3ES4A 3Q8AA 1GV9A 2W39A 1S4CA 1WCDJ 1AYN3 2ZHMA 1C8NA 5IVJA 4TWTA 1R093 3DPRC 5FZAA 4LO6B 1LRHA 3KB5A 3W5NA 2Y34A 1F4HA 1JZ2A 4R9BA 2AGSA 4YG3A 3MHZA 3WDVA 1MVEA 1ZBE2 3CJXA 1JZ5A 5K4LA 3BOPA 1WLCA 4PF1A 1RITA 2UU8A 2OA2A 1J84A 1CAWA 4LIUA 3PHMA 3OB8A 4PBPA 1OF3A 1C3HA 4GZ9A 3FE5A 3WZ1A 4MH0E 1TMF2 4AFMA 1QQP2 3O12A 4NIIA 2O1QA 4WM8A 5JPNB 3FLRA 4TSVA 4A6OA 4AI1A 4H14A 1W6PB 2GC2A 3M3OA 4Y20A 3AB0A 1CD3G 4IEOA 1JYNA 2VOTA 4TLGA 4ET7A 4Z92B 2A6YA 4AZZA 5BYNA 2W5FA 4WM8C 4JVAA 1Q8PA 4AXOA 4BJ0A 2WN3A 1MVQA 1QJX2 1AR72 4OULA 4GMP3 1W3XA 2WT0A 3U75A 2MEV3 5JWPA 1I6XA 4EN8B 1VBB3 2D6OX 4AEJA 3ZDSA 4CDXC 5L19A 3AZZA 4IV3A 3IAQA 3HAGA 4AI8A 4JDOA 1C5HA 4QGNA 3UJQA 5KR7A 4JDNA 5JZGA 3ZKUA 3DXUA 1BJQA 3H1YA 1JI6A 3GNEA 1TG7A 1AJKA 3QH6A 4FQZA 3CJIB 4CEYA 3JD72 4N7UA 5KXEA 1IKPA 1YFUA 4X8PA 5J7MA 5JZGC 1ZVFA 3D0JA 5C5TA 2O8QA 1NLQA 3ME2A 2RS51 4CEYC 2WNUA 1H6YA 1CAUB 1VBB2 3TNPB 1YQ5A 4K20A 1AYN2 1W6QA 3KVAA 4HKWA 3WQ1A 3OPZA 1AXKA 3RS6A 4E9KA 2VECA 5CFCB 2G1MA 5CKMA 2NLRA 4FOWA 4YGCA 5C4WA 4AW7A 4GH4A 2BOIA 1W8OA 1KEXA 2QQIA 4M0NA 3PUQA 5C9AB 5I0RA 1GKBA 2Q30A 3KCXA 3LF7A 3NV2A 4LLOA 4S2GA 3RWKX 4DINB 4IUGA 1BMV1 5HCBA 4OZOA 4AI3A 5IYYA 1ULEA 3ON7A 3L2YA 3SXWA 2YGMA 3VBFA 3DYPA 2ZGTA 2OQ7A 4GAZA 1R1ZA 3I2OA 1FATA 1H8TB 1BMV2 2D6MA 2K2SA 3T2QA 1SMVA 4R9CA 1ZA7A 1AX1A 4LBOA 1OH4A 2J1AA 2DUPA 2VNRA 4LOTA 2Q4SA 4X6RB 4P08A 5KXCA 4QM8A 2ZMKA 5I0UA 4RS5B 5LEJA 2WNEA 1UPIA 3E5UA 4QB2A 1SZBA 1R091 2HWC1 2Z69A 5LA0A 1ZREA 2HYXA 3MZHA 2XL7A 1SFPA 1QJY1 4LA2A 3CU7A 5A7NA 3HQXA 5C70A 4LJHA 4QPIA 5IK4A 4RFT0 3PDQA 4Y1XA 1RUI1 1UX7A 3ALQA 4N9IA 4XFHA 5H9QA 3MIBA 1IZ3A 3RMXA 2D6PA 2VMEA 2JECA 3WG3A 2XQRA 4LUKA 3ZFEC 5JLVA 2BJSA 3TYJA 5A1LA 4XUPA 5FZMA 2VGDA 1QJZA 5CIRA 4AEKA 1GOFA 3IB3A 1NE4A 5AVAA 1NLSA 5F3GA 1ENQA 4FI9A 1UQXA 4XJ9A 1W8FA 2H0VA 2R072 5T55A 2C26A 1K45A 1EV11 1CR7A 2EAAA 1QJX1 3WT3A 4QQHA 3ZXDA 3WR0A 2I45A 4CSWA 4A41A 5LRRA 5EYYA 3NNGA 1VBA3 5GZFA 1LULA 5LK5A 3GGLA 1HXS1 3GZUC 4J1XA 4KMQA 1RYYA 3K51A 1W8TA 2XBO1 3OTFA 4LBKA 5A3LA 4V2VA 2OXBA 3LFIA 3SQOA 1GLHA 5A6QA 1CIWA 3AVRA 1XNDA 1T6BX 1VAMA 4I09A 1UWWA 4XURA 1RUF2 1YIPA 1RMU2 3WNNA 4PDWA 5EWSA 3UT0A 1PGL1 1WMEA 5F5AA 1CGPA 4LR4A 1XXNA 3N9NA 1YIFA 2JENA 4UXAA 4JGZB 2QJVA 4COUA 1I3HA 1CPMA 2GH8A 2JG9C 5J98B 3V0AB 4LPLA 3ZFGA 4YW1A 4GH4B 4P9JA 3IWZA 3GYDA 5C4WB 5F5QA 4L99A 5FV3A 3HN1A 3T3YA 5B4XA 2PQQA 4EROA 2G4IA 1NE6A 3LZZA 5FO9B 2LRPA 2Y6GA 4COYA 4K8FA 2ZGPA 4ES9A 1ONAA 1RUH3 3GALA 1Z7S2 2CDOA 3HT2A 1NUKA 1MZEA 4GWNA 2WNVC 1O8SA 2RMU1 4W4ZA 1NCQB 1OLQA 3C8XA 2GALA 3KM5A 3NKGA 4IEZA 2AH2A 2X8KA 3JCIA 4XETA 4Q4Y2 1OQ1A 1W8HA 2ADDA 5LEKA 1ENRA 1VLNA 1QQP3 1YHFA 4XEZA 3AC0A 5IVEA 3NV4A 1OVSA 3WDYA 3S0MA 2JIJA 4J25A 3GJAA 2OUJA 4BQ4A 3V65A 3CL1A 4UYBA 4XTPA 4BWOA 4TN7A 3URFA 2D6NA 3NW4A 5IK5A 2Z2SB 2ATFA 2I74A 3GZEA 1UXZA 3FJSA 4YW3A 1W06A 5FYUA 1UAIA 2P3JA 4Z2WA 4GWMA 3I2GA 5FOBB 1TE1B 5ANNA 4PI0A 3V0AA 4CRQA 4EN0A 2HWB1 1QJEA 2Y38A 2YC4A 1SPPB 5FY8A 4H7LA 1S0DA 2V4AA 3POBA 3KQ4B 4A3XA 3TWIA 2RR12 1EAH2 2W0XA 3KS7A 4R4XA 1VRH2 1FMD2 5FKCA 1WCQA 1BCXA 1OD3A 2R16A 1K5MC 1JYCA 1MQTC 3ZN4A 1SLAA 1H4GA 2QFEA 4CCJA 2YPDA 4OMCA 1GWKA 3U1XA 4XFIA 1P8JA 4OQ8A 3VD3A 4FPYA 1QH6A 1OI6A 2VO5A 1H8VA 5FYHA 1PO13 4KGGA 4XTMA 2NPIA 1BEV3 3KGLA 4ATFA 2IC1A 5BNNC 4QT6A 2Y6JA 2C1FA 4AAXA 5DAVA 2WFF3 2GP5A 1FV2A 3H1MA 1Y43B 1UYYA 2L9LA 4QKNA 1EY2A 1MR5A 5GALA 4A44A 4BZ4A 2XWJB 2KM2A 3M2MA 5FZGA 1MZ6A 5FZFA 3QACA 1ZZ6A 2R063 2ZOEB 4CVUA 3N7KA 5D2AA 4Q1PA 1XYNA 3OF1A 4Q8KA 4KBBA 1CWPA 3AMHA 2O0OA 2EAKA 4FT8A 4MG2A 5IAVA 1V6JA 4O65A 2RMU2 2V4VA 1DGRN 3JQWA 3S5AA 1HB1A 1H1AA 4YGEA 1J59A 2DFCA 5T5JA 4CDUB 2DCKA 1IPSA 3O1RA 3ZSEA 3KV4A 1GU3A 4NOTA 2XG3A 1HKDA 1POV3 5FUIA 3ZYBA 4HVQA 2GH2A 3ZXFA 1ZZ8A 3K2OA 4BQ5A 5FZ9A 5IWFA 1YJLA 4PT6A 2WWJA 3I3BA 4HVRA 3AZYA 4NHYA 1NCRB 2OUHA 5E6HA 1OMIA 1UKRA 1Q56A 2WZ8A 1COV2 3AKQA 2Z5WA 4QPWA 4QPGC 1X82A 1R1A2 4PLMA 3T09A 1LAJA 1VBC2 4W65A 1GANA 3TN91 2YBKA 3IIIA 1K12A 2E31A 1YFXA 1QDCA 4XFAA 3N36A 3O0VA 2ZKNA 1XNCA 1IS3A 4HK8A 5FPVA 1AF9A 3LA7A 1VB2A 2F4PA 4C8DA 1V70A 1ND3C 4AAPA 1KRIA 2OYZA 1L7QA 4FPOB 5T54A 1AR62 3PUIA 1LTEA 5FYZA 3RRDA 2RE9A 3LA2A 1H4HA 4RR3A 5F9TA 1DP0A 4N53A 1O59A 3WOGA 5FAXA 5K9YA 2BYVE 1LEMA 3KV6A 3ACHA 4CDXB 1LOBA 3ILNA 4LBLA 4HMZA 1PIV3 1REDA 3CBNA 3ROUA 4CP9B 1C57A 1OLMA 1RC6A 4KWKA 4FOYA 1NXMA 4UW4A 4B29A 3IKWA 5LATA 3VD7A 1VBC3 2RDSA 3HNBM 3CNAA 3OGGA 5FXZA 3TOJA 1VRH3 4CPBD 1VMFA 1CZTA 4A4AA 3WG4A 4CP9A 3B69A 5ABJC 4XCBA 4LT5A 1QJY2 3CEWA 3KZ4C 4JX0A 4AVAA 5FY9A 5CAZA 2NN8A 2RJ2A 1ASJ1 3KWVA 3V64A 4GJYA 1OURA 4TXWA 3ZYJB 4W8JA 5F3IA 2FDJA 1DQ6A 1JOJA 2CGNA 4LORA 3UGHA 5CG9A 1LR5A 3FUQA 1GZWB 3R4DB 2HWB2 2XWBB 4MVTA 2VE1A 4DQAA 4Q0UA 3SC7X 1RINA 2MHFA 5FYYA 1RUE1 5CFCC 1SBEA 4NWWA 1QXRA 1DFQA 2CWMA 3GZAA 2P3YA 4FFIA 4IV3C 1TVGA 3NJYA 4RQPB 1R082 2XBO3 5FZ0A 1IS4A 3HQUA 3ETQA 3V0BA 5FKBA 3HT1A 1WCSA 4D3WA 3ZOIA 1MS1A 3VDCA 1YFWA 3O0XA 4KWJA 4EZHA 1XYOA 3GJBA 2V5DA 5BNPA 1V9U1 3BU0A 2B4KA 3IZOA 1F31A 3THTA 4OHWA 2R32A 2R061 3NRUA 4JCKA 1WLTA 2ADEA 2DVDA 3THDA 1OQEA 1BBT3 4GALA 4OMDA 4Q4X2 2CAUA 1PM4A 2DVGA 2XKOA 4JQTA 4K3UA 4OI2A 4Q2FA 1IGOA 2YDEA 1N3PA 2EIDA 1K42A 2GC0A 1U0AA 4WVWA 1ZBA2 1KITA 4L2NA 1N3OA 3AYDA 5E16A 2XVLA 5KHHA 1DCSA 4R4ZA 1CZSA 5SV8A 2QVSB 5ISLA 1UZ0A 2JKXA 4WVMA 5BUVA 1VBD1 5BNPB 2BVVA 3U4XA 1AYN1 3RJRA 1OC1A 4XILA 5L73A 4UBHA 4AOCA 4RGKA 5JUVA 5JCTA 4C1WA 4DZGA 1LNSA 3W59A 4QDRA 3RYPA 3H3UA 5DXDA 3MV01 5FY7A 1UXXX 1I9RA 1WKYA 2WDBA 3QCWA 5LW9A 1HV1A 4FO9A 3RGBA 3AM2A 1Q3EA 1FMD3 2J1SA 2P4EA 2QQWA 3AXDA 1O4TA 1OUSA 2B9UA 2JWPA 3WDWA 3ZXEA 2AYHA 5LB6A 2C4XA 2ZBJA 5FRAA 2OZJA 3O1OA 5BPXA 5BY5A 1XE8A 3A0KA 1UL9A 1US2A 3I97A 3HBKA 5EJ1B 3FN9A 2A6VA 5AC93 1K3IA 1SLCA 1MS3A 4AYUA 3UGFA 1RUC3 4YGDA 2ZAAA 3VGIA 4CE8A 4B7EA 2ET7A 3LAGA 2IWGB 4AL9A 5T52A 3NAPB 2W91A 4QKBA 3ABZA 4XUNA 1LKNA 2BDRA 1YO8A 3FLPA 2YYOA 1PK6C 5CEHA 3Q8BA 4B1MA 3I3EA 2VJXA 4DNYA 1X33A 4ZY9A 5LBFA 3POFA 1UW8A 1G9DA 3J7HA 3CKHA 4QX3A 4CU7A 2XDVA 1UOFA 5I8YA 4N43B 5FY0A 5K7PA 1Q43A 2J1TA 3VBSA 1RUF3 3ZN6A 3ZXLA 5LA9A 4YW4A 2WKKA 4RA0A 4UW3A 3WP3A 5L7OA 2GDFA 3ILRA 5JOYA 1OKOA 2A7AA 5FJKA 5ABJB 1D2QA 4I0BA 4QWNA 3NQHA 1V9U2 2XVKA 4RFRB 3WW2A 4D6RA 1XNBA 4RD7A 1DYKA 4KG0A 4LKSA 4GH4C 5CKQA 1JZ8A 3N7MA 1N1SA 5FYCA 3K3NA 3W58A 3POEA 1RUNA 4M4RA 2B8MA 1O3QA 1Z78A 4BMBA 3VBHB 3TNQA 3U0ZA 3GXUA 2RJLA 5FWEA 1FT9A 4GMP0 1W6OB 1W2AX 1ULFA 3PMEA 1A3KA 2RV9A 3HBZA 2WFF1 5FO7B 3T2OA 5JXHA 1VAKA 1KGYA 3E5XA 3AMQA 3RYKA 5CKNA 4LUMA 5LZ6A 3MLJA 1GBGA 2UWAA 5DDJ3 4M3CF 1GQPA 1VRBA 2A6WA 4XJ8A 4XYXA 1HJGA 2OQ6A 2YFZA 1RUG3 2ZX3A 4HANA 3T1MA 1PX4A 2W94A 1XSQA 3T4HB 4I3PA 3USSA 2CL2A 3LEMA 3VBOB 1ZRCA 2QZ2A 4SBVA 3TRSB 5CU1A 1SCSA 2JG8B 1IPJA 1RVF1 2WS92 3PIJA 4NAOA 4C91A 5HI0A 1QY4A 3AJYA 5AC91 1WUVA 3WEZA 1H9WA 3ASIA 3USUA 1S0EA 2KR2A 3BOWA 3BPZA 4LE4A 3DKQA 2C9AA 1PO11 4UFLA 4XACA 3I7DA 3N7JA 4ZS3A 3OGJA 3H42B 4HBNA 3FUOA 4AVSA 2J7MA 3ZR5A 2GP3A 1YC61 2WYSA 2HWB3 4EE2A 4OFGA 4FAGA 2Z4FA 4LHSA 3UJOA 2PHDA 4CP2A 2Q1FA 3I3DA 2A6XA 4Q29A 5IVCA 2R073 3LE0A 4BQWA 2ERFA 3JU9A 1CONA 1XOYA 1PK6A 3I59B 4AR2A 4XZPA 3RPQA 4ZU5A 4BPZA 3E5QA 5FXXA 2PXJA 4NAMA 4B8EA 1IS5A 3BIEA 3POWA 1OLME 3HOBA 4OQ9A 3PUAA 2C5DA 1OQDA 2HH9A 2P37A 4H3WA 1RMU1 4UW5A 5FZ8A 3B01A 3W20A 3VDAA 5JOXA 3W21A 1TME2 3OUIA 2D43A 1ZYBA 4I02A 4A7KA 2WZPP 1AX2A 2CNAA 4KL1A 4NWVA 1EV13 1N1YA 2P5BA 5BNNB 1HV0A 2VM9A 1F9KA 3VBOA 4AGRA 3MDPA 2OPKA 1IG3A 1ND2A 1OLRA 2YU1A 4NPMA 3WLUA 2WNUB 2JE8A 4Y1ZA 1W6NB 4IE5A 4FFFA 2JDMA 3J7MA 1NZCA 3AYAA 3M3CA 4K21A 4MGKE 2XLAA 1FAYA 5D8AB 3O1TA 4MYEA 2ZS6B 3WP5A 5JDBA 4YG0A 5FTTC 1DIWA 1C1FA 4Q4V2 5FLHA 2B9VA 4YGBA 1AZDA 4Q4Y1 4YM0A 4CA9A 3FZ3A 5HXMA 1YFYA 3OY8B 1A8MA 1DLCA 1B35A 1QEXA 2DCTA 4IEVA 3VDDB 2NMNA 3DV8A 2ILMA 2DCJA 4ISQA 1COV3 5CB7A 4HG6B 1RB8G 1AL23 3M8LA 1OBNA 2IXLA 1XNKA 4RN5A 2DCZA 2RG4A 4QU1A 1UYXA 1NY72 4XF4A 1AHSA 4CPBA 4XFCA 1QJU2 5JIUA 1FOD1 3MW3A 3S30A 4CEWB 2E63A 2WWUA 4CDWA 2Q1ZB 4W50A 3OBTA 2WO3A 3K4DA 5DUUA 1RHI1 2ZGSA 5AFEA 1LGNA 3LIHA 2WN2A 1DF0A 1REEA 3JB8A 1UOBA 4IESA 2CY6A 4XXPA 1XE0A 3MIEA 4PCRA 3UGGA 5C7GA 3GM8A 5F3CA 1SBFA 1UMIA 3IDAA 1VBE2 2VMGA 1SG3A 1XU2A 1SHWB 2VTXA 3MUZ1 1MZFA 4FPLA 4P9IA 4QHZA 5FXWA 1BBT1 1LEDA 2DYCA 1L3JA 2VVEA 4RL7A 2BTVC 4JGZA 3WW3A 3Q8CA 1LGCA 2OVUA 3P3PA 3U10A 1C8M1 1VRH1 4DS0A 2FZ2A 5DG1A 3LSDA 2UY8A 3ZSJA 3VBFB 2BBAA 2JIGA 4K1YA 4JTNA 4DRRA 2W1SA 3JBG2 3MUY1 4IEUA 1XSRA 5FZHA 4M01A 1AR83 4IDZA 3DF0A 5J3UA 2D5FA 2D3SA 4YG6A 2G19A 3MF6A 1T2XA 1UNBA 2OT7A 3AMPA 1CAVA 2WAAA 1VMHA 3FHIB 4HPKA 3CO2A 3J8F1 3OSDA 5CFDA 2Q0AA 3LB9A 2DTYA 4YFZA 2VZPA 1LOAA 2ZMLA 3FMGA 2X53S 1W9TA 2PAMA 3J9SA 3PIGA 5FBJA 4JKKA 5C3SA 4FPJA 4PDWC 1UY1A 3BVCA 3NV1A 4U36A 3JBG3 2YY1A 2R7EB 4QX5A 4UFHA 5FOJB 3AKSA 2JB4A 1G6NA 5JSRA 5JMOA 1HIXA 4QGMA 3QLQA 1HQNA 3R05A 3WUCA 4G3YC 1H30A 3SISA 4WVMB 4GWIA 2XB6C 2VOKA 3ST7A 4DFSA 3WV6A 3WDTA 1JUIA 5FZ3A 3OD0A 4CU6A 3WXPA 1FPN3 2WRAA 4NHMA 3VKLA 5A3UA 4P5HA 2FD8A 1Z7S1 3DUIA 1NT0A 1SLIA 1VE0A 3VZMA 1XPWA 3GHNA 4FPHA 2P34A 1U5IA 2WNVA 2BU9A 4HONA 1UU5A 3MBWA 3IMMA 2J1EA 2ZEZA 2VUAA 2VZOA 1ALYA 4K7JA 3B93A 4MZUA 4NMIA 4ZU4A 5FYBA 4L11A 5FZLA 2B39A 4IEXA 5BNOC 1G9CA 1L7RA 2JXAA 4AFBA 5ABJA 1V6KA 4UAPA 2ZAHA 4NN0A 5CFDB 5LK7B 4O9EA 4S2FA 4Y5TA 2XXZA 2VMHA 3S7IA 1LU2A 3NO8A 1KS4A 1OPOA 4QQPA 2XQXA 4Q4Y3 4AGGA 4FOQA 1EUUA 3MIGA 4FXGB 3LWCA 3DECA 5HV4A 1GZWA 1MEC3 2RM23 3KV9A 2CTVA 3ZFFB 2VZVA 2AC1A 5E88A 2ARAA 2YG0A 1C5IA 3VBRC 5C3OA 4LITA 5IATA 4DY3A 2QBXA 1CX4A 2D44A 3AXEA 3CIHA 5E8AA 5FP9A 1AR81 1D4VB 4ZZ8A 3OEBA 5JPMB 2EIBA 2DV9A 3WNOA 4BYYA 1D7PM 3OBAA 4DXTA 5C9AA 4AI2A 4QXBA 4ZPIA 1RUC2 5GLTA 3ZKYA 1W0NA 2RS11 4Q4W2 1KQRA 4ZKTB 5DZGA 2HWF2 4A7ZA 2Y26A 3OJBA 4NRMA 4K8RB 1URXA 2VL4A 5AVPA 3AFKA 3KCYA 4QDQA 3K75B 4W6XA 4XQ4A 5EJZB 1RUI3 4MXVA 4M0HA 1BBT2 2ZCWA 4IEQA 2XJSA 4Q4X3 4D7TA 3WSOA 2VC9A 3AL5A 3ZSMA 1WW7A 2P2KA 4AHZA 3CQOA 4JHZA 3LCPA 2XUEA 2VD7A 4ITCA 5EV7A 4LTAA 4RS5A 4LHKA 1JZ6A 4QU2A 4OUMA 2HEYF 3HMYA 2W52A 3O0WA 4DPNA 1RJ8A 3R4SA 3LEGA 3ZX7A 3VL9A 3B94A 3NV3A 4XCAA 4HL0A 3H50A 4Y4YA 3N35A 2DUOA 2WA3A 3SCHA 1WMFA 2Y8KA 3R6SA 1A78A 2JDAA 1YNAA 4GXLA 2Y64A 4MHUA 1FNYA 3J8F2 1Y7BA 4SLIA 1MPXA 4Q0QA 1GZTA 5FMBA 2Q8CA 1DZQA 1ZM1A 2EICA 2VZTA 1OOPC 1UZZA 1PIV1 1HQLA 5J36A 1YQ8A 1OH3A 3I2IA 2ZJCA 1A34A 3NMBA 2PAEA 1JU4A 1GICA 1RUD1 2ZGQA 3NKTA 4YVSA 4CCCA 3S57A 5GJ6A 3JBG1 5A32B 2CAVA 5GLZA 2JDPA 1U5YA 2VZSA 3ZFFA 2VMIA 4E4ZA 1MEC1 2RM21 1Q8OA 5GZCA 2F17A 3M4FA 3W5MA 3RI9A 1X7NA 3FBMA 1GUIA 3WG1A 2FCVA 3GDBA 5F8PA 3I3QA 1R083 1W9WA 4NJ4A 2ARXA 2W3JA 1DGRA 1FV3A 3OG2A 3POYA 2A6ZA 4OUSA 4PQ9A 5EP9A 5IVFA 5J96B 5FP8A 4XQWA 2ZGUA 1AR63 3M1HA 5C33A 2VCBA 2JDKA 2YC0A 5C6CA 2D40A 1ZZ7A 2MEV1 1JYVA 1FPN2 4F83A 1Z0HA 5C3RA 1RHI2 1ND2C 3E1F1 4UFJA 3EYPA 3THPA 1B35B 1J3PA 3AP7A 5BNOB 3WD5A 2A3YA 4JGYC 1ENXA 1V6LA 3LOIA 1GFF2 4P9LA 1PVXA 2HWD3 4YARA 4BLJA 2AZ5A 4NPRA 3PNAA 3WNXA 2WQ4A 1O5UA 2BRTA 3BUCA 5FP7A 2BVBA 5FZ7A 3ZXKA 2VG9A 5LRSA 4XHBA 4YW6A 3QOPA 3ZR6A 2IXIA 2HKXA 1RUD2 3MFCA 5H9SA 3ZXAC 4OYUA 3AYCA 1IQDC 5FQ0B 3NJZA 3IDCB 4EN7B 1SQ4A 4EWEA 4BM8A 3SKVA 1NZIA 4ES8A 4ASKA 1RHI3 3LSEA 2FDHA 2WNOA 1X50A 2XR4A 4JTOA 1ZNPA 2WBKA 2WO2A 4A6SA 1D4M1 2VULA 4XF1A 2XJPA 4XFBA 1W2UA 2GNTA 3N9MA 4EQVA 5ACA2 3WQBA 4D6QA 2ZGOA 4FFGA 2VZUA 1NYWA 1CAVB 3H8UA 2YPJA 2W1UA 2ZX0A 5GZGA 2GNDA 3VN4A 3KHCA 5F32A 4CUBA 4YFWA 2H0BA 1TMF1 2W1WA 1DQ1A 2K9ZA 1J1TA 2AENA 5FPAA 5FMDA 5IVYA 4NROA 3ZYPA 4FPEA 4R52A 3MV11 3EQEA 1VBE3 1W8ZA 3ZSLA 4F8AA 1W9FA 2KD7A 2WZEA 3PJQA 1JXNA 3VUOA 3P1IA 5A3WA 5FR3A 2FDFA 4FCAA 1RUC1 4EWAA 1LJ7A 1NA1A 1WA6X 4DUXA 1AR73 4QX7A 2VNGA 1HJFA 5DZEA 2VZRA 4BCUA 3BGAA 2DDUA 5GLVA 4UF0A 2BGOA 1QJU3 2B46X 1JMUB 4ZHNA 1W6QB 4IV1B 4UI9L 5CYYA 4IEPA 2OIIA 1LOEA 2BWAA 1F5FA 2ZHNA 4QX8A 3VDDA 2EIGA 4AQSA 4D94A 1QOOA 1ULPA 1RUF1 1VJ2A 3NJXA 4XBQA 1G7YA 5KBFA 5LWBA 3ZYHA 1WW5A 1O8PA 2UURA 1BYHA 1U12A 1H0BA 4B3NA 3VDDC 4JHTA 4WZCA 3VBUB 4CCEA 4XJUA 3HVDA 4ISRA 1WW6A 1JOBA 1ULCA 2YU2A 3DGTA 3I2HA 4QXCA 3T0BA 2BEOA 2EIEA 2IXHA 4BU2A 3FL7A 4QMAA 4JRLA 4GD4A 2ETEA 3KSCA 1LCLA 2FHRA 2WZR3 3INAA 5A7OA 1BEV2 4BK4A 4UBGA 3T08A 4BXFA 2ZX2A 2VW2A 2P3IA 4Z2AA 1TNRA 1PZ7A 2W47A 2PYTA 4LO5B 4S2DA 1NAEA 1QF3A 1U5ZA 2EXIA 2VBPA 3M3IA 1AXYA 4YZ3A 3B9CA 5FPLA 2QTWB 4I2OA 2BGPA 2PA7A 2ZZQA 3HR9A 5BV6A 5L7OB 4FTSA 2PTMA 5J37A 4IXLA 1B35C 2HJIA 1UZYA 2YBSA 3UV9A 1DQ5A 1SEFA 4GKXA 2CDPA 1ZZCA 4CDQA 5C8CC 1DGWX 3G7DA 3PJYA 3DYMA 5EHDA 2RJKA 3K46A 2GN3A 1NOVA 5LY1A 2WABA 3ZMOA 5KHIA 1J83A 1IQAA 5FZOB 2VH9A 3T30A 5J09A 4IE4A 1ZA4A 2BZDA 3MW4A 5LBCA 1UMHA 5G05L 3L9JT 1E5SA 1JYTA 1YQ2A 2QE3A 4V1PA 1JN2P 1C28A 1YUDA 1UOGA 2HEWF 1QIQA 2XJTA 1U5XA 4LKEA 2DFBA 1OHFA 2LALA 2VUCA 5KXBA 2RS13 4XJZA 1UCXA 3ZN5A 4WM7B 5KHGA 1DZTA 1YQ6A 5C8WA 1LU1A 3GHMA 3MW2A 1G9BA 3PVOA 3AP5A 4KU8A 2CU5A 4DXZA 5FBZA 1AL22 5FO8B 2JE9A 4Y5SA 3E97A 3FLTA 4NRPA 4QXHA 2R0FA 4P02B 2WC2A 1N1TA 3O14A 1OA2A 3JD73 3LDKA 3HNYM 2VQ0A 1NA1B 3H3LA 2DURA 2FZ1A 2RS33 4W6YA 1AR91 2WLQA 1POV1 2Q5TA 2WAOA 3S5QA 2XGXA 4DO0A 3O7OA 4N90A 3RVHA 1WD3A 1WZXA 2BNOA 1YJKA 2JDYA 4GWJA 4HSJA 4FSJA 4YVWA 1S2BA 1OSGA 1CPNA 2IXJA 2UY9A 4NHXA 1UIKA 4ATEA 3ZM8A 1IKQA 5A1FA 1WMXA 1PO22 1J58A 1JZ4A 2VMFA 2JB8A 3ZDVA 1AYM3 2JDUA 3L2HA 2ZACA 1EV12 4IV1C 1V6OA 4MGYE 5CFDC 1NCRC 3BB6A 1ZRFA 3ZIWA 3OYWA 4DRVA 4EN6B 1R64A 4DXRA 3UNPA 4MXWB 1H2LA 4QPGB 4IE7A 2BW8A 4D8MA 1E57A 1QQP1 4IGOA 1EAH3 1PVC3 3LEIA 4N43A 3ZFEB 4CXWA 1OOPA 3WW4A 1TQ5A 3DKWA 5EFUA 4H7MA 3ACLA 4L0PA 4XXAA 3TB0A 3VBUC 1Q8VA 1LESA 1R1A1 3ZIXA 2R062 3NNMA 3J7LA 2RDQA 3VHOA 5JVVA 2W9XA 3PTYA 4CUGA 3LIGA 2AEYA 4PI2A 2WR9A 2MEV2 5T50A 4XABA 1POQA 3S7EA 4FP3A 1UOJA 3FC0A 4J1WA 5C8CA 1BKZA 3D3AA 3OBRA 2HEVF 1S0FA 1QJY3 3UKVA 3JQXA 3IAPA 4M3CE 3KVBA 3WG2A 4GA9A 4K1ZA 2WFPA 4AQTA 4CXXA 5D8AA 5F2WA 5JXGA 3Q9OA 1UPSA 1RUG1 1XB9A 1XJAA 2J22A 2WINB 2ZGNA 4BK5A 2HWD1 2PHWA 4FP2A 4HKOA 3ACGA 4I01A 4Y22A 5F3EA 2H6CA 4HKLA 4BE3A 4QX1A 4B4QA 2RS12 2Z79A 1QHDA 5A33A 2VW0A 1Z7S3 2WLPA 4LQRA 1H1MA 3G6JB 5FUPA 1PO23 1FPN1 4N53B 1J3RA 2FMYA 3KT4A 5C4WC 3EXUA 5DUVA 1UY0A 3OGVA 1W8NA 3ITQA 1X9PA 3ZO0B 4F7ZA 2UYBA 4BMEA 1UD1A 4XFGA 5SV5A 1JH5A 4B4PA 3ZSKA 4XJAA 4QPGA 5CNAA 5EPAA 2WL1A 1BLZA 1LECA 1WBLA 3C7HA 1NQDA 3N9QA 3O1UA 1GP4A 1W8UA 2PHXA 1GR3A 4HN1A 4O7XA 5IHRA 1EUTA 1Q8SA 2J42A 1K5MA 2C24A 2JE7A 2WO7A 4FBFA 2IVJA 3E6BA 5FYMA 2GAUA 4XUTA 5T5OA 4AHXA 2E26A 3SMHA 2Z42A 2EALA 1NCRA 4LKDA 3WP4A 4OUEA 3LD8A 4CDQC 2WA4A 1DHKB 2RR11 1RUG2 4XOGA 1S0BA 1XC6A 3HNMA 2Y0IA 4NIHA 5LASA 4PHZA 5KXDA 1UY4A 2LTNA 4XF9A 4MGTA 2G9GA 3HD8B 2GMMA 4FXKB 2JJ6A 3V56A 1KD7A 2R1DA 2IVIB 4Q0PA 2QDNA 2BNMA 2ZGKA 1LOFC 5HCFA 3TAYA 3WW1A 2BERA 3T2PA 4UW6A 1S2KA 5CA6A 3H3ZA 4R9AA 1YQCA 3ZYGA 2Y6KA 2HYKA 3IBMA 2XL9A 4IE6A 4Q0VA 3OY8A 1LODA 1VR3A 2WSUA 3SHRA 1FX5A 1AVBA 2MNGA 3IPVA 1FOD2 4JGYB 2RMU3 3BALA 1VP6A 2FDGA 1NY71 1SFYA 4XIOA 2HBUA 3B7MA 4PF5A 1GWMA 1ND3A 3BODA 3HJRA 4KGQA 2WJSA 1XNAA 3KT1A 4QKDA 5FZCA 3FFZA 3EJKA 1S1AA 1MQTB 3MGUA 4BHPA 5HCHA 1XBFA 3BYWA 1W6NA 1NX9A 4OLLA 3RI8A 1IHMA 4I3GA 2J1UA 3N9OA 3RSJA 4GULA 4AFAA 2ZGLA 1JYXA 1C1LA 2DVAA 1WA4A 3QBQA 3C7EA 3AZVA 4P14A 4QB6A 2N7GA 4META 1DYOA 5A1AA 2A1XA 2P17A 4AVBA 3NAPC 1HDKA 1MS0A 4FPFA 1VBA2 1EYBA 3H8OA 4CCNA 5IUQA 5IK8A 4RSUA 4GJZA 4AK3A 4CCOA 4CZSA 2C9KA 5FPBA 3BIWE 4DOUA 1JODA 3ZN6B 4Y5Z0 5I8TA 2E9QA 1F5JA 3T0AA 1WLWA 4XFFA 5C3QA 1HN0A 4Y1UA 5JI7A 3PL0A 1G9FA 3D5OA 4G4FA 4MGSA 2EXJA 4UFMA 1LB2A 1ZBE3 3OGRA 5KC5A 3T1LA 3M3QA 4FPGA 5DABA 3M3EA 1VPHA 1ODNA 1UY2A 3AKRA 3KV5A 2LUWA 1WWYA 3VZOA 5JR2A 2OW4A 4Z07A 4LE3A 2DU1A 4LULA 2PHLA 3VHNA 3VKNA 3VHRA 2P6HA 4KNCA 4QPYA 1OA4A 3OUJA 5F5IA 4XE9A 4D7YA 5FWJA 1JHJA 1OPMA 4M3CB 1YLLA 1SBDA 3CLPA 2RVAA 3SITA 4UOJA 3WF1A 2QQPA 3AP9A 1PZ8A 2WZR2 2YB7A 3LA3A 4BLIA 1E5IA 4HSLA 1PGSA 3D82A 3I2KA 1QMJA 3DYOA 5HBAA 2VW1A 3BTYA 1NXD1 4E4DX 1MS4A 4UF0B 3H0OA 5A7WB 1CESA 2QCSB 4LO7A 4Q8LA 4QDSA 1W39A 3BTZA 1CQ9A 1C4RA 4AGVA 5DG2A 5E89A 2I2SA 1SCRA 1W0PA 2IUWA 3VBOC 2BOJA 3SKJE 5ACA1 4GB31 4M3CA 3VBHA 4KWUA 3DCQA 3ACIA 1ENSA 1QJX3 1ZRRA 1QOTA 1R081 3BCWA 4AFDA 4A42A 5T5LA 4FPCA 3POJA 1IOAA 1I5PA 3AKPA 3DEMA 3I2FA 2BWCA 4OVEA 2EA7A 3ZFGB 4ARYA 4YSFA 4RHV3 3POGA 2ZHLA 3IPVB 4JGYA 5F39A 1UY3A 2XKPA 3GF6A 3P5BA 5EXOA 1H2MA 2B7YA 5JOZA 4LK6A 4E2QA 1M06G 2PHUA 5L7OC 5JOWA 1ASJ2 1TNFA 2VOXA 4Q1RA 1G86A 1FMD1 2TNFA 4BQ2A 4CP1A 2XLFA 1FXZA 1WW4A 1HRV3 1VAVA 1UN1A 2JDNA 2W92A 4ZXEA 5JSOA 4I0AA 2VZ3A 4MXWA 1UU6A 5A32A 1OFNA 3POSA 1A8DA 3OYWB 4Y1VA 1VBE1 4XBNA 3WVJA 1BXHA 1R092 4IE0A 1RTVA 1W90A 4GB33 2Q8EA 1LENA 5C71A 3R0RA 1M4WA 2OPWA 1SFNA 1XRUA 4H55A 5DAQA 3SH5A 2VTXJ 3PU8A 4JKLA 3SNMA 1YXWA 4CXYA 1W9SA 1CAXA 2RS31 4E4SA 3ELNA 4RQPC 4XPVA 5EQUA 1DZRA 2G9FA 2XBO2 1AXZA 2W95A 1W8WA 1W2TA 5F5CA 1POV0 3PUSA 3GZTB 1VBA1 5B4NA 2JEMA 1W6MB 3K48A 1MEC2 2K46A 2RM22 4BQ3A 3RJ2X 4COWA 3SCFA 2R071 2RDNA 1HX6A 3VBUA 5K0UB 5C5UA 2IXCA 2JG9A 4QHBA 1FI2A 1VBC1 4Q27A 4HOOA 3VZNA 3THCA 4CDUA 3ORJA 5ANQA 1XYPA 2TUNA 3X29B 4CUAA 2W1QA 3SEEA 1RGSA 1V0AA 4HZFA 3ZVXA 4L97A 1IG0A 3C2UA 5IW0A 3POIA 1R1A3 2PHFA 1CIYA 3WHUA 5F1RA 3VD4A 3QD6A 4XDOA 5CG8A 1PGW1 2JG9B 2JD9A 4BXSV 1N3QA 4AEDB 1SACA 2YBPA 1H2KA 1JU3A 5L9RA 3WCSA 3AMMA 1NCQA 4QQ2A 5A7SA 1X36A 4PLOA 5CVRA 1VBB1 2CV6A 3WNMA 4CCLA 3DPRB 4ASLA 1EPZA 4CDWC 1PGW2 5FZ1A 4B7KA 1AYM1 1A6CA 1BVP1 1DQ0A 1W99A 4E27A 1H9PA 1VMJA 4EZ4A 3N7LA 4MOAA 2VOVA 1Y9MA 5IVBA 5J1XA 5FCCA 2J1RA 4Q26A 4HFSA 4XVHA 2EXHA 3I2DA 2YHJA 5DQ0A 2FQPA 1W2NA 1JTZX 2VCCA 2OX0A 2LROA 3WINE 4V2WA 3SCGA 4HN0A 4FTBA 1ASJ3 3LKJA 4AI9A 3SH4A 3HN3A 1MS8A 1UMZA 2D3RA 2Y60A 4AHWA 5FZDA 2VMDA 4WM8B 1LOGA 5LBEA 1HRI1 2SLIA 1JBCA 1JOPA 2D98A 3CMGA 1O7FA 3T4VA 4BOWA 4DEVA 4L8QA 1NQJA 2VY0A 5GZEA 4A7YA 3LEKA 5FY4A 1RUH2 4RHV1 5A7QA 2XHKA 3WDUA 5FLJA 1UZWA 2WIIB 3FHAA 1HXS3 1GNZA 4XAAA 1XNTA 4P00B 2GMEA 3ETPA 3K4ZA 1ZX5A 5I93A 4R8HA 3NAPA 2ORZA 4Y22B 4N43C 2ARCA 2JX9A 3MIDA 1CN1A 5CBLA 5DAPA 5FZKA 2JD4A 1V6NA 3E6DA 3ACFA 4YPJA 3CF6E 3J7NA 2XMLA 1RUD3 5JZGB 1SDWA 4E8DA 4C0HA 3C3VA 3RDIA 1JZ7A 1KJLA 1O4YA 3MIHA 1AL21 2CYFA 2MPFA 2QQJA 2W87A 4OZXA 3UETA 3HWJA 3H1WA 4NHLA 3VD5A 5EZWA 1TEIA 3VZKA 2RR13 4XDQA 2Q8OA 1DDLA 3ZXGA 1WGPA 2HLEA 1GWLA 4AWDA 2LM3A 3EMRA 3FWEA 3MF9A 2E51A 1LHWA 2I07B 2ZEXA 1EP0A 1QOSA 4UWDA 1GP5A 4AHYA 1BEV1 5A70A 5F37A 4P5YA 3UKTA 1OD5A 1Q5OA 2GSYA 2HWC3 4Y20B 2NYYA 2XUMA 4PQQA 2Y33A
chains in the Genus database with same CATH topology
3VV1A 4K6BA 3TBDA 1O4ZA 2ZHKA 4AQ2A 4EV0A 2NZ9A 2BNNA 3ZFEA 2X5IC 1LHUA 2JKBA 2PN5A 4AG4A 1IS6A 5B2GB 2AREA 4P9XA 4C1XA 1PVC1 4P9WA 4MX3A 2JG8C 5JR7B 2UWCA 5AFBA 1PIV2 2R30A 3AK0A 1S0CA 4LNVA 2V5YA 1CJPA 3I8TA 2OZ6A 3KQRA 4YW5A 3IIAA 5T5PA 1UU4A 4PIXA 2HWE2 3EBRA 1JW6A 3VBRB 2ZMNA 2BFUL 3FFQA 3AYEA 3WHTA 4AQ6A 1Y3TA 5GKAC 3AJZA 2D93A 4ZU7A 4EWDA 3ZPYA 4LA3A 4RQPA 2YV8A 4JDMA 1KJRA 4CDWB 1RIRA 1T6GC 1UIJA 4ASMB 2WQZC 4KH9A 2D5HA 5FDBA 5DDJ1 5DUXA 4KQ7A 3SLIA 4YYOA 4QQOA 4FAHA 4XF0A 5F6KA 2E53A 1PGL2 1C8M3 4LEJA 2RS53 2XJQA 2D6KA 1F2NA 4LHLA 5J48A 1LHNA 4BIFA 3MPPG 3WY6A 1SLBA 2Y0OA 1ND3B 3WX5A 3M70A 2HWF3 4CP0A 5EJ3A 2WNUC 1APNA 4WV8A 1AR82 3VZJA 2XJRA 2EVXA 5JIAA 1S0GA 4OHXA 2A73B 3AFGA 3AZWA 4C90A 2WS93 3ZXJA 4OHYA 1OOPB 3D0SA 2A5ZA 3NVCA 1W0OA 3MFAA 4AE2A 2TBVA 4YZ4A 4YZ1A 4Q4X1 1COV1 2IFRA 4MUVA 4QQLA 1HQWA 1YCIA 1YI9A 4L92A 5JSPA 4JQRA 1PO21 2DF7A 4YNIA 1O3RA 1UF2C 4U2AA 4XHXA 4CEWC 2IXKA 1QNWA 4NR1A 2X29A 3JZVA 4QGLA 3IMNA 3B5LB 4R9DA 3FBYA 2B45X 3LOBA 5A3MA 3M7AA 1RUE3 1MACA 5DZFA 2VXRA 2DWRA 1GYKA 2DCYA 1B09A 5GLWA 1NCQC 2YMZA 4M00A 4YVWC 3ATGA 1V9U3 1LOFA 1KFUL 1O3TA 2VNOA 1UKGA 1JYIA 2BBVA 2VVDA 2VQAA 1CJDA 2GC3A 5KWRA 5BNNA 1ZRDA 4RR3B 5IK7A 3IN9A 4Q4V3 2WT2A 4D69A 3WQ7A 1AJOA 3AMNA 3GBFA 3MEPA 2EF6A 5JAXA 2IFWA 1W6MA 3GBWA 4DB5A 1KS5A 4YM2A 2W68A 3ES1A 5BNPC 2GN7A 4RGAA 1IPKA 3E6CC 3KLSA 4CYDA 5KHJA 2E7QA 5GZDA 4PDWB 1D2SA 2JDZA 2ZX1A 2VU9A 2K0GA 4DMIA 1AX0A 4YLZA 2V73A 2YGLA 2R043 3JD71 3LGRA 2XJVA 1G9AA 4Q4V1 3ZMNA 4YM1A 3I4IA 1GQGA 2UYAA 1AR71 3ENRA 1MZ5A 1RUH1 4RHV2 2Q1MA 2DU0A 4CEWA 1D4M2 2NQYA 2YUEA 1PK6B 2ZGMA 1I1EA 2PLV2 3UL2A 2VUJA 1HRI2 5D1IA 3DL3A 4C0BA 2KXLA 4QM9A 3IDBB 3AX4A 4BQ1A 1S0JA 5FFOC 5K0UC 2XLGA 1TME3 1Y9QA 3UK9A 4XMIA 1VIWB 3MPBA 3NL1A 1MS5A 2A75A 3D4KA 4PBOA 5BNOA 4YZ5A 1RVF3 3ZYIB 1ZBE1 1BQPA 3EHKA 3QH7A 4GKYA 3B3QE 2ES3A 3U07A 3VKOA 3KT7A 3VKFC 1SLLA 5KHKA 4AEMA 2BPA2 2RHPA 2JG8A 3ECQA 4XBLA 4HPKB 4GQ7A 3JB4C 4AF9A 3ILFA 2GNBA 3IM0A 1WMDA 1CVNA 1QGLA 2ZKLA 2RS32 4WM7A 3VBHC 1JUHA 1J3QA 2XPJA 2QUOA 4Z82A 1AR92 3W9AA 2BFUS 4FPKA 2A3XA 2YXSA 1WBFA 4QD2A 1HRV1 1RUJ1 3RMYA 4OHVA 3KGZA 1QU0A 3MYXA 2PELA 4N7IA 2YROA 3I59A 4A2UA 2ZZJA 4YZ2A 2CWSA 5H9PA 1PZ9A 1EAH1 2B42B 4GIQA 1G8WA 4JC1A 4O9GA 4Q0SA 1PHMA 2EXKA 5F6LB 2KA3A 4P9YA 4RR3C 4XW3A 2XH6A 3PVBB 3ZYRA 2D97A 5I0SA 2C0ZA 3NWKA 3DPRA 4JV4A 1LHVA 3MI8A 4LBQB 3AP4A 4B4RA 3VBSB 2ARBA 3N4MA 4AEDA 5IT6A 1YYNA 5AC92 3EO6A 1RVF2 2WS91 4WM7C 4YRDA 1RUJ3 1AUYA 2DUQA 2A71A 2QNKA 3PMSA 4ORFA 4G9SB 5K0UA 4JRAA 2W08A 2ZGRA 3FX3A 4INDA 4IEWA 4PIZA 3WCRA 1I5ZA 5FPZA 5BNQA 3B02A 2WSVA 2E6VA 1AR93 4FQ4A 4IV3B 2ENRA 1V00A 1W6PA 3BTAA 4F3JA 2QDRA 3AKTA 1CAXB 2AR6A 5I8SA 1RJ7A 4X6QB 2X5IB 2GZWA 2E7AA 2WWSA 4XQDA 2ZA9A 3RG0A 4JAAA 1RUOA 5TSWA 1WLDA 2GU9A 4XJWA 3AP6A 4OI4A 4HLTA 4LBNA 3VBRA 2UWBA 1HRV2 1OFSA 3APBA 1CAWB 1H1IA 2CGOA 1RUI2 3IT8A 1DLLA 4KU7A 5DDJ2 4AI0A 4PIYA 2TEPA 1AYM2 4Y24A 1N1VA 2QKDA 2R1BA 4ONUA 1MS9A 4Z8BA 1D4M3 1LGBA 2BQPA 4YW2A 2PAKA 5I91A 1DGWA 4X8NA 1DU3D 4MSVA 5K8SA 4AVTA 2HWE3 4LO8A 3USUB 4AVVA 2WT1A 2CGPA 1NLRA 2XJUA 5FREA 1TMF3 3I54A 4MLOA 4IETA 4CDXA 4LBMA 1CAUA 1J1LA 1ZBA1 2R041 4IV1A 3SH3A 4Y1YA 5FPXA 1O91A 4Q4W1 5GM0A 3VBFC 1FNZA 1VALA 4CEYB 5ACA3 2QZ3A 3OCPA 4XMAA 2HWC2 1GZ9A 1GZCA 1D0GA 1W6OA 1X8MA 2SBAA 4GMP1 1QJU1 4S2HA 1PO12 1O5LA 1QWRA 1HLCA 5DUWA 1X8EA 2JICA 2HWE1 3WUDA 4COVA 3HIFA 3VBSC 5C9AC 1GNHA 5FMOS 4OHZA 4CTEA 2H6BA 5GLUA 3RYRA 4D7SA 4HETA 1LHOA 4QPIC 5CFCA 4OI0A 1KFXL 4K9SA 1H8TC 3MIFA 4CDQB 4LBJA 4BH9A 2DVFA 4HK9A 2B5HA 5T3NA 4IEYA 1F8VA 1BVVA 2WFF2 3U11A 3JUUA 2R49A 3RQ0A 3H7YA 2FBEA 1VBD3 1XE7A 2X5IA 3S6PA 1KDMA 4YVWB 1DBNA 4IERA 1QKQA 1N47A 4NHKA 4XF3A 4KWLA 3R4UA 3WQ0A 2RS52 3J26N 3P3NA 4GB32 4DY5A 3AZXA 4TYSA 5C8CB 1ZBA3 2VVFA 4NO4A 2HWD2 4AVCA 2A70A 3N3HA 5HCAA 1SLTA 3H7JA 1ZZ9A 3NSTA 5JMCA 1VB4A 2NM1A 3RWNA 2BUKA 4QXKA 4MV2A 4YVSC 2D7FA 2GC1A 2ZX4A 2NMOA 3ZFFC 2ET1A 4NVPA 2E7TA 1KXGA 1S0IA 2PLV1 4TZDA 2ZPXA 3IDEA 5CADA 1AR61 3MICA 3T2TA 2P3KA 4LBQA 2ZABA 4OI1A 3D6EA 1JHNA 4LO4B 3MLKA 4KG8A 4LLFA 1QH7A 4TLFA 4FTEA 1V6MA 3TN92 2R042 1TME1 2R0HA 4AFCA 3DN7A 4LHNA 1KDKA 2V09A 4YM3A 4WVZA 1NA1C 5BXXA 3PVNA 1GSLA 4WVVA 4JGZC 2O8OA 2D3PA 3KD4A 1ZZBA 4IL7A 1O3SA 5JI9A 2A3WA 2GMPA 1EPWA 3VHPA 5KC6A 2XVGA 1RL3A 4K40A 4E2SA 1WD4A 2NP0A 4MGIE 1Q8QA 1D0HA 1QDOA 1BZWA 4COZA 1YWKA 4I30A 3VL8A 4FVVA 5D8AC 3D8CA 3KMHA 2DTWA 1ULDA 1DQ4A 2WNVB 5E1RA 1DG6A 1YRZA 5A33B 4URTA 1ULGA 4PJYA 1YI7A 3TN93 1PVC2 2PFWA 2VPVA 1OA3A 3J4UH 4MGZE 3H9AA 2FMDA 3B00A 4WZFA 3GBGA 2PHTA 4QPIB 4P9GA 3VLBB 1HXS2 3WDXA 5FLIA 4BIOA 2BGCA 2DVBA 1FOD3 1PM7A 1PNFA 1REFA 3OD4A 1QXPA 5FMOL 4J6GA 1GQHA 3J8F3 4BA6A 3ZFGC 3O5SA 4PLNA 1FYUA 4EN9B 4XIKA 1XQNA 2R6QA 1ND2B 3A0NA 5I0TA 3CJIC 1BK1A 4LBQD 1QXJA 1H8TA 1S55A 4EJRA 4HVOA 1XU1A 3PVEA 4FOVA 1DYPA 2IZWA 1NG0A 2D6LX 3VZLA 1DGLA 2F6BA 5EYXA 3UKNA 1K5MB 4Q4W3 1AL0G 1H2NA 4YVSB 4N53C 5HXVA 3A4UA 3RNSA 4Z1VA 1HW5A 4W6WA 3B9IA 1VBD2 4N9HA 3BU7A 5H9RA 2WZR1 1HRI3 2PLV3 4E2GA 1PMIA 1WCKA 3VKMA 2PHRA 3MLLA 2YZ4A 4WBBA 3V0BB 4IQPA 1PNGA 4RGGA 1LOCA 1C8M2 4HT1T 5FQ0A 3PLQA 1OKQA 2AUYA 2GNMA 1DQ2A 1RMU3 4ZXKA 3CJIA 4Y26A 1UX6A 1RUJ2 4L9BA 1QNYA 2VOWA 5L36A 4CDUC 3RZZA 3WP6A 2ZTNA 3KCCA 1RUE2 1V6IA 4RS5C 2HWF1 1MQTA 4AEDC 3ES4A 1GV9A 2W39A 1WCDJ 1AYN3 2ZHMA 1C8NA 4TWTA 1R093 3DPRC 4LO6B 1LRHA 3KB5A 4R9BA 2AGSA 4YG3A 3WDVA 1MVEA 1ZBE2 3CJXA 3BOPA 1WLCA 1RITA 2UU8A 2OA2A 1CAWA 3PHMA 4PBPA 1C3HA 3FE5A 3WZ1A 4MH0E 1TMF2 4AFMA 1QQP2 3O12A 2O1QA 4WM8A 5JPNB 3FLRA 4TSVA 4AI1A 4H14A 1W6PB 2GC2A 3M3OA 4Y20A 3AB0A 1CD3G 4IEOA 4Z92B 2A6YA 5BYNA 4WM8C 4JVAA 1Q8PA 4AXOA 1MVQA 1QJX2 1AR72 4OULA 4GMP3 2WT0A 2MEV3 5JWPA 1I6XA 4EN8B 1VBB3 2D6OX 4AEJA 3ZDSA 4CDXC 5L19A 3AZZA 4IV3A 3HAGA 4AI8A 4JDOA 1C5HA 4QGNA 3UJQA 4JDNA 5JZGA 1BJQA 3H1YA 3GNEA 1AJKA 3QH6A 4FQZA 3CJIB 4CEYA 3JD72 4N7UA 5KXEA 1IKPA 1YFUA 4X8PA 5J7MA 5JZGC 1ZVFA 3D0JA 2O8QA 3ME2A 2RS51 4CEYC 2WNUA 1CAUB 1VBB2 3TNPB 4K20A 1AYN2 1W6QA 4HKWA 3WQ1A 3OPZA 1AXKA 3RS6A 4E9KA 2VECA 5CFCB 2NLRA 4FOWA 4YGCA 5C4WA 4AW7A 4GH4A 4M0NA 5C9AB 5I0RA 1GKBA 2Q30A 3KCXA 3NV2A 4LLOA 4S2GA 4DINB 1BMV1 5HCBA 4AI3A 1ULEA 3L2YA 3SXWA 2YGMA 3VBFA 2ZGTA 1R1ZA 1FATA 1H8TB 1BMV2 2D6MA 2K2SA 1SMVA 4R9CA 1AX1A 4LBOA 2DUPA 2VNRA 2Q4SA 4X6RB 5KXCA 4QM8A 2ZMKA 5I0UA 4RS5B 2WNEA 1UPIA 3E5UA 1R091 2HWC1 2Z69A 1ZREA 3MZHA 2XL7A 1QJY1 4LA2A 3CU7A 3HQXA 5IK4A 4QPIA 4RFT0 4Y1XA 1RUI1 3ALQA 4N9IA 4XFHA 5H9QA 3MIBA 1IZ3A 3RMXA 2D6PA 2JECA 3WG3A 4LUKA 3ZFEC 5JLVA 3TYJA 2VGDA 1QJZA 5CIRA 4AEKA 1NE4A 5AVAA 1NLSA 1ENQA 4XJ9A 5T55A 2H0VA 2R072 2EAAA 1EV11 1CR7A 3WT3A 1QJX1 3ZXDA 4QQHA 4BM8A 3WR0A 2I45A 5LRRA 5EYYA 1VBA3 5GZFA 1LULA 5LK5A 1HXS1 3GZUC 4J1XA 3K51A 3OTFA 2XBO1 4LBKA 5A3LA 1GLHA 1CIWA 1XNDA 1VAMA 4I09A 1RUF2 1YIPA 1RMU2 4PDWA 5EWSA 1PGL1 1WMEA 1CGPA 4LR4A 1XXNA 4UXAA 1YIFA 2JENA 4JGZB 2QJVA 4COUA 1I3HA 1CPMA 2GH8A 2JG9C 5J98B 3V0AB 3ZFGA 4YW1A 4GH4B 4P9JA 3IWZA 3GYDA 5C4WB 5F5QA 4L99A 3HN1A 2PQQA 4EROA 2G4IA 1NE6A 3LZZA 5FO9B 4COYA 4ES9A 4K8FA 2ZGPA 1ONAA 1RUH3 3GALA 1Z7S2 3HT2A 1MZEA 4GWNA 2WNVC 2RMU1 1NCQB 1OLQA 3NKGA 2GALA 3KM5A 4IEZA 2AH2A 2X8KA 3JCIA 4XETA 4Q4Y2 1OQ1A 5LEKA 1ENRA 1VLNA 1QQP3 1YHFA 4XEZA 3S0MA 3NV4A 3WDYA 2OUJA 3V65A 3CL1A 4XTPA 4BWOA 3URFA 2D6NA 3NW4A 5IK5A 2Z2SB 2ATFA 2I74A 3FJSA 4YW3A 1UAIA 2P3JA 4Z2WA 4GWMA 5FOBB 1TE1B 3V0AA 4CRQA 4EN0A 2HWB1 2Y38A 4H7LA 1S0DA 4A3XA 3TWIA 2RR12 1EAH2 2W0XA 3KS7A 4R4XA 1VRH2 1FMD2 1BCXA 2R16A 1K5MC 1JYCA 1MQTC 3ZN4A 1SLAA 1H4GA 2QFEA 4XFIA 4FPYA 1QH6A 1OI6A 1H8VA 1PO13 4KGGA 4XTMA 2NPIA 1BEV3 3KGLA 4ATFA 2IC1A 5BNNC 4QT6A 2C1FA 2WFF3 1FV2A 3H1MA 1Y43B 1EY2A 1MR5A 5GALA 4BZ4A 2XWJB 2KM2A 3M2MA 1MZ6A 3QACA 1ZZ6A 2R063 2ZOEB 3N7KA 4Q1PA 1XYNA 3OF1A 4Q8KA 4KBBA 3AMHA 2O0OA 2EAKA 4FT8A 1V6JA 2RMU2 1DGRN 3JQWA 1H1AA 4YGEA 1J59A 2DFCA 5T5JA 4CDUB 2DCKA 3ZSEA 4NOTA 2XG3A 1HKDA 1POV3 4HVQA 2GH2A 3ZXFA 1ZZ8A 1YJLA 4HVRA 3AZYA 1NCRB 2OUHA 1OMIA 1UKRA 1Q56A 1COV2 3AKQA 2Z5WA 4QPGC 1X82A 1R1A2 4PLMA 1VBC2 4W65A 1GANA 3TN91 1YFXA 1QDCA 4XFAA 3N36A 3O0VA 2ZKNA 1XNCA 1IS3A 4HK8A 1AF9A 3LA7A 1VB2A 2F4PA 1V70A 1ND3C 1KRIA 2OYZA 4FPOB 5T54A 1AR62 1LTEA 3RRDA 2RE9A 3LA2A 1H4HA 4RR3A 5F9TA 4N53A 3WOGA 5FAXA 5K9YA 2BYVE 1LEMA 4CDXB 1LOBA 3ILNA 4LBLA 4HMZA 1PIV3 1REDA 3ROUA 1C57A 1RC6A 4KWKA 4FOYA 1NXMA 4UW4A 4B29A 3IKWA 1VBC3 3OGGA 3CNAA 3TOJA 1VRH3 3WG4A 5ABJC 3B69A 4LT5A 1QJY2 3CEWA 3KZ4C 4AVAA 5CAZA 2NN8A 1ASJ1 3V64A 3ZYJB 1DQ6A 1JOJA 2CGNA 5CG9A 1LR5A 3FUQA 1GZWB 3R4DB 2HWB2 2XWBB 4MVTA 4DQAA 4Q0UA 1RINA 2MHFA 5CFCC 1RUE1 1SBEA 4NWWA 1QXRA 1DFQA 2CWMA 3GZAA 4IV3C 4RQPB 1R082 2XBO3 1IS4A 3ETQA 3V0BA 3HT1A 1WCSA 4D3WA 1MS1A 1YFWA 3O0XA 4KWJA 1XYOA 5BNPA 1V9U1 1F31A 3THTA 4OHWA 2R32A 2R061 4JCKA 1WLTA 2DVDA 1OQEA 1BBT3 4GALA 4Q4X2 2CAUA 2DVGA 2XKOA 4K3UA 4OI2A 4Q2FA 1IGOA 2YDEA 1N3PA 2GC0A 1U0AA 4WVWA 1ZBA2 1KITA 4L2NA 1N3OA 3AYDA 5E16A 2XVLA 5KHHA 4R4ZA 5SV8A 2QVSB 4WVMA 5BUVA 1VBD1 5BNPB 2BVVA 3U4XA 1AYN1 3RJRA 4XILA 5L73A 4UBHA 5JCTA 4C1WA 4DZGA 3W59A 3RYPA 3H3UA 5DXDA 1I9RA 3QCWA 1HV1A 4FO9A 3AM2A 1Q3EA 1FMD3 3AXDA 1O4TA 2B9UA 3ZXEA 3WDWA 2AYHA 2ZBJA 5FRAA 2OZJA 5BPXA 5BY5A 1XE8A 3A0KA 1UL9A 5AC93 2A6VA 1SLCA 1MS3A 4AYUA 1RUC3 4YGDA 2ZAAA 3VGIA 4B7EA 2ET7A 3LAGA 2IWGB 5T52A 3NAPB 1LKNA 1YO8A 3FLPA 2YYOA 1PK6C 4DNYA 1X33A 1UW8A 1G9DA 5I8YA 4N43B 5K7PA 1Q43A 3VBSA 3ZXLA 1RUF3 3ZN6A 4YW4A 2WKKA 4RA0A 4UW3A 3WP3A 5L7OA 2GDFA 3ILRA 5JOYA 2A7AA 5ABJB 1D2QA 4I0BA 1V9U2 2XVKA 3WW2A 1XNBA 4RD7A 1DYKA 4KG0A 4GH4C 3N7MA 1N1SA 3W58A 1RUNA 2B8MA 1O3QA 1Z78A 4BMBA 3VBHB 3TNQA 3U0ZA 2RJLA 1FT9A 4GMP0 1W6OB 1ULFA 3PMEA 1A3KA 3HBZA 5FO7B 2WFF1 1VAKA 3E5XA 3AMQA 3RYKA 4LUMA 3MLJA 1GBGA 2UWAA 5DDJ3 4M3CF 2A6WA 4XJ8A 4XYXA 1RUG3 2ZX3A 4HANA 3T1MA 4I3PA 3USSA 2CL2A 3VBOB 1ZRCA 2QZ2A 4SBVA 3TRSB 5CU1A 1SCSA 2JG8B 1IPJA 1RVF1 2WS92 4C91A 5HI0A 1QY4A 3AJYA 5AC91 1WUVA 1H9WA 3ASIA 3USUA 1S0EA 3BOWA 3BPZA 4LE4A 2C9AA 1PO11 3I7DA 3N7JA 3OGJA 4HBNA 3FUOA 4AVSA 2HWB3 4FAGA 4OFGA 3UJOA 2PHDA 4CP2A 2A6XA 4Q29A 2R073 2ERFA 3JU9A 1CONA 1PK6A 3I59B 4XZPA 3RPQA 4ZU5A 4BPZA 3E5QA <