2ETCA

Crystal structure of the ankyrin repeat domain of trpv2
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
252
structure length
252
Chain Sequence
QQEPDRFDRDRLFSVVSRGVPEELTGLLEYLRWNSKYLTDSAYTEGSTGKTCLMKAVLNLQDGVNACIMPLLQIDKDSGNPKPLVNAQCTDEFYQGHSALHIAIEKRSLQCVKLLVENGADVHLRACGRFFQKHQGTCFYFGELPLSLAACTKQWDVVTYLLENPHQPASLEATDSLGNTVLHALVMIADNSPENSALVIHMYDGLLQMGARLCPTVQLEEISNHQGLTPLKLAAKEGKIEIFRHILQREFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-terminal Ankyrin Repeat Domain of the TRPV2 Ion Channel.
pubmed doi rcsb
molecule keywords Transient receptor potential cation channel subfamily V memb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 82
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2etcA00
3TWUA 2NYJA 4OAVB 5AAOA 3V2OA 3JXIA 5ITZF 5JMND 3ZNGA 3NOGD 4C48B 4HI8A 1OT8A 1AWCB 5AARA 1BI8B 5HRYA 4DX2A 2L6BA 1YYHA 1MX4A 5AQBA 1N11A 4DX7D 5BXUA 2DWZA 2V4HC 4YDYA 5ENSD 4QQIA 5KNGA 2KXPC 4O1PA 1DCQA 2P2CP 3UI2A 1A5EA 3AAAC 3TWRA 3D9HA 3V30A 3V31A 3JUEA 4J8YA 1MX2A 2BKGA 2XZDG 3LJNA 5CEDB 2JABA 1IXVA 5EIBE 2DZNA 5EN5D 4N5QA 5FIOA 3V2XA 3SO8A 4ATZD 3AJIA 4A63B 4ZHBA 4NIKA 4HRNA 1SW6A 2V5QC 4DUIA 4GMRA 4G8LA 1WDYA 2ZGDA 4LG6A 4ZFHA 2VGEA 2A5EA 3DEPA 4K5BA 1IKND 5AQ7A 1QYMA 3IXEA 3TWTA 1BI7B 1OY3D 4B93B 2ZGGA 1BU9A 4YDWA 1G3NB 5ENQD 2F8YA 4K5AB 4U95D 2DZOA 1SVXA 5ENOD 2J8SD 1TR4A 4O1OA 3EU9A 1K1AA 3ZU7B 5ENRD 2Y1LE 4HB5A 5EIDA 4O60A 1BLXB 3F6QA 4HNAD 4DX6D 4JB8P 5FINA 1S70B 2B0OE 2QYJA 4U96D 4HBDA 5AQ9A 4BESA 2FO1E 5HKPA 1K3ZD 2QC9A 3Q9UC 4GPMA 5AN8A 4K5CA 1BD8A 2RFMA 4J7WA 5ENTD 5AQAA 5HS0A 5BXOA 1DC2A 3B7BA 1AP7A 3J5QB 1YCSB 4BSZB 2RFAA 4BEPA 4DX5D 3NOCD 5CEAA 4G8KA 1UOHA 2HE0A 5KWDA 4DRXE 4HRMB 3TWSA 3EHQA 3B95A 3TWVA 1WG0A 4CYMD 5ENPD 4HRLA 4BERA 3KEAA 2ETBA 4UUCA 1D9SA 3T9KA 3TWXA 1IHBA 4DX1A 2XEHA 5CECB 4RLYA 3JXJA 4LNUD 4BETA 5CBNA 2KBXA 2XZTG 1MYOA 3EHRA 5JA4D 1YMPA 3TWWA 2XEEA 4OAUC 3J5PA 4QFVA 4U8VD 4TUMA 5EILA 3T8KA 3TWQA 3ZKJA 3HG0D 1K1BA 5D66A 5EYPF 5KBAA 5EYLA 2ETCA 3HRAA 1MJ0A 5CBOA 3W9GA 2AJAA 2ETAA 4Z68A 1NFIE 4HI9A 3UXGA 2MYOA 2Y0BG 2F37A 1N0QA 4HQDA 2PNNA 3UTMA 4CZ2D 3V79K 3NBNB 2XENA 2BKKB 3DEOA 3ZUVB 4LSZE 3C5RA 3Q9NC 2F8XK 5CERB 4U8YD 5KNHD 4F6RD 1MX6A 4HLLA 4F1PA 3W9FA 1N0RA 2DVWA
chains in the Genus database with same CATH superfamily
3NQPA 2H6IA 4KZCA 3LKUA 3KSLA 3MZLB 2L9BA 3Q75A 2Y3AA 3UUXA 3ESKA 4YDYA 5G04J 3EDTB 3RAUA 3L82A 1DCQA 3PEVB 1Y8MA 1Z5SC 3E33A 4I2ZA 4GTVA 2C0MA 1UN8A 3U4TA 2M63A 4X8QA 2L6JA 4HRNA 2WXKA 4FA6A 3DSTA 2A5EA 4HOQA 2WQ7A 3TXMA 1HG2A 5JHBA 4AV7A 3CHRA 1SVXA 5ENOD 5KCMA 3ZYQA 4HS2A 1UN9A 4JA9A 3NF1A 4IRUA 4AEZC 3B7BA 3ZHEB 3ASHA 3NOCD 3ABLE 2I9CA 4BERA 3CHOA 3FUEA 2BUGA 3JXJA 3PZDA 5FQ7A 2XPYA 1MHQA 4AJWA 1OCZE 5EILA 1IQRA 2LUHA 1FT2A 3ZYMA 3UXGA 2DIWA 3FU5A 4GTOA 4KVMA 3QNKA 5C1DA 1S0PA 4RQIA 2WXHA 2WXGA 3UKRG 1H6KA 4BT8A 3QWWA 3CVPA 3ZNGA 3CSFA 2QY7A 3B7TA 2R03A 1EYHA 1MX4A 4BTBA 3FUFA 3HXDA 5EKQD 1N11A 2BF0X 5ENSD 1X5BA 1IQUA 3CVWA 4H7YA 4XKBA 2V0PA 5BUZA 3FU3A 5EIBE 3FTVA 3PZ1A 3TG4A 3HXBA 3B7UX 3ESLA 3DSSA 3I5PA 4WAFA 4B8CB 3D9LA 4GCOA 3I3NA 1OWPA 1G3NB 1UJJA 1OWMA 4ANUA 4HB5A 3PNTB 4JL0A 4KBQA 4UWFA 5CRUA 2ONDA 4UWHA 3UM2A 3I4GA 5AQAA 4GB9A 1YCSB 4BSZB 4AVXA 3BUAA 3D9JA 3RKVA 3TXNA 5CHEE 3UIOC 2GROB 3R9AB 3GZ1A 3FUMA 4B0ZA 3IEGA 4LNUD 3AS5A 3ENEA 4IN3B 1TNOA 3QWVA 2WXRA 3DXKG 2LSUA 3O48A 5EYPF 2GRLA 2WXJA 4W9RA 3LDZA 1H19A 5FJYA 4UWLA 3S7DA 3ONKA 3FH8A 1TYQG 2I2OA 5ITZF 3SHFA 4HI8A 4FADA 4L7TA 4TXRA 5HI7A 5EDSA 5DIZA 4I1MA 2V4HC 5KNGA 2R05A 1EF1C 3DSUA 4JPSA 3FEXA 3LY7A 2CHZA 1H6PA 5FZSA 4GTMA 2AXZA 2KM4A 3IKOB 3QDNA 2H6HA 3CHPA 5FIOA 2EIKE 4NIKA 4JW1A 3CHMA 5AJDA 4DLOA 2IY0C 4LG6A 2BEDA 3HXCA 4K5BA 1TN6A 4B93B 2MRIA 4MKTA 3FH7A 5CMWA 3LY8A 5AQ9A 2FO1E 3VLFA 1Z3XA 2XPIA 1N52A 4TRQA 4CDMA 4WWPA 1W3BA 4G23A 4WNDA 2ZIRA 3EHQA 1BPOA 4HRLA 3UT4A 3QJZA 4XX5A 4UUCA 1JUQA 2WXNA 2R5SA 3BEEA 4L2LA 3HVEB 1MYOA 2OV8A 1IYGA 4E85A 4C0EA 4GMLA 4BT9A 3FTSA 4GAAA 1WM5A 2XRYA 2F37A 4DLQA 3CKBA 3UTMA 5B1AE 3EJNA 5BT1A 1O1TA 4G11A 4P29A 4M7CA 2X3MA 2PZIA 2L0TB 3ISMC 1NI1A 4IULA 5FZQA 1LD7A 5AQBA 3EIQC 3PE3A 4GMJA 4FHKA 3V31A 3ZEFA 2BKGA 2IO3C 2P58C 3CEQA 1IXVA 3HXFA 2EIME 2IO2C 1FVHA 1TEZA 3MKRA 3ASNE 3RO3A 4APFA 5AQ7A 2OVBA 3P2BA 4U0ZA 2J8SD 3JUIA 5EIDA 2AW6A 3E30A 4ILIA 2R59A 4GTRA 4AIFA 4MBGA 1MZCA 1B89A 3CVLA 4N3BA 2LO6A 3PREA 5CEAA 3SFYA 4DRXE 3TWSA 3B95A 5ENNA 5ENPD 3CGHA 2VQ2A 2H6FA 4JZYA 5CRVA 3PRZA 3VTXA 5G05C 1V55E 3ASDA 5D0QD 5ARGA 5JA4D 3JYSA 1OWNA 2GRMA 2PL2A 4JXTA 2IOSA 4F3VA 1N4RA 3NBNB 3SF4A 4U8YD 4DK5A 3JQ1A 3C3RA 4JHKA 2WMOA 3RRMB 3ULYA 3TL5A 1SA5A 1SZ9A 3IHVA 4CRWA 4J8DA 2VSXE 2YQ8A 2DWZA 1KT0A 2ZXWE 2VGXA 2J49A 3NZUA 3E4BA 2BTDA 3GZSA 3V2XA 3DSWA 2FI7A 3DPYA 1V54E 4L9PA 3TG5A 2FBNA 2PQRA 4GA0A 3U9WA 3X2QE 3SI5A 2I1JA 3DEPA 3QC1A 2PM6A 3TWTA 3CSTA 1BU9A 3G2TA 2YNQA 2WXFA 3FH5A 4U7EB 3EHNA 4B89A 4U96D 2WM9A 5ENTD 3NZSA 5HS0A 3EIJA 2KCVA 2OOEA 1HZ4A 3TWVA 5KJKA 4YDOA 1D9SA 4BETA 1JCRA 2VTBB 4G25A 4UI9J 5LCWJ 4FJZA 2XGSA 4AY5A 3ULEG 5D2MC 1EDUA 3I4RB 4ACKA 4UQXA 4EHMA 4LCTA 1E96B 1QNFA 4F1PA 3T5VA 2X38A 2NYJA 3K9IA 2OEWA 3SBSA 2WMNA 5AIJA 1BI8B 4DX2A 5E75A 4YNDA 2KXPC 2P2CP 3JUEA 1JWFA 4GA1A 1TN7A 1HFAA 3Q7FA 4A63B 3KAEA 3TGOA 3UQ3A 5EX3A 3U64A 3C98A 2WB2A 4I1AA 4XKCA 5T4YA 3SBTB 3IXEA 4C0MA 3MKQA 4Y6WA 2LAHA 2LXMA 5ENQD 1XNFA 3AG1E 4K5AB 4BSXA 5A23A 2PQNA 3CHQA 3D9OA 1LTXA 4BWRA 4O60A 4HNAD 1WY6A 4BESA 5CCMA 3DRAA 2XGMA 4J7WA 1KPSB 1E8XA 3LVRE 2E0IA 2IQCA 4CYMD 3L16A 1OCCE 3ULQA 4MLPA 4KVOA 3OXFA 3APFA 2XZTG 3D3MA 4UWGA 3D9PA 4EZKA 4U8VD 3IV0A 1UW4B 1P5QA 3PNLB 4FP7A 1N0QA 3UM0A 3AG3E 4I9CA 3ZRHA 1FT1A 3HDXA 1MX6A 2J09A 3UKUG 3JXIA 2QZAA 1S63A 2YINA 5AARA 4UI9K 3PVLA 2L6BA 3BG0B 3ZPJA 1PAQA 2YHCA 1MX2A 4LRZA 2IFUA 4UWKA 2DZNA 2FULA 3PDNA 4N5QA 3CVNA 3S7JA 4ZHBA 3PE4A 2P9PG 3QK0A 1H2VC 2XGOA 4MS6A 3L54A 1O1RA 2Y4UA 1TJFA 3ZXSA 2CHXA 1OCRE 4LNBA 3D9NA 1HU3A 5HQ8A 4I1OB 4GZDA 4OYSA 3CV0A 4J8SA 5LFAA 4U63A 4I9EA 4J8FA 2JEKA 1HE8A 4XIFA 4A1GA 2OCCE 3ASOE 2NSZA 5LX8A 5FWQA 1IHBA 5A7DB 2YHEA 5CBNA 4XEIG 5KJMA 4JA7A 3ZXPA 3D9MA 2J07A 4GCNA 4MRUA 3ASFA 2X6JA 3J5PA 1TNYA 1TN8A 2MOWA 3CQGB 3TWQA 3CK9A 4RSYA 3MYVA 2ZISA 4EBAG 3ZUVB 4LSZE 2F8XK 3UINC 2V4LA 3G2SA 5AAOA 3Q7AA 3ZHEA 3ZYLA 4XZ4A 1HH8A 4HOSA 2CFZA 5HRYA 4DX7D 4BY6A 3UI2A 2WXPA 3AAAC 2P9NG 2LSVA 3ZYKA 3R7QA 1H6OA 3S2AA 1A17A 3Q78A 1N4SA 2KCKA 3DXMG 1NP7A 2CG2A 4GTQA 5JJ6A 4U0UA 2DCPA 2VGEA 4XI9A 4AY6A 4BTAA 2ZGGA 3CVVA 3CLJA 2F8YA 1X81A 1D8EA 1K1AA 3DSXA 4F7AA 1BLXB 2EILE 2PM7A 3QB2A 4HBDA 5AN8A 1RW2A 3PS6A 2C0LA 3EU5A 5ARFA 4DX5D 2DYRE 2V8SE 3T9KA 3Q47B 4DPRA 4GZ3A 4GU5A 4GTSA 4FULA 4GPKA 4UQYA 3ZKJA 5KBAA 4A55A 3HRAA 5C2YA 3W9GA 2ETAA 1E7UA 3IHYA 4A3TA 3AS8A 1Z3YA 1FVFA 2FEZA 2XENA 1OUVA 3C5RA 3AG4E 5BV0A 4N3AA 4TUUA 3GZ2A 3S7BA 2HYZA 3LY9A 4ILGA 1OT8A 1AWCB 5JJTA 1E8WA 1DNPA 3G2VA 4CEMA 3FUNA 3LEWA 4FLBA 5T3RA 1HXIA 3APCA 1ZB1A 4PDXA 2XCCA 4KZ0A 1XGWA 4FHJA 4EECA 2X6KA 2LAIA 5FQ6A 3E32A 4ATZD 3PUJA 4RG6A 5FQ4A 2ZGDA 3HHMA 4ZFHA 3CHSA 4AOFA 3QAQA 3CVXA 2P9UG 1OY3D 1H2UA 4AP2A 3FDHA 2XPZA 4O1OA 4B94A 4F6RD 5BXOA 4JC8A 1E7VA 2A4ZA 3QWPA 4ILHB 4HORA 4J8EA 4G8KA 3PUKA 2J4DA 3KEAA 3RU0A 1TNZA 4I6JA 4GZCA 1U2VG 5ANRA 1NA0A 4GYOA 2XEEA 1PC2A 3HG0D 2P9KG 4Z68A 4EPZA 5EX0A 2MYOA 1LF8A 4LERA 1JPLA 4H7XA 3Q9NC 3T5XA 5G04C 2UWJG 4HLLA 4XE0A 4ANWA 4EQFA 1QBQA 2KZTB 4NRHB 1NZNA 4HXIA 4O1PA 3HVEA 3V30A 4RVBA 4HFGA 4Q96A 2X6HA 3ABKE 3AU4A 3UT8A 2F0YA 1SZAA 4NQ0A 4LEUA 3LJ3A 3KEZA 1WDYA 3ZFWA 4FU3A 2UY1B 3SFXA 4U8HA 3U3WA 4WNEA 2J9QA 3EHMA 1TR4A 3MCXA 3EU9A 4N3CA 3BU8A 1KZOA 4YVOA 3L08A 2RFMA 3FUDA 2GRNB 3Q79A 3HXEA 1NL4A 3IBEA 4HRMB 4GA2A 1Y6IA 3UPVA 3TWWA 4OAUC 5B3SE 4TUMA 3Q5MA 4URKA 5FZRA 3LYAA 5BPPA 3HYMB 4HI9A 5E76A 3FP3A 3QARA 3CVYA 1Q2ZA 3T8MA 3SD5A 1U3CA 4Q94A 1N4PA 3ZIMA 3SGHA 5KNHD 3B13A 2WXMA 2RD0A 3FULA 3UM3A 1YYHA 2WPVA 3UX4A 4JEHA 3UT7A 3L9TA 4PS8A 3R7RA 4I6EA 3TWRA 4DI3A 4J8YA 3VLEA 4N5CA 5CEDB 3SY2A 5T8IA 4ACLA 3BG1B 2R17C 4BFRA 2OEVA 1ELRA 4EZLA 1KT1A 4I43A 3MV2B 4GYYA 2Y69E 2KC7A 3FWVA 2WQ6A 4U95D 1U3DA 1S70B 1KZPA 4V3IA 3DSVA 5HKPA 3G2UA 4EZJA 1DC2A 3PZ4A 3UIPC 2IJGX 2WXOA 3O4ZA 2KCLA 5DBKA 4JEUA 3RRNB 4RLYA 3CK7A 2KBXA 2I6HA 1YMPA 2AVPA 3Q15A 3GYZA 4GTTA 5D66A 2ETCA 1MJ0A 3LCAA 1NFIE 4KMOA 1S64A 5G05J 2BKKB 1OWOA 5CERB 2GW1A 1JWGA 2LNIA 4TXQA 3VLDA 5JHAA 4U0SA 3MX3A 5G2NA 3P1UA 4QQIA 2GGFA 2L0IA 3D9HA 5BNWA 2VTBA 3CIAA 3URZA 4WUYA 4TV3A 4ANXA 4AM9A 3C3OA 2V5QC 4G24A 2IONA 3FTWA 1OXJA 3CVQA 2ZU6B 4YDWA 3E37A 3LS8A 1OCOE 4CT4A 3ZGQA 3PZ2A 5M72A 2QYJA 1HS6A 4GTPA 3L6AA 4GPMA 4K5CA 1BD8A 1HO8A 3OXGA 2EQXA 1DCEA 2QFCA 5LP0A 2E2EA 1HX8A 1E8ZA 1NA3A 1SA4A 4ANVA 3LVQE 2IEJA 2WQHA 4R7LA 2X6IA 4A3VA 3B7SA 4PH4B 2DYSE 4F53A 4PS7A 1K1BA 3RRUA 4I6GA 1QZ2A 2XEVA 2EIJE 3C72A 3WG7E 1WAO1 1Z6TA 2VSOE 2XQ0A 5BV1A 5JJ7A 3CVUA 2AXVA 2QYUA 2XCBA 4AXHA 3MJWA 4G2VA 3MEKA 3SZ7A 2EINE 3GW4A 4GZ6A 5H7PA 3ABME 4WWOA 3Q73A 2JABA 4HLEA 3FY4A 3N71A 1VDYA 3KS2A 3FUJA 4E6HA 3B7RL 4HOUA 1SW6A 4L23A 4GMRA 3ZVVA 3RIBA 2IU1A 3AS4A 3TAXA 1IKND 2HO1A 3FTUA 3JCKC 3D9IA 2DZOA 2J4BA 2JLBA 4DX6D 5FINA 5BXUA 1N54A 3J5QB 3FTYA 1TNUA 2HR2A 5LOZA 4Q69A 4NACA 5KWDA 3RK6A 1H0AA 4OVVA 4CT0A 2Q7FA 3MV3B 2ETBA 4G26A 5D0OD 4DX1A 2XEHA 2XS8A 5CECB 1K8KG 4WNFA 4CDNA 5KJNA 3PH0C 3L22A 1INZA 2R02A 2WXLA 2HM8A 4JVSA 3SFZA 2PNNA 3AU5A 3CKCA 1TNBA 2NXPA 2A5UA 4N2QA 4KXKB 2LXLA 2CHWA 2B6CA 1N0RA 4ATGA 4CDRA 4PS3A 4CGVA 3ML8A 4OAVB 2RG8A 5BW8C 3G2WA 2XRZA 5FQ8A 3FEYA 2IF4A 1A5EA 3FUHA 1FPPA 4O6FA 2XZDG 4Y6CA 3KSQA 4FLHA 2FO7A 3ZN3A 4XI0A 1SQMA 3FU0A 3SO8A 3APDA 2WXIA 4N39A 4M3OA 4DUIA 4G8LA 2XHEA 2MHKA 5CMYA 1MQSA 2GRRB 3NAWA 1QYMA 3PEUB 1BI7B 2DBAA 1QQEA 4NURA 1EPUA 4DJAA 1HG5A 4BX8A 1UG3A 3ZU7B 3RSEG 3EUVA 2Y1LE 2B0OE 5AENA 1JCSA 1KLXA 5B1BE 3U66A 4HVBA 3FHEA 3Q9UC 4F1SA 2V5FA 3LPZA 1AP7A 3L13A 4JHJA 4BEPA 4UI9C 4KYOB 2P9SG 4ME2A 5LCWC 3ONLA 3L17A 1WG0A 4JD2G 4JHRA 2AWIA 3JQ0A 3UMVA 3TWXA 3FTZA 1N9AA 2C2LA 2VGXB 3CQCB 2Y4TA 3DPDA 5ANLA 3VTYA 5CCLA 1D8DA 3RO2A 5EYLA 4I2WA 5CBOA 2H6GA 2AJAA 1N94A 3DBSA 2Y0BG 4LNGA 3LXUX 3TJPA 3NB2A 2KATA 4J6IA 1JCQA 2I1KA 3E34A 2VJ8A 3W9FA 4L1BA 2VYIA 3C3QA 2DVWA 2P9IG 3TWUA 4DI4A 2R2LA 5JMND 3NOGD 4C48B 3D9KA 5KJLA 3Q4AB 2XS1A 4YDEA 3CK8A 4UQZA 4U04A 4YVQC 3FTXA 3SQVA 4B8AA 3LJNA 5EN5D 2P9LG 5IY5E 5G55A 3R9MA 3OXLA 2VSNA 3QKYA 1UJKA 4C9BB 2ILRA 5AYWD 2X6FA 1E8YA 3MGBA 3CR3A 2FF4A 2WVIA 4D10C 1TJCA 5ENRD 3F6QA 4JB8P 4LUNU 2QC9A 4ABNA 1ZBPA 3PZ3A 2RFAA 3FUKA 2CFUA 5FT9A 1UOHA 2HE0A 4KT6B 4FC8A 5J08A 4TXPA 3MA5A 1ELWA 3EHRA 4CGWA 3UM1A 3ZW3A 4WWNA 1DVPA 1L5JA 3FFLA 1PY1A 3S7FA 4HQDA 4OVUA 3SNXA 4CZ2D 3V79K 2CG3A 3DEOA 4U07A 2WXQA 2VGYA 4PUCA 3MKQB 5FTPA 4K03A 3V2OA 4FJYA 4L2YA 2NC9A 4BX9A 4A1SA 3FUIA 3FU6A 5AJLA 3QOUA 2IOLA 1FCHA 3AG2E 3AJIA 2GRQB 3ML9A 3ASGA 1N95A 3Q49B 1YA0A 4K0RA 4CCAA 2AXUA 1E90A 1GW6A 2J08A 1ZU2A 2GRPB 3KD7A 3OAWA 4I17A 4RG9A 3RJVA 2KZTA 4J0UA 3HIZA 1K3ZD 2OVFA 5A6CA 4IYPA 4N2SA 2VSYA 4WNGA 1ELKA 3BQOA 4GYWA 3DWLG 4GZ5A 5J90A 4APOA 3OTNA 1O5MA 1H2TC 4G1TA 2RKKA 1OWLA 4QFVA 2UY1A 1O1SA 3T8KA 1IHGA 4EBAA 1N4QA 3WXXA 1LD8A 1HF8A 4HOTA 1RZ4A
chains in the Genus database with same CATH topology
3TWUA 2NYJA 4OAVB 5AAOA 3V2OA 3JXIA 5ITZF 5JMND 3ZNGA 3NOGD 4C48B 4HI8A 1OT8A 1AWCB 5AARA 1BI8B 5HRYA 4DX2A 2L6BA 1YYHA 1MX4A 5AQBA 1N11A 4DX7D 5BXUA 2DWZA 2V4HC 4YDYA 5ENSD 4QQIA 5KNGA 2KXPC 4O1PA 1DCQA 2P2CP 3UI2A 1A5EA 3AAAC 3TWRA 3D9HA 3V30A 3V31A 3JUEA 4J8YA 1MX2A 2BKGA 2XZDG 3LJNA 5CEDB 2JABA 1IXVA 5EIBE 2DZNA 5EN5D 4N5QA 5FIOA 3V2XA 3SO8A 4ATZD 3AJIA 4A63B 4ZHBA 4NIKA 4HRNA 1SW6A 2V5QC 4DUIA 4GMRA 4G8LA 1WDYA 2ZGDA 4LG6A 4ZFHA 2VGEA 2A5EA 3DEPA 4K5BA 1IKND 5AQ7A 1QYMA 3IXEA 3TWTA 1BI7B 1OY3D 4B93B 2ZGGA 1BU9A 4YDWA 1G3NB 5ENQD 2F8YA 4K5AB 4U95D 2DZOA 1SVXA 5ENOD 2J8SD 1TR4A 4O1OA 3EU9A 1K1AA 3ZU7B 5ENRD 2Y1LE 4HB5A 5EIDA 4O60A 1BLXB 3F6QA 4HNAD 4DX6D 4JB8P 5FINA 1S70B 2B0OE 2QYJA 4U96D 4HBDA 5AQ9A 4BESA 2FO1E 5HKPA 1K3ZD 2QC9A 3Q9UC 4GPMA 5AN8A 4K5CA 1BD8A 2RFMA 4J7WA 5ENTD 5AQAA 5HS0A 5BXOA 1DC2A 3B7BA 1AP7A 3J5QB 1YCSB 4BSZB 2RFAA 4BEPA 4DX5D 3NOCD 5CEAA 4G8KA 1UOHA 2HE0A 5KWDA 4DRXE 4HRMB 3TWSA 3EHQA 3B95A 3TWVA 1WG0A 4CYMD 5ENPD 4HRLA 4BERA 3KEAA 2ETBA 4UUCA 1D9SA 3T9KA 3TWXA 1IHBA 4DX1A 2XEHA 5CECB 4RLYA 3JXJA 4LNUD 4BETA 5CBNA 2KBXA 2XZTG 1MYOA 3EHRA 5JA4D 1YMPA 3TWWA 2XEEA 4OAUC 3J5PA 4QFVA 4U8VD 4TUMA 5EILA 3T8KA 3TWQA 3ZKJA 3HG0D 1K1BA 5D66A 5EYPF 5KBAA 5EYLA 2ETCA 3HRAA 1MJ0A 5CBOA 3W9GA 2AJAA 2ETAA 4Z68A 1NFIE 4HI9A 3UXGA 2MYOA 2Y0BG 2F37A 1N0QA 4HQDA 2PNNA 3UTMA 4CZ2D 3V79K 3NBNB 2XENA 2BKKB 3DEOA 3ZUVB 4LSZE 3C5RA 3Q9NC 2F8XK 5CERB 4U8YD 5KNHD 4F6RD 1MX6A 4HLLA 4F1PA 3W9FA 1N0RA 2DVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWU A;  2NYJ A;  4OAV B;  5AAO A;  3V2O A;  3JXI A;  5ITZ F;  5JMN D;  3ZNG A;  3NOG D;  4C48 B;  4HI8 A;  1OT8 A;  1AWC B;  5AAR A;  1BI8 B;  5HRY A;  4DX2 A;  2L6B A;  1YYH A;  1MX4 A;  5AQB A;  1N11 A;  4DX7 D;  5BXU A;  2DWZ A;  2V4H C;  4YDY A;  5ENS D;  4QQI A;  5KNG A;  2KXP C;  4O1P A;  1DCQ A;  2P2C P;  3UI2 A;  1A5E A;  3AAA C;  3TWR A;  3D9H A;  3V30 A;  3V31 A;  3JUE A;  4J8Y A;  1MX2 A;  2BKG A;  2XZD G;  3LJN A;  5CED B;  2JAB A;  1IXV A;  5EIB E;  2DZN A;  5EN5 D;  4N5Q A;  5FIO A;  3V2X A;  3SO8 A;  4ATZ D;  3AJI A;  4A63 B;  4ZHB A;  4NIK A;  4HRN A;  1SW6 A;  2V5Q C;  4DUI A;  4GMR A;  4G8L A;  1WDY A;  2ZGD A;  4LG6 A;  4ZFH A;  2VGE A;  2A5E A;  3DEP A;  4K5B A;  1IKN D;  5AQ7 A;  1QYM A;  3IXE A;  3TWT A;  1BI7 B;  1OY3 D;  4B93 B;  2ZGG A;  1BU9 A;  4YDW A;  1G3N B;  5ENQ D;  2F8Y A;  4K5A B;  4U95 D;  2DZO A;  1SVX A;  5ENO D;  2J8S D;  1TR4 A;  4O1O A;  3EU9 A;  1K1A A;  3ZU7 B;  5ENR D;  2Y1L E;  4HB5 A;  5EID A;  4O60 A;  1BLX B;  3F6Q A;  4HNA D;  4DX6 D;  4JB8 P;  5FIN A;  1S70 B;  2B0O E;  2QYJ A;  4U96 D;  4HBD A;  5AQ9 A;  4BES A;  2FO1 E;  5HKP A;  1K3Z D;  2QC9 A;  3Q9U C;  4GPM A;  5AN8 A;  4K5C A;  1BD8 A;  2RFM A;  4J7W A;  5ENT D;  5AQA A;  5HS0 A;  5BXO A;  1DC2 A;  3B7B A;  1AP7 A;  3J5Q B;  1YCS B;  4BSZ B;  2RFA A;  4BEP A;  4DX5 D;  3NOC D;  5CEA A;  4G8K A;  1UOH A;  2HE0 A;  5KWD A;  4DRX E;  4HRM B;  3TWS A;  3EHQ A;  3B95 A;  3TWV A;  1WG0 A;  4CYM D;  5ENP D;  4HRL A;  4BER A;  3KEA A;  2ETB A;  4UUC A;  1D9S A;  3T9K A;  3TWX A;  1IHB A;  4DX1 A;  2XEH A;  5CEC B;  4RLY A;  3JXJ A;  4LNU D;  4BET A;  5CBN A;  2KBX A;  2XZT G;  1MYO A;  3EHR A;  5JA4 D;  1YMP A;  3TWW A;  2XEE A;  4OAU C;  3J5P A;  4QFV A;  4U8V D;  4TUM A;  5EIL A;  3T8K A;  3TWQ A;  3ZKJ A;  3HG0 D;  1K1B A;  5D66 A;  5EYP F;  5KBA A;  5EYL A;  2ETC A;  3HRA A;  1MJ0 A;  5CBO A;  3W9G A;  2AJA A;  2ETA A;  4Z68 A;  1NFI E;  4HI9 A;  3UXG A;  2MYO A;  2Y0B G;  2F37 A;  1N0Q A;  4HQD A;  2PNN A;  3UTM A;  4CZ2 D;  3V79 K;  3NBN B;  2XEN A;  2BKK B;  3DEO A;  3ZUV B;  4LSZ E;  3C5R A;  3Q9N C;  2F8X K;  5CER B;  4U8Y D;  5KNH D;  4F6R D;  1MX6 A;  4HLL A;  4F1P A;  3W9F A;  1N0R A;  2DVW A; 
#chains in the Genus database with same CATH topology
 3NQP A;  2H6I A;  4KZC A;  3LKU A;  3KSL A;  3MZL B;  2L9B A;  3Q75 A;  2Y3A A;  3UUX A;  3ESK A;  4YDY A;  5G04 J;  3EDT B;  3RAU A;  3L82 A;  1DCQ A;  3PEV B;  1Y8M A;  1Z5S C;  3E33 A;  4I2Z A;  4GTV A;  2C0M A;  1UN8 A;  3U4T A;  2M63 A;  4X8Q A;  2L6J A;  4HRN A;  2WXK A;  4FA6 A;  3DST A;  2A5E A;  4HOQ A;  2WQ7 A;  3TXM A;  1HG2 A;  5JHB A;  4AV7 A;  3CHR A;  1SVX A;  5ENO D;  5KCM A;  3ZYQ A;  4HS2 A;  1UN9 A;  4JA9 A;  3NF1 A;  4IRU A;  4AEZ C;  3B7B A;  3ZHE B;  3ASH A;  3NOC D;  3ABL E;  2I9C A;  4BER A;  3CHO A;  3FUE A;  2BUG A;  3JXJ A;  3PZD A;  5FQ7 A;  2XPY A;  1MHQ A;  4AJW A;  1OCZ E;  5EIL A;  1IQR A;  2LUH A;  1FT2 A;  3ZYM A;  3UXG A;  2DIW A;  3FU5 A;  4GTO A;  4KVM A;  3QNK A;  5C1D A;  1S0P A;  4RQI A;  2WXH A;  2WXG A;  3UKR G;  1H6K A;  4BT8 A;  3QWW A;  3CVP A;  3ZNG A;  3CSF A;  2QY7 A;  3B7T A;  2R03 A;  1EYH A;  1MX4 A;  4BTB A;  3FUF A;  3HXD A;  5EKQ D;  1N11 A;  2BF0 X;  5ENS D;  1X5B A;  1IQU A;  3CVW A;  4H7Y A;  4XKB A;  2V0P A;  5BUZ A;  3FU3 A;  5EIB E;  3FTV A;  3PZ1 A;  3TG4 A;  3HXB A;  3B7U X;  3ESL A;  3DSS A;  3I5P A;  4WAF A;  4B8C B;  3D9L A;  4GCO A;  3I3N A;  1OWP A;  1G3N B;  1UJJ A;  1OWM A;  4ANU A;  4HB5 A;  3PNT B;  4JL0 A;  4KBQ A;  4UWF A;  5CRU A;  2OND A;  4UWH A;  3UM2 A;  3I4G A;  5AQA A;  4GB9 A;  1YCS B;  4BSZ B;  4AVX A;  3BUA A;  3D9J A;  3RKV A;  3TXN A;  5CHE E;  3UIO C;  2GRO B;  3R9A B;  3GZ1 A;  3FUM A;  4B0Z A;  3IEG A;  4LNU D;  3AS5 A;  3ENE A;  4IN3 B;  1TNO A;  3QWV A;  2WXR A;  3DXK G;  2LSU A;  3O48 A;  5EYP F;  2GRL A;  2WXJ A;  4W9R A;  3LDZ A;  1H19 A;  5FJY A;  4UWL A;  3S7D A;  3ONK A;  3FH8 A;  1TYQ G;  2I2O A;  5ITZ F;  3SHF A;  4HI8 A;  4FAD A;  4L7T A;  4TXR A;  5HI7 A;  5EDS A;  5DIZ A;  4I1M A;  2V4H C;  5KNG A;  2R05 A;  1EF1 C;  3DSU A;  4JPS A;  3FEX A;  3LY7 A;  2CHZ A;  1H6P A;  5FZS A;  4GTM A;  2AXZ A;  2KM4 A;  3IKO B;  3QDN A;  2H6H A;  3CHP A;  5FIO A;  2EIK E;  4NIK A;  4JW1 A;  3CHM A;  5AJD A;  4DLO A;  2IY0 C;  4LG6 A;  2BED A;  3HXC A;  4K5B A;  1TN6 A;  4B93 B;  2MRI A;  4MKT A;  3FH7 A;  5CMW A;  3LY8 A;  5AQ9 A;  2FO1 E;  3VLF A;  1Z3X A;  2XPI A;  1N52 A;  4TRQ A;  4CDM A;  4WWP A;  1W3B A;  4G23 A;  4WND A;  2ZIR A;  3EHQ A;  1BPO A;  4HRL A;  3UT4 A;  3QJZ A;  4XX5 A;  4UUC A;  1JUQ A;  2WXN A;  2R5S A;  3BEE A;  4L2L A;  3HVE B;  1MYO A;  2OV8 A;  1IYG A;  4E85 A;  4C0E A;  4GML A;  4BT9 A;  3FTS A;  4GAA A;  1WM5 A;  2XRY A;  2F37 A;  4DLQ A;  3CKB A;  3UTM A;  5B1A E;  3EJN A;  5BT1 A;  1O1T A;  4G11 A;  4P29 A;  4M7C A;  2X3M A;  2PZI A;  2L0T B;  3ISM C;  1NI1 A;  4IUL A;  5FZQ A;  1LD7 A;  5AQB A;  3EIQ C;  3PE3 A;  4GMJ A;  4FHK A;  3V31 A;  3ZEF A;  2BKG A;  2IO3 C;  2P58 C;  3CEQ A;  1IXV A;  3HXF A;  2EIM E;  2IO2 C;  1FVH A;  1TEZ A;  3MKR A;  3ASN E;  3RO3 A;  4APF A;  5AQ7 A;  2OVB A;  3P2B A;  4U0Z A;  2J8S D;  3JUI A;  5EID A;  2AW6 A;  3E30 A;  4ILI A;  2R59 A;  4GTR A;  4AIF A;  4MBG A;  1MZC A;  1B89 A;  3CVL A;  4N3B A;  2LO6 A;  3PRE A;  5CEA A;  3SFY A;  4DRX E;  3TWS A;  3B95 A;  5ENN A;  5ENP D;  3CGH A;  2VQ2 A;  2H6F A;  4JZY A;  5CRV A;  3PRZ A;  3VTX A;  5G05 C;  1V55 E;  3ASD A;  5D0Q D;  5ARG A;  5JA4 D;  3JYS A;  1OWN A;  2GRM A;  2PL2 A;  4JXT A;  2IOS A;  4F3V A;  1N4R A;  3NBN B;  3SF4 A;  4U8Y D;  4DK5 A;  3JQ1 A;  3C3R A;  4JHK A;  2WMO A;  3RRM B;  3ULY A;  3TL5 A;  1SA5 A;  1SZ9 A;  3IHV A;  4CRW A;  4J8D A;  2VSX E;  2YQ8 A;  2DWZ A;  1KT0 A;  2ZXW E;  2VGX A;  2J49 A;  3NZU A;  3E4B A;  2BTD A;  3GZS A;  3V2X A;  3DSW A;  2FI7 A;  3DPY A;  1V54 E;  4L9P A;  3TG5 A;  2FBN A;  2PQR A;  4GA0 A;  3U9W A;  3X2Q E;  3SI5 A;  2I1J A;  3DEP A;  3QC1 A;  2PM6 A;  3TWT A;  3CST A;  1BU9 A;  3G2T A;  2YNQ A;  2WXF A;  3FH5 A;  4U7E B;  3EHN A;  4B89 A;  4U96 D;  2WM9 A;  5ENT D;  3NZS A;  5HS0 A;  3EIJ A;  2KCV A;  2OOE A;  1HZ4 A;  3TWV A;  5KJK A;  4YDO A;  1D9S A;  4BET A;  1JCR A;  2VTB B;  4G25 A;  4UI9 J;  5LCW J;  4FJZ A;  2XGS A;  4AY5 A;  3ULE G;  5D2M C;  1EDU A;  3I4R B;  4ACK A;  4UQX A;  4EHM A;  4LCT A;  1E96 B;  1QNF A;  4F1P A;  3T5V A;  2X38 A;  2NYJ A;  3K9I A;  2OEW A;  3SBS A;  2WMN A;  5AIJ A;  1BI8 B;  4DX2 A;  5E75 A;  4YND A;  2KXP C;  2P2C P;  3JUE A;  1JWF A;  4GA1 A;  1TN7 A;  1HFA A;  3Q7F A;  4A63 B;  3KAE A;  3TGO A;  3UQ3 A;  5EX3 A;  3U64 A;  3C98 A;  2WB2 A;  4I1A A;  4XKC A;  5T4Y A;  3SBT B;  3IXE A;  4C0M A;  3MKQ A;  4Y6W A;  2LAH A;  2LXM A;  5ENQ D;  1XNF A;  3AG1 E;  4K5A B;  4BSX A;  5A23 A;  2PQN A;  3CHQ A;  3D9O A;  1LTX A;  4BWR A;  4O60 A;  4HNA D;  1WY6 A;  4BES A;  5CCM A;  3DRA A;  2XGM A;  4J7W A;  1KPS B;  1E8X A;  3LVR E;  2E0I A;  2IQC A;  4CYM D;  3L16 A;  1OCC E;  3ULQ A;  4MLP A;  4KVO A;  3OXF A;  3APF A;  2XZT G;  3D3M A;  4UWG A;  3D9P A;  4EZK A;  4U8V D;  3IV0 A;  1UW4 B;  1P5Q A;  3PNL B;  4FP7 A;  1N0Q A;  3UM0 A;  3AG3 E;  4I9C A;  3ZRH A;  1FT1 A;  3HDX A;  1MX6 A;  2J09 A;  3UKU G;  3JXI A;  2QZA A;  1S63 A;  2YIN A;  5AAR A;  4UI9 K;  3PVL A;  2L6B A;  3BG0 B;  3ZPJ A;  1PAQ A;  2YHC A;  1MX2 A;  4LRZ A;  2IFU A;  4UWK A;  2DZN A;  2FUL A;  3PDN A;  4N5Q A;  3CVN A;  3S7J A;  4ZHB A;  3PE4 A;  2P9P G;  3QK0 A;  1H2V C;  2XGO A;  4MS6 A;  3L54 A;  1O1R A;  2Y4U A;  1TJF A;  3ZXS A;  2CHX A;  1OCR E;  4LNB A;  3D9N A;  1HU3 A;  5HQ8 A;  4I1O B;  4GZD A;  4OYS A;  3CV0 A;  4J8S A;  5LFA A;  4U63 A;  4I9E A;  4J8F A;  2JEK A;  1HE8 A;  4XIF A;  4A1G A;  2OCC E;  3ASO E;  2NSZ A;  5LX8 A;  5FWQ A;  1IHB A;  5A7D B;  2YHE A;  5CBN A;  4XEI G;  5KJM A;  4JA7 A;  3ZXP A;  3D9M A;  2J07 A;  4GCN A;  4MRU A;  3ASF A;  2X6J A;  3J5P A;  1TNY A;  1TN8 A;  2MOW A;  3CQG B;  3TWQ A;  3CK9 A;  4RSY A;  3MYV A;  2ZIS A;  4EBA G;  3ZUV B;  4LSZ E;  2F8X K;  3UIN C;  2V4L A;  3G2S A;  5AAO A;  3Q7A A;  3ZHE A;  3ZYL A;  4XZ4 A;  1HH8 A;  4HOS A;  2CFZ A;  5HRY A;  4DX7 D;  4BY6 A;  3UI2 A;  2WXP A;  3AAA C;  2P9N G;  2LSV A;  3ZYK A;  3R7Q A;  1H6O A;  3S2A A;  1A17 A;  3Q78 A;  1N4S A;  2KCK A;  3DXM G;  1NP7 A;  2CG2 A;  4GTQ A;  5JJ6 A;  4U0U A;  2DCP A;  2VGE A;  4XI9 A;  4AY6 A;  4BTA A;  2ZGG A;  3CVV A;  3CLJ A;  2F8Y A;  1X81 A;  1D8E A;  1K1A A;  3DSX A;  4F7A A;  1BLX B;  2EIL E;  2PM7 A;  3QB2 A;  4HBD A;  5AN8 A;  1RW2 A;  3PS6 A;  2C0L A;  3EU5 A;  5ARF A;  4DX5 D;  2DYR E;  2V8S E;  3T9K A;  3Q47 B;  4DPR A;  4GZ3 A;  4GU5 A;  4GTS A;  4FUL A;  4GPK A;  4UQY A;  3ZKJ A;  5KBA A;  4A55 A;  3HRA A;  5C2Y A;  3W9G A;  2ETA A;  1E7U A;  3IHY A;  4A3T A;  3AS8 A;  1Z3Y A;  1FVF A;  2FEZ A;  2XEN A;  1OUV A;  3C5R A;  3AG4 E;  5BV0 A;  4N3A A;  4TUU A;  3GZ2 A;  3S7B A;  2HYZ A;  3LY9 A;  4ILG A;  1OT8 A;  1AWC B;  5JJT A;  1E8W A;  1DNP A;  3G2V A;  4CEM A;  3FUN A;  3LEW A;  4FLB A;  5T3R A;  1HXI A;  3APC A;  1ZB1 A;  4PDX A;  2XCC A;  4KZ0 A;  1XGW A;  4FHJ A;  4EEC A;  2X6K A;  2LAI A;  5FQ6 A;  3E32 A;  4ATZ D;  3PUJ A;  4RG6 A;  5FQ4 A;  2ZGD A;  3HHM A;  4ZFH A;  3CHS A;  4AOF A;  3QAQ A;  3CVX A;  2P9U G;  1OY3 D;  1H2U A;  4AP2 A;  3FDH A;  2XPZ A;  4O1O A;  4B94 A;  4F6R D;  5BXO A;  4JC8 A;  1E7V A;  2A4Z A;  3QWP A;  4ILH B;  4HOR A;  4J8E A;  4G8K A;  3PUK A;  2J4D A;  3KEA A;  3RU0 A;  1TNZ A;  4I6J A;  4GZC A;  1U2V G;  5ANR A;  1NA0 A;  4GYO A;  2XEE A;  1PC2 A;  3HG0 D;  2P9K G;  4Z68 A;  4EPZ A;  5EX0 A;  2MYO A;  1LF8 A;  4LER A;  1JPL A;  4H7X A;  3Q9N C;  3T5X A;  5G04 C;  2UWJ G;  4HLL A;  4XE0 A;  4ANW A;  4EQF A;  1QBQ A;  2KZT B;  4NRH B;  1NZN A;  4HXI A;  4O1P A;  3HVE A;  3V30 A;  4RVB A;  4HFG A;  4Q96 A;  2X6H A;  3ABK E;  3AU4 A;  3UT8 A;  2F0Y A;  1SZA A;  4NQ0 A;  4LEU A;  3LJ3 A;  3KEZ A;  1WDY A;  3ZFW A;  4FU3 A;  2UY1 B;  3SFX A;  4U8H A;  3U3W A;  4WNE A;  2J9Q A;  3EHM A;  1TR4 A;  3MCX A;  3EU9 A;  4N3C A;  3BU8 A;  1KZO A;  4YVO A;  3L08 A;  2RFM A;  3FUD A;  2GRN B;  3Q79 A;  3HXE A;  1NL4 A;  3IBE A;  4HRM B;  4GA2 A;  1Y6I A;  3UPV A;  3TWW A;  4OAU C;  5B3S E;  4TUM A;  3Q5M A;  4URK A;  5FZR A;  3LYA A;  5BPP A;  3HYM B;  4HI9 A;  5E76 A;  3FP3 A;  3QAR A;  3CVY A;  1Q2Z A;  3T8M A;  3SD5 A;  1U3C A;  4Q94 A;  1N4P A;  3ZIM A;  3SGH A;  5KNH D;  3B13 A;  2WXM A;  2RD0 A;  3FUL A;  3UM3 A;  1YYH A;  2WPV A;  3UX4 A;  4JEH A;  3UT7 A;  3L9T A;  4PS8 A;  3R7R A;  4I6E A;  3TWR A;  4DI3 A;  4J8Y A;  3VLE A;  4N5C A;  5CED B;  3SY2 A;  5T8I A;  4ACL A;  3BG1 B;  2R17 C;  4BFR A;  2OEV A;  1ELR A;  4EZL A;  1KT1 A;  4I43 A;  3MV2 B;  4GYY A;  2Y69 E;  2KC7 A;  3FWV A;  2WQ6 A;  4U95 D;  1U3D A;  1S70 B;  1KZP A;  4V3I A;  3DSV A;  5HKP A;  3G2U A;  4EZJ A;  1DC2 A;  3PZ4 A;  3UIP C;  2IJG X;  2WXO A;  3O4Z A;  2KCL A;  5DBK A;  4JEU A;  3RRN B;  4RLY A;  3CK7 A;  2KBX A;  2I6H A;  1YMP A;  2AVP A;  3Q15 A;  3GYZ A;  4GTT A;  5D66 A;  2ETC A;  1MJ0 A;  3LCA A;  1NFI E;  4KMO A;  1S64 A;  5G05 J;  2BKK B;  1OWO A;  5CER B;  2GW1 A;  1JWG A;  2LNI A;  4TXQ A;  3VLD A;  5JHA A;  4U0S A;  3MX3 A;  5G2N A;  3P1U A;  4QQI A;  2GGF A;  2L0I A;  3D9H A;  5BNW A;  2VTB A;  3CIA A;  3URZ A;  4WUY A;  4TV3 A;  4ANX A;  4AM9 A;  3C3O A;  2V5Q C;  4G24 A;  2ION A;  3FTW A;  1OXJ A;  3CVQ A;  2ZU6 B;  4YDW A;  3E37 A;  3LS8 A;  1OCO E;  4CT4 A;  3ZGQ A;  3PZ2 A;  5M72 A;  2QYJ A;  1HS6 A;  4GTP A;  3L6A A;  4GPM A;  4K5C A;  1BD8 A;  1HO8 A;  3OXG A;  2EQX A;  1DCE A;  2QFC A;  5LP0 A;  2E2E A;  1HX8 A;  1E8Z A;  1NA3 A;  1SA4 A;  4ANV A;  3LVQ E;  2IEJ A;  2WQH A;  4R7L A;  2X6I A;  4A3V A;  3B7S A;  4PH4 B;  2DYS E;  4F53 A;  4PS7 A;  1K1B A;  3RRU A;  4I6G A;  1QZ2 A;  2XEV A;  2EIJ E;  3C72 A;  3WG7 E;  1WAO 1;  1Z6T A;  2VSO E;  2XQ0 A;  5BV1 A;  5JJ7 A;  3CVU A;  2AXV A;  2QYU A;  2XCB A;  4AXH A;  3MJW A;  4G2V A;  3MEK A;  3SZ7 A;  2EIN E;  3GW4 A;  4GZ6 A;  5H7P A;  3ABM E;  4WWO A;  3Q73 A;  2JAB A;  4HLE A;  3FY4 A;  3N71 A;  1VDY A;  3KS2 A;  3FUJ A;  4E6H A;  3B7R L;  4HOU A;  1SW6 A;  4L23 A;  4GMR A;  3ZVV A;  3RIB A;  2IU1 A;  3AS4 A;  3TAX A;  1IKN D;  2HO1 A;  3FTU A;  3JCK C;  3D9I A;  2DZO A;  2J4B A;  2JLB A;  4DX6 D;  5FIN A;  5BXU A;  1N54 A;  3J5Q B;  3FTY A;  1TNU A;  2HR2 A;  5LOZ A;  4Q69 A;  4NAC A;  5KWD A;  3RK6 A;  1H0A A;  4OVV A;  4CT0 A;  2Q7F A;  3MV3 B;  2ETB A;  4G26 A;  5D0O D;  4DX1 A;  2XEH A;  2XS8 A;  5CEC B;  1K8K G;  4WNF A;  4CDN A;  5KJN A;  3PH0 C;  3L22 A;  1INZ A;  2R02 A;  2WXL A;  2HM8 A;  4JVS A;  3SFZ A;  2PNN A;  3AU5 A;  3CKC A;  1TNB A;  2NXP A;  2A5U A;  4N2Q A;  4KXK B;  2LXL A;  2CHW A;  2B6C A;  1N0R A;  4ATG A;  4CDR A;  4PS3 A;  4CGV A;  3ML8 A;  4OAV B;  2RG8 A;  5BW8 C;  3G2W A;  2XRZ A;  5FQ8 A;  3FEY A;  2IF4 A;  1A5E A;  3FUH A;  1FPP A;  4O6F A;  2XZD G;  4Y6C A;  3KSQ A;  4FLH A;  2FO7 A;  3ZN3 A;  4XI0 A;  1SQM A;  3FU0 A;  3SO8 A;  3APD A;  2WXI A;  4N39 A;  4M3O A;  4DUI A;  4G8L A;  2XHE A;  2MHK A;  5CMY A;  1MQS A;  2GRR B;  3NAW A;  1QYM A;  3PEU B;  1BI7 B;  2DBA A;  1QQE A;  4NUR A;  1EPU A;  4DJA A;  1HG5 A;  4BX8 A;  1UG3 A;  3ZU7 B;  3RSE G;  3EUV A;  2Y1L E;  2B0O E;  5AEN A;  1JCS A;  1KLX A;  5B1B E;  3U66 A;  4HVB A;  3FHE A;  3Q9U C;  4F1S A;  2V5F A;  3LPZ A;  1AP7 A;  3L13 A;  4JHJ A;  4BEP A;  4UI9 C;  4KYO B;  2P9S G;  4ME2 A;  5LCW C;  3ONL A;  3L17 A;  1WG0 A;  4JD2 G;  4JHR A;  2AWI A;  3JQ0 A;  3UMV A;  3TWX A;  3FTZ A;  1N9A A;  2C2L A;  2VGX B;  3CQC B;  2Y4T A;  3DPD A;  5ANL A;  3VTY A;  5CCL A;  1D8D A;  3RO2 A;  5EYL A;  4I2W A;  5CBO A;  2H6G A;  2AJA A;  1N94 A;  3DBS A;  2Y0B G;  4LNG A;  3LXU X;  3TJP A;  3NB2 A;  2KAT A;  4J6I A;  1JCQ A;  2I1K A;  3E34 A;  2VJ8 A;  3W9F A;  4L1B A;  2VYI A;  3C3Q A;  2DVW A;  2P9I G;  3TWU A;  4DI4 A;  2R2L A;  5JMN D;  3NOG D;  4C48 B;  3D9K A;  5KJL A;  3Q4A B;  2XS1 A;  4YDE A;  3CK8 A;  4UQZ A;  4U04 A;  4YVQ C;  3FTX A;  3SQV A;  4B8A A;  3LJN A;  5EN5 D;  2P9L G;  5IY5 E;  5G55 A;  3R9M A;  3OXL A;  2VSN A;  3QKY A;  1UJK A;  4C9B B;  2ILR A;  5AYW D;  2X6F A;  1E8Y A;  3MGB A;  3CR3 A;  2FF4 A;  2WVI A;  4D10 C;  1TJC A;  5ENR D;  3F6Q A;  4JB8 P;  4LUN U;  2QC9 A;  4ABN A;  1ZBP A;  3PZ3 A;  2RFA A;  3FUK A;  2CFU A;  5FT9 A;  1UOH A;  2HE0 A;  4KT6 B;  4FC8 A;  5J08 A;  4TXP A;  3MA5 A;  1ELW A;  3EHR A;  4CGW A;  3UM1 A;  3ZW3 A;  4WWN A;  1DVP A;  1L5J A;  3FFL A;  1PY1 A;  3S7F A;  4HQD A;  4OVU A;  3SNX A;  4CZ2 D;  3V79 K;  2CG3 A;  3DEO A;  4U07 A;  2WXQ A;  2VGY A;  4PUC A;  3MKQ B;  5FTP A;  4K03 A;  3V2O A;  4FJY A;  4L2Y A;  2NC9 A;  4BX9 A;  4A1S A;  3FUI A;  3FU6 A;  5AJL A;  3QOU A;  2IOL A;  1FCH A;  3AG2 E;  3AJI A;  2GRQ B;  3ML9 A;  3ASG A;  1N95 A;  3Q49 B;  1YA0 A;  4K0R A;  4CCA A;  2AXU A;  1E90 A;  1GW6 A;  2J08 A;  1ZU2 A;  2GRP B;  3KD7 A;  3OAW A;  4I17 A;  4RG9 A;  3RJV A;  2KZT A;  4J0U A;  3HIZ A;  1K3Z D;  2OVF A;  5A6C A;  4IYP A;  4N2S A;  2VSY A;  4WNG A;  1ELK A;  3BQO A;  4GYW A;  3DWL G;  4GZ5 A;  5J90 A;  4APO A;  3OTN A;  1O5M A;  1H2T C;  4G1T A;  2RKK A;  1OWL A;  4QFV A;  2UY1 A;  1O1S A;  3T8K A;  1IHG A;  4EBA A;  1N4Q A;  3WXX A;  1LD8 A;  1HF8 A;  4HOT A;  1RZ4 A; 
#chains in the Genus database with same CATH homology
 3TWU A;  2NYJ A;  4OAV B;  5AAO A;  3V2O A;  3JXI A;  5ITZ F;  5JMN D;  3ZNG A;  3NOG D;  4C48 B;  4HI8 A;  1OT8 A;  1AWC B;  5AAR A;  1BI8 B;  5HRY A;  4DX2 A;  2L6B A;  1YYH A;  1MX4 A;  5AQB A;  1N11 A;  4DX7 D;  5BXU A;  2DWZ A;  2V4H C;  4YDY A;  5ENS D;  4QQI A;  5KNG A;  2KXP C;  4O1P A;  1DCQ A;  2P2C P;  3UI2 A;  1A5E A;  3AAA C;  3TWR A;  3D9H A;  3V30 A;  3V31 A;  3JUE A;  4J8Y A;  1MX2 A;  2BKG A;  2XZD G;  3LJN A;  5CED B;  2JAB A;  1IXV A;  5EIB E;  2DZN A;  5EN5 D;  4N5Q A;  5FIO A;  3V2X A;  3SO8 A;  4ATZ D;  3AJI A;  4A63 B;  4ZHB A;  4NIK A;  4HRN A;  1SW6 A;  2V5Q C;  4DUI A;  4GMR A;  4G8L A;  1WDY A;  2ZGD A;  4LG6 A;  4ZFH A;  2VGE A;  2A5E A;  3DEP A;  4K5B A;  1IKN D;  5AQ7 A;  1QYM A;  3IXE A;  3TWT A;  1BI7 B;  1OY3 D;  4B93 B;  2ZGG A;  1BU9 A;  4YDW A;  1G3N B;  5ENQ D;  2F8Y A;  4K5A B;  4U95 D;  2DZO A;  1SVX A;  5ENO D;  2J8S D;  1TR4 A;  4O1O A;  3EU9 A;  1K1A A;  3ZU7 B;  5ENR D;  2Y1L E;  4HB5 A;  5EID A;  4O60 A;  1BLX B;  3F6Q A;  4HNA D;  4DX6 D;  4JB8 P;  5FIN A;  1S70 B;  2B0O E;  2QYJ A;  4U96 D;  4HBD A;  5AQ9 A;  4BES A;  2FO1 E;  5HKP A;  1K3Z D;  2QC9 A;  3Q9U C;  4GPM A;  5AN8 A;  4K5C A;  1BD8 A;  2RFM A;  4J7W A;  5ENT D;  5AQA A;  5HS0 A;  5BXO A;  1DC2 A;  3B7B A;  1AP7 A;  3J5Q B;  1YCS B;  4BSZ B;  2RFA A;  4BEP A;  4DX5 D;  3NOC D;  5CEA A;  4G8K A;  1UOH A;  2HE0 A;  5KWD A;  4DRX E;  4HRM B;  3TWS A;  3EHQ A;  3B95 A;  3TWV A;  1WG0 A;  4CYM D;  5ENP D;  4HRL A;  4BER A;  3KEA A;  2ETB A;  4UUC A;  1D9S A;  3T9K A;  3TWX A;  1IHB A;  4DX1 A;  2XEH A;  5CEC B;  4RLY A;  3JXJ A;  4LNU D;  4BET A;  5CBN A;  2KBX A;  2XZT G;  1MYO A;  3EHR A;  5JA4 D;  1YMP A;  3TWW A;  2XEE A;  4OAU C;  3J5P A;  4QFV A;  4U8V D;  4TUM A;  5EIL A;  3T8K A;  3TWQ A;  3ZKJ A;  3HG0 D;  1K1B A;  5D66 A;  5EYP F;  5KBA A;  5EYL A;  2ETC A;  3HRA A;  1MJ0 A;  5CBO A;  3W9G A;  2AJA A;  2ETA A;  4Z68 A;  1NFI E;  4HI9 A;  3UXG A;  2MYO A;  2Y0B G;  2F37 A;  1N0Q A;  4HQD A;  2PNN A;  3UTM A;  4CZ2 D;  3V79 K;  3NBN B;  2XEN A;  2BKK B;  3DEO A;  3ZUV B;  4LSZ E;  3C5R A;  3Q9N C;  2F8X K;  5CER B;  4U8Y D;  5KNH D;  4F6R D;  1MX6 A;  4HLL A;  4F1P A;  3W9F A;  1N0R A;  2DVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...