2ETDA

Crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
151
structure length
129
Chain Sequence
b'HHLVSLEQEVQEYSQIQNQLQRRADLIPNLVETVGYAAHEEILEEIANARALIGATPQESAQADAELSSALSRLLAIAENYPNLADANFRQLMDELAGTENRIAVARRDYNEAVYNTAIGFEEQYFEAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lemA protein
publication title Crystal structure of LEMA protein (tm0961) from THERMOTOGA MARITIMA at 2.28 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Membrane protein
total genus 47
structure length 129
sequence length 151
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04011 LemA LemA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.20 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) LemA-like domain 2etdA00
2ETDA
chains in the Genus database with same CATH superfamily
2GSCA 3DA3A 4G75A 4Z7GA 2XTQA 4O1PA 1JQOA 4Q9VA 3VA9A 5HGIA 3B55A 2V6EA 1U5KA 3L0IA 4NV2A 3I9V1 3JSBA 2F6MB 2XTRA 4YZCA 4YZ9A 4OAVB 4I1TA 4HFVA 4O1OA 2P22B 3FVVA 3FBVA 3P23A 3DO9A 4GXTA 3LJ1A 1YO7A 4DWLA 4OAUC 2RLDA 4AS3A 2L1LB 2CAZB 4HEA1 2V1CC 3UITA 2QGMA 2A2DA 2E8GA 2ZRRA 2JB1A 1W3SA 2JBWA 4NV5A 2JB2A 2RIOA 3SDJA 3IAM1 3LJ2A 2FUG1 3Q8DA 3LJ0A 2RADA 2ETDA 2FEFA 1SJ8A 2JB3A 2YFBA 2JAEA 4YZDA 5LNK1 2KKMA 4PL4A 2XMXA 3IAS1 2QZGA 2YFAA 4G76A 4Z7HA 1TDPA 2IP6A 2K19A 3F4MA 4PL5A 4JCVE 2QSBA 4AS2A 2A2CA 2BL8A 2ZW3A 3DA4A 2MJFB 2BL7A 3FNBA 4U6RA 2F66B 3AJFA 4PL3A 2HGKA 3KP9A 2FU2A
chains in the Genus database with same CATH topology
2ETDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ETD A; 
#chains in the Genus database with same CATH topology
 2GSC A;  3DA3 A;  4G75 A;  4Z7G A;  2XTQ A;  4O1P A;  1JQO A;  4Q9V A;  3VA9 A;  5HGI A;  3B55 A;  2V6E A;  1U5K A;  3L0I A;  4NV2 A;  3I9V 1;  3JSB A;  2F6M B;  2XTR A;  4YZC A;  4YZ9 A;  4OAV B;  4I1T A;  4HFV A;  4O1O A;  2P22 B;  3FVV A;  3FBV A;  3P23 A;  3DO9 A;  4GXT A;  3LJ1 A;  1YO7 A;  4DWL A;  4OAU C;  2RLD A;  4AS3 A;  2L1L B;  2CAZ B;  4HEA 1;  2V1C C;  3UIT A;  2QGM A;  2A2D A;  2E8G A;  2ZRR A;  2JB1 A;  1W3S A;  2JBW A;  4NV5 A;  2JB2 A;  2RIO A;  3SDJ A;  3IAM 1;  3LJ2 A;  2FUG 1;  3Q8D A;  3LJ0 A;  2RAD A;  2ETD A;  2FEF A;  1SJ8 A;  2JB3 A;  2YFB A;  2JAE A;  4YZD A;  5LNK 1;  2KKM A;  4PL4 A;  2XMX A;  3IAS 1;  2QZG A;  2YFA A;  4G76 A;  4Z7H A;  1TDP A;  2IP6 A;  2K19 A;  3F4M A;  4PL5 A;  4JCV E;  2QSB A;  4AS2 A;  2A2C A;  2BL8 A;  2ZW3 A;  3DA4 A;  2MJF B;  2BL7 A;  3FNB A;  4U6R A;  2F66 B;  3AJF A;  4PL3 A;  2HGK A;  3KP9 A;  2FU2 A; 
#chains in the Genus database with same CATH homology
 2ETD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...