2EUCA

Crystal structure of yfmb from bacillus subtilis. nesg target sr324
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
113
structure length
108
Chain Sequence
MQYFSPEQQYNAWIVSDLVKQIFHKRAGCSPGIHELAVFAEEHFHIDIDFVFSIIMNIGDIEFALTDEIEKKLSGYLSTLLPYVTADMFETSKANAHAFLSAAYHLFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yfmB
publication title Crystal structure of YfmB from bacillus subtilis NESG TARGET SR324.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 36
structure length 108
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11486 DUF3212 Protein of unknown function (DUF3212)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.570 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2eucA00
2EUCA
chains in the Genus database with same CATH superfamily
1SXJA 5A2QS 4M0DA 2I7NA 3GLIE 4PCZA 1D2NA 4L6V6 4L8RC 2W82A 5IWAM 1E9SA 2ZAOA 4LF6M 5KO3A 4MH0E 1HQCA 5EP2A 4GRIA 4LFAM 4A3VB 2QSFX 5EXPA 2DZLA 2LH0A 1K3WA 3KS8A 1IM2A 4D82A 3KOYE 3Q8GA 3C58A 1VDDA 3I4YA 5E26A 2DENA 4FCVA 4KO8A 5EP1A 2Y0QA 2JY7A 1QUTA 3K1JA 1QDRA 5ITXA 1IBLM 4AW4A 1XB2B 3LVWA 4LJ6A 2UUCM 2R46A 4WW0A 1EE8A 3FUTA 3NBXX 4LGMA 4MB7A 1QQWA 3AOEA 4LCBA 3IHPA 1J09A 4X66M 1IY1A 3QYBA 2V1CA 3RGSA 2LBCA 4IIWA 2K0BX 4NRWA 3T15A 4DR4M 4BB9A 4XK8F 1PJJA 1GJSA 2R4EA 1XNQM 3BOSA 1K3XA 2CUZA 1GABA 1VDLA 2HAKA 3U5ZA 3KP0E 4GH9A 5JI3E 3SAUA 4MGKE 2X8AA 3M6AA 1TF0B 5JI2E 1L8QA 2JY5A 4Z6YA 2R62A 1QAQA 1PJTA 4IBIA 2J7OA 2XF3A 3J7BA 1DO2A 4IBFA 3C9PA 1D0MA 1OFHA 4LF7M 2KNAA 3JR4A 4IBBA 2EO2A 1MN3A 2I7PA 3CF6E 3UZUA 2C99A 4RNAA 3TWLA 4GC5A 1KFVA 4II7A 3TQSA 4IBEA 4OW0A 5IZ7D 4DV7M 1DGBA 1ZAEA 4B08A 4G4QA 2CRUA 3V76A 2GQFA 3GLHA 4OVZB 1DV0A 3CF2A 1Z5BA 1VEKA 4JI0M 4B3TM 3QAUA 4PT5A 3GLGE 2LHCA 1WIVA 4IBCA 4YHHM 2XLJA 3AOGA 3FD9A 3U6LA 1XMOM 2C9CA 1Z5CA 3HWSA 1PRBA 1JR3A 2QZ4A 3PNVA 4KLNA 5IREB 2JY6B 5FTMA 5ITUA 3ZH9B 3JR5A 3L28A 2K47A 1TDHA 1G71A 2FH0A 4R7GA 4B7HA 3U61B 2WSCF 4PDGA 2MGWA 1HNXM 3TWKA 2C5RA 3SFZA 1SXJC 4FWDA 4CIZA 3GLIA 1W5SA 2M60A 2QP9X 1UM8A 1J5EM 3SYKA 2MH8A 3GPXA 3J80S 3TL4X 4GIPA 4NL4H 4XGIA 3PFIA 4DUYM 1MJGM 2LVQD 4LZZA 2LVAA 3PXGA 2VQEM 1NY5A 4X64M 2DWLA 1DGHB 4GITA 2Y21A 5EXTA 3AL0C 3HJQA 2L4FA 2FS1A 4DV6M 2O5RA 1IXSA 1LV7A 3PVSA 2VQFM 4REZA 2YFQA 2YQZA 3A45A 2QQ8A 2C9OA 2HWJA 2JUJA 4G4OA 1JQJC 2P5TA 1HNZM 2Z4SA 2R6FA 3AOEC 3HY5A 3T6PA 2R45A 1ZMVA 3FUXA 4LY6A 1CUKA 1ZMUA 4CISA 2DVWB 1TH4A 4I4LA 1XXHE 1IY0A 2Z8YM 3I4VA 3GQ5A 2G3QA 4MGZE 2QPAA 4DUZM 1G8PA 1N36M 1D0KA 2ZANA 4JI1M 2BNKA 1R6BX 5F3WA 1PJIA 3LW5F 1NV8A 1IQPA 3MHVC 4WP2A 3GPPA 1GO5A 3R8FA 4M9XA 4NRVA 4B7GA 1QYRA 2L7HA 2YNMD 1Z6TA 1QUSA 4AQYM 4P16A 3C3EA 3HX3A 1Q02A 3F92A 3M7GA 3U6SA 2ZM6M 3L29A 1VQ1A 2ZAMA 4JI5M 1J7KA 1OAIA 3U6EA 1AUAA 1NHGC 3HU2A 4PD2A 3J7AS 4G4RA 1NSFA 4JV5M 2GNOA 3KSXA 1C7YA 4AZFA 3KW6A 1Z5AA 3FRIA 2DAGA 5EQTA 4LFBM 2FOIC 2EKFA 2JY8A 3JAMS 4NSOB 2DWMA 1E32A 3SC3A 3GLGA 2XEPA 3U6QA 3HHZA 2KRKA 3EIEA 3LQRA 1Y8GA 3L26A 3GLFB 2JZ1A 3T1YM 3KS4A 3D8BA 5FSWA 3Q8XA 4HLQA 3U6CA 3KOWE 3K2LA 3RE8A 1FJGM 3FTFA 4LF5M 1NV9A 1T3TA 2XH9A 1GVNA 5DYGA 4KT0F 2APLA 3HKPA 3GQ4A 3HU3A 1OIPA 3LCUA 1T43A 1TGUA 3SMPA 1I94M 1L2DA 1HNWM 1L1TA 2CFOA 4JI7M 3HZJA 4X65M 1V33A 1WXQA 3T1HM 4QOZC 3I51A 1RU3A 3FTDA 2AHMA 3KXEC 4R3DA 2QHOB 4UN2B 4OX9M 1HT2E 2QNJA 2D7HA 1IN7A 1QAOA 2BWBA 3FUUA 2OPFA 5LMNM 2HCBA 2WZJA 3BBZA 2DAEA 5DFLA 3UGJA 3GP1A 2OOBA 3A98B 3RFWA 2JA2A 4R71A 1GL6A 2KW0A 2YR0A 3U6DA 3VLFB 5H37D 3U6OA 4JI4M 1R2YA 3L27A 2O25A 1BVSA 2DZNB 4B3SM 1OKSA 3T38A 2ZBKB 4AI6A 3L2AA 3CF0A 1XXHA 1A5TA 1VG5A 2XGNA 3SHGB 2CV2A 4TUWA 3SHFA 4NXMM 2K9DA 4JI8M 1IN8A 4ZPXA 1EFUB 1F4IA 2O01F 2UU9M 2H1RA 2NQ8C 4B3RM 4GKJM 1Q3BA 2N35A 1JB0F 2DWNA 5FTKA 2F4VM 1L2CA 4W5WA 2KHHA 4NSRA 1JR3D 2K6BA 2JP7A 1IY2A 2C98A 3U60B 3SAVA 3CTWB 3GPUA 1N77A 2DI0A 3HHXA 5KPRA 2CEAA 3FUWA 4DR2M 3KOZE 4MGYE 1XNRM 4JN6A 1NO1A 3D8LA 4IBKA 3SBJA 2H5XA 4CGYB 2HKJA 3GRYA 2Z7JA 1GKIA 1TR8A 4LJ7A 4QHTA 1DGGA 2LVNC 3DZDA 2QBYB 2D7EA 1PJQA 4XBOA 3KFUG 2XSZD 1PM5A 1TH3A 4DR5M 4FVMA 4P17A 2M5ZA 3SAWA 2LVOC 1SXJB 3EIHA 1V92A 2BJVA 2HL7A 2KXEA 4DV5M 4AKGA 5DNYA 3E21A 5BPVA 2KEBA 1ZQ9A 2Y0TA 3LMMA 1L2BA 4M9ZA 1L1ZA 2XFTA 3VK7A 2JWSA 4D80A 2R0IA 2Z4RA 3J81S 3KOXE 2UUBM 2MROB 1IXZA 3IECA 1N33M 2B3TA 4FD2A 5C18A 2XFSA 1N78A 4MGHA 5FTJA 1P3QQ 3FE3A 3DOAA 3WHKA 2QCUA 1R2ZA 3H4MA 5EJCA 1TDZA 3WHLA 3FYDA 3GRVA 4PDIA 1QVRA 1Z59A 3B74A 3W67A 1GLNA 2ZTDA 3B7NA 3SMSA 2CE7A 4YY3M 3W0FA 2L09A 1Q3CA 1QDTA 2J7NA 4B3MM 2Y20A 2XZFA 2CHQA 3LQQA 3TPZA 1NJGA 5ITTA 2OQ4A 1IXRC 4B7FA 4F1IA 3UMMA 3U5ZB 1H6UA 1OQYA 4MM3B 5EP4A 1HT1E 5EP3A 3UK6A 4LFCM 3B9PA 4AKHA 2CP8A 4M9SA 4JI6M 3FTEA 4K0KM 5ITRA 3KDSE 3K8ZA 3MJ5A 1G3IA 4CJ6A 1E9RA 4LJ9A 3VKHA 1SXJD 1QANA 4RKUF 4BLCA 2JZ0A 3A42A 4I5SA 3BXWA 4FWHA 4IBJA 1IBMM 3GRRA 3GRUA 3B7QA 4FW9A 2BJWA 4OVZA 3HHYA 3ZC7B 3U6MA 1G41A 2CV0A 1WJ7A 2LTUA 1NY6A 4S12A 4MGIE 3RGPA 3THGA 4AG6A 3GLFE 3DFZA 4HL4A 4G6ZA 3CGWA 2CHGA 3QWLA 3GLHB 4I8OA 4IJEA 1OIZA 2KDLA 1IBKM 1D0LA 1WGNA 2ERCA 1R4GA 4LJ4A 3DA1A 1S3SA 4DV0M 4LF4M 2WSEF 4RF0A 3GPYA 1UFZA 4GKKM 1NNUC 3E9SA 4L15A 3ZQJA 4M0WA 1ORYB 1XWIA 3AKZA 2RKOA 4LJAA 2D7GA 2UXBM 4IBDA 5EXSA 4DV3M 4GHLA 1HR0M 2VDBB 4L16A 2L2DA 1DGHA 4CHTB 3GO8A 3GLIB 4JI3M 1YUBA 2G5GX 3FKEA 3LCVB 3TWMA 1XMQM 4DR7M 3ZCBB 4JI2M 4GEWA 3W68A 3U6PA 3NWLA 1GJTA 2UUAM 3B7ZA 2VF7A 3H4JA 2HHHM 1HJPA 2F5PA 5FLXS 5ITQA 1I4WA 1N75A 4GMQA 1IXSB 2FFJA 4Z8XA 3TE6A 4QHSA 5LMUM 4LF9M 2JNHA 2EA0A 3MK6A 4DV2M 4LJ5A 3KSJA 1ZV1A 4QOSA 5ITYA 2KNZA 2KRUA 2R18A 1NNJA 1N34M 1OTRA 2DAIA 4DR1M 4LRSA 5FTLA 1IFYA 2KA6B 2UXCM 1NVMA 2Z3XA 1G4AE 8CATA 1IN6A 2DZOB 1YLAA 1TTEA 4EIWA 2J5YA 2F5SA 4LRTA 4FCTA 3IG8A 4NC6A 3ILKA 4DBGB 2LWXA 4LF8M 5C1BA 4Y28F 4LJ8A 1SG9A 1VEJA 3AFHA 2DNAA 2MR9A 4JXJA 3HJ8A 2DWZB 3GQ3A 2R44A 1FNNA 4OU7A 2FE8A 3VDUA 4FWGA 1Q39A 1OJLA 3I01M 1PGYA 5EXXA 2F5NA 2LXEA 2CHVA 5E6JA 1N32M 2VF8A 4DR6M 3UJNA 2C96A 2DKLA 4LZJA 2CWBA 1WGLA 4BBAA 3K9PA 2LVPC 4FCWA 3SARA 2V6ZM 1SXJE 3GLFA 1NHWC 2DAKA 1XC8A 4L78A 2L6OA 2F5QA 1T6OA 3L25A 1E94E 2EUCA 1QAMA 3K9OA 3GLGB 3J27B 2EJSA 3K92A 3OTOM 1HQYE 4I81A 4IJFA 2L4EA 2R4JA 3C3DA 2L7IA 1KSFX 2X49A 3I04M 4ANRA 1QZEA 5KQDA 1IN4A 1X37A 4HEOA 3R9XB 2E5LM 1R7RA 5ITXE 3B89A 3FTCA 3VKGA 4L4UA 1KYIA 1TH2A 3QYEA 2RGHA 4G3OA 2RGOA 2UXDM 2X4AA 4D81A 2DAMA 2DHRA 2XSZA 4NOOB 5BR8M 4GHAA 3HJSA 1PJSA 3E4RA 4JYAM 4ITQA 2OO9A 4Q7JA 4AKIA 1IN5A 3HHWA 4X62M 2A5YB 3MMPA 2DXIA 2EKKA 5DYIA 7CATA 3SASA 3FUVA 2Q2EB 1EIJA 3KP1E 2LHGA 1DGFA 1R5LA 3M0EA 1MX0A 3PNYA 4AG5A 4DV4M 2KZSA 5L8RF 2RRUA 3FYCA 3VFDA 3NBIA 1G59A 4QNMA 2WSFF 3AJIB 2QENA 2R65A 4QNRA 2CV1A 4DR3M 2V1UA 3AV0A 1K82A 1W5TA 4KHPM 3HGIA 4LG2A 2BWEA 1WR1B 2F5OA 1DO0A 5FTNA 2VIIA 2ZTCA 5KPZA 5KQ8A 1AIPC 1XXHB 1YSYA 2MJ5B 3E46A 3FRHA 1C1KA 3J2PB 1VEGA 4IBGA 3IG5A 1OFIA 1GL7A 1QZMA 1V34A 2DHYA 4KODA 3U60A 2G8LA 3GLHE 4WURA 4DV1M 1WHCA 5KPTA 4G4NA 2XZUA 1XHBA 3SATA 3VDPA 1MU5A 2FNAA 3KVWA 1LTMA 1YE9A 3HU1A 2LNHC 4RF1A 2KZUA 1JR3E 4F2LA 3W0LB 3U61A 3VK8A 1NJFA 5IT9S 3A46A 2QBYA 3SYLA 2JXNA 2KNVA 4LGYA 1ZMWA 4GC9A 2OOAA 1OAOC 4NXNM 3LVVA 5GKNA
chains in the Genus database with same CATH topology
1SXJA 5A2QS 4M0DA 2I7NA 4PCZA 1D2NA 4L8RC 2W82A 5IWAM 1E9SA 2ZAOA 4LF6M 5KO3A 4MH0E 1HQCA 5EP2A 4GRIA 4LFAM 4A3VB 5EXPA 2LH0A 1K3WA 3KS8A 1IM2A 4D82A 3KOYE 3C58A 1VDDA 3I4YA 5E26A 4FCVA 4KO8A 5EP1A 2Y0QA 3K1JA 1IBLM 5ITXA 4AW4A 3LVWA 4LJ6A 2UUCM 2R46A 4WW0A 1EE8A 3FUTA 4LGMA 4MB7A 1QQWA 3AOEA 4LCBA 1J09A 4X66M 1IY1A 2V1CA 3RGSA 4IIWA 4NRWA 3T15A 4DR4M 4BB9A 1PJJA 2R4EA 1XNQM 3BOSA 1K3XA 2CUZA 3U5ZA 3KP0E 4GH9A 5JI3E 3SAUA 4MGKE 2X8AA 3M6AA 5JI2E 1L8QA 4Z6YA 2R62A 1QAQA 4IBIA 2J7OA 2XF3A 3J7BA 1DO2A 4IBFA 1OFHA 4LF7M 3JR4A 4IBBA 2EO2A 3UZUA 2I7PA 3CF6E 2C99A 4RNAA 3TWLA 4GC5A 1KFVA 4II7A 3TQSA 4IBEA 4OW0A 5IZ7D 4DV7M 1DGBA 1ZAEA 4B08A 4G4QA 3GLHA 4OVZB 3CF2A 1Z5BA 4JI0M 4B3TM 3QAUA 4PT5A 4IBCA 4YHHM 2XLJA 3AOGA 3FD9A 3U6LA 1XMOM 2C9CA 1Z5CA 3HWSA 1JR3A 2QZ4A 3PNVA 4KLNA 5IREB 5FTMA 3JR5A 5ITUA 3ZH9B 3L28A 2K47A 1TDHA 4R7GA 4B7HA 3U61B 4PDGA 1HNXM 3TWKA 2C5RA 3SFZA 1SXJC 4FWDA 3GLIA 1W5SA 2M60A 2QP9X 1UM8A 1J5EM 3SYKA 3GPXA 3J80S 3TL4X 4GIPA 4NL4H 4XGIA 3PFIA 4DUYM 4LZZA 2VQEM 3PXGA 1NY5A 4X64M 2DWLA 1DGHB 4GITA 2Y21A 5EXTA 3AL0C 3HJQA 4DV6M 2O5RA 1LV7A 3PVSA 2VQFM 4REZA 2YFQA 2YQZA 3A45A 2C9OA 4G4OA 1JQJC 2P5TA 1HNZM 2Z4SA 3AOEC 2R45A 3FUXA 4LY6A 4CISA 2DVWB 1TH4A 4I4LA 1IY0A 3I4VA 3GQ5A 4MGZE 4DUZM 2QPAA 1N36M 1G8PA 4JI1M 2ZANA 2BNKA 1R6BX 5F3WA 1PJIA 3MHVC 1IQPA 3GPPA 3R8FA 4M9XA 4NRVA 4B7GA 1QYRA 2L7HA 2YNMD 1Z6TA 4AQYM 4P16A 3M7GA 3U6SA 2ZM6M 3L29A 2ZAMA 4JI5M 1J7KA 3U6EA 1NHGC 3HU2A 4PD2A 3J7AS 4G4RA 1NSFA 4JV5M 3KSXA 4AZFA 3KW6A 1Z5AA 5EQTA 4LFBM 2FOIC 3JAMS 4NSOB 1E32A 3SC3A 3GLGA 2XEPA 3U6QA 3HHZA 2KRKA 3EIEA 3LQRA 3GLFB 3L26A 3T1YM 3KS4A 3D8BA 5FSWA 3Q8XA 4HLQA 3U6CA 3KOWE 3K2LA 3RE8A 1FJGM 3FTFA 4LF5M 1T3TA 2XH9A 1GVNA 5DYGA 3HKPA 3GQ4A 3HU3A 1TGUA 3SMPA 1I94M 1L2DA 1HNWM 1L1TA 2CFOA 4JI7M 4X65M 3T1HM 1WXQA 4QOZC 3I51A 3FTDA 2AHMA 3KXEC 4R3DA 4OX9M 1HT2E 1QAOA 1IN7A 2D7HA 3FUUA 2OPFA 5LMNM 2HCBA 3UGJA 3GP1A 2DWMA 3A98B 3RFWA 2JA2A 1GL6A 2KW0A 2YR0A 3U6DA 3VLFB 5H37D 3U6OA 4JI4M 1R2YA 3L27A 2DZNB 4B3SM 3T38A 2ZBKB 4AI6A 3L2AA 3CF0A 1XXHA 3SHGB 2XGNA 2CV2A 4TUWA 3SHFA 4NXMM 4JI8M 1IN8A 4ZPXA 2UU9M 2H1RA 2NQ8C 4B3RM 4GKJM 1Q3BA 2DWNA 5FTKA 2F4VM 1L2CA 4W5WA 4NSRA 1JR3D 1IY2A 2C98A 3U60B 3SAVA 3CTWB 3GPUA 1N77A 3HHXA 5KPRA 2CEAA 3FUWA 4DR2M 3KOZE 4MGYE 1XNRM 4JN6A 3D8LA 4IBKA 3SBJA 4CGYB 2HKJA 3GRYA 2Z7JA 1GKIA 4LJ7A 4QHTA 1DGGA 3DZDA 2QBYB 3KFUG 2D7EA 4XBOA 2XSZD 1PM5A 1TH3A 4DR5M 4FVMA 2M5ZA 3SAWA 1SXJB 3EIHA 2BJVA 2HL7A 2KXEA 4DV5M 4AKGA 5DNYA 5BPVA 2KEBA 1ZQ9A 2Y0TA 3LMMA 1L2BA 4M9ZA 1L1ZA 2XFTA 3VK7A 4D80A 3J81S 2Z4RA 3KOXE 2UUBM 1IXZA 1N33M 4FD2A 5C18A 2XFSA 1N78A 4MGHA 5FTJA 3DOAA 3WHKA 2QCUA 1R2ZA 3H4MA 5EJCA 1TDZA 3WHLA 3FYDA 3GRVA 4PDIA 1QVRA 1Z59A 1GLNA 3SMSA 2CE7A 4YY3M 3W0FA 2L09A 1Q3CA 2J7NA 4B3MM 2Y20A 2XZFA 2CHQA 3LQQA 3TPZA 1NJGA 5ITTA 2OQ4A 1IXRC 4B7FA 3UMMA 3U5ZB 1H6UA 4MM3B 5EP4A 3UK6A 1HT1E 5EP3A 4LFCM 3B9PA 4AKHA 4JI6M 4M9SA 3FTEA 4K0KM 5ITRA 3KDSE 3K8ZA 3MJ5A 1G3IA 1E9RA 4LJ9A 3VKHA 1SXJD 1QANA 4BLCA 1IBMM 3A42A 4I5SA 4FWHA 4IBJA 3GRRA 3GRUA 3U6MA 4FW9A 2BJWA 4OVZA 3HHYA 3ZC7B 2CV0A 1G41A 1NY6A 4S12A 4MGIE 3RGPA 3THGA 4AG6A 3DFZA 4HL4A 4G6ZA 2CHGA 3QWLA 3GLHB 4I8OA 4IJEA 1IBKM 4LJ4A 2ERCA 3DA1A 1S3SA 4DV0M 4LF4M 4RF0A 3GPYA 4GKKM 1NNUC 3E9SA 4L15A 4M0WA 1ORYB 1XWIA 3AKZA 2RKOA 4LJAA 2D7GA 2UXBM 4IBDA 5EXSA 4DV3M 4GHLA 1HR0M 4L16A 3GO8A 1DGHA 4CHTB 3GLIB 3TWMA 4JI3M 1YUBA 2G5GX 3FKEA 1XMQM 4DR7M 3ZCBB 4JI2M 3U6PA 3NWLA 2UUAM 2HHHM 2F5PA 5FLXS 5ITQA 1I4WA 1N75A 4GMQA 1IXSB 2FFJA 4Z8XA 3TE6A 4QHSA 5LMUM 4LF9M 2EA0A 3MK6A 4DV2M 4LJ5A 3KSJA 4QOSA 5ITYA 2KRUA 2R18A 1NNJA 1N34M 4DR1M 4LRSA 5FTLA 2KA6B 2UXCM 1NVMA 2Z3XA 1G4AE 8CATA 1IN6A 2DZOB 4EIWA 2F5SA 4LRTA 4FCTA 3IG8A 3ILKA 2LWXA 4LF8M 5C1BA 4LJ8A 3AFHA 4JXJA 3HJ8A 2DWZB 3GQ3A 1FNNA 4OU7A 2FE8A 3VDUA 4FWGA 1Q39A 1OJLA 5EXXA 2F5NA 2LXEA 2CHVA 5E6JA 1N32M 4DR6M 3UJNA 2C96A 4LZJA 4BBAA 4FCWA 3SARA 2V6ZM 1SXJE 3GLFA 1NHWC 1XC8A 4L78A 2L6OA 2F5QA 3L25A 1E94E 2EUCA 1QAMA 3GLGB 3J27B 3K92A 3OTOM 1HQYE 4I81A 4IJFA 2R4JA 2L7IA 1KSFX 2X49A 5KQDA 1IN4A 1X37A 3R9XB 2E5LM 1R7RA 5ITXE 3FTCA 3VKGA 4L4UA 1KYIA 1TH2A 2RGHA 2RGOA 2UXDM 2X4AA 4D81A 5BR8M 2DHRA 2XSZA 4NOOB 4GHAA 3HJSA 3E4RA 4JYAM 4ITQA 4AKIA 1IN5A 3HHWA 4X62M 2A5YB 2DXIA 3SASA 5DYIA 7CATA 3FUVA 2Q2EB 3KP1E 1DGFA 3M0EA 1MX0A 3PNYA 4AG5A 4DV4M 2KZSA 3FYCA 3VFDA 3NBIA 1G59A 4QNMA 3AJIB 2QENA 2R65A 4QNRA 2CV1A 4DR3M 2V1UA 3AV0A 1K82A 1W5TA 4KHPM 3HGIA 4LG2A 2F5OA 1DO0A 5FTNA 2VIIA 5KPZA 5KQ8A 1XXHB 1YSYA 1C1KA 3J2PB 4IBGA 3IG5A 1OFIA 1GL7A 1QZMA 4KODA 3U60A 2G8LA 4WURA 4DV1M 5KPTA 2XZUA 4G4NA 1XHBA 3SATA 3VDPA 1MU5A 2FNAA 3KVWA 1YE9A 3HU1A 2LNHC 4RF1A 2KZUA 3VK8A 3W0LB 3U61A 1NJFA 5IT9S 3A46A 2QBYA 3SYLA 4LGYA 4GC9A 4NXNM 3LVVA 5GKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EUC A; 
#chains in the Genus database with same CATH topology
 1SXJ A;  5A2Q S;  4M0D A;  2I7N A;  3GLI E;  4PCZ A;  1D2N A;  4L6V 6;  4L8R C;  2W82 A;  5IWA M;  1E9S A;  2ZAO A;  4LF6 M;  5KO3 A;  4MH0 E;  1HQC A;  5EP2 A;  4GRI A;  4LFA M;  4A3V B;  2QSF X;  5EXP A;  2DZL A;  2LH0 A;  1K3W A;  3KS8 A;  1IM2 A;  4D82 A;  3KOY E;  3Q8G A;  3C58 A;  1VDD A;  3I4Y A;  5E26 A;  2DEN A;  4FCV A;  4KO8 A;  5EP1 A;  2Y0Q A;  2JY7 A;  1QUT A;  3K1J A;  1QDR A;  5ITX A;  1IBL M;  4AW4 A;  1XB2 B;  3LVW A;  4LJ6 A;  2UUC M;  2R46 A;  4WW0 A;  1EE8 A;  3FUT A;  3NBX X;  4LGM A;  4MB7 A;  1QQW A;  3AOE A;  4LCB A;  3IHP A;  1J09 A;  4X66 M;  1IY1 A;  3QYB A;  2V1C A;  3RGS A;  2LBC A;  4IIW A;  2K0B X;  4NRW A;  3T15 A;  4DR4 M;  4BB9 A;  4XK8 F;  1PJJ A;  1GJS A;  2R4E A;  1XNQ M;  3BOS A;  1K3X A;  2CUZ A;  1GAB A;  1VDL A;  2HAK A;  3U5Z A;  3KP0 E;  4GH9 A;  5JI3 E;  3SAU A;  4MGK E;  2X8A A;  3M6A A;  1TF0 B;  5JI2 E;  1L8Q A;  2JY5 A;  4Z6Y A;  2R62 A;  1QAQ A;  1PJT A;  4IBI A;  2J7O A;  2XF3 A;  3J7B A;  1DO2 A;  4IBF A;  3C9P A;  1D0M A;  1OFH A;  4LF7 M;  2KNA A;  3JR4 A;  4IBB A;  2EO2 A;  1MN3 A;  2I7P A;  3CF6 E;  3UZU A;  2C99 A;  4RNA A;  3TWL A;  4GC5 A;  1KFV A;  4II7 A;  3TQS A;  4IBE A;  4OW0 A;  5IZ7 D;  4DV7 M;  1DGB A;  1ZAE A;  4B08 A;  4G4Q A;  2CRU A;  3V76 A;  2GQF A;  3GLH A;  4OVZ B;  1DV0 A;  3CF2 A;  1Z5B A;  1VEK A;  4JI0 M;  4B3T M;  3QAU A;  4PT5 A;  3GLG E;  2LHC A;  1WIV A;  4IBC A;  4YHH M;  2XLJ A;  3AOG A;  3FD9 A;  3U6L A;  1XMO M;  2C9C A;  1Z5C A;  3HWS A;  1PRB A;  1JR3 A;  2QZ4 A;  3PNV A;  4KLN A;  5IRE B;  2JY6 B;  5FTM A;  5ITU A;  3ZH9 B;  3JR5 A;  3L28 A;  2K47 A;  1TDH A;  1G71 A;  2FH0 A;  4R7G A;  4B7H A;  3U61 B;  2WSC F;  4PDG A;  2MGW A;  1HNX M;  3TWK A;  2C5R A;  3SFZ A;  1SXJ C;  4FWD A;  4CIZ A;  3GLI A;  1W5S A;  2M60 A;  2QP9 X;  1UM8 A;  1J5E M;  3SYK A;  2MH8 A;  3GPX A;  3J80 S;  3TL4 X;  4GIP A;  4NL4 H;  4XGI A;  3PFI A;  4DUY M;  1MJG M;  2LVQ D;  4LZZ A;  2LVA A;  3PXG A;  2VQE M;  1NY5 A;  4X64 M;  2DWL A;  1DGH B;  4GIT A;  2Y21 A;  5EXT A;  3AL0 C;  3HJQ A;  2L4F A;  2FS1 A;  4DV6 M;  2O5R A;  1IXS A;  1LV7 A;  3PVS A;  2VQF M;  4REZ A;  2YFQ A;  2YQZ A;  3A45 A;  2QQ8 A;  2C9O A;  2HWJ A;  2JUJ A;  4G4O A;  1JQJ C;  2P5T A;  1HNZ M;  2Z4S A;  2R6F A;  3AOE C;  3HY5 A;  3T6P A;  2R45 A;  1ZMV A;  3FUX A;  4LY6 A;  1CUK A;  1ZMU A;  4CIS A;  2DVW B;  1TH4 A;  4I4L A;  1XXH E;  1IY0 A;  2Z8Y M;  3I4V A;  3GQ5 A;  2G3Q A;  4MGZ E;  2QPA A;  4DUZ M;  1G8P A;  1N36 M;  1D0K A;  2ZAN A;  4JI1 M;  2BNK A;  1R6B X;  5F3W A;  1PJI A;  3LW5 F;  1NV8 A;  1IQP A;  3MHV C;  4WP2 A;  3GPP A;  1GO5 A;  3R8F A;  4M9X A;  4NRV A;  4B7G A;  1QYR A;  2L7H A;  2YNM D;  1Z6T A;  1QUS A;  4AQY M;  4P16 A;  3C3E A;  3HX3 A;  1Q02 A;  3F92 A;  3M7G A;  3U6S A;  2ZM6 M;  3L29 A;  1VQ1 A;  2ZAM A;  4JI5 M;  1J7K A;  1OAI A;  3U6E A;  1AUA A;  1NHG C;  3HU2 A;  4PD2 A;  3J7A S;  4G4R A;  1NSF A;  4JV5 M;  2GNO A;  3KSX A;  1C7Y A;  4AZF A;  3KW6 A;  1Z5A A;  3FRI A;  2DAG A;  5EQT A;  4LFB M;  2FOI C;  2EKF A;  2JY8 A;  3JAM S;  4NSO B;  2DWM A;  1E32 A;  3SC3 A;  3GLG A;  2XEP A;  3U6Q A;  3HHZ A;  2KRK A;  3EIE A;  3LQR A;  1Y8G A;  3L26 A;  3GLF B;  2JZ1 A;  3T1Y M;  3KS4 A;  3D8B A;  5FSW A;  3Q8X A;  4HLQ A;  3U6C A;  3KOW E;  3K2L A;  3RE8 A;  1FJG M;  3FTF A;  4LF5 M;  1NV9 A;  1T3T A;  2XH9 A;  1GVN A;  5DYG A;  4KT0 F;  2APL A;  3HKP A;  3GQ4 A;  3HU3 A;  1OIP A;  3LCU A;  1T43 A;  1TGU A;  3SMP A;  1I94 M;  1L2D A;  1HNW M;  1L1T A;  2CFO A;  4JI7 M;  3HZJ A;  4X65 M;  1V33 A;  1WXQ A;  3T1H M;  4QOZ C;  3I51 A;  1RU3 A;  3FTD A;  2AHM A;  3KXE C;  4R3D A;  2QHO B;  4UN2 B;  4OX9 M;  1HT2 E;  2QNJ A;  2D7H A;  1IN7 A;  1QAO A;  2BWB A;  3FUU A;  2OPF A;  5LMN M;  2HCB A;  2WZJ A;  3BBZ A;  2DAE A;  5DFL A;  3UGJ A;  3GP1 A;  2OOB A;  3A98 B;  3RFW A;  2JA2 A;  4R71 A;  1GL6 A;  2KW0 A;  2YR0 A;  3U6D A;  3VLF B;  5H37 D;  3U6O A;  4JI4 M;  1R2Y A;  3L27 A;  2O25 A;  1BVS A;  2DZN B;  4B3S M;  1OKS A;  3T38 A;  2ZBK B;  4AI6 A;  3L2A A;  3CF0 A;  1XXH A;  1A5T A;  1VG5 A;  2XGN A;  3SHG B;  2CV2 A;  4TUW A;  3SHF A;  4NXM M;  2K9D A;  4JI8 M;  1IN8 A;  4ZPX A;  1EFU B;  1F4I A;  2O01 F;  2UU9 M;  2H1R A;  2NQ8 C;  4B3R M;  4GKJ M;  1Q3B A;  2N35 A;  1JB0 F;  2DWN A;  5FTK A;  2F4V M;  1L2C A;  4W5W A;  2KHH A;  4NSR A;  1JR3 D;  2K6B A;  2JP7 A;  1IY2 A;  2C98 A;  3U60 B;  3SAV A;  3CTW B;  3GPU A;  1N77 A;  2DI0 A;  3HHX A;  5KPR A;  2CEA A;  3FUW A;  4DR2 M;  3KOZ E;  4MGY E;  1XNR M;  4JN6 A;  1NO1 A;  3D8L A;  4IBK A;  3SBJ A;  2H5X A;  4CGY B;  2HKJ A;  3GRY A;  2Z7J A;  1GKI A;  1TR8 A;  4LJ7 A;  4QHT A;  1DGG A;  2LVN C;  3DZD A;  2QBY B;  2D7E A;  1PJQ A;  4XBO A;  3KFU G;  2XSZ D;  1PM5 A;  1TH3 A;  4DR5 M;  4FVM A;  4P17 A;  2M5Z A;  3SAW A;  2LVO C;  1SXJ B;  3EIH A;  1V92 A;  2BJV A;  2HL7 A;  2KXE A;  4DV5 M;  4AKG A;  5DNY A;  3E21 A;  5BPV A;  2KEB A;  1ZQ9 A;  2Y0T A;  3LMM A;  1L2B A;  4M9Z A;  1L1Z A;  2XFT A;  3VK7 A;  2JWS A;  4D80 A;  2R0I A;  2Z4R A;  3J81 S;  3KOX E;  2UUB M;  2MRO B;  1IXZ A;  3IEC A;  1N33 M;  2B3T A;  4FD2 A;  5C18 A;  2XFS A;  1N78 A;  4MGH A;  5FTJ A;  1P3Q Q;  3FE3 A;  3DOA A;  3WHK A;  2QCU A;  1R2Z A;  3H4M A;  5EJC A;  1TDZ A;  3WHL A;  3FYD A;  3GRV A;  4PDI A;  1QVR A;  1Z59 A;  3B74 A;  3W67 A;  1GLN A;  2ZTD A;  3B7N A;  3SMS A;  2CE7 A;  4YY3 M;  3W0F A;  2L09 A;  1Q3C A;  1QDT A;  2J7N A;  4B3M M;  2Y20 A;  2XZF A;  2CHQ A;  3LQQ A;  3TPZ A;  1NJG A;  5ITT A;  2OQ4 A;  1IXR C;  4B7F A;  4F1I A;  3UMM A;  3U5Z B;  1H6U A;  1OQY A;  4MM3 B;  5EP4 A;  1HT1 E;  5EP3 A;  3UK6 A;  4LFC M;  3B9P A;  4AKH A;  2CP8 A;  4M9S A;  4JI6 M;  3FTE A;  4K0K M;  5ITR A;  3KDS E;  3K8Z A;  3MJ5 A;  1G3I A;  4CJ6 A;  1E9R A;  4LJ9 A;  3VKH A;  1SXJ D;  1QAN A;  4RKU F;  4BLC A;  2JZ0 A;  3A42 A;  4I5S A;  3BXW A;  4FWH A;  4IBJ A;  1IBM M;  3GRR A;  3GRU A;  3B7Q A;  4FW9 A;  2BJW A;  4OVZ A;  3HHY A;  3ZC7 B;  3U6M A;  1G41 A;  2CV0 A;  1WJ7 A;  2LTU A;  1NY6 A;  4S12 A;  4MGI E;  3RGP A;  3THG A;  4AG6 A;  3GLF E;  3DFZ A;  4HL4 A;  4G6Z A;  3CGW A;  2CHG A;  3QWL A;  3GLH B;  4I8O A;  4IJE A;  1OIZ A;  2KDL A;  1IBK M;  1D0L A;  1WGN A;  2ERC A;  1R4G A;  4LJ4 A;  3DA1 A;  1S3S A;  4DV0 M;  4LF4 M;  2WSE F;  4RF0 A;  3GPY A;  1UFZ A;  4GKK M;  1NNU C;  3E9S A;  4L15 A;  3ZQJ A;  4M0W A;  1ORY B;  1XWI A;  3AKZ A;  2RKO A;  4LJA A;  2D7G A;  2UXB M;  4IBD A;  5EXS A;  4DV3 M;  4GHL A;  1HR0 M;  2VDB B;  4L16 A;  2L2D A;  1DGH A;  4CHT B;  3GO8 A;  3GLI B;  4JI3 M;  1YUB A;  2G5G X;  3FKE A;  3LCV B;  3TWM A;  1XMQ M;  4DR7 M;  3ZCB B;  4JI2 M;  4GEW A;  3W68 A;  3U6P A;  3NWL A;  1GJT A;  2UUA M;  3B7Z A;  2VF7 A;  3H4J A;  2HHH M;  1HJP A;  2F5P A;  5FLX S;  5ITQ A;  1I4W A;  1N75 A;  4GMQ A;  1IXS B;  2FFJ A;  4Z8X A;  3TE6 A;  4QHS A;  5LMU M;  4LF9 M;  2JNH A;  2EA0 A;  3MK6 A;  4DV2 M;  4LJ5 A;  3KSJ A;  1ZV1 A;  4QOS A;  5ITY A;  2KNZ A;  2KRU A;  2R18 A;  1NNJ A;  1N34 M;  1OTR A;  2DAI A;  4DR1 M;  4LRS A;  5FTL A;  1IFY A;  2KA6 B;  2UXC M;  1NVM A;  2Z3X A;  1G4A E;  8CAT A;  1IN6 A;  2DZO B;  1YLA A;  1TTE A;  4EIW A;  2J5Y A;  2F5S A;  4LRT A;  4FCT A;  3IG8 A;  4NC6 A;  3ILK A;  4DBG B;  2LWX A;  4LF8 M;  5C1B A;  4Y28 F;  4LJ8 A;  1SG9 A;  1VEJ A;  3AFH A;  2DNA A;  2MR9 A;  4JXJ A;  3HJ8 A;  2DWZ B;  3GQ3 A;  2R44 A;  1FNN A;  4OU7 A;  2FE8 A;  3VDU A;  4FWG A;  1Q39 A;  1OJL A;  3I01 M;  1PGY A;  5EXX A;  2F5N A;  2LXE A;  2CHV A;  5E6J A;  1N32 M;  2VF8 A;  4DR6 M;  3UJN A;  2C96 A;  2DKL A;  4LZJ A;  2CWB A;  1WGL A;  4BBA A;  3K9P A;  2LVP C;  4FCW A;  3SAR A;  2V6Z M;  1SXJ E;  3GLF A;  1NHW C;  2DAK A;  1XC8 A;  4L78 A;  2L6O A;  2F5Q A;  1T6O A;  3L25 A;  1E94 E;  2EUC A;  1QAM A;  3K9O A;  3GLG B;  3J27 B;  2EJS A;  3K92 A;  3OTO M;  1HQY E;  4I81 A;  4IJF A;  2L4E A;  2R4J A;  3C3D A;  2L7I A;  1KSF X;  2X49 A;  3I04 M;  4ANR A;  1QZE A;  5KQD A;  1IN4 A;  1X37 A;  4HEO A;  3R9X B;  2E5L M;  1R7R A;  5ITX E;  3B89 A;  3FTC A;  3VKG A;  4L4U A;  1KYI A;  1TH2 A;  3QYE A;  2RGH A;  4G3O A;  2RGO A;  2UXD M;  2X4A A;  4D81 A;  2DAM A;  2DHR A;  2XSZ A;  4NOO B;  5BR8 M;  4GHA A;  3HJS A;  1PJS A;  3E4R A;  4JYA M;  4ITQ A;  2OO9 A;  4Q7J A;  4AKI A;  1IN5 A;  3HHW A;  4X62 M;  2A5Y B;  3MMP A;  2DXI A;  2EKK A;  5DYI A;  7CAT A;  3SAS A;  3FUV A;  2Q2E B;  1EIJ A;  3KP1 E;  2LHG A;  1DGF A;  1R5L A;  3M0E A;  1MX0 A;  3PNY A;  4AG5 A;  4DV4 M;  2KZS A;  5L8R F;  2RRU A;  3FYC A;  3VFD A;  3NBI A;  1G59 A;  4QNM A;  2WSF F;  3AJI B;  2QEN A;  2R65 A;  4QNR A;  2CV1 A;  4DR3 M;  2V1U A;  3AV0 A;  1K82 A;  1W5T A;  4KHP M;  3HGI A;  4LG2 A;  2BWE A;  1WR1 B;  2F5O A;  1DO0 A;  5FTN A;  2VII A;  2ZTC A;  5KPZ A;  5KQ8 A;  1AIP C;  1XXH B;  1YSY A;  2MJ5 B;  3E46 A;  3FRH A;  1C1K A;  3J2P B;  1VEG A;  4IBG A;  3IG5 A;  1OFI A;  1GL7 A;  1QZM A;  1V34 A;  2DHY A;  4KOD A;  3U60 A;  2G8L A;  3GLH E;  4WUR A;  4DV1 M;  1WHC A;  5KPT A;  4G4N A;  2XZU A;  1XHB A;  3SAT A;  3VDP A;  1MU5 A;  2FNA A;  3KVW A;  1LTM A;  1YE9 A;  3HU1 A;  2LNH C;  4RF1 A;  2KZU A;  1JR3 E;  4F2L A;  3W0L B;  3U61 A;  3VK8 A;  1NJF A;  5IT9 S;  3A46 A;  2QBY A;  3SYL A;  2JXN A;  2KNV A;  4LGY A;  1ZMW A;  4GC9 A;  2OOA A;  1OAO C;  4NXN M;  3LVV A;  5GKN A; 
#chains in the Genus database with same CATH homology
 1SXJ A;  5A2Q S;  4M0D A;  2I7N A;  4PCZ A;  1D2N A;  4L8R C;  2W82 A;  5IWA M;  1E9S A;  2ZAO A;  4LF6 M;  5KO3 A;  4MH0 E;  1HQC A;  5EP2 A;  4GRI A;  4LFA M;  4A3V B;  5EXP A;  2LH0 A;  1K3W A;  3KS8 A;  1IM2 A;  4D82 A;  3KOY E;  3C58 A;  1VDD A;  3I4Y A;  5E26 A;  4FCV A;  4KO8 A;  5EP1 A;  2Y0Q A;  3K1J A;  1IBL M;  5ITX A;  4AW4 A;  3LVW A;  4LJ6 A;  2UUC M;  2R46 A;  4WW0 A;  1EE8 A;  3FUT A;  4LGM A;  4MB7 A;  1QQW A;  3AOE A;  4LCB A;  1J09 A;  4X66 M;  1IY1 A;  2V1C A;  3RGS A;  4IIW A;  4NRW A;  3T15 A;  4DR4 M;  4BB9 A;  1PJJ A;  2R4E A;  1XNQ M;  3BOS A;  1K3X A;  2CUZ A;  3U5Z A;  3KP0 E;  4GH9 A;  5JI3 E;  3SAU A;  4MGK E;  2X8A A;  3M6A A;  5JI2 E;  1L8Q A;  4Z6Y A;  2R62 A;  1QAQ A;  4IBI A;  2J7O A;  2XF3 A;  3J7B A;  1DO2 A;  4IBF A;  1OFH A;  4LF7 M;  3JR4 A;  4IBB A;  2EO2 A;  3UZU A;  2I7P A;  3CF6 E;  2C99 A;  4RNA A;  3TWL A;  4GC5 A;  1KFV A;  4II7 A;  3TQS A;  4IBE A;  4OW0 A;  5IZ7 D;  4DV7 M;  1DGB A;  1ZAE A;  4B08 A;  4G4Q A;  3GLH A;  4OVZ B;  3CF2 A;  1Z5B A;  4JI0 M;  4B3T M;  3QAU A;  4PT5 A;  4IBC A;  4YHH M;  2XLJ A;  3AOG A;  3FD9 A;  3U6L A;  1XMO M;  2C9C A;  1Z5C A;  3HWS A;  1JR3 A;  2QZ4 A;  3PNV A;  4KLN A;  5IRE B;  5FTM A;  3JR5 A;  5ITU A;  3ZH9 B;  3L28 A;  2K47 A;  1TDH A;  4R7G A;  4B7H A;  3U61 B;  4PDG A;  1HNX M;  3TWK A;  2C5R A;  3SFZ A;  1SXJ C;  4FWD A;  3GLI A;  1W5S A;  2M60 A;  2QP9 X;  1UM8 A;  1J5E M;  3SYK A;  3GPX A;  3J80 S;  3TL4 X;  4GIP A;  4NL4 H;  4XGI A;  3PFI A;  4DUY M;  4LZZ A;  2VQE M;  3PXG A;  1NY5 A;  4X64 M;  2DWL A;  1DGH B;  4GIT A;  2Y21 A;  5EXT A;  3AL0 C;  3HJQ A;  4DV6 M;  2O5R A;  1LV7 A;  3PVS A;  2VQF M;  4REZ A;  2YFQ A;  2YQZ A;  3A45 A;  2C9O A;  4G4O A;  1JQJ C;  2P5T A;  1HNZ M;  2Z4S A;  3AOE C;  2R45 A;  3FUX A;  4LY6 A;  4CIS A;  2DVW B;  1TH4 A;  4I4L A;  1IY0 A;  3I4V A;  3GQ5 A;  4MGZ E;  4DUZ M;  2QPA A;  1N36 M;  1G8P A;  4JI1 M;  2ZAN A;  2BNK A;  1R6B X;  5F3W A;  1PJI A;  3MHV C;  1IQP A;  3GPP A;  3R8F A;  4M9X A;  4NRV A;  4B7G A;  1QYR A;  2L7H A;  2YNM D;  1Z6T A;  4AQY M;  4P16 A;  3M7G A;  3U6S A;  2ZM6 M;  3L29 A;  2ZAM A;  4JI5 M;  1J7K A;  3U6E A;  1NHG C;  3HU2 A;  4PD2 A;  3J7A S;  4G4R A;  1NSF A;  4JV5 M;  3KSX A;  4AZF A;  3KW6 A;  1Z5A A;  5EQT A;  4LFB M;  2FOI C;  3JAM S;  4NSO B;  1E32 A;  3SC3 A;  3GLG A;  2XEP A;  3U6Q A;  3HHZ A;  2KRK A;  3EIE A;  3LQR A;  3GLF B;  3L26 A;  3T1Y M;  3KS4 A;  3D8B A;  5FSW A;  3Q8X A;  4HLQ A;  3U6C A;  3KOW E;  3K2L A;  3RE8 A;  1FJG M;  3FTF A;  4LF5 M;  1T3T A;  2XH9 A;  1GVN A;  5DYG A;  3HKP A;  3GQ4 A;  3HU3 A;  1TGU A;  3SMP A;  1I94 M;  1L2D A;  1HNW M;  1L1T A;  2CFO A;  4JI7 M;  4X65 M;  3T1H M;  1WXQ A;  4QOZ C;  3I51 A;  3FTD A;  2AHM A;  3KXE C;  4R3D A;  4OX9 M;  1HT2 E;  1QAO A;  1IN7 A;  2D7H A;  3FUU A;  2OPF A;  5LMN M;  2HCB A;  3UGJ A;  3GP1 A;  2DWM A;  3A98 B;  3RFW A;  2JA2 A;  1GL6 A;  2KW0 A;  2YR0 A;  3U6D A;  3VLF B;  5H37 D;  3U6O A;  4JI4 M;  1R2Y A;  3L27 A;  2DZN B;  4B3S M;  3T38 A;  2ZBK B;  4AI6 A;  3L2A A;  3CF0 A;  1XXH A;  3SHG B;  2XGN A;  2CV2 A;  4TUW A;  3SHF A;  4NXM M;  4JI8 M;  1IN8 A;  4ZPX A;  2UU9 M;  2H1R A;  2NQ8 C;  4B3R M;  4GKJ M;  1Q3B A;  2DWN A;  5FTK A;  2F4V M;  1L2C A;  4W5W A;  4NSR A;  1JR3 D;  1IY2 A;  2C98 A;  3U60 B;  3SAV A;  3CTW B;  3GPU A;  1N77 A;  3HHX A;  5KPR A;  2CEA A;  3FUW A;  4DR2 M;  3KOZ E;  4MGY E;  1XNR M;  4JN6 A;  3D8L A;  4IBK A;  3SBJ A;  4CGY B;  2HKJ A;  3GRY A;  2Z7J A;  1GKI A;  4LJ7 A;  4QHT A;  1DGG A;  3DZD A;  2QBY B;  3KFU G;  2D7E A;  4XBO A;  2XSZ D;  1PM5 A;  1TH3 A;  4DR5 M;  4FVM A;  2M5Z A;  3SAW A;  1SXJ B;  3EIH A;  2BJV A;  2HL7 A;  2KXE A;  4DV5 M;  4AKG A;  5DNY A;  5BPV A;  2KEB A;  1ZQ9 A;  2Y0T A;  3LMM A;  1L2B A;  4M9Z A;  1L1Z A;  2XFT A;  3VK7 A;  4D80 A;  3J81 S;  2Z4R A;  3KOX E;  2UUB M;  1IXZ A;  1N33 M;  4FD2 A;  5C18 A;  2XFS A;  1N78 A;  4MGH A;  5FTJ A;  3DOA A;  3WHK A;  2QCU A;  1R2Z A;  3H4M A;  5EJC A;  1TDZ A;  3WHL A;  3FYD A;  3GRV A;  4PDI A;  1QVR A;  1Z59 A;  1GLN A;  3SMS A;  2CE7 A;  4YY3 M;  3W0F A;  2L09 A;  1Q3C A;  2J7N A;  4B3M M;  2Y20 A;  2XZF A;  2CHQ A;  3LQQ A;  3TPZ A;  1NJG A;  5ITT A;  2OQ4 A;  1IXR C;  4B7F A;  3UMM A;  3U5Z B;  1H6U A;  4MM3 B;  5EP4 A;  3UK6 A;  1HT1 E;  5EP3 A;  4LFC M;  3B9P A;  4AKH A;  4JI6 M;  4M9S A;  3FTE A;  4K0K M;  5ITR A;  3KDS E;  3K8Z A;  3MJ5 A;  1G3I A;  1E9R A;  4LJ9 A;  3VKH A;  1SXJ D;  1QAN A;  4BLC A;  1IBM M;  3A42 A;  4I5S A;  4FWH A;  4IBJ A;  3GRR A;  3GRU A;  3U6M A;  4FW9 A;  2BJW A;  4OVZ A;  3HHY A;  3ZC7 B;  2CV0 A;  1G41 A;  1NY6 A;  4S12 A;  4MGI E;  3RGP A;  3THG A;  4AG6 A;  3DFZ A;  4HL4 A;  4G6Z A;  2CHG A;  3QWL A;  3GLH B;  4I8O A;  4IJE A;  1IBK M;  4LJ4 A;  2ERC A;  3DA1 A;  1S3S A;  4DV0 M;  4LF4 M;  4RF0 A;  3GPY A;  4GKK M;  1NNU C;  3E9S A;  4L15 A;  4M0W A;  1ORY B;  1XWI A;  3AKZ A;  2RKO A;  4LJA A;  2D7G A;  2UXB M;  4IBD A;  5EXS A;  4DV3 M;  4GHL A;  1HR0 M;  4L16 A;  3GO8 A;  1DGH A;  4CHT B;  3GLI B;  3TWM A;  4JI3 M;  1YUB A;  2G5G X;  3FKE A;  1XMQ M;  4DR7 M;  3ZCB B;  4JI2 M;  3U6P A;  3NWL A;  2UUA M;  2HHH M;  2F5P A;  5FLX S;  5ITQ A;  1I4W A;  1N75 A;  4GMQ A;  1IXS B;  2FFJ A;  4Z8X A;  3TE6 A;  4QHS A;  5LMU M;  4LF9 M;  2EA0 A;  3MK6 A;  4DV2 M;  4LJ5 A;  3KSJ A;  4QOS A;  5ITY A;  2KRU A;  2R18 A;  1NNJ A;  1N34 M;  4DR1 M;  4LRS A;  5FTL A;  2KA6 B;  2UXC M;  1NVM A;  2Z3X A;  1G4A E;  8CAT A;  1IN6 A;  2DZO B;  4EIW A;  2F5S A;  4LRT A;  4FCT A;  3IG8 A;  3ILK A;  2LWX A;  4LF8 M;  5C1B A;  4LJ8 A;  3AFH A;  4JXJ A;  3HJ8 A;  2DWZ B;  3GQ3 A;  1FNN A;  4OU7 A;  2FE8 A;  3VDU A;  4FWG A;  1Q39 A;  1OJL A;  5EXX A;  2F5N A;  2LXE A;  2CHV A;  5E6J A;  1N32 M;  4DR6 M;  3UJN A;  2C96 A;  4LZJ A;  4BBA A;  4FCW A;  3SAR A;  2V6Z M;  1SXJ E;  3GLF A;  1NHW C;  1XC8 A;  4L78 A;  2L6O A;  2F5Q A;  3L25 A;  1E94 E;  2EUC A;  1QAM A;  3GLG B;  3J27 B;  3K92 A;  3OTO M;  1HQY E;  4I81 A;  4IJF A;  2R4J A;  2L7I A;  1KSF X;  2X49 A;  5KQD A;  1IN4 A;  1X37 A;  3R9X B;  2E5L M;  1R7R A;  5ITX E;  3FTC A;  3VKG A;  4L4U A;  1KYI A;  1TH2 A;  2RGH A;  2RGO A;  2UXD M;  2X4A A;  4D81 A;  5BR8 M;  2DHR A;  2XSZ A;  4NOO B;  4GHA A;  3HJS A;  3E4R A;  4JYA M;  4ITQ A;  4AKI A;  1IN5 A;  3HHW A;  4X62 M;  2A5Y B;  2DXI A;  3SAS A;  5DYI A;  7CAT A;  3FUV A;  2Q2E B;  3KP1 E;  1DGF A;  3M0E A;  1MX0 A;  3PNY A;  4AG5 A;  4DV4 M;  2KZS A;  3FYC A;  3VFD A;  3NBI A;  1G59 A;  4QNM A;  3AJI B;  2QEN A;  2R65 A;  4QNR A;  2CV1 A;  4DR3 M;  2V1U A;  3AV0 A;  1K82 A;  1W5T A;  4KHP M;  3HGI A;  4LG2 A;  2F5O A;  1DO0 A;  5FTN A;  2VII A;  5KPZ A;  5KQ8 A;  1XXH B;  1YSY A;  1C1K A;  3J2P B;  4IBG A;  3IG5 A;  1OFI A;  1GL7 A;  1QZM A;  4KOD A;  3U60 A;  2G8L A;  4WUR A;  4DV1 M;  5KPT A;  2XZU A;  4G4N A;  1XHB A;  3SAT A;  3VDP A;  1MU5 A;  2FNA A;  3KVW A;  1YE9 A;  3HU1 A;  2LNH C;  4RF1 A;  2KZU A;  3VK8 A;  3W0L B;  3U61 A;  1NJF A;  5IT9 S;  3A46 A;  2QBY A;  3SYL A;  4LGY A;  4GC9 A;  4NXN M;  3LVV A;  5GKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...