2EUCA

Crystal structure of yfmb from bacillus subtilis. nesg target sr324
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
113
structure length
108
Chain Sequence
b'MQYFSPEQQYNAWIVSDLVKQIFHKRAGCSPGIHELAVFAEEHFHIDIDFVFSIIMNIGDIEFALTDEIEKKLSGYLSTLLPYVTADMFETSKANAHAFLSAAYHLFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yfmB
publication title Crystal structure of YfmB from bacillus subtilis NESG TARGET SR324.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 36
structure length 108
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11486 DUF3212 Protein of unknown function (DUF3212)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.570 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2eucA00
2EUCA
chains in the Genus database with same CATH superfamily
2A5YB 1MN3A 3HWSA 2DNAA 2KXEA 3SBJA 3LCUA 5KQ8A 1DGHA 1GO5A 4DV6M 4WP2A 2AHMA 2KRUA 1DGGA 2G5GX 3CF6E 3TQSA 3M7GA 4KLNA 3KXEC 2LWXA 4XBOA 2UUCM 3AL0C 3CF0A 1XMQM 1VEJA 1G8PA 1NV8A 3GP1A 3AJIB 4KT0F 1YE9A 2JY5A 2LVAA 4FCVA 4LZZA 1QQWA 3FUVA 4JI0M 4R71A 4OVZB 1IQPA 3V76A 3GPYA 5KQDA 3JR4A 2HKJA 2APLA 3C3DA 2C98A 1N36M 2RGOA 1WHCA 3GLIB 4IBDA 1OIZA 1MJGM 2DHYA 1NJFA 2DENA 4QOZC 2CRUA 3J27B 4X66M 2UUAM 1QANA 2EA0A 1W5SA 2N35A 2J7OA 1JQJC 3EIHA 4HL4A 3A46A 1WJ7A 4G4NA 4G4RA 2XZFA 2MJ5B 3L29A 4R3DA 2XLJA 3I04M 3MHVC 4LJAA 3FTFA 5EP1A 4L4UA 5DYIA 1RU3A 1T3TA 3L28A 2UXDM 3W68A 1V92A 1BVSA 5EXXA 1SXJB 2EKKA 1R7RA 3D8BA 1Q02A 4QNRA 3K9PA 1WXQA 2K9DA 2R0IA 3M6AA 3U6PA 4FWGA 4IJFA 2O5RA 1G41A 3GLGB 4HLQA 4M9SA 3TWKA 4DV1M 4LRSA 4LJ6A 4NL4H 4S12A 1IN8A 3LVWA 2QQ8A 4CJ6A 4KO8A 1OKSA 2LBCA 4DR7M 1D0KA 3SHGB 1EE8A 1GL7A 1V34A 3GLFB 3E46A 4I5SA 4QOSA 5LMNM 1TH3A 2W82A 2Y0QA 5FLXS 1XNQM 2H1RA 4LJ8A 3R9XB 4LFBM 3KW6A 3SAVA 1IY2A 1Z5BA 4FW9A 4W5WA 2CE7A 3J81S 1D0MA 1N77A 1PJSA 4L6V6 4B3RM 2KEBA 2CV1A 2WSFF 2L7IA 2DKLA 4JI8M 3FTCA 2V6ZM 4FWHA 4YY3M 3U5ZB 1ZMWA 2DZLA 4II7A 2LH0A 1JR3D 2UXCM 2VQFM 3TE6A 2QSFX 4IBKA 3LW5F 1OQYA 4LGMA 3TL4X 2QHOB 3CF2A 5ITXE 3KFUG 5EP3A 4CHTB 5LMUM 3B7ZA 2Z8YM 3LCVB 2QZ4A 3I4YA 4JYAM 1QDTA 3W0FA 4QHTA 4JI6M 3Q8XA 4JN6A 3BBZA 4MGZE 3IHPA 1XNRM 1NVMA 2R6FA 1N33M 1QAOA 1XXHA 3IECA 4NSRA 1AIPC 2F5OA 1HNZM 2OO9A 3FUTA 2D7EA 2XSZA 4JI7M 4LFCM 3SHFA 4GHLA 3U6CA 4QNMA 2KZUA 2B3TA 3PFIA 2LTUA 3T1YM 1LV7A 2HAKA 3PNYA 3U6MA 2DI0A 3CTWB 4OW0A 3VKGA 4G4QA 4NC6A 3AOEA 1IY1A 1QZMA 3BOSA 3GO8A 3FE3A 3I51A 2CWBA 2DXIA 2DWZB 4GIPA 2CV2A 1VEGA 3KSJA 3T38A 2C5RA 4GEWA 3CGWA 4G3OA 4G4OA 4OVZA 3HU2A 3VK7A 2KDLA 3FRIA 1N78A 3LVVA 4L16A 1XHBA 3GQ4A 1QVRA 2JWSA 3D8LA 3GLIA 1TTEA 1ZMVA 3RGPA 1N34M 2LVPC 1L1ZA 2DWNA 3U6DA 3MJ5A 4LF8M 3HHYA 2J5YA 3KOWE 5GKNA 3K2LA 3KVWA 3HHWA 4LF4M 1LTMA 3J7AS 1DGBA 4X62M 1NHWC 1L1TA 4PCZA 3ZQJA 3GPPA 1NSFA 4FCWA 3I4VA 2V1UA 2FOIC 3KOYE 2E5LM 2CHGA 5FSWA 4LJ5A 5FTJA 4IBJA 3QYBA 1IN4A 3ZCBB 1QYRA 2VF7A 3U60B 1K3XA 1V33A 2RRUA 3A45A 1TDHA 1OTRA 1ORYB 2C9OA 5C1BA 3LQRA 4AG5A 1SXJC 3GLGA 1QUSA 1N75A 1ZQ9A 1Z5AA 4AKGA 4RF0A 3C9PA 3QWLA 4IBGA 3K92A 3DFZA 1I94M 3SAUA 3GLIE 2KNZA 2KHHA 3GRVA 3GLFA 1PRBA 3E21A 4B7GA 4K0KM 1FJGM 1G71A 1Y8GA 1J5EM 1OJLA 2WSEF 1S3SA 2YFQA 4M9XA 2LNHC 2LVOC 4Q7JA 2K47A 5IREB 2QBYA 3RGSA 2Q2EB 4LGYA 1R2ZA 2VIIA 1WIVA 4LZJA 3B89A 4G6ZA 3U5ZA 4AKIA 4LF7M 1OIPA 3FUUA 4OX9M 2ZBKB 2OQ4A 2EJSA 2XF3A 5ITXA 4D80A 2CUZA 2GNOA 2LHGA 5FTKA 2O25A 2CFOA 1DO2A 1SXJE 3RFWA 4DR6M 2XEPA 1TH2A 3GLHB 4GH9A 3T6PA 5C18A 2R4JA 4IBEA 3B9PA 2L4FA 4UN2B 2L2DA 4BB9A 3HHXA 4YHHM 4DV7M 3GLGE 3L25A 1GLNA 3M0EA 1OAIA 1XMOM 3SYKA 4XK8F 1PJQA 1IN5A 3QYEA 4IBFA 3E9SA 1NJGA 1L2CA 5DNYA 5E6JA 1NHGC 3GLFE 2XFTA 2K6BA 4NRWA 1NY5A 3FYCA 2JA2A 3UMMA 4CISA 4NXMM 1ZV1A 4TUWA 2DAEA 2DAIA 3PVSA 4MGIE 2JUJA 3R8FA 1IN6A 2BWBA 2G3QA 2GQFA 3MMPA 4RNAA 4JI5M 2MGWA 2FH0A 4PDIA 1MX0A 2XSZD 4REZA 3SATA 4GC9A 1NNUC 2FS1A 2FFJA 4GMQA 3L26A 2YR0A 3JR5A 1VG5A 2F5SA 4D82A 1GJSA 2MROB 1IXSB 4AQYM 3SC3A 2DAKA 2OOBA 1G4AE 3SYLA 2C96A 2DHRA 2K0BX 2BNKA 2YNMD 2V1CA 5H37D 2DAGA 3RE8A 2JNHA 1ZMUA 3LQQA 2LVQD 2OOAA 2R18A 2KNAA 3KOZE 5A2QS 1Z59A 4JI4M 7CATA 2VQEM 1IBLM 2M60A 4LCBA 1VEKA 3THGA 3VFDA 4GKJM 4BBAA 2D7HA 2HHHM 1IM2A 2LHCA 3C3EA 4GRIA 3TWMA 4OU7A 3U61B 1WGLA 1N32M 4NRVA 2ZTCA 3HU3A 1R5LA 2JY6B 3W67A 4A3VB 1L8QA 2LXEA 2QP9X 4PDGA 1GKIA 1PJTA 2HL7A 4ITQA 1G3IA 3U6OA 3E4RA 3Q8GA 3HJQA 3HJ8A 1E9RA 1EIJA 2LVNC 1C1KA 2ZTDA 3GRRA 3HGIA 2XH9A 3L27A 5EP2A 4DR3M 5IT9S 1WGNA 1QAQA 2Z7JA 3IG5A 4JI1M 2G8LA 1TR8A 4FD2A 1AUAA 5EQTA 3I01M 2WZJA 3H4MA 4WURA 3VK8A 3SARA 2UU9M 2VF8A 1CUKA 4LFAM 3VDPA 5FTLA 3T15A 4L78A 4R7GA 3AOGA 5JI2E 2XFSA 2O01F 4GITA 4I8OA 4B08A 1T43A 3EIEA 3K9OA 4MB7A 4PT5A 3SFZA 4B7FA 4Z8XA 4LJ4A 4AZFA 3OTOM 4L8RC 1IXZA 2XGNA 4DV3M 1DGFA 5ITQA 2CEAA 3A42A 1E94E 1SG9A 4BLCA 1NV9A 4AKHA 3PNVA 3GRYA 3AV0A 5EJCA 2JY8A 1UFZA 3DA1A 2L7HA 3HX3A 1XXHB 2QCUA 3AFHA 1E9SA 5FTNA 3HHZA 2ERCA 5EXPA 4EIWA 3U6QA 3UZUA 1SXJA 3SAWA 3B7QA 2X49A 5EXTA 3FKEA 3ILKA 5KPZA 3SASA 4LG2A 1JR3E 2HCBA 2F5PA 2FE8A 2Y21A 3GLHA 1NO1A 3U6SA 3VDUA 2BWEA 5FTMA 3ZH9B 4F2LA 4CGYB 3J80S 4MGHA 2R44A 1QUTA 2R4EA 4FCTA 2J7NA 2F4VM 4JXJA 2D7GA 4DV5M 3HY5A 2ZAOA 2KRKA 2OPFA 1HQYE 3NBIA 2DAMA 3T1HM 2JZ1A 3MK6A 4MH0E 2X8AA 3FTEA 2Z4RA 2DVWB 3BXWA 4X65M 4F1IA 1WR1B 1PJIA 1KFVA 5IZ7D 5F3WA 5KO3A 1YUBA 4JI2M 3KS4A 4JV5M 3FD9A 4P17A 4ANRA 1VQ1A 1J7KA 1QZEA 1K3WA 4HEOA 4XGIA 1IFYA 2BJWA 3JAMS 1IXSA 5ITUA 1DV0A 2I7NA 8CATA 3GPXA 4LJ7A 2DWLA 3GQ5A 1Q3CA 3FTDA 1PGYA 4DUYM 3A98B 5BPVA 4LJ9A 1DGHB 2KZSA 3PXGA 3GLHE 3KP1E 1HR0M 1QAMA 2Y0TA 5ITRA 3UJNA 1NY6A 3DOAA 4L15A 3SMPA 3U6LA 2L09A 3KOXE 1QDRA 4FWDA 5ITTA 4GKKM 3KS8A 1OFIA 4IBIA 1L2DA 1W5TA 3J7BA 3HZJA 1P3QQ 4I4LA 1HJPA 3KDSE 3B74A 3GQ3A 4B7HA 3U61A 3DZDA 2R62A 2JXNA 4JI3M 4MGKE 3HJSA 3TPZA 4IIWA 1TH4A 4AI6A 1HNXM 5JI3E 1MU5A 2QENA 2JZ0A 4B3SM 3L2AA 4WW0A 5L8RF 4LRTA 1XC8A 4M9ZA 2RGHA 4GHAA 1R6BX 4DV0M 3GPUA 1EFUB 2UUBM 4B3TM 3C58A 1HQCA 1E32A 3VKHA 5DYGA 2YQZA 3K1JA 2XZUA 5ITYA 2R46A 4DV4M 4D81A 4DR4M 2ZAMA 2CHVA 3KP0E 1HNWM 2QPAA 2R45A 2JP7A 2L6OA 1XWIA 1UM8A 1K82A 1IBMM 1Q39A 2QBYB 4M0WA 1NNJA 3FUWA 2EO2A 4DR2M 3K8ZA 1L2BA 4NXNM 1TF0B 1XB2B 3FUXA 3KSXA 3UGJA 4DR5M 3NWLA 1GL6A 3NBXX 2EUCA 2QNJA 4Z6YA 2L4EA 1R2YA 2DWMA 4LF5M 1Z6TA 2UXBM 2RKOA 4ZPXA 1D0LA 4LF6M 2R65A 1YLAA 3QAUA 2C99A 2WSCF 2DZOB 3B7NA 1OFHA 2I7PA 3UK6A 3FYDA 4PD2A 5IWAM 2Y20A 4Y28F 4AG6A 2HWJA 3HKPA 3TWLA 5E26A 4IJEA 1GJTA 1IY0A 1PM5A 1Q3BA 1I4WA 2P5TA 1F4IA 1GVNA 4RF1A 3WHLA 1G59A 1X37A 1HT1E 1R4GA 1YSYA 1IXRC 1ZAEA 2Z4SA 4KODA 4LY6A 2ZM6M 3F92A 1TDZA 1H6UA 3U60A 1VDDA 1JR3A 2KNVA 2EKFA 4DBGB 4I81A 2NQ8C 1T6OA 1D2NA 2VDBB 2KA6B 4B3MM 1KSFX 2Z3XA 5EP4A 5KPTA 1GABA 4GC5A 3VLFB 3HU1A 4KHPM 1SXJD 2FNAA 3H4JA 3IG8A 4X64M 1J09A 3ZC7B 2H5XA 1DO0A 4NSOB 4CIZA 4LF9M 4MM3B 5EXSA 4DUZM 1A5TA 1PJJA 4P16A 1IBKM 1TGUA 1KYIA 5BR8M 2BJVA 3AOEC 3WHKA 2JY7A 3J2PB 4DV2M 3GRUA 1FNNA 2M5ZA 2X4AA 4FVMA 4IBBA 1VDLA 2ZANA 4NOOB 4AW4A 4DR1M 1C7YA 4M0DA 2F5NA 2CV0A 2MR9A 4IBCA 4MGYE 3W0LB 4RKUF 3FRHA 2F5QA 2KW0A 1XXHE 1JB0F 2DZNB 2MH8A 3SMSA 3U6EA 2C9CA 1HT2E 2CP8A 1Z5CA 3LMMA 1OAOC 2CHQA 5DFLA 3AKZA 1IN7A 5KPRA 4QHSA
chains in the Genus database with same CATH topology
2A5YB 3HWSA 2KXEA 3SBJA 5KQ8A 1DGHA 4DV6M 2AHMA 2KRUA 1DGGA 2G5GX 3CF6E 3TQSA 3M7GA 4KLNA 3KXEC 2LWXA 4XBOA 2UUCM 3AL0C 3CF0A 1XMQM 1G8PA 3GP1A 3AJIB 1YE9A 4FCVA 4LZZA 1QQWA 3FUVA 4JI0M 4OVZB 1IQPA 3GPYA 5KQDA 3JR4A 2HKJA 2C98A 1N36M 2RGOA 3GLIB 4IBDA 1NJFA 4QOZC 4X66M 3J27B 2UUAM 1QANA 2EA0A 1W5SA 2J7OA 1JQJC 3EIHA 4HL4A 3A46A 4G4NA 4G4RA 2XZFA 3L29A 4R3DA 2XLJA 3MHVC 4LJAA 3FTFA 5EP1A 4L4UA 5DYIA 1T3TA 3L28A 2UXDM 5EXXA 1SXJB 1R7RA 3D8BA 4QNRA 3U6PA 1WXQA 3M6AA 4FWGA 4IJFA 2O5RA 1G41A 3GLGB 4HLQA 4M9SA 3TWKA 4DV1M 4LRSA 4LJ6A 4NL4H 4S12A 1IN8A 3LVWA 4KO8A 4DR7M 3SHGB 1EE8A 1GL7A 3GLFB 4I5SA 4QOSA 5LMNM 1TH3A 2W82A 2Y0QA 5FLXS 1XNQM 2H1RA 4LJ8A 3R9XB 4LFBM 3KW6A 3SAVA 1IY2A 1Z5BA 4FW9A 4W5WA 2CE7A 3J81S 1N77A 4B3RM 2KEBA 2CV1A 2L7IA 4JI8M 3FTCA 2V6ZM 4FWHA 4YY3M 3U5ZB 4II7A 2LH0A 1JR3D 2UXCM 2VQFM 3TE6A 4IBKA 4LGMA 3TL4X 3CF2A 5ITXE 3KFUG 5EP3A 4CHTB 5LMUM 2QZ4A 3I4YA 4JYAM 3W0FA 4QHTA 4JI6M 3Q8XA 4JN6A 4MGZE 1XNRM 1NVMA 1N33M 1QAOA 1XXHA 4NSRA 2F5OA 1HNZM 3FUTA 2D7EA 2XSZA 4JI7M 4LFCM 3SHFA 4GHLA 3U6CA 4QNMA 2KZUA 3PFIA 3T1YM 1LV7A 3PNYA 3U6MA 3CTWB 4OW0A 3VKGA 4G4QA 3AOEA 1IY1A 1QZMA 3BOSA 3GO8A 3I51A 2DXIA 2DWZB 4GIPA 2CV2A 3KSJA 3T38A 2C5RA 4G4OA 4OVZA 3HU2A 3VK7A 1N78A 3LVVA 4L16A 1XHBA 3GQ4A 1QVRA 3GLIA 3D8LA 1N34M 3RGPA 1L1ZA 2DWNA 3U6DA 3MJ5A 4LF8M 3HHYA 3KOWE 5GKNA 3K2LA 3KVWA 3HHWA 4LF4M 3J7AS 1DGBA 4X62M 1NHWC 1L1TA 4PCZA 3GPPA 1NSFA 4FCWA 3I4VA 2V1UA 3KOYE 2FOIC 2E5LM 2CHGA 5FSWA 4LJ5A 5FTJA 4IBJA 3ZCBB 1IN4A 1QYRA 3U60B 1K3XA 3A45A 1TDHA 1ORYB 2C9OA 5C1BA 3LQRA 4AG5A 1SXJC 3GLGA 1N75A 1ZQ9A 1Z5AA 4AKGA 4RF0A 3QWLA 4IBGA 3K92A 3DFZA 1I94M 3SAUA 3GLFA 3GRVA 4B7GA 4K0KM 1FJGM 1J5EM 1OJLA 4M9XA 1S3SA 2YFQA 2LNHC 5IREB 2QBYA 2K47A 3RGSA 2Q2EB 4LGYA 1R2ZA 2VIIA 4LZJA 4G6ZA 3U5ZA 4AKIA 4LF7M 3FUUA 4OX9M 2ZBKB 2OQ4A 2XF3A 5ITXA 4D80A 2CUZA 5FTKA 2CFOA 1DO2A 1SXJE 3RFWA 4DR6M 2XEPA 1TH2A 3GLHB 4GH9A 5C18A 2R4JA 4IBEA 3B9PA 4BB9A 3HHXA 4YHHM 4DV7M 3L25A 1GLNA 3M0EA 1XMOM 3SYKA 1IN5A 4IBFA 3E9SA 1NJGA 1L2CA 5DNYA 5E6JA 1NHGC 2XFTA 4NRWA 4TUWA 1NY5A 3FYCA 2JA2A 3UMMA 4CISA 4NXMM 3PVSA 4MGIE 3R8FA 1IN6A 4JI5M 4RNAA 4PDIA 2XSZD 1MX0A 4REZA 3SATA 4GC9A 1NNUC 2FFJA 4GMQA 3L26A 2YR0A 3JR5A 2F5SA 4D82A 1IXSB 4AQYM 3SC3A 1G4AE 3SYLA 2C96A 2DHRA 2BNKA 2YNMD 2V1CA 5H37D 3RE8A 3LQQA 2R18A 3KOZE 5A2QS 4JI4M 1Z59A 7CATA 2VQEM 1IBLM 2M60A 4LCBA 3THGA 3VFDA 4GKJM 4BBAA 2D7HA 2HHHM 1IM2A 1N32M 4GRIA 3TWMA 4OU7A 3U61B 4NRVA 3HU3A 4A3VB 4PDGA 1L8QA 2LXEA 2QP9X 1GKIA 2HL7A 4ITQA 1G3IA 3U6OA 3E4RA 3HJQA 3HJ8A 1E9RA 1C1KA 3GRRA 3HGIA 2XH9A 3L27A 5EP2A 4DR3M 5IT9S 1QAQA 2Z7JA 3IG5A 4JI1M 2G8LA 4FD2A 5EQTA 3SARA 3H4MA 4WURA 3VK8A 2UU9M 4LFAM 3VDPA 5FTLA 3T15A 4L78A 4R7GA 3AOGA 5JI2E 2XFSA 4GITA 4I8OA 4B08A 3EIEA 4MB7A 4PT5A 3SFZA 4B7FA 4Z8XA 4LJ4A 4AZFA 3OTOM 4L8RC 1IXZA 2XGNA 4DV3M 1DGFA 5ITQA 2CEAA 3A42A 1E94E 4BLCA 4AKHA 3PNVA 3GRYA 3AV0A 5EJCA 3DA1A 2L7HA 5FTNA 1XXHB 2QCUA 3AFHA 1E9SA 3HHZA 2ERCA 5EXPA 4EIWA 3U6QA 3UZUA 1SXJA 3SAWA 2X49A 5EXTA 3FKEA 3ILKA 5KPZA 3SASA 4LG2A 2HCBA 2F5PA 2FE8A 2Y21A 3GLHA 3U6SA 3VDUA 5FTMA 3ZH9B 4CGYB 3J80S 4MGHA 2R4EA 4FCTA 2J7NA 2F4VM 4JXJA 2D7GA 4DV5M 2ZAOA 2KRKA 2OPFA 1HQYE 3NBIA 3T1HM 3MK6A 4MH0E 2X8AA 3FTEA 2Z4RA 2DVWB 4X65M 1PJIA 1KFVA 5IZ7D 5F3WA 5KO3A 1YUBA 4JI2M 3KS4A 4JV5M 3FD9A 1J7KA 1K3WA 4XGIA 2BJWA 3JAMS 5ITUA 2I7NA 8CATA 3GPXA 4LJ7A 2DWLA 3GQ5A 1Q3CA 3FTDA 4DUYM 3A98B 5BPVA 4LJ9A 1DGHB 2KZSA 3PXGA 1HR0M 3KP1E 1QAMA 2Y0TA 5ITRA 3UJNA 1NY6A 3DOAA 4L15A 3SMPA 3U6LA 2L09A 3KOXE 4FWDA 5ITTA 4GKKM 3KS8A 1OFIA 4IBIA 1L2DA 1W5TA 3J7BA 4I4LA 3KDSE 3GQ3A 4B7HA 3U61A 3DZDA 2R62A 4JI3M 4MGKE 3HJSA 3TPZA 4IIWA 1TH4A 4AI6A 1HNXM 5JI3E 1MU5A 2QENA 4B3SM 3L2AA 4WW0A 1XC8A 4LRTA 4M9ZA 2RGHA 4GHAA 1R6BX 4DV0M 3GPUA 2UUBM 4B3TM 3VKHA 3C58A 1HQCA 1E32A 5DYGA 2YQZA 3K1JA 2XZUA 5ITYA 2R46A 4DV4M 4D81A 4DR4M 2ZAMA 2CHVA 3KP0E 1HNWM 2QPAA 2R45A 2L6OA 1IBMM 1XWIA 1UM8A 1K82A 1Q39A 2QBYB 4M0WA 1NNJA 3FUWA 2EO2A 4DR2M 3K8ZA 1L2BA 4NXNM 3FUXA 3KSXA 4DR5M 3UGJA 3NWLA 1GL6A 2EUCA 4Z6YA 1R2YA 2DWMA 4LF5M 1Z6TA 2UXBM 2RKOA 4ZPXA 4LF6M 2R65A 3QAUA 2C99A 4PD2A 2DZOB 1OFHA 2I7PA 3UK6A 3FYDA 5IWAM 2Y20A 4AG6A 3HKPA 3TWLA 5E26A 4IJEA 1IY0A 1PM5A 1Q3BA 1I4WA 2P5TA 1GVNA 4RF1A 3WHLA 1G59A 1X37A 1HT1E 1ZAEA 1YSYA 1IXRC 4KODA 2Z4SA 4LY6A 2ZM6M 1TDZA 1H6UA 3U60A 1VDDA 1JR3A 4I81A 2NQ8C 1D2NA 2KA6B 4B3MM 1KSFX 2Z3XA 5EP4A 5KPTA 4GC5A 3VLFB 3HU1A 4KHPM 1SXJD 2FNAA 3IG8A 4X64M 1J09A 3ZC7B 4LF9M 1DO0A 4NSOB 4MM3B 5EXSA 4DUZM 1PJJA 4P16A 1IBKM 1TGUA 1KYIA 5BR8M 2BJVA 3AOEC 3WHKA 3J2PB 4DV2M 3GRUA 1FNNA 2M5ZA 2X4AA 4FVMA 4IBBA 2ZANA 4NOOB 4DR1M 4AW4A 2F5NA 2CV0A 4M0DA 4IBCA 4MGYE 3W0LB 2F5QA 2KW0A 2DZNB 3SMSA 3U6EA 2C9CA 1HT2E 1Z5CA 3LMMA 2CHQA 3AKZA 1IN7A 5KPRA 4QHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EUC A; 
#chains in the Genus database with same CATH topology
 2A5Y B;  1MN3 A;  3HWS A;  2DNA A;  2KXE A;  3SBJ A;  3LCU A;  5KQ8 A;  1DGH A;  1GO5 A;  4DV6 M;  4WP2 A;  2AHM A;  2KRU A;  1DGG A;  2G5G X;  3CF6 E;  3TQS A;  3M7G A;  4KLN A;  3KXE C;  2LWX A;  4XBO A;  2UUC M;  3AL0 C;  3CF0 A;  1XMQ M;  1VEJ A;  1G8P A;  1NV8 A;  3GP1 A;  3AJI B;  4KT0 F;  1YE9 A;  2JY5 A;  2LVA A;  4FCV A;  4LZZ A;  1QQW A;  3FUV A;  4JI0 M;  4R71 A;  4OVZ B;  1IQP A;  3V76 A;  3GPY A;  5KQD A;  3JR4 A;  2HKJ A;  2APL A;  3C3D A;  2C98 A;  1N36 M;  2RGO A;  1WHC A;  3GLI B;  4IBD A;  1OIZ A;  1MJG M;  2DHY A;  1NJF A;  2DEN A;  4QOZ C;  2CRU A;  3J27 B;  4X66 M;  2UUA M;  1QAN A;  2EA0 A;  1W5S A;  2N35 A;  2J7O A;  1JQJ C;  3EIH A;  4HL4 A;  3A46 A;  1WJ7 A;  4G4N A;  4G4R A;  2XZF A;  2MJ5 B;  3L29 A;  4R3D A;  2XLJ A;  3I04 M;  3MHV C;  4LJA A;  3FTF A;  5EP1 A;  4L4U A;  5DYI A;  1RU3 A;  1T3T A;  3L28 A;  2UXD M;  3W68 A;  1V92 A;  1BVS A;  5EXX A;  1SXJ B;  2EKK A;  1R7R A;  3D8B A;  1Q02 A;  4QNR A;  3K9P A;  1WXQ A;  2K9D A;  2R0I A;  3M6A A;  3U6P A;  4FWG A;  4IJF A;  2O5R A;  1G41 A;  3GLG B;  4HLQ A;  4M9S A;  3TWK A;  4DV1 M;  4LRS A;  4LJ6 A;  4NL4 H;  4S12 A;  1IN8 A;  3LVW A;  2QQ8 A;  4CJ6 A;  4KO8 A;  1OKS A;  2LBC A;  4DR7 M;  1D0K A;  3SHG B;  1EE8 A;  1GL7 A;  1V34 A;  3GLF B;  3E46 A;  4I5S A;  4QOS A;  5LMN M;  1TH3 A;  2W82 A;  2Y0Q A;  5FLX S;  1XNQ M;  2H1R A;  4LJ8 A;  3R9X B;  4LFB M;  3KW6 A;  3SAV A;  1IY2 A;  1Z5B A;  4FW9 A;  4W5W A;  2CE7 A;  3J81 S;  1D0M A;  1N77 A;  1PJS A;  4L6V 6;  4B3R M;  2KEB A;  2CV1 A;  2WSF F;  2L7I A;  2DKL A;  4JI8 M;  3FTC A;  2V6Z M;  4FWH A;  4YY3 M;  3U5Z B;  1ZMW A;  2DZL A;  4II7 A;  2LH0 A;  1JR3 D;  2UXC M;  2VQF M;  3TE6 A;  2QSF X;  4IBK A;  3LW5 F;  1OQY A;  4LGM A;  3TL4 X;  2QHO B;  3CF2 A;  5ITX E;  3KFU G;  5EP3 A;  4CHT B;  5LMU M;  3B7Z A;  2Z8Y M;  3LCV B;  2QZ4 A;  3I4Y A;  4JYA M;  1QDT A;  3W0F A;  4QHT A;  4JI6 M;  3Q8X A;  4JN6 A;  3BBZ A;  4MGZ E;  3IHP A;  1XNR M;  1NVM A;  2R6F A;  1N33 M;  1QAO A;  1XXH A;  3IEC A;  4NSR A;  1AIP C;  2F5O A;  1HNZ M;  2OO9 A;  3FUT A;  2D7E A;  2XSZ A;  4JI7 M;  4LFC M;  3SHF A;  4GHL A;  3U6C A;  4QNM A;  2KZU A;  2B3T A;  3PFI A;  2LTU A;  3T1Y M;  1LV7 A;  2HAK A;  3PNY A;  3U6M A;  2DI0 A;  3CTW B;  4OW0 A;  3VKG A;  4G4Q A;  4NC6 A;  3AOE A;  1IY1 A;  1QZM A;  3BOS A;  3GO8 A;  3FE3 A;  3I51 A;  2CWB A;  2DXI A;  2DWZ B;  4GIP A;  2CV2 A;  1VEG A;  3KSJ A;  3T38 A;  2C5R A;  4GEW A;  3CGW A;  4G3O A;  4G4O A;  4OVZ A;  3HU2 A;  3VK7 A;  2KDL A;  3FRI A;  1N78 A;  3LVV A;  4L16 A;  1XHB A;  3GQ4 A;  1QVR A;  2JWS A;  3D8L A;  3GLI A;  1TTE A;  1ZMV A;  3RGP A;  1N34 M;  2LVP C;  1L1Z A;  2DWN A;  3U6D A;  3MJ5 A;  4LF8 M;  3HHY A;  2J5Y A;  3KOW E;  5GKN A;  3K2L A;  3KVW A;  3HHW A;  4LF4 M;  1LTM A;  3J7A S;  1DGB A;  4X62 M;  1NHW C;  1L1T A;  4PCZ A;  3ZQJ A;  3GPP A;  1NSF A;  4FCW A;  3I4V A;  2V1U A;  2FOI C;  3KOY E;  2E5L M;  2CHG A;  5FSW A;  4LJ5 A;  5FTJ A;  4IBJ A;  3QYB A;  1IN4 A;  3ZCB B;  1QYR A;  2VF7 A;  3U60 B;  1K3X A;  1V33 A;  2RRU A;  3A45 A;  1TDH A;  1OTR A;  1ORY B;  2C9O A;  5C1B A;  3LQR A;  4AG5 A;  1SXJ C;  3GLG A;  1QUS A;  1N75 A;  1ZQ9 A;  1Z5A A;  4AKG A;  4RF0 A;  3C9P A;  3QWL A;  4IBG A;  3K92 A;  3DFZ A;  1I94 M;  3SAU A;  3GLI E;  2KNZ A;  2KHH A;  3GRV A;  3GLF A;  1PRB A;  3E21 A;  4B7G A;  4K0K M;  1FJG M;  1G71 A;  1Y8G A;  1J5E M;  1OJL A;  2WSE F;  1S3S A;  2YFQ A;  4M9X A;  2LNH C;  2LVO C;  4Q7J A;  2K47 A;  5IRE B;  2QBY A;  3RGS A;  2Q2E B;  4LGY A;  1R2Z A;  2VII A;  1WIV A;  4LZJ A;  3B89 A;  4G6Z A;  3U5Z A;  4AKI A;  4LF7 M;  1OIP A;  3FUU A;  4OX9 M;  2ZBK B;  2OQ4 A;  2EJS A;  2XF3 A;  5ITX A;  4D80 A;  2CUZ A;  2GNO A;  2LHG A;  5FTK A;  2O25 A;  2CFO A;  1DO2 A;  1SXJ E;  3RFW A;  4DR6 M;  2XEP A;  1TH2 A;  3GLH B;  4GH9 A;  3T6P A;  5C18 A;  2R4J A;  4IBE A;  3B9P A;  2L4F A;  4UN2 B;  2L2D A;  4BB9 A;  3HHX A;  4YHH M;  4DV7 M;  3GLG E;  3L25 A;  1GLN A;  3M0E A;  1OAI A;  1XMO M;  3SYK A;  4XK8 F;  1PJQ A;  1IN5 A;  3QYE A;  4IBF A;  3E9S A;  1NJG A;  1L2C A;  5DNY A;  5E6J A;  1NHG C;  3GLF E;  2XFT A;  2K6B A;  4NRW A;  1NY5 A;  3FYC A;  2JA2 A;  3UMM A;  4CIS A;  4NXM M;  1ZV1 A;  4TUW A;  2DAE A;  2DAI A;  3PVS A;  4MGI E;  2JUJ A;  3R8F A;  1IN6 A;  2BWB A;  2G3Q A;  2GQF A;  3MMP A;  4RNA A;  4JI5 M;  2MGW A;  2FH0 A;  4PDI A;  1MX0 A;  2XSZ D;  4REZ A;  3SAT A;  4GC9 A;  1NNU C;  2FS1 A;  2FFJ A;  4GMQ A;  3L26 A;  2YR0 A;  3JR5 A;  1VG5 A;  2F5S A;  4D82 A;  1GJS A;  2MRO B;  1IXS B;  4AQY M;  3SC3 A;  2DAK A;  2OOB A;  1G4A E;  3SYL A;  2C96 A;  2DHR A;  2K0B X;  2BNK A;  2YNM D;  2V1C A;  5H37 D;  2DAG A;  3RE8 A;  2JNH A;  1ZMU A;  3LQQ A;  2LVQ D;  2OOA A;  2R18 A;  2KNA A;  3KOZ E;  5A2Q S;  1Z59 A;  4JI4 M;  7CAT A;  2VQE M;  1IBL M;  2M60 A;  4LCB A;  1VEK A;  3THG A;  3VFD A;  4GKJ M;  4BBA A;  2D7H A;  2HHH M;  1IM2 A;  2LHC A;  3C3E A;  4GRI A;  3TWM A;  4OU7 A;  3U61 B;  1WGL A;  1N32 M;  4NRV A;  2ZTC A;  3HU3 A;  1R5L A;  2JY6 B;  3W67 A;  4A3V B;  1L8Q A;  2LXE A;  2QP9 X;  4PDG A;  1GKI A;  1PJT A;  2HL7 A;  4ITQ A;  1G3I A;  3U6O A;  3E4R A;  3Q8G A;  3HJQ A;  3HJ8 A;  1E9R A;  1EIJ A;  2LVN C;  1C1K A;  2ZTD A;  3GRR A;  3HGI A;  2XH9 A;  3L27 A;  5EP2 A;  4DR3 M;  5IT9 S;  1WGN A;  1QAQ A;  2Z7J A;  3IG5 A;  4JI1 M;  2G8L A;  1TR8 A;  4FD2 A;  1AUA A;  5EQT A;  3I01 M;  2WZJ A;  3H4M A;  4WUR A;  3VK8 A;  3SAR A;  2UU9 M;  2VF8 A;  1CUK A;  4LFA M;  3VDP A;  5FTL A;  3T15 A;  4L78 A;  4R7G A;  3AOG A;  5JI2 E;  2XFS A;  2O01 F;  4GIT A;  4I8O A;  4B08 A;  1T43 A;  3EIE A;  3K9O A;  4MB7 A;  4PT5 A;  3SFZ A;  4B7F A;  4Z8X A;  4LJ4 A;  4AZF A;  3OTO M;  4L8R C;  1IXZ A;  2XGN A;  4DV3 M;  1DGF A;  5ITQ A;  2CEA A;  3A42 A;  1E94 E;  1SG9 A;  4BLC A;  1NV9 A;  4AKH A;  3PNV A;  3GRY A;  3AV0 A;  5EJC A;  2JY8 A;  1UFZ A;  3DA1 A;  2L7H A;  3HX3 A;  1XXH B;  2QCU A;  3AFH A;  1E9S A;  5FTN A;  3HHZ A;  2ERC A;  5EXP A;  4EIW A;  3U6Q A;  3UZU A;  1SXJ A;  3SAW A;  3B7Q A;  2X49 A;  5EXT A;  3FKE A;  3ILK A;  5KPZ A;  3SAS A;  4LG2 A;  1JR3 E;  2HCB A;  2F5P A;  2FE8 A;  2Y21 A;  3GLH A;  1NO1 A;  3U6S A;  3VDU A;  2BWE A;  5FTM A;  3ZH9 B;  4F2L A;  4CGY B;  3J80 S;  4MGH A;  2R44 A;  1QUT A;  2R4E A;  4FCT A;  2J7N A;  2F4V M;  4JXJ A;  2D7G A;  4DV5 M;  3HY5 A;  2ZAO A;  2KRK A;  2OPF A;  1HQY E;  3NBI A;  2DAM A;  3T1H M;  2JZ1 A;  3MK6 A;  4MH0 E;  2X8A A;  3FTE A;  2Z4R A;  2DVW B;  3BXW A;  4X65 M;  4F1I A;  1WR1 B;  1PJI A;  1KFV A;  5IZ7 D;  5F3W A;  5KO3 A;  1YUB A;  4JI2 M;  3KS4 A;  4JV5 M;  3FD9 A;  4P17 A;  4ANR A;  1VQ1 A;  1J7K A;  1QZE A;  1K3W A;  4HEO A;  4XGI A;  1IFY A;  2BJW A;  3JAM S;  1IXS A;  5ITU A;  1DV0 A;  2I7N A;  8CAT A;  3GPX A;  4LJ7 A;  2DWL A;  3GQ5 A;  1Q3C A;  3FTD A;  1PGY A;  4DUY M;  3A98 B;  5BPV A;  4LJ9 A;  1DGH B;  2KZS A;  3PXG A;  3GLH E;  3KP1 E;  1HR0 M;  1QAM A;  2Y0T A;  5ITR A;  3UJN A;  1NY6 A;  3DOA A;  4L15 A;  3SMP A;  3U6L A;  2L09 A;  3KOX E;  1QDR A;  4FWD A;  5ITT A;  4GKK M;  3KS8 A;  1OFI A;  4IBI A;  1L2D A;  1W5T A;  3J7B A;  3HZJ A;  1P3Q Q;  4I4L A;  1HJP A;  3KDS E;  3B74 A;  3GQ3 A;  4B7H A;  3U61 A;  3DZD A;  2R62 A;  2JXN A;  4JI3 M;  4MGK E;  3HJS A;  3TPZ A;  4IIW A;  1TH4 A;  4AI6 A;  1HNX M;  5JI3 E;  1MU5 A;  2QEN A;  2JZ0 A;  4B3S M;  3L2A A;  4WW0 A;  5L8R F;  4LRT A;  1XC8 A;  4M9Z A;  2RGH A;  4GHA A;  1R6B X;  4DV0 M;  3GPU A;  1EFU B;  2UUB M;  4B3T M;  3C58 A;  1HQC A;  1E32 A;  3VKH A;  5DYG A;  2YQZ A;  3K1J A;  2XZU A;  5ITY A;  2R46 A;  4DV4 M;  4D81 A;  4DR4 M;  2ZAM A;  2CHV A;  3KP0 E;  1HNW M;  2QPA A;  2R45 A;  2JP7 A;  2L6O A;  1XWI A;  1UM8 A;  1K82 A;  1IBM M;  1Q39 A;  2QBY B;  4M0W A;  1NNJ A;  3FUW A;  2EO2 A;  4DR2 M;  3K8Z A;  1L2B A;  4NXN M;  1TF0 B;  1XB2 B;  3FUX A;  3KSX A;  3UGJ A;  4DR5 M;  3NWL A;  1GL6 A;  3NBX X;  2EUC A;  2QNJ A;  4Z6Y A;  2L4E A;  1R2Y A;  2DWM A;  4LF5 M;  1Z6T A;  2UXB M;  2RKO A;  4ZPX A;  1D0L A;  4LF6 M;  2R65 A;  1YLA A;  3QAU A;  2C99 A;  2WSC F;  2DZO B;  3B7N A;  1OFH A;  2I7P A;  3UK6 A;  3FYD A;  4PD2 A;  5IWA M;  2Y20 A;  4Y28 F;  4AG6 A;  2HWJ A;  3HKP A;  3TWL A;  5E26 A;  4IJE A;  1GJT A;  1IY0 A;  1PM5 A;  1Q3B A;  1I4W A;  2P5T A;  1F4I A;  1GVN A;  4RF1 A;  3WHL A;  1G59 A;  1X37 A;  1HT1 E;  1R4G A;  1YSY A;  1IXR C;  1ZAE A;  2Z4S A;  4KOD A;  4LY6 A;  2ZM6 M;  3F92 A;  1TDZ A;  1H6U A;  3U60 A;  1VDD A;  1JR3 A;  2KNV A;  2EKF A;  4DBG B;  4I81 A;  2NQ8 C;  1T6O A;  1D2N A;  2VDB B;  2KA6 B;  4B3M M;  1KSF X;  2Z3X A;  5EP4 A;  5KPT A;  1GAB A;  4GC5 A;  3VLF B;  3HU1 A;  4KHP M;  1SXJ D;  2FNA A;  3H4J A;  3IG8 A;  4X64 M;  1J09 A;  3ZC7 B;  2H5X A;  1DO0 A;  4NSO B;  4CIZ A;  4LF9 M;  4MM3 B;  5EXS A;  4DUZ M;  1A5T A;  1PJJ A;  4P16 A;  1IBK M;  1TGU A;  1KYI A;  5BR8 M;  2BJV A;  3AOE C;  3WHK A;  2JY7 A;  3J2P B;  4DV2 M;  3GRU A;  1FNN A;  2M5Z A;  2X4A A;  4FVM A;  4IBB A;  1VDL A;  2ZAN A;  4NOO B;  4AW4 A;  4DR1 M;  1C7Y A;  4M0D A;  2F5N A;  2CV0 A;  2MR9 A;  4IBC A;  4MGY E;  3W0L B;  4RKU F;  3FRH A;  2F5Q A;  2KW0 A;  1XXH E;  1JB0 F;  2DZN B;  2MH8 A;  3SMS A;  3U6E A;  2C9C A;  1HT2 E;  2CP8 A;  1Z5C A;  3LMM A;  1OAO C;  2CHQ A;  5DFL A;  3AKZ A;  1IN7 A;  5KPR A;  4QHS A; 
#chains in the Genus database with same CATH homology
 2A5Y B;  3HWS A;  2KXE A;  3SBJ A;  5KQ8 A;  1DGH A;  4DV6 M;  2AHM A;  2KRU A;  1DGG A;  2G5G X;  3CF6 E;  3TQS A;  3M7G A;  4KLN A;  3KXE C;  2LWX A;  4XBO A;  2UUC M;  3AL0 C;  3CF0 A;  1XMQ M;  1G8P A;  3GP1 A;  3AJI B;  1YE9 A;  4FCV A;  4LZZ A;  1QQW A;  3FUV A;  4JI0 M;  4OVZ B;  1IQP A;  3GPY A;  5KQD A;  3JR4 A;  2HKJ A;  2C98 A;  1N36 M;  2RGO A;  3GLI B;  4IBD A;  1NJF A;  4QOZ C;  4X66 M;  3J27 B;  2UUA M;  1QAN A;  2EA0 A;  1W5S A;  2J7O A;  1JQJ C;  3EIH A;  4HL4 A;  3A46 A;  4G4N A;  4G4R A;  2XZF A;  3L29 A;  4R3D A;  2XLJ A;  3MHV C;  4LJA A;  3FTF A;  5EP1 A;  4L4U A;  5DYI A;  1T3T A;  3L28 A;  2UXD M;  5EXX A;  1SXJ B;  1R7R A;  3D8B A;  4QNR A;  3U6P A;  1WXQ A;  3M6A A;  4FWG A;  4IJF A;  2O5R A;  1G41 A;  3GLG B;  4HLQ A;  4M9S A;  3TWK A;  4DV1 M;  4LRS A;  4LJ6 A;  4NL4 H;  4S12 A;  1IN8 A;  3LVW A;  4KO8 A;  4DR7 M;  3SHG B;  1EE8 A;  1GL7 A;  3GLF B;  4I5S A;  4QOS A;  5LMN M;  1TH3 A;  2W82 A;  2Y0Q A;  5FLX S;  1XNQ M;  2H1R A;  4LJ8 A;  3R9X B;  4LFB M;  3KW6 A;  3SAV A;  1IY2 A;  1Z5B A;  4FW9 A;  4W5W A;  2CE7 A;  3J81 S;  1N77 A;  4B3R M;  2KEB A;  2CV1 A;  2L7I A;  4JI8 M;  3FTC A;  2V6Z M;  4FWH A;  4YY3 M;  3U5Z B;  4II7 A;  2LH0 A;  1JR3 D;  2UXC M;  2VQF M;  3TE6 A;  4IBK A;  4LGM A;  3TL4 X;  3CF2 A;  5ITX E;  3KFU G;  5EP3 A;  4CHT B;  5LMU M;  2QZ4 A;  3I4Y A;  4JYA M;  3W0F A;  4QHT A;  4JI6 M;  3Q8X A;  4JN6 A;  4MGZ E;  1XNR M;  1NVM A;  1N33 M;  1QAO A;  1XXH A;  4NSR A;  2F5O A;  1HNZ M;  3FUT A;  2D7E A;  2XSZ A;  4JI7 M;  4LFC M;  3SHF A;  4GHL A;  3U6C A;  4QNM A;  2KZU A;  3PFI A;  3T1Y M;  1LV7 A;  3PNY A;  3U6M A;  3CTW B;  4OW0 A;  3VKG A;  4G4Q A;  3AOE A;  1IY1 A;  1QZM A;  3BOS A;  3GO8 A;  3I51 A;  2DXI A;  2DWZ B;  4GIP A;  2CV2 A;  3KSJ A;  3T38 A;  2C5R A;  4G4O A;  4OVZ A;  3HU2 A;  3VK7 A;  1N78 A;  3LVV A;  4L16 A;  1XHB A;  3GQ4 A;  1QVR A;  3GLI A;  3D8L A;  1N34 M;  3RGP A;  1L1Z A;  2DWN A;  3U6D A;  3MJ5 A;  4LF8 M;  3HHY A;  3KOW E;  5GKN A;  3K2L A;  3KVW A;  3HHW A;  4LF4 M;  3J7A S;  1DGB A;  4X62 M;  1NHW C;  1L1T A;  4PCZ A;  3GPP A;  1NSF A;  4FCW A;  3I4V A;  2V1U A;  3KOY E;  2FOI C;  2E5L M;  2CHG A;  5FSW A;  4LJ5 A;  5FTJ A;  4IBJ A;  3ZCB B;  1IN4 A;  1QYR A;  3U60 B;  1K3X A;  3A45 A;  1TDH A;  1ORY B;  2C9O A;  5C1B A;  3LQR A;  4AG5 A;  1SXJ C;  3GLG A;  1N75 A;  1ZQ9 A;  1Z5A A;  4AKG A;  4RF0 A;  3QWL A;  4IBG A;  3K92 A;  3DFZ A;  1I94 M;  3SAU A;  3GLF A;  3GRV A;  4B7G A;  4K0K M;  1FJG M;  1J5E M;  1OJL A;  4M9X A;  1S3S A;  2YFQ A;  2LNH C;  5IRE B;  2QBY A;  2K47 A;  3RGS A;  2Q2E B;  4LGY A;  1R2Z A;  2VII A;  4LZJ A;  4G6Z A;  3U5Z A;  4AKI A;  4LF7 M;  3FUU A;  4OX9 M;  2ZBK B;  2OQ4 A;  2XF3 A;  5ITX A;  4D80 A;  2CUZ A;  5FTK A;  2CFO A;  1DO2 A;  1SXJ E;  3RFW A;  4DR6 M;  2XEP A;  1TH2 A;  3GLH B;  4GH9 A;  5C18 A;  2R4J A;  4IBE A;  3B9P A;  4BB9 A;  3HHX A;  4YHH M;  4DV7 M;  3L25 A;  1GLN A;  3M0E A;  1XMO M;  3SYK A;  1IN5 A;  4IBF A;  3E9S A;  1NJG A;  1L2C A;  5DNY A;  5E6J A;  1NHG C;  2XFT A;  4NRW A;  4TUW A;  1NY5 A;  3FYC A;  2JA2 A;  3UMM A;  4CIS A;  4NXM M;  3PVS A;  4MGI E;  3R8F A;  1IN6 A;  4JI5 M;  4RNA A;  4PDI A;  2XSZ D;  1MX0 A;  4REZ A;  3SAT A;  4GC9 A;  1NNU C;  2FFJ A;  4GMQ A;  3L26 A;  2YR0 A;  3JR5 A;  2F5S A;  4D82 A;  1IXS B;  4AQY M;  3SC3 A;  1G4A E;  3SYL A;  2C96 A;  2DHR A;  2BNK A;  2YNM D;  2V1C A;  5H37 D;  3RE8 A;  3LQQ A;  2R18 A;  3KOZ E;  5A2Q S;  4JI4 M;  1Z59 A;  7CAT A;  2VQE M;  1IBL M;  2M60 A;  4LCB A;  3THG A;  3VFD A;  4GKJ M;  4BBA A;  2D7H A;  2HHH M;  1IM2 A;  1N32 M;  4GRI A;  3TWM A;  4OU7 A;  3U61 B;  4NRV A;  3HU3 A;  4A3V B;  4PDG A;  1L8Q A;  2LXE A;  2QP9 X;  1GKI A;  2HL7 A;  4ITQ A;  1G3I A;  3U6O A;  3E4R A;  3HJQ A;  3HJ8 A;  1E9R A;  1C1K A;  3GRR A;  3HGI A;  2XH9 A;  3L27 A;  5EP2 A;  4DR3 M;  5IT9 S;  1QAQ A;  2Z7J A;  3IG5 A;  4JI1 M;  2G8L A;  4FD2 A;  5EQT A;  3SAR A;  3H4M A;  4WUR A;  3VK8 A;  2UU9 M;  4LFA M;  3VDP A;  5FTL A;  3T15 A;  4L78 A;  4R7G A;  3AOG A;  5JI2 E;  2XFS A;  4GIT A;  4I8O A;  4B08 A;  3EIE A;  4MB7 A;  4PT5 A;  3SFZ A;  4B7F A;  4Z8X A;  4LJ4 A;  4AZF A;  3OTO M;  4L8R C;  1IXZ A;  2XGN A;  4DV3 M;  1DGF A;  5ITQ A;  2CEA A;  3A42 A;  1E94 E;  4BLC A;  4AKH A;  3PNV A;  3GRY A;  3AV0 A;  5EJC A;  3DA1 A;  2L7H A;  5FTN A;  1XXH B;  2QCU A;  3AFH A;  1E9S A;  3HHZ A;  2ERC A;  5EXP A;  4EIW A;  3U6Q A;  3UZU A;  1SXJ A;  3SAW A;  2X49 A;  5EXT A;  3FKE A;  3ILK A;  5KPZ A;  3SAS A;  4LG2 A;  2HCB A;  2F5P A;  2FE8 A;  2Y21 A;  3GLH A;  3U6S A;  3VDU A;  5FTM A;  3ZH9 B;  4CGY B;  3J80 S;  4MGH A;  2R4E A;  4FCT A;  2J7N A;  2F4V M;  4JXJ A;  2D7G A;  4DV5 M;  2ZAO A;  2KRK A;  2OPF A;  1HQY E;  3NBI A;  3T1H M;  3MK6 A;  4MH0 E;  2X8A A;  3FTE A;  2Z4R A;  2DVW B;  4X65 M;  1PJI A;  1KFV A;  5IZ7 D;  5F3W A;  5KO3 A;  1YUB A;  4JI2 M;  3KS4 A;  4JV5 M;  3FD9 A;  1J7K A;  1K3W A;  4XGI A;  2BJW A;  3JAM S;  5ITU A;  2I7N A;  8CAT A;  3GPX A;  4LJ7 A;  2DWL A;  3GQ5 A;  1Q3C A;  3FTD A;  4DUY M;  3A98 B;  5BPV A;  4LJ9 A;  1DGH B;  2KZS A;  3PXG A;  1HR0 M;  3KP1 E;  1QAM A;  2Y0T A;  5ITR A;  3UJN A;  1NY6 A;  3DOA A;  4L15 A;  3SMP A;  3U6L A;  2L09 A;  3KOX E;  4FWD A;  5ITT A;  4GKK M;  3KS8 A;  1OFI A;  4IBI A;  1L2D A;  1W5T A;  3J7B A;  4I4L A;  3KDS E;  3GQ3 A;  4B7H A;  3U61 A;  3DZD A;  2R62 A;  4JI3 M;  4MGK E;  3HJS A;  3TPZ A;  4IIW A;  1TH4 A;  4AI6 A;  1HNX M;  5JI3 E;  1MU5 A;  2QEN A;  4B3S M;  3L2A A;  4WW0 A;  1XC8 A;  4LRT A;  4M9Z A;  2RGH A;  4GHA A;  1R6B X;  4DV0 M;  3GPU A;  2UUB M;  4B3T M;  3VKH A;  3C58 A;  1HQC A;  1E32 A;  5DYG A;  2YQZ A;  3K1J A;  2XZU A;  5ITY A;  2R46 A;  4DV4 M;  4D81 A;  4DR4 M;  2ZAM A;  2CHV A;  3KP0 E;  1HNW M;  2QPA A;  2R45 A;  2L6O A;  1IBM M;  1XWI A;  1UM8 A;  1K82 A;  1Q39 A;  2QBY B;  4M0W A;  1NNJ A;  3FUW A;  2EO2 A;  4DR2 M;  3K8Z A;  1L2B A;  4NXN M;  3FUX A;  3KSX A;  4DR5 M;  3UGJ A;  3NWL A;  1GL6 A;  2EUC A;  4Z6Y A;  1R2Y A;  2DWM A;  4LF5 M;  1Z6T A;  2UXB M;  2RKO A;  4ZPX A;  4LF6 M;  2R65 A;  3QAU A;  2C99 A;  4PD2 A;  2DZO B;  1OFH A;  2I7P A;  3UK6 A;  3FYD A;  5IWA M;  2Y20 A;  4AG6 A;  3HKP A;  3TWL A;  5E26 A;  4IJE A;  1IY0 A;  1PM5 A;  1Q3B A;  1I4W A;  2P5T A;  1GVN A;  4RF1 A;  3WHL A;  1G59 A;  1X37 A;  1HT1 E;  1ZAE A;  1YSY A;  1IXR C;  4KOD A;  2Z4S A;  4LY6 A;  2ZM6 M;  1TDZ A;  1H6U A;  3U60 A;  1VDD A;  1JR3 A;  4I81 A;  2NQ8 C;  1D2N A;  2KA6 B;  4B3M M;  1KSF X;  2Z3X A;  5EP4 A;  5KPT A;  4GC5 A;  3VLF B;  3HU1 A;  4KHP M;  1SXJ D;  2FNA A;  3IG8 A;  4X64 M;  1J09 A;  3ZC7 B;  4LF9 M;  1DO0 A;  4NSO B;  4MM3 B;  5EXS A;  4DUZ M;  1PJJ A;  4P16 A;  1IBK M;  1TGU A;  1KYI A;  5BR8 M;  2BJV A;  3AOE C;  3WHK A;  3J2P B;  4DV2 M;  3GRU A;  1FNN A;  2M5Z A;  2X4A A;  4FVM A;  4IBB A;  2ZAN A;  4NOO B;  4DR1 M;  4AW4 A;  2F5N A;  2CV0 A;  4M0D A;  4IBC A;  4MGY E;  3W0L B;  2F5Q A;  2KW0 A;  2DZN B;  3SMS A;  3U6E A;  2C9C A;  1HT2 E;  1Z5C A;  3LMM A;  2CHQ A;  3AKZ A;  1IN7 A;  5KPR A;  4QHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...