2EV6A

Bacillus subtilis manganese transport regulator (mntr) bound to zinc
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
136
structure length
136
Chain Sequence
PSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 53
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ev6A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2ev6A02
2V9VA 5L3CA 3ABTA 1REPC 3ZMDA 3WTSC 4EJOA 2GA1A 1BI1A 1FSEA 5JVTA 4MQVA 4LG0A 1U8RA 3PQJA 3EUHA 2CGPA 1IXRC 3F6VA 2PJPA 2QENA 4M9XA 2TDXA 1Z6RA 2STTA 2MA3A 2OZUA 5JR3A 3FHZA 5F1RA 4OU0A 3GX4X 1F1ZA 2DQLA 3WTZA 1U2WA 4RB0A 4ETSA 3J80K 5HS9A 4DQ2A 4D0PA 1ZH5A 4U0WA 3WGIA 4I98B 1BOAA 3IL2A 1TNTA 1YS7A 1G3SA 2PMHA 2IA1A 3RPUA 2M1BA 1J59A 5K5QA 2K02A 3GFMA 3ERED 3WTTC 1WWXA 1QGPA 5FFXA 1UHMA 2HQRA 4RGRA 2ZFWA 1TW2A 5ED4A 3EYYA 1KQ8A 5ERIA 4FX4A 1KA8A 3ZQ7A 5FFZA 5FD5A 2QZ8A 3NRVA 1QBJA 1OYWA 2D1HA 5HDNA 4IRHA 5HS8A 4L9TA 4LG0B 3M8FA 5CVVA 2W85A 4N9HA 1R36A 2O0YA 1T39A 4Z2YA 1O3TA 4QLCU 3D0SA 2NYXA 3JAMZ 3HTSB 5FB2A 4TV7A 5CVRA 1DUXC 1XB4A 2XGXA 3FX3A 2RVCA 3HHGA 4MEYF 4RGXA 2AS5F 2DAOA 3I59A 3V8LA 1BI0A 2F5CA 2GA2A 4EM0B 5AONA 2DBBA 4LK0F 4I02A 4XRFA 2Z33A 4M9ZA 1ZRDA 2VT3A 5E20A 4KDPA 1YW7A 5AIPA 2X4HA 2ADUA 1G3YA 3DFGA 1IAWA 3CTAA 3Q9VA 3LAJA 1KU3A 2XUBA 3QPHA 2K4BA 3KFWX 1BIBA 1BI2A 2H09A 3WE2A 4OMYA 1XGOA 1TQIA 3KP5A 3ECHA 3AAFA 4HQEA 2MH9A 2RQPA 3TO7A 2WV0A 2PQ8A 3BDDA 2IA0A 1FYLA 2M87A 4KICA 1RIOH 4CYDA 5ICEA 2CQKA 2VBXA 4NQWA 2K27A 3SXYA 1Z9CA 4NB5A 5D8LB 5KVRA 4HX4A 3U9GA 3I59B 3T1BA 2IVMA 2FBIA 2DQRA 5H6QA 1B9NA 4KNYA 5DDGA 3LA7A 4WF2A 1PUEE 3IRRA 5HLGA 3BWGA 3GWZA 1DDNA 3DXJF 2IPQX 4GXOA 4GYIA 3IKVA 2OZ6A 4BXUA 4L5JA 2OU2A 4IHSA 1XGSA 3WTUC 5LEKA 3N97A 1F5TA 1TNSA 2BEOA 5HVQC 2W25A 5H6RA 3WTYC 1HSJA 2FMYA 3JSPA 4GCVA 1FC3A 1FBQA 4ESFA 2IP2A 3I4PA 4OIOF 1IRFA 3BOQA 2KIUA 3OV8A 3QPTA 4G7ZF 1PP7U 3JSOA 4O5VA 1RI7A 3FMSA 3SHFA 3MCZA 1MZBA 1FX7A 1BIAA 3VB2A 2HTSA 1MDMB 2V6CA 1JXSA 4BNCA 2OQGA 4OIRF 1ODDA 5DYMA 5LGUA 1TW3A 5D4RA 1IN7A 4Y15A 4ZYEA 3G3ZA 2VN2A 2P5VA 3B73A 3E5XA 2YSRA 2L02A 5HDGA 2IW5A 4ENJA 1QO0D 2VE8A 1RZ4A 3ULQB 2EFOA 2V1DA 4EGYA 4G8XA 1A04A 3KZZA 2CFXA 4FX0A 2VOOA 4L0ZB 3KLOA 4OOIA 2GAUA 3TOAA 3TOBA 3O3KA 2XAGA 1K78A 1R7JA 3ZMVA 4OIQF 2A61A 3WODF 1UCRA 5D5UB 4EQQA 2RNJA 3RDIA 1XGNA 2CO5A 2NNYA 1ZG3A 3ZMSA 3HSRA 2HKXA 4ZYHA 1LVAA 4U7BA 4PDKA 3Q5FA 5K5RA 1XMKA 4HF2A 2P8TA 2P7VB 4LD5A 3ZN0A 1HKQA 4ENKA 4I09A 4EJTA 3F23A 1SFXA 1J2XA 1OMIA 5CJ9A 2K4JA 3T0YA 5DUKA 3GXOA 5E1XA 2Y75A 1EH8A 2LSOA 1T6SA 3QU3A 4G6DA 4F7ZA 1TQMA 4BHPA 4CICA 1MD0A 4P96A 3HSEA 4P5OA 1W5TA 4KIBA 2JTVA 1K78B 3V7SA 4Q5SF 4L9JA 4RB1A 1ZG1A 2FQ3A 4HF0A 5LRRA 2JPBA 5IT3A 4E70A 2L4AA 1GVJA 3SZTA 4QWQA 5DD4A 3H3ZA 5HS7A 2YX4A 3K1NA 2KJCA 5FGMA 4A5MA 2E1NA 2DPDA 5CYVA 4XLNF 3J81K 4HYEA 1DP7P 3I71A 1J0RA 3IKTA 2HQNA 1J9IA 2H6CA 3F8CA 1SD6A 3FMRA 4M74A 5LLQA 3KETA 1R23A 3MAJA 4AIKA 2CSOA 5LRSA 1S3JA 4LGWA 3W6KB 4O3MA 3BROA 1P92A 3RI4A 2WWYA 2A3SA 1YQAA 3TGNA 4UV8A 4EV0A 4M6XA 4ZH4F 2BBYA 1XGMA 2FBHA 2HWVA 3M7GA 1ZLKA 3C7JA 3R61A 1TTYA 1BC8C 4LB5A 4ESBA 4IPAA 4A0ZA 3BPXA 5DEQA 2KKOA 3GLXA 4OIPF 3FM5A 1FPQA 1UB9A 3DF8A 4HOBA 4UVAA 1ON2A 2PBIA 3F3XA 1FP1D 1ONVA 3E3VA 4MGRA 3K69A 1R1UA 1ZREA 4IRGA 5FLXK 4BYYA 1L3LA 4RGSA 1SD7A 2DI3A 3E6BA 4Y13A 2VONA 3GO5A 2XV4S 4YIIA 2XKOA 3CUQB 3HRTA 2O8XA 3KZYA 5D4SA 3TKYA 3P9CA 2PI0A 3VOEA 3KP2A 3S2WA 4UHTA 1DPUA 1FYMA 5LBQA 2DT5A 2Z9OA 3KP4A 1TLHB 3E97A 4MTDA 1XSDA 4BHBA 3U2RA 4Q48A 2NAZA 3K9TA 2IA2A 5K1YA 1XCVA 5CVJA 1JHFA 3I0TA 4UNOA 1T0FA 3FM3A 4JBAA 3WGHA 1W7PD 1DPRA 1KU2A 1T38A 1BBYA 2FNAA 3IWZA 2QQAA 2IRFG 1HW1A 1W5SA 3GZ5A 5D5XB 2LF8A 1XSVA 2DK5A 1JHHA 3QP5A 1U5TA 4RS8A 3TDUC 1HKTA 1XDUA 5DCFA 2O6GE 4AIHA 4RB2C 3J7AO 1SFEA 3WGGA 2JRTA 4WK8F 2ZMEB 1ZGJA 2QYOA 4R79A 4K2EA 2WTEA 3V8JA 4KN7X 1KYWA 2L54A 4KMUX 3BJOA 2DFIA 2V1XA 1BJAA 3DQVC 2ZJ2A 2Q2EA 4A12A 3DKWA 4LFUA 6PAXA 1FBUA 4EGZA 2VT2A 1O57A 3OOPA 3MZYA 3REOA 3CDHA 5IT9Z 2QQ9A 4ZZDA 2FU4A 4G7HF 3I58A 1HBXG 2L3DA 4M73A 1YIOA 5J8CA 3FF5A 3QU6A 1OYYA 3FMQA 4PGHA 1SD4A 4EVIA 3M9AA 5K5OA 4FHTA 3P7NA 3F8BA 4M6YA 2GWRA 2FOKA 1ZYRF 4KA4A 3QOPA 5H20A 2W84A 2C6YA 4LLLA 3BZ6A 1U5TB 1K7AA 3RTRA 1R1TA 2MBFA 3Q9SA 4IVNA 2Z3YA 1YO5C 2NNNA 2VODA 2UXXA 5HLHA 3COAC 2IJLA 2RC4A 4G94A 4WXCA 2PG4A 5JI6A 1XD7A 2D1VA 1KQ9A 1O7FA 4H0EA 3KP7A 4A2UA 1ZARA 2EB7A 3CUOA 3H3UA 5BQTA 4PZJA 3CO7C 1MDMA 4ENMA 3RKWA 1KU9A 4WXHA 1PDNC 5F6FA 1Z7UA 2KJBA 4GYGA 4CHUA 3GUDA 3CO6C 2A68F 4LMYA 1IF1A 2BV6A 5ILVA 1I6XA 5D5WB 3HIFA 5IT9K 4L9NA 1O3QA 4NHJA 1SAXA 3VEPA 1K79A 5CVUA 2EFQA 3JAMK 2H6BA 2WC2A 5BOXA 2JPCA 3TO6A 2AXLA 4A5NA 1G3WA 2O3FA 1C0WA 2VC0A 2R3SA 3C18A 3JW4A 4XBFA 4A6EA 2JT1A 3C3WA 1W4MA 2XIGA 1J7KA 3CUQC 2GZWA 1CGPA 2FE3A 5E18F 2F5FA 2F2EA 1H0MA 3IHUA 4I0AA 4RAYA 4CZZA 2XAHA 2DLLA 2QQBA 4WX9A 3GZ6A 1ZAOA 2STWA 4KUMA 5LEJA 1TBXA 1LDDA 1LEBA 1STZA 5EEGA 5D6EA 4YFXF 3D5LA 3M1EA 2VE9A 3FZVA 3E6CC 4HF1A 1MKMA 1BM9A 4WXDA 1XN7A 3WE3A 4KT5C 3DEUA 4EM2A 2OBPA 1SD5A 4XSZF 2QLZA 2XAFA 1O3SA 2FMLA 5LHIA 2DK8A 2X0LA 2W57A 3R6SA 2XASA 5ILUA 3I53A 3L09A 2HGCA 4KFCA 1R5GA 1YLFA 1CF7A 2HZTA 1S8NA 1EH7A 2ZNZA 2DU9A 1U3EM 4HX8A 4G7OF 2EK5A 1IXCA 2A6HF 4P55A 5DCMB 2HS5A 2W24A 1QZYA 4N0BA 3MEXA 2PLYA 3H92A 2OQRA 1ON1A 4ZZLA 5ICGA 4ENNA 1LDKB 5BPIA 3K1PA 2HEOA 3MWMA 4KYWA 2L4MA 1T2KA 3GF2A 5DUIA 4I01A 1IN4A 5A2QZ 3ZP5A 1P4AA 3RYPA 1RNLA 3FXRA 1Q1HA 2RKHA 3ZMTA 1QZZA 4A6DA 2RDPA 5EEHA 4XLPF 3F21A 2V79A 2RN7A 1V4RA 2ESNA 3RKYA 1P2FA 4MQ9F 4IHTA 4CGZA 3KP3A 2FEZA 1FLIA 4Q47A 2GXGA 1XCBA 3KE2A 3ZMZA 4U0VA 2VBWA 4YIFA 4EJVA 1U5TC 4DNCA 4MEXF 4AD9A 5BMZA 1CF7B 2VC1A 3IWFA 2PN6A 1R5HA 5TRDA 1XMAA 1X3UA 1IN8A 2P7CB 3WTWC 4CXFA 3WTVC 3NQOA 1FP2A 2PFBA 4AWXB 4BQAA 2FXAA 1YYVA 2DPUA 1YG2A 4S04A 3F22A 5F64A 2FNPA 4JK1X 3K1MA 3PFIA 1OR7A 4LLGF 5DV5A 3G73A 4KMFA 2J5OA 1HKSA 3MFKA 3L9FA 3CUQA 4A0XA 2O03A 2PEXA 1OPCA 4U0YA 3L2CA 2MC3A 5HLIA 2Z99A 3JTHA 2ISZA 2EV5A 3J80Z 2ELHA 3F6OA 2QBYA 1H9GA 2XKPA 2J5PA 3IC7A 2Q8KA 1Z1DA 4L0YB 4ZYDA 2HYGD 1AOYA 1FT9A 4UUVA 4HBLA 5ICCA 1LEAA 2XHKA 2ISYA 2ZNYA 4L9VA 3HYIA 2COMA 2ESHA 4RGUA 3T8RA 5L3BA 3GVAA 2MLGA 2ZMEA 4G9YA 3PQKA 3F8FA 3P9KA 1JGSA 2LKPA 2D45A 1GXQA 1QPMA 3BPVA 1O7LA 1FY7A 2L01A 2M45A 2Z5UA 1IXSB 3L7WA 3LQRA 3WTXC 3LA3A 1YTYA 4FT8A 4HZFA 3CLOA 3K0LA 3VFZA 2XRNA 3GEZA 5BS6A 1UHWA 1D3YA 4ESJA 1I1GA 4HDVA 1F9NA 2ETHA 2Y48A 4PGGA 2GXBA 3SZPA 1NHAA 3VODA 4MHGA 2QBYB 1WSUA 5KK1A 2MD5A 4L5IA 4I0BA 2EFWA 3TDZC 2ZXJA 4HV5A 1TQPA 3E5QA 4HV6A 4YFNF 2HFHA 3BP8A 2ZCWA 1D8JA 3TQNA 4P9FA 4XSXF 4CO8A 2EA2A 1USSA 2Y0MA 3DV8A 2H94A 1KU7A 3BY6A 1B6AA 1KYZA 3FXUA 3RJPA 3EYIA 5E8GA 1E2XA 3V4GA 3NEUA 4U7DA 2Q0OA 3F72A 3DP7A 2HYFA 1AWCA 1BC7C 1WKMA 2YPRA 1EH6A 2DW4A 1PP8F 1MJAA 5E17F 1Z05A 5J6XA 3R0AA 1B9MA 4RB3C 3DPLC 1LNWA 2EWNA 3RYRA 5J8FA 1S7AA 1FSHA 3KEQA 1WI9A 4KN4X 4M72A 3R60A 4A0YA 3QRFF 5HOOA 1LQ1A 1FOKA 3ZN1A 2M30A 1QNTA 1YW8A 3I64A 5LGNA 2CYYA 2QWWA 1HW5A 2K7LA 2M5WA 3FXQA 1L0OC 3MQ0A 1ZRFA 1ZHFA 2CW0F 4B8XA 5E1ZB 2YX7A 3W6JB 1YFHA 2UWMA 2EV0A 4L18B 3BJ6A 3K2ZA 5L3FA 4M9SA 5D6FA 2YU3A 4WWCA 3MZHA 4P9UA 1OKRA 3WU0A 4KIFA 4HAMA 4KIGA 2G9WA 3ELKA 1ZN2A 2E7XA 2P6SA 2A69F 1YS6A 2OA4A 2D2WA 3E6DA 4OMZA 2RGVA 1IN5A 2EA4A 2FBKA 4RAZA 2YR2A 3HHHA 2GQQA 1JE8A 3R0JA 1RUNA 1IN6A 3C1DA 1P4XA 2JSCA 1LJ9A 2P5LC 3DPTA 3ZPLA 4Y17A 1P6RA 1BN5A 1B59A 3V7RA 2P6TA 2P4WA 1U6GA 3EQLF 1I1SA 1SFUA 4O6JA 1FYKA 5AIQA 2QUFA 1W7PA 2ZBKA 3LFKA 2EFPA 2A07F 1LDJA 1ZLJA 3O2PE 1S29A 4AVPA 1XDSA 2FSWA 1HQCA 2K86A 5LGTA 1MGTA 1UFMA 1H9TA 5DCMA 3HSFA 1FBSA 3BJAA 1S6LA 3TO9A 3LAPA 3V7CA 1FZPB 2H27A 4BAYA 3LA2A 1ZG5A 1ZRCA 2EFNA 1USTA 4LB6B 1MJ9A 1HW2A 3SQNA 1SMYF 2A6EF 1P4WA 1S7OA 3GFJA 1FNNA 2UZKA 3LWFA 1IW7F 2XAJA 3V8KA 1O3RA 3HRMA 3HUGA 3GFLA 5ICFA 3I5UA 2VBZA 3P9IA 3U1DA 1J75A 3N4MA 2M8EA 4B09A 2BGCA 1ULYA 5E8IA 1I5ZA 5JHUA 4LLNA 4S05A 4HX7A 5L3EA 1IZ1A 5CLSA 1R00A 4LJZF 2XVCA 4JQFA 2EV6A 2DTRA 1W7PB 2ZKZA 3RIRA 1HSTA 4UVCA 2CWEA 2QVOA 1IUYA 2HKOA 2JZYA 1KQ0A 1I27A 1XSXA 2OAZA 3F8NA 2EJRA 3ISPA 3GW2A 4PCQA 2F5DA 5HDKA 2QM3A 3J81Z 4GO1A 2BYVE 2KRFA 4M71A 3HRSA 1KGSA 3QAHA 3RPQA 2F5EA 3RKXA 2KIFA 4ON0A 1R22A 1G6NA 1B4AA 4ASNA 3CJNA 4N9IA 1Y0UA 1V3FA 5FO5A 3IRQA 4YFKF 3GFIA 5BPDA 3T5XA 2PMUA 1R1VA 4UXNA 3KP6A 3L00A 1K6OA 3E6MA 1Z6TA 3EDPA 1RUOA 1HXDA 4I7HA 3FWEA 1MJBA 2OD5A 2ACJA 3ROUA 2HOEA 1D8KA 3ABUA 3EETA 2HTJA 1VTNC 3M8EA 4I2OA 2UXNA 3KEOA 1IRGA 2R7FA 1BI3A 1G3TA 2XAQA 2DO7A 5ILSA 1ZGAA 4CDGA 1OYIA 4UVBA 3HOTA 4YG2F 2FRHA 2VXZA 5TJJA 2LNBA 3O6BB 3KLNA 3E5UA 1WQ2A 5E1WA 2B0LA 1F4KA 5D5VB 5FLXZ 4EM1A 4MNUA 4HQMA 1T98A 1Z91A 2V1UA 4ZYGA 2LDUA 1QQIA 1SMTA 4Q4ZF 5L3DA 5D8KB 2P5KA 2XROA 4R8HA 3B02A 3LSTA 2HDCA 2IT0A 3R4KA 1D5VA 1E17A 3JTGA 5CVIA 2ZO4A 1GHCA 5DD8A 2CG4A 1WRJA 5FD6A 5LHHA 4IJAA 2VBYA 2A5YB 4GGGA 3F8MA 1G4DA 3QP6A 3ECOA 4OINF 3SFZA 3GYHX 1B1BA 2E7WA 2HR3A 4MTEA 4R1HA 4HW0A 4IXAA 4HA8A 1EV7A 2GIVA 2E1CA 5A2QK 2KIMA 2MH2A 3HTUA 3T8TA 4AIJA 4WCGA 4UV9A 4BH9A 5JFRA 3LQQA 1YW9A 3HOSA 5LHGA 2FA5A 2G7HA 1R58A 4HDUA 1U78A 2MLKA 2NRAC 3ML6A 4IRIA 3WU1B 2O61A 3ZMUA 2NS0A 2LF7A 2G7UA 1GXPA 4HLYA 5L3GA 4IF4A 2R7DA 4EMSA 4BHCA 3HRUA 4HLXA 4LK1F 1FWZA 4EJWA 3KCCA 2RV8A 4EJUA 4G6QA 2FF4A 1J5YA 1LB2A 3WG9A 2VOPA 4U88A 2BE5F 3I54A
chains in the Genus database with same CATH superfamily
2V9VA 5L3CA 3ABTA 1REPC 2KRCA 3ZMDA 3WTSC 4EJOA 2GA1A 4NNJA 2VUMJ 2OTJI 1BI1A 1FSEA 2MG4A 4OWRB 5B5EC 5JVTA 4MQVA 4DYCA 3VWBA 3H3VK 1TWHJ 3WHBA 4LG0A 3SEZA 1U8RA 2AQEA 3PQJA 1DP3A 2VPRA 3EUHA 2CGPA 1IXRC 3F6VA 4ZJZA 2W7NA 2QENA 4M9XA 2PJPA 3L2VA 3SJMA 2TDXA 1D5YA 1Z6RA 1ZQ3P 3KPHA 1HDPA 2STTA 2MA3A 5F08A 4BXXJ 4XKWA 1WPKA 2OZUA 4II2A 5JR3A 3FHZA 1WJFA 4IHYA 5F1RA 4OU0A 4GDFA 3GX4X 1F1ZA 2DQLA 2OJED 3WTZA 4U87A 3TL4X 2LFBA 1LFPA 1U2WA 1Z77A 2R92J 4RB0A 4ETSA 2CV1A 2IXSA 3I3LA 3J80K 3DBHB 5HS9A 4DQ2A 5FROA 2HOSA 4D0PA 1ZH5A 3BR3A 2HXOA 4FETA 4U0WA 3WGIA 4I98B 3KYCB 5JHFA 2QF7A 4B3AA 1BOAA 3IL2A 1TNTA 1V54H 1YS7A 2BY1A 1G3SA 3S1NJ 2M35A 2PMHA 3H5NA 1A5JA 4BXFA 2IA1A 3RPUA 2H8RA 2M1BA 3IH2A 2WAFA 3FKJA 2DDBA 1J59A 1ZR2A 5K5QA 2K02A 2DA5A 5LFAA 3GFMA 3DBLB 4BDZA 2R7SA 3ERED 3MVPA 3WTTC 1WWXA 1QGPA 2DA3A 5FFXA 3CMEI 3CJTB 2XF7A 2V7FA 4CCOA 1UHMA 2HQRA 3FXMA 2M8GX 4RGRA 2ZFWA 1TW2A 3OYNA 3I4NJ 5J3LA 5ED4A 3AKZA 3EYYA 1KQ8A 5ERIA 4FX4A 1UG2A 4CCKA 1KA8A 1UHSA 3ZQ7A 5FFZA 5FD5A 2QZ8A 3NRVA 4FCYA 1A36A 2ELKA 4J00A 1OYWA 2KRHA 3D5SC 1QBJA 2W4SA 2D1HA 5HDNA 4IRHA 5HS8A 4L9TA 4LG0B 3M8FA 5CVVA 1MMGA 2W85A 4N9HA 4IHWA 1R36A 2L0KA 2O0YA 1T39A 1EKEA 2OV7A 4Z2YA 2ME0A 2WBMA 3LOCA 5J1RA 5EG0B 3JRDA 1O3TA 4QLCU 1TWAJ 3D0SA 3OYLA 3G6EI 4BBRJ 1FTTA 2L5QA 2NYXA 1Y56A 5B1AH 3Q0VA 3JAMZ 3HTSB 5FB2A 4TV7A 5CVRA 1DUXC 1XB4A 2XGXA 3FX3A 3ASOH 4D7MA 2RVCA 3HHGA 4MEYF 1V5FA 4RGXA 2AS5F 1BR4A 2DAOA 3I59A 3V8LA 2D5VA 4DBRA 1IDYA 3CCVI 4YEJA 1BI0A 2F5CA 2GA2A 2CQXA 4EM0B 1JTXA 2DBBA 5AONA 4M3EA 3OR1C 2A5WA 5F04A 2HVQA 4LK0F 1JTYA 4I02A 3S14J 1W0UA 4XRFA 2Z33A 4XN3A 4M9ZA 1ZRDA 2VT3A 5E20A 1KZHA 4KDPA 4PJMA 3IAM2 1YW7A 1A6IA 5B66C 1RQ6A 3OYHA 1JKOC 3K10A 5AIPA 2X4HA 3GTJJ 1AKHA 2ADUA 2W82A 2ECBA 1G3YA 4ZYAA 1UELB 4I99C 3DFGA 1SVMA 1SC7A 2FUG2 3PUFA 2BOLA 3ESWB 1JKPC 1IAWA 3CTAA 3Q9VA 2GIZA 3LAJA 1KU3A 3W6VA 1V55H 3PO2J 1DU6A 1VQMI 4A3LJ 4XQFA 2XUBA 3QPHA 1VQ4I 2K4BA 2IBDA 2WA0A 4PJNA 3DTIA 4OAYA 3KZIC 2R5ZA 3KFWX 2A05A 1IC8A 5KNLA 1BIBA 1RR7A 2QGUA 1BI2A 4JX6A 1FIAA 2H09A 4BJ6C 1ITYA 2K5CA 3WE2A 4OMYA 2E71A 1XGOA 3LSPA 2QSHX 1TQIA 3KP5A 4BE0A 3ECHA 2Y30A 5FKKA 2NXNB 3AAFA 2MH9A 2RQPA 3D5RC 3TO7A 5M3MJ 2WV0A 4HQEA 2PQ8A 3BDDA 4LOCA 1R4MB 2IA0A 5FLMJ 3K4CA 4E7SA 4DYQA 5GAEJ 1FYLA 2M87A 4KICA 1RIOH 2VKVA 3E7LA 4CYDA 1TT5B 5ICEA 2CQKA 2VBXA 4NQWA 2K27A 1AHDP 3SXYA 1Z9CA 1SFKA 4RA2A 2CUZA 2HYJA 2DCEA 2O5RA 2E2JJ 1LFBA 3ZCOA 4NB5A 2NOGA 2QKLB 5D8LB 3BR5A 5KVRA 1BR1A 4HX4A 3U9GA 2X6WA 3I59B 1WJCA 3T1BA 2IVMA 5EDNA 2FBIA 2DQRA 5H6QA 1B9NA 4KNYA 4M3BA 2GXAA 5DDGA 3LA7A 4WF2A 3QYEA 3LL7A 1PUEE 4Y33A 5HLGA 3IRRA 3BWGA 3GWZA 1YJ9I 2QCOA 3LMMA 1DDNA 2R7XA 1XTAA 2IGNA 3DXJF 2ME6A 1X1CA 2IPQX 4GXOA 4GYIA 4BBSJ 4BQQA 3LSMA 3IKVA 2OZ6A 4BXUA 2Z16A 2GOMA 4L5JA 2OU2A 4IHSA 1XGSA 2MD0A 2DJNA 3WTUC 9ANTA 5J1YA 5LEKA 1NH3A 2X9DA 5EF6A 4XORA 3N97A 4D7NA 1F5TA 2MFZA 3JRAA 1TNSA 5FKNA 1VQKI 4IKFA 2BEOA 5HVQC 3MKZA 2W25A 5H6RA 3WTYC 1A35A 1HSJA 2FMYA 3JSPA 3HL2A 2E1OA 2LVSA 2R7OA 4GCVA 3SDBA 3S3OA 5FRMA 1FC3A 1FBQA 4ESFA 1N78A 2IP2A 3I4PA 2M0CA 4OIOF 1IRFA 3BOQA 2KIUA 3OV8A 5IP6A 3QPTA 4G7ZF 3M07A 1PP7U 4MLOA 3JSOA 2FOWA 4O5VA 2R5ZB 1RI7A 4B48A 2BVMA 1FMVA 3OYGA 3FMSA 3SHFA 3MCZA 1MZBA 1FX7A 1E0EA 2VXDA 1BIAA 3VB2A 2HTSA 4BU2A 2V6CA 1MDMB 1JXSA 4ANJA 4BNCA 3H9QA 2OQGA 4OIRF 1ODDA 5DYMA 5LGUA 2JA5J 1TW3A 5D4RA 3AG4H 4A3BJ 1IN7A 4Y15A 4ZYEA 3G3ZA 2KIQA 2MGQA 4HNUA 1W5CC 1G59A 2VN2A 2QA4I 2P5VA 4BE2A 2Y0SN 2IS2A 3B73A 2K9LA 3E5XA 2YSRA 2L02A 3W2WA 1RRJA 5HDGA 2IW5A 4ENJA 1QO0D 2VE8A 4RAGA 2KZGA 2JJ7A 1RZ4A 3ULQB 2EFOA 2FD5A 2V1DA 4EGYA 4G8XA 1A04A 3KZZA 2CFXA 3J80R 4FX0A 3BTIA 3KEYA 4L0ZB 2L9NA 2VOOA 3KLOA 4OOIA 4XOTA 2GAUA 3TOAA 3TOBA 1NG7A 3O3KA 3MMYB 2XAGA 2TCTA 3BG9A 1K78A 3W2AA 2DDAA 2XPUA 1R7JA 3TP0A 3ZMVA 4OIQF 4UUSA 2XGCA 2A61A 3WODF 1UCRA 5D5UB 3ZQIA 4EQQA 2VL8A 4IX7A 2RNJA 3RDIA 1XGNA 2CO5A 2OUMA 5F0CA 2NNYA 2X1CA 1ZG3A 3Q3SA 3ZMSA 4RBOA 4A3JJ 3PUBA 4Y4RA 3HSRA 1SFOJ 2HKXA 4ZYHA 1LVAA 2K9QA 2JN6A 1QHGA 1YE9A 2VASA 3S3NA 4XKVA 2HU9A 1YJWI 1K61A 4X0GA 2LY9A 4PDKA 3WHCA 4U7BA 2V6EA 1OCCH 3Q5FA 2K9MA 4EATA 5K5RA 3K70D 1XMKA 4HF2A 3ZGKA 5IPAA 2P8TA 1Y6IA 2P7VB 2XPVA 3A4CA 4LD5A 4XRSG 5IP9J 2XC7A 2CH0A 1P9QC 1VI0A 2COBA 5E79C 3ZN0A 1X19A 1DU0A 1HKQA 1FOYA 4ENKA 3EUHC 4I09A 5E3NA 4EJTA 3F23A 1SFXA 1J2XA 2CJJA 1OCPA 1OMIA 5IYCJ 1X1AA 5KCMA 5CJ9A 3HEFA 2LY1A 1OQYA 1PVEA 2K4JA 3T0YA 3DCFA 3C2BA 4F3QA 1T0FC 5DUKA 2V26A 4UB6C 4B44A 1ETWA 3GXOA 4C9YA 1YRNA 1QVTA 2JMWA 2GBYA 5E1XA 1T95A 1X1DA 3JCUC 3HDDA 1VF9A 4BUPA 1R9TJ 2Y75A 2W48A 1EH8A 3GMEA 4PFPA 2LSOA 1T6SA 3QU3A 4G6DA 5CQEA 1TQMA 4F7ZA 2OCEA 4BHPA 3W3CA 4BQOA 4CICA 1N75A 1MD0A 4P96A 2P0TA 3S1MJ 1VQPI 3HSEA 4P5OA 1W5TA 2EZLA 2M34A 2W1OA 4KIBA 4IZZA 2E1MB 2M9HA 2JTVA 1K78B 1IDZA 1B8IA 3BCAA 1ORKA 3CC7I 3S17J 3V7SA 4Q5SF 4L9JA 2XPWA 4RB1A 1WHUA 2HXIA 4XK4A 1ZG1A 1FJLA 2FQ3A 4HF0A 4PK4A 2K85A 2CV2A 1UZCA 5LRRA 2JPBA 5IT3A 5KAIC 3CCYA 2QEXI 1JUPA 4E70A 3HM5A 2L4AA 1GVJA 3SZTA 3OYKA 3AG2H 4QWQA 5DD4A 5IYBJ 3H3ZA 5HS7A 1BW5A 1Z3YA 2YX4A 2H1LA 3K1NA 2KJCA 5FGMA 1WJ5A 1JT0A 4A5MA 2E1NA 2DPDA 4HRIA 5CYVA 4XLNF 2L2OA 1TC3C 3J81K 4HYEA 1DP7P 3I71A 5IY5H 2E36A 1J0RA 2EIKH 2AQFA 3OYEA 3IKTA 2HQNA 2VQGA 1J9IA 4ABZA 2H6CA 2EBIA 3F8CA 3S15J 1SD6A 3FMRA 2JVHA 3DEEA 4M74A 2DA2A 5LLQA 3KETA 1R23A 3GTQJ 3MAJA 4AIKA 3VYTB 2NVQJ 5EGOA 2Y0SA 2F5VA 1T33A 4FE4A 2CSOA 3ABLH 2X6XA 5LRSA 1VNDA 1S3JA 3IH3A 4LGWA 2WAEA 3W6KB 3OYFA 4O3MA 3BC8A 3BROA 4JOMA 1YRNB 3W2VA 4ZDPA 1P92A 2N8GA 2DMNA 3RI4A 1R49A 3CQZJ 1ERDA 2WWYA 2A3SA 1IO2A 1YQAA 4RM3A 3TGNA 3RKQA 1OCOH 4UV8A 2F4OB 2R7QA 4EV0A 4M6XA 2Z2SB 4ZH4F 2BBYA 1XGMA 2FBHA 2HWVA 3HGYA 4E7ZA 3M7GA 3FXJA 2YS9A 2AHQA 1MNEA 3JRHA 2DTZA 1ZLKA 3V42A 3C7JA 5M5WJ 2OPTA 3R61A 1TTYA 2DFEA 1BC8C 1B8IB 2KPMA 4LB5A 4ESBA 3DKXA 4IPAA 4A0ZA 1MBEA 3BPXA 4S0HB 5HLTA 5DEQA 2V9PA 2KKOA 3DPUA 3GLXA 3OSFA 1IRXA 3RSNA 4OIPF 3FM5A 3OL3A 1VQ8I 1FPQA 1UB9A 3DF8A 3A01A 4XN0A 4HOBA 4UVAA 3PL8A 1XX5A 3FBNB 1ON2A 2PBIA 3F3XA 4NC6A 3I56I 1JJ6C 1BJZA 1FP1D 4I76A 1ONVA 2ICWG 4BEHB 3E3VA 4MGRA 3CDIA 3K69A 3JRGA 1R1UA 5K7FA 1FTZA 3C2GA 1JT6A 5IOYA 4BS9A 4XR6A 1VQNI 4XM3A 4C2UA 1ZREA 4IRGA 5FLXK 4BYYA 1Y1VJ 1L3LA 2CW7A 5F0HA 4RGSA 4HSTA 2VKDA 1SD7A 2DI3A 3E6BA 4Y13A 4BKXA 2VONA 3GO5A 2XV4S 4YIIA 2XKOA 3CUQB 3HRTA 2O8XA 2R7TA 3KZYA 5D4SA 3TKYA 3P9CA 3HOVJ 4IEJA 4X1EA 2PI0A 3VOEA 2BW3A 3KP2A 3S2WA 4UHTA 1DPUA 1PUFA 1FYMA 5LBQA 2MYSA 1NK2P 2MUNA 3G1LA 2DT5A 5EGOB 2Z9OA 3KP4A 1TLHB 3PNYA 4IOCF 2NOJB 3E97A 4MTDA 5EG0A 3OS1A 1FOWA 1XSDA 4BHBA 1X1PA 3U2RA 2VB6A 4Q48A 4DGWB 2NAZA 3BG6A 3K9TA 2IA2A 3JRCA 5K1YA 4LG3A 3DTKA 3CMAI 3QODA 3AG3H 1HA8A 1XCVA 1H88C 1WZ2A 2R7ZJ 5CVJA 1JHFA 3GZNB 3K4LA 3I0TA 3B6AA 4UNOA 5HNHA 1T0FA 2EQRA 2KL4A 3FM3A 4JBAA 2W00A 1JKRC 3WGHA 1W7PD 5E3OA 1DPRA 1KU2A 4XKBA 3BTCA 2CQNA 2KMUA 4PSWA 1T38A 1BBYA 2FNAA 3K4MA 3IWZA 2QQAA 2IRFG 3CDLA 1HW1A 1W5SA 2VQCA 3GZ5A 3I4MJ 2KP6A 3LSKA 5D5XB 2LF8A 5J4VA 4B47A 3AFHA 3G1OA 1XSVA 2DK5A 1JHHA 3QP5A 1U5TA 4RS8A 2MZ4A 3TDUC 1YOVB 5K7ZA 1HKTA 4X6AJ 2DA4A 1XDUA 4HEA2 5DCFA 2O6GE 4AIHA 5GAHJ 4RB2C 1SFEA 3J7AO 3WGGA 4YIRX 2JRTA 4WK8F 2ZMEB 1ZGJA 2R7UA 2IGOA 4L5EA 3A01B 2QYOA 4R79A 4K2EA 2WTEA 3TEDA 4AU7A 3V8JA 3K2AA 2M2EA 2XAUA 4KN7X 2I8DA 3QOEA 1KYWA 2L54A 4KMUX 3L2UA 4FE7A 3BJOA 2DFIA 1D1AA 2DJIA 2V1XA 3UNGC 4CYCB 1GDTA 1BJAA 1OISA 3CCSI 1QVUA 3DQVC 2ZJ2A 4CCLA 3CCRI 2Q2EA 4XOPA 3DKWA 4A12A 4LFUA 2KFDA 4D9JA 6PAXA 1FBUA 4EGZA 3CC2I 1HF0A 2R7VA 2X98A 4XRSA 2VT2A 4J19A 1O57A 3BQZA 3OOPA 3MZYA 3REOA 4RLQA 2DMUA 2JA7J 3S16J 3CDHA 2LG4A 1T56A 3VSLA 5IT9Z 3CD6I 2BW3B 2QQ9A 1PUFB 3NWSA 3CCQI 4A3GJ 4ZZDA 2FU4A 2BHZA 4G7HF 3I58A 1OFCX 1HBXG 2L3DA 4M73A 1YIOA 5J8CA 3A02A 3FF5A 3QU6A 5TISC 1OYYA 3FMQA 4PGHA 3HXLA 4DBQA 4H4KC 2JQ7A 4V19K 2E1MC 2DOEA 2Q1ZB 3A2KA 3OYBA 2R0QC 3OS2A 1SD4A 3S8PA 1TP4A 2EZHA 1WFXA 4IHXA 4EVIA 1QRYA 2BY0A 1JUMA 1HC8A 3M9AA 4FHTA 5K5OA 3P7NA 3F8BA 4M6YA 2GWRA 2FOKA 1JI8A 5GPAA 1ZYRF 4KA4A 2CUFA 1XPXA 4BL0B 1D1CA 4DYRA 3CCJI 1DGWY 3X2QH 1B72A 3QOPA 5E3LA 2BHYA 5H20A 4A3IJ 3VPRA 3JR9A 5GPCA 2W84A 1U0JA 2C6YA 4XONA 4LLLA 2IS4A 3BZ6A 1U5TB 1K7AA 4A3CJ 3RTRA 1R1TA 2MBFA 2IGMA 3Q9SA 4IVNA 2Z3YA 4ZDLA 1YO5C 2NNNA 1OCTC 2VODA 2UXXA 5HLHA 1GUUA 2E60A 3QPLA 1AA7A 3COAC 1WCMJ 2F6CA 2IJLA 2RC4A 4G94A 2LH9A 4BACA 4WXCA 2JUCA 2PG4A 2HI3A 4IQ4A 4RLFA 5KHDA 5JI6A 1XD7A 1X4PA 1ZK8A 3GTMJ 4XRMA 4DJAA 1RETA 3G71I 2D1VA 2DA6A 1KQ9A 1O7FA 3HGGA 1Z3XA 4H0EA 3J81R 3IP4B 5GAGJ 3M3YJ 3KP7A 4A2UA 2Q2EB 1ZARA 2EB7A 2EIMH 3CUOA 4MFEA 1ETKA 3HJEA 3U1KA 2WB1A 3H3UA 5BQTA 3OOUA 4E7KA 4PZJA 3CO7C 3O8GA 2O9LA 2LREA 4PJ0C 1MDMA 4ENMA 3RKWA 2MW8A 1KU9A 4WXHA 1PDNC 3GTPJ 5A2QR 2LD5A 4B43A 5F6FA 1Z7UA 2KJBA 2LTPA 4ZC3A 4GYGA 1BW6A 4CHUA 3GUDA 4HPQA 1YJNI 3BT9A 3CO6C 2A68F 3J7YJ 1M1EB 3TW7A 1LKXA 4LMYA 1IF1A 2EPFA 2H8WA 1FIPA 3OR2C 2BV6A 2V9KA 1R5ID 1I6XA 5ILVA 5D5WB 3HIFA 5IT9K 2ECCA 4L9NA 4M3DA 4B4CA 3OYDA 4HNVA 4RMNA 4C30A 1Y8RB 1O3QA 4FTHA 1K4SA 1JGGA 4NHJA 1N25A 3CJQB 1SAXA 2IAIA 1I39A 3VEPA 1B72B 1K79A 4PUSA 5CVUA 3VYUB 2L7FP 4BGDA 2EFQA 5B3SH 4XNFA 3JAMK 2H6BA 1VQ5I 3GTKJ 1EF4A 2WC2A 3PFYA 3DU5A 5BOXA 1OR7C 2JPCA 3TO6A 2XSJC 2CW8A 4DOZA 2AXLA 4A5NA 1G3WA 2O3FA 2F48A 1C0WA 2VC0A 1PYVA 3E0JB 3BZCA 2R3SA 3C18A 4NC8A 1J09A 3JW4A 4XBFA 4A6EA 4BJ5C 2JT1A 3C3WA 1VQLI 1W4MA 2NS7A 1R71A 2XIGA 2LRDA 1IJWC 1J7KA 3CUQC 2LKXA 1D0YA 1E3HA 2GZWA 4QSHA 1CGPA 2FE3A 5E18F 2F5FA 1JJ8C 1MMNA 2F2EA 1H0MA 3IHUA 2DN0A 4I0AA 4RAYA 1WGXA 3BTLA 4CZZA 2XAHA 4F91B 1W36C 2DLLA 2QQBA 4WX9A 3FISA 1XS9A 2HOTA 3GZ6A 3QWLA 2XF5A 1ZAOA 2STWA 4KUMA 4DZJA 4W97A 1GVDA 5LEJA 1ZTRA 1TBXA 2EINH 2JUGA 3HOXJ 1LDDA 2HVRA 3WG7H 4XLCA 4Y7NJ 1STZA 5EEGA 1LEBA 5D6EA 3TBIA 4YFXF 3D5LA 1BOBA 2TRTA 4F55A 1X2MA 1RC9A 3M1EA 4XLAA 2DOAA 3CCMI 2UUZA 3FZVA 2VE9A 3E6CC 2CUJA 4HF1A 3HOWJ 1MKMA 1BM9A 4WXDA 2HPMA 2L9VA 1XN7A 3WE3A 4A3DJ 4KT5C 4CCMA 1NTCA 3ABKH 3FBIB 3DEUA 4EM2A 3A1YA 2OBPA 4KITB 1G2HA 1DGRM 1SD5A 5FLVA 2WAQA 4XSZF 1YX5A 4E7LA 4BY7J 5EJCA 2QLZA 2XAFA 1O3SA 1VFCA 2FMLA 5LHIA 2DK8A 1GV2A 2LYCA 2W57A 2X0LA 2X51A 2GLOA 3KX2A 3R6SA 3QYBA 2XSDC 1P7IA 2FJ1A 3GLLA 2QSGX 2XASA 5ILUA 3I53A 4UUTA 3L09A 1Y8QB 2HGCA 4KFCA 1KONA 1R5GA 2CRGA 1YLFA 3HBLA 4KT6A 3ZQFA 4DW6A 3SEQA 1CF7A 2Y2ZA 2Y9ZA 2HZTA 4D5FA 2EH3A 2ZMEC 3AL0B 1S8NA 1EH7A 2ZNZA 2DU9A 3CC4I 3ONQA 4NUBA 2Y31A 1U3EM 1YITI 4HX8A 5GTHC 4JP0A 2EK5A 3S2DJ 1IXCA 4G7OF 4CZCA 4LITA 3MZ8A 1VQOI 2A6HF 5FJ8J 4P55A 3CP8A 5DCMB 3HPGA 3ZXSA 4C3HJ 2HS5A 2W24A 3S3MA 3FK7A 1FMWA 1QZYA 1MBKA 2HPIA 4N0BA 3MEXA 3OYAA 2PLYA 3H92A 3F0CA 2EZIA 4YELA 2OQRA 2IS1A 1ON1A 2MABA 4ZZLA 2ZJPF 1WJAA 2K9NA 4HG2A 5ICGA 4ENNA 2KISA 4AC0A 1LDKB 3HOUJ 5BPIA 3K1PA 1U9OA 2HEOA 2LMDA 3J7AY 1QA6A 3MWMA 4KYWA 3OSGA 4NC7A 5IYDJ 2L4MA 1T2KA 2K9SA 1Z21A 3GF2A 2LK2A 5DUIA 4I01A 2JWTA 2ZC2A 1IN4A 5A2QZ 3F9KA 3ZP5A 2ZJQF 1P4AA 3RYPA 1RNLA 3FXRA 2K3FA 2LC2A 1Q1HA 3IH4A 2JK3A 2JA2A 3H9JA 2RKHA 3HUGB 3ZMTA 1QZZA 4A6DA 2RDPA 3GCMA 2CV0A 5EEHA 4XLPF 2ZXIA 1OLTA 3F21A 2V79A 2M4GA 1V4RA 2F4MB 2RN7A 2ESNA 3RKYA 1P2FA 3GTLJ 1V5EA 4MQ9F 4EEFG 4IHTA 3BG7A 4CGZA 3KP3A 2FEZA 3H5RA 3ZOBA 3CCEI 1TWFJ 1FLIA 4Q47A 3K4KA 1WJEA 2OC6A 1GLNA 2GXGA 1XCBA 3KE2A 3CMMA 3ZMZA 3H0GJ 3M8JA 3M4OJ 1MW7A 4G12A 4U0VA 2VBWA 4YIFA 4EJVA 1U5TC 4DNCA 4MEXF 1BR2A 2KT0A 4MIMA 4AD9A 1OJLA 2V1NA 3L2QA 5BMZA 1CF7B 2VC1A 3VDXA 4A3MJ 3IWFA 2PN6A 1R5HA 5TRDA 1XMAA 1X3UA 1IN8A 2P7CB 1HOMA 4LIVA 3WTWC 4CXFA 1MMAA 3WTVC 3NQOA 1FP2A 4ZTJA 1TL8A 2PFBA 2E19A 4AWXB 3G4SI 4BQAA 1R6RA 3FKIJ 2FXAA 2VJIA 2VJJA 3H9GA 1NK3P 1YYVA 2DPUA 4RM2A 4QPOA 1MH4A 3RPUD 1S9HA 1YG2A 1LPQA 4S04A 1WI3A 2CS3A 1WVRA 4BEHA 3F22A 5F64A 2FNPA 4JK1X 3K1MA 4B1RA 3PFIA 1WJDA 1Z0XA 1OR7A 2DYSH 2R5YA 3PIPF 3RZDJ 2Z1DA 1SVLA 2LR8A 4LLGF 2AO9A 2JRMA 2M0MA 4E7JA 5DV5A 3G73A 4W1UA 4KMFA 4P1WA 3PSFA 5CKTA 2J5OA 1HKSA 3MFKA 3L9FA 3CUQA 4A0XA 1ETOA 3BLYA 4MO7A 3BZKA 3Q0WA 5CQGA 2X6YA 1YX3A 2O03A 3FHNA 2PEXA 3FK6A 4KISA 5DM6F 1OPCA 4U0YA 2E2HJ 1T8IA 2CUEA 3L2CA 2E35A 2ZB9A 2MC3A 2EILH 3CJRB 3HKZA 5HLIA 2Z99A 1QHHD 3DBRB 3JTHA 2ISZA 2EV5A 3FDYA 3J80Z 2ELHA 3F6OA 5LD2C 2R7RA 3ASNH 2QBYA 1H9GA 3BR2A 1JKQC 1Y1WJ 2XKPA 3MN2A 2LLKA 1EA3A 2J5PA 3IC7A 2Q8KA 2XDVA 3PM1A 1IGNA 5JLXA 1Z1DA 4IL6C 4N4NB 4L0YB 3BG5A 4ZYDA 4OAZA 1DQUA 2HYGD 1AOYA 1FT9A 1MH3A 4UUVA 4HBLA 4A3FJ 5ICCA 2DA7A 1Y0NA 1LUJB 1LEAA 2X1DA 2XHKA 2ISYA 2ZNYA 3PNVA 4L9VA 3HYIA 5DS9A 5C3EJ 2DOFA 2COMA 2ESHA 3B6CA 1SEUA 1QU3A 3BR6A 2ID6A 2V4JC 3SDGA 3OYJA 4RGUA 3T8RA 5L3BA 1IV8A 3GVAA 3PO3J 2MLGA 2WADA 1MBJA 2ZMEA 2ZXWH 2HVSA 5FRNA 1X3ZB 3I55I 4G9YA 3PQKA 4XMYA 1MSEC 2UV1A 3F8FA 4BY1J 4XLHA 3P9KA 1JGSA 2LKPA 2D45A 2CMPA 2R5YB 4CYCA 3ZQLA 1GXQA 1APLC 1ETYA 3HB9A 1X4OA 2AXTC 3BPVA 1QPMA 1O7LA 1EJ9A 2M45A 1FY7A 2FQ4A 2L01A 2Z5UA 2VKEA 1IXSB 3L7WA 3QYFA 3MKYB 3J7ZI 1O4XA 5J47A 3LSHA 3LQRA 3WTXC 3LA3A 3PSIA 1YTYA 2JA8J 3TP3A 2I10A 4FT8A 4HZFA 5KAFC 3DKYA 3CLOA 1AU7A 3K4JA 5HNFA 2E34A 3K0LA 3VFZA 4M3GA 2XRNA 3GEZA 3CMYA 5BS6A 1UHWA 2BY2A 3MKLA 4JYKA 1D3YA 1D0XA 4PFOA 1ZGWA 4A3KJ 4ESJA 1I1GA 4HDVA 1F9NA 2ETHA 2Y48A 1POGA 5F27A 1LE8B 2HDWA 2WB1N 2DMQA 4PGGA 4YRVA 3GBGA 3CLQA 2GXBA 5C44J 3SZPA 3OYMA 1NHAA 5H2FC 3VODA 1YI2I 4MHGA 2QBYB 3AL0C 3K6GA 1WSUA 5KK1A 3WU2C 2MD5A 4CUGA 2DT6A 4L5IA 2BXZA 2E5ZA 4I0BA 2EFWA 2IS6A 3BQYA 1W0TA 3TDZC 2LBFA 2LY2A 2ZXJA 4HV5A 1TQPA 3TMOA 3E5QA 2DYRH 4HV6A 2BY3A 4YFNF 2HFHA 3BP8A 3VYSB 3LSGA 1RKTA 4QIWN 1TWGJ 1F43A 1HDDC 2NVTJ 2ZCWA 1D8JA 3TQNA 4P9FA 2CU7A 3BR1A 2HZDA 4XSXF 2DODA 4CCNA 4CO8A 2VQLA 2EA2A 3G2BA 1USSA 3A0BC 2Y0MA 1H89C 3DV8A 1ZR4A 2H94A 1KU7A 1S72I 3BY6A 5DM7F 4UB8C 1B6AA 4JX5A 3H36A 4IQJA 1KYZA 3HZJA 3FXUA 4PJJA 3RJPA 3EYIA 5E8GA 1E2XA 4AYBA 3V4GA 3NEUA 4G6TB 4U7DA 2PMZA 1MSFC 3VSKA 2Q0OA 3F72A 3DP7A 1MBFA 1W1WE 2HYFA 5HODA 4F93B 3SFIA 3PJRA 3A52A 3A0HC 1AWCA 1H8AC 1N77A 1BC7C 1WKMA 2YPRA 1EH6A 1Z67A 2DW4A 1PP8F 1WH7A 2MC4A 1RKWA 2VPLA 1MJAA 4GFBA 5E17F 2QQ8A 3QQAA 1LFUP 2EIJH 3N05A 1Z05A 5J6XA 3R0AA 1B9MA 1Y39A 3A03A 4RB3C 3DPLC 1TT0A 1LNWA 2EWNA 3RYRA 5J8FA 1S7AA 2FX0A 2XGDA 1FSHA 3UKGA 3KEQA 2WY7Q 1WJBA 1WI9A 4KN4X 4IHVA 4M72A 4AUXA 3R60A 3I9V2 4A0YA 3QRFF 3UR3C 5HOOA 1LQ1A 1FOKA 3GTGJ 1ETXA 3ZN1A 2M30A 4F52A 1QNTA 1YW8A 4GRIA 3I64A 2NVUB 5LGNA 3OIOA 2CYYA 2JA6J 2QWWA 2DFHA 1ETQA 1HW5A 2LBFB 2WAQN 3OY9A 1E3OC 2K7LA 2M5WA 3FXQA 1L0OC 3MQ0A 5B1BH 4CA0A 1ZRFA 4D5CA 1BA5A 3ZR8X 2ZSIB 2DMPA 3MD2A 1I3QJ 1ZHFA 1S7EA 3L1PA 4KJZA 2CW0F 3K4BA 3U21A 4UY8I 4B8XA 1A31A 5E1ZB 2ZFUA 2QSFX 2YX7A 3H5AA 3W6JB 2QKMB 4F92B 5C4JJ 1YFHA 2UWMA 2EV0A 5GTIC 1XG1A 3DLLF 2DFFA 1PJRA 1SVOA 1VQ9I 3BJ6A 3FIWA 2CFOA 3K2ZA 5L3FA 4L18B 4M9SA 4M3FA 5D6FA 2Y69H 1ACIA 1P7JA 2YU3A 4WWCA 3EPZA 3OIQA 3MKWB 5TGTA 1SANA 1ZELA 2KQRA 3MZHA 2IEKA 4XICA 4P9UA 1OKRA 3LFUA 2DMTA 3WU0A 4KIFA 2K40A 1UMQA 4HAMA 4KIGA 4FASD 1T08B 2G9WA 4XIDA 3ELKA 3FXOA 3JRIA 1ZN2A 4A93J 1QZEA 1IG7A 2E7XA 2P6SA 2X48A 2A69F 1YS6A 2OA4A 2D2WA 3E6DA 4OMZA 4RAFA 2RGVA 1IN5A 2EA4A 2G0EA 3EUKL 2FBKA 3OS0A 2X6OA 4ZDOA 2IGKA 4RAZA 1ETVA 3AG1H 5F1JA 1Q1VA 2HQ5A 2YR2A 3HHHA 1X2NA 4E6KG 2GQQA 2LOOA 3RQIA 1JE8A 2NS8A 3R0JA 2A6TA 1RUNA 3H0DA 4BJTA 1IN6A 3C1DA 3EUAA 4QPQA 1TZLA 2OCCH 1P4XA 5EZGA 2JSCA 4CSWA 1LJ9A 1IUFA 2P5LC 2EZKA 3K4NA 3DPTA 1FOXA 4II3A 3ZPLA 4J01A 4Y17A 4AVZA 1P6RA 1X3WB 5EEAA 1FEXA 1BN5A 2XB0X 1B59A 3V7RA 2P6TA 2P4WA 1U6GA 3EQLF 1I1SA 1SFUA 4FQGA 3VYRB 4O6JA 1FYKA 3BTJA 2HDDA 5AIQA 2QUFA 2M3AA 4HNTA 3L2RA 1W7PA 1CQTA 2ZBKA 3LFKA 4XLFA 1RPWA 2EFPA 2A07F 2M7AA 2H1KA 1LDJA 4PSXA 1ZLJA 3O2PE 3ERMA 2GM4A 1S29A 4AVPA 1XDSA 2FSWA 3IAS2 1I50J 1HQCA 2K86A 3OWTA 5LGTA 1LVKA 1MGTA 2JVGA 2RQQA 1UFMA 1H9TA 4V2FA 5DCMA 3HSFA 3RQ4A 1FBSA 1R4NB 2OF7A 3BJAA 1S6LA 3DLAA 3TO9A 3FXKA 4N4OB 3LAPA 3V7CA 1FZPB 2H27A 4BAYA 1QPIA 2P81A 2MVTA 2BXYA 3LA2A 4Y52J 5C4XJ 1ZG5A 3ABMH 2R7WA 1U9NA 1ZRCA 4C2TA 2EFNA 1USTA 3BCBA 3KYDB 2K3PA 4LB6B 2KDOA 2KLOA 3H35A 3ZQQA 4A69C 1MJ9A 3ZRGA 3JREA 3K7AJ 1AKHB 1HW2A 3SQNA 4BE1A 1SMYF 3LSRA 5FLXR 2R4GA 2A6EF 4C3JJ 1P4WA 1S7OA 3GFJA 4QTRA 2WV1A 1VQ7I 2ZSHB 1FNNA 2UZKA 4E7IA 4E7HA 2PX9A 3HOYJ 3LWFA 1IW7F 2XAJA 2LP0A 3NAUA 2ID3A 5JVGF 4LIUA 3V8KA 1O3RA 3HRMA 3H1CA 3HUGA 3GFLA 1ZKGA 3C2HA 1W36D 5ICFA 5DTDA 3I5UA 3D1NI 3NARA 2VBZA 3P9IA 3U1DA 1TWCJ 3M1CA 1J75A 3N4MA 2M8EA 3BG3A 4B09A 2BGCA 4ITVA 1D1BA 1ULYA 5E8IA 2RNGA 4AM3A 3RZOJ 1YHQI 1XC5A 1I5ZA 5JHUA 2PJRA 4LLNA 4S05A 1A6QA 4XL9A 3HKZN 2I5UA 4HX7A 4A3EJ 5L3EA 1IZ1A 5CLSA 1X1BA 1MMSA 1R00A 4LJZF 3SZGA 2XVCA 4JQFA 2EV6A 4NQWB 1JUSA 2HOAA 2DTRA 1W7PB 2L7KA 2ZKZA 4DIQA 2BVLA 3RIRA 1HSTA 4UVCA 2CWEA 2QVOA 4PJLA 3IUOA 2KHMA 5M3FJ 1IUYA 2HKOA 2JZYA 1KQ0A 3ZQGA 4B3XA 1I27A 1K4TA 1Z7LA 3HPHA 3CZ6A 2ELJA 3P5JA 4D1QA 5GADJ 2X1EA 1XSXA 4AIDA 2OAZA 3F8NA 2KDZA 2EJRA 3ISPA 2VJ4A 3GW2A 2NVXJ 3J7AW 5F0FA 4PCQA 2F5DA 3K70C 2YU9J 5HDKA 2XRLA 2QM3A 3J81Z 2O7OA 4GO1A 2BYVE 1MNDA 2KRFA 4M71A 3HRSA 1KGSA 3QAHA 3RPQA 2F5EA 3RKXA 4BQNA 4NDLA 2LKSA 4XLEA 2M7BA 2KIFA 4ON0A 1R22A 5BNGA 1G6NA 1B4AA 4ASNA 3CJNA 2X85A 4N9IA 1Y0UA 2E2IJ 2OTLI 1V3FA 5FO5A 3IRQA 4YFKF 3GFIA 5BPDA 3T5XA 2PMUA 1R1VA 4UXNA 4BDYA 2L7MP 2R93J 3KP6A 3L00A 1K6OA 5K7HA 3L2WA 3KYLA 3S2HJ 1VZ0A 3E6MA 1Z6TA 3S32A 3SYTA 3EDPA 3HOZJ 4RDUA 3ZQCA 1HLVA 1RUOA 1HXDA 4I7HA 1MNMC 3FWEA 5FKLA 1MJBA 2OD5A 5CPRB 2ACJA 3ROUA 3OIPA 3S1RJ 2HOEA 1GT0C 1OCRH 5JLWA 1D8KA 3ABUA 1MBGA 5E3MA 1ENHA 3EETA 2HTJA 2P0WA 1XMXA 3M8EA 4M6VA 1VTNC 1RR8C 2PJRB 4I2OA 2UXNA 3KEOA 1IRGA 2R7FA 1BI3A 3CF2A 1G3TA 2XAQA 4V2GA 2DO7A 3CP2A 1RESA 5ILSA 1ZGAA 3OL4A 4CDGA 3E1SA 4XKCA 1OYIA 4FISA 1MBHA 4UVBA 2XB5A 5J40A 3HOTA 3PNTA 4YG2F 2FRHA 2VXZA 5TJJA 4NBQA 2LNBA 1BL0A 2VI6A 1SAUA 3O6BB 5FKMA 4CH7A 5J1UA 1VQ6I 3KLNA 3E5UA 1WQ2A 2F4IA 5E1WA 2B0LA 1F4KA 3S1QJ 2E5NA 2L9RA 1E3PA 4UUSB 5D5VB 5FLXZ 4EM1A 1HCRA 4MNUA 4ZTFA 5M5YJ 4HQMA 4IO9F 2VJ5A 3G1MA 1T98A 3CESA 2BZTA 1I6HJ 1Z91A 2V1UA 2B7EA 4ZYGA 2LDUA 2CQ7A 1QQIA 1SMTA 4Z6YA 4Q4ZF 2HNHA 2B9SA 2JSPA 3RCOA 5L3DA 2RREA 4HSRA 5D8KB 2HQAA 2P5KA 3NWTA 2XROA 4IOAF 4R8HA 3B02A 3O8HA 4DZPA 3LSTA 4AYBN 2WY8Q 5M5XJ 2HDCA 2IT0A 3DTEA 3R4KA 1D5VA 1E17A 3JTGA 5CVIA 3Q0UA 2PMZN 2ZO4A 5DD8A 1GHCA 2CG4A 1WRJA 3DWLE 5FD6A 5LHHA 4IJAA 4C3IJ 3FXLA 2VBYA 5IP7J 2O8KA 2A5YB 3HC7A 4GGGA 1WH5A 3F8MA 3OYCA 2ZJRF 2KZVA 1G4DA 5FKOA 3TW6A 3QP6A 3ECOA 4OINF 1LE8A 3ZQHA 3SFZA 1D0ZA 1G8XA 1B1BA 3S93A 3GYHX 2E7WA 2HR3A 4MTEA 5J4YA 1UG0A 4R1HA 1UJ8A 4HW0A 4MFDA 4IXAA 1MIJA 2MSYA 3DU6A 4HA8A 1EV7A 2GIVA 2E1CA 3GTOJ 3JRBA 1K83J 5A2QK 2KIMA 2MH2A 3HTUA 2YUSA 2CQQA 5EZHA 1F36A 1MMDA 2RAEA 3T8TA 4AIJA 5IT9R 3QPSA 4WCGA 4UV9A 3KIOA 4BH9A 1V5GA 4E4HA 5JFRA 2VQHA 3LQQA 4CCJA 1YW9A 3HOSA 5EYRA 5LHGA 1I3AA 2FA5A 2GOXB 2G7HA 1R58A 3JAMR 4HDUA 1K6YA 1U78A 1IRZA 1OCZH 2NVYJ 2L7ZA 3JRFA 4JX4A 1S5LC 2DT7B 2MLKA 3CCUI 3OMYA 1X58A 2NRAC 3ML6A 1NG6A 4IRIA 5GP9A 3WU1B 2O61A 3IV5A 3BR0A 3ZMUA 3LNQA 2XF6A 2NS0A 2Y9YA 2VLAA 2ZXHA 2B63J 3CCLI 2LF7A 3HG9A 4C2MJ 2VIXA 5IOZA 4I6ZA 3LSJA 2G7UA 1U8BA 2DXIA 2M4KA 1YIJI 1GV5A 1GXPA 4HLYA 3CF5F 4Y3OA 5L3GA 4IF4A 2R7DA 4EMSA 2L9SA 4BHCA 3HRUA 1IV6A 4HLXA 2XGEA 4LK1F 1FWZA 3OYIA 4EJWA 3KCCA 3PIOF 2RV8A 2VKHA 2DA1A 4EJUA 1UAAA 3LSIA 3DEWA 4G6QA 2FF4A 1J5YA 1LB2A 3WG9A 2VOPA 4U88A 2BE5F 3I54A
chains in the Genus database with same CATH topology
2V9VA 5L3CA 3ABTA 1REPC 3ZMDA 3WTSC 4EJOA 2GA1A 1BI1A 1FSEA 5JVTA 4MQVA 4LG0A 1U8RA 3PQJA 3EUHA 2CGPA 1IXRC 3F6VA 2PJPA 2QENA 4M9XA 2TDXA 1Z6RA 2STTA 2MA3A 2OZUA 5JR3A 3FHZA 5F1RA 4OU0A 3GX4X 1F1ZA 2DQLA 3WTZA 1U2WA 4RB0A 4ETSA 3J80K 5HS9A 4DQ2A 4D0PA 1ZH5A 4U0WA 3WGIA 4I98B 1BOAA 3IL2A 1TNTA 1YS7A 1G3SA 2PMHA 2IA1A 3RPUA 2M1BA 1J59A 5K5QA 2K02A 3GFMA 3ERED 3WTTC 1WWXA 1QGPA 5FFXA 1UHMA 2HQRA 4RGRA 2ZFWA 1TW2A 5ED4A 3EYYA 1KQ8A 5ERIA 4FX4A 1KA8A 3ZQ7A 5FFZA 5FD5A 2QZ8A 3NRVA 1QBJA 1OYWA 2D1HA 5HDNA 4IRHA 5HS8A 4L9TA 4LG0B 3M8FA 5CVVA 2W85A 4N9HA 1R36A 2O0YA 1T39A 4Z2YA 1O3TA 4QLCU 3D0SA 2NYXA 3JAMZ 3HTSB 5FB2A 4TV7A 5CVRA 1DUXC 1XB4A 2XGXA 3FX3A 2RVCA 3HHGA 4MEYF 4RGXA 2AS5F 2DAOA 3I59A 3V8LA 1BI0A 2F5CA 2GA2A 4EM0B 5AONA 2DBBA 4LK0F 4I02A 4XRFA 2Z33A 4M9ZA 1ZRDA 2VT3A 5E20A 4KDPA 1YW7A 5AIPA 2X4HA 2ADUA 1G3YA 3DFGA 1IAWA 3CTAA 3Q9VA 3LAJA 1KU3A 2XUBA 3QPHA 2K4BA 3KFWX 1BIBA 1BI2A 2H09A 3WE2A 4OMYA 1XGOA 1TQIA 3KP5A 3ECHA 3AAFA 4HQEA 2MH9A 2RQPA 3TO7A 2WV0A 2PQ8A 3BDDA 2IA0A 1FYLA 2M87A 4KICA 1RIOH 4CYDA 5ICEA 2CQKA 2VBXA 4NQWA 2K27A 3SXYA 1Z9CA 4NB5A 5D8LB 5KVRA 4HX4A 3U9GA 3I59B 3T1BA 2IVMA 2FBIA 2DQRA 5H6QA 1B9NA 4KNYA 5DDGA 3LA7A 4WF2A 1PUEE 3IRRA 5HLGA 3BWGA 3GWZA 1DDNA 3DXJF 2IPQX 4GXOA 4GYIA 3IKVA 2OZ6A 4BXUA 4L5JA 2OU2A 4IHSA 1XGSA 3WTUC 5LEKA 3N97A 1F5TA 1TNSA 2BEOA 5HVQC 2W25A 5H6RA 3WTYC 1HSJA 2FMYA 3JSPA 4GCVA 1FC3A 1FBQA 4ESFA 2IP2A 3I4PA 4OIOF 1IRFA 3BOQA 2KIUA 3OV8A 3QPTA 4G7ZF 1PP7U 3JSOA 4O5VA 1RI7A 3FMSA 3SHFA 3MCZA 1MZBA 1FX7A 1BIAA 3VB2A 2HTSA 1MDMB 2V6CA 1JXSA 4BNCA 2OQGA 4OIRF 1ODDA 5DYMA 5LGUA 1TW3A 5D4RA 1IN7A 4Y15A 4ZYEA 3G3ZA 2VN2A 2P5VA 3B73A 3E5XA 2YSRA 2L02A 5HDGA 2IW5A 4ENJA 1QO0D 2VE8A 1RZ4A 3ULQB 2EFOA 2V1DA 4EGYA 4G8XA 1A04A 3KZZA 2CFXA 4FX0A 2VOOA 4L0ZB 3KLOA 4OOIA 2GAUA 3TOAA 3TOBA 3O3KA 2XAGA 1K78A 1R7JA 3ZMVA 4OIQF 2A61A 3WODF 1UCRA 5D5UB 4EQQA 2RNJA 3RDIA 1XGNA 2CO5A 2NNYA 1ZG3A 3ZMSA 3HSRA 2HKXA 4ZYHA 1LVAA 4U7BA 4PDKA 3Q5FA 5K5RA 1XMKA 4HF2A 2P8TA 2P7VB 4LD5A 3ZN0A 1HKQA 4ENKA 4I09A 4EJTA 3F23A 1SFXA 1J2XA 1OMIA 5CJ9A 2K4JA 3T0YA 5DUKA 3GXOA 5E1XA 2Y75A 1EH8A 2LSOA 1T6SA 3QU3A 4G6DA 4F7ZA 1TQMA 4BHPA 4CICA 1MD0A 4P96A 3HSEA 4P5OA 1W5TA 4KIBA 2JTVA 1K78B 3V7SA 4Q5SF 4L9JA 4RB1A 1ZG1A 2FQ3A 4HF0A 5LRRA 2JPBA 5IT3A 4E70A 2L4AA 1GVJA 3SZTA 4QWQA 5DD4A 3H3ZA 5HS7A 2YX4A 3K1NA 2KJCA 5FGMA 4A5MA 2E1NA 2DPDA 5CYVA 4XLNF 3J81K 4HYEA 1DP7P 3I71A 1J0RA 3IKTA 2HQNA 1J9IA 2H6CA 3F8CA 1SD6A 3FMRA 4M74A 5LLQA 3KETA 1R23A 3MAJA 4AIKA 2CSOA 5LRSA 1S3JA 4LGWA 3W6KB 4O3MA 3BROA 1P92A 3RI4A 2WWYA 2A3SA 1YQAA 3TGNA 4UV8A 4EV0A 4M6XA 4ZH4F 2BBYA 1XGMA 2FBHA 2HWVA 3M7GA 1ZLKA 3C7JA 3R61A 1TTYA 1BC8C 4LB5A 4ESBA 4IPAA 4A0ZA 3BPXA 5DEQA 2KKOA 3GLXA 4OIPF 3FM5A 1FPQA 1UB9A 3DF8A 4HOBA 4UVAA 1ON2A 2PBIA 3F3XA 1FP1D 1ONVA 3E3VA 4MGRA 3K69A 1R1UA 1ZREA 4IRGA 5FLXK 4BYYA 1L3LA 4RGSA 1SD7A 2DI3A 3E6BA 4Y13A 2VONA 3GO5A 2XV4S 4YIIA 2XKOA 3CUQB 3HRTA 2O8XA 3KZYA 5D4SA 3TKYA 3P9CA 2PI0A 3VOEA 3KP2A 3S2WA 4UHTA 1DPUA 1FYMA 5LBQA 2DT5A 2Z9OA 3KP4A 1TLHB 3E97A 4MTDA 1XSDA 4BHBA 3U2RA 4Q48A 2NAZA 3K9TA 2IA2A 5K1YA 1XCVA 5CVJA 1JHFA 3I0TA 4UNOA 1T0FA 3FM3A 4JBAA 3WGHA 1W7PD 1DPRA 1KU2A 1T38A 1BBYA 2FNAA 3IWZA 2QQAA 2IRFG 1HW1A 1W5SA 3GZ5A 5D5XB 2LF8A 1XSVA 2DK5A 1JHHA 3QP5A 1U5TA 4RS8A 3TDUC 1HKTA 1XDUA 5DCFA 2O6GE 4AIHA 4RB2C 3J7AO 1SFEA 3WGGA 2JRTA 4WK8F 2ZMEB 1ZGJA 2QYOA 4R79A 4K2EA 2WTEA 3V8JA 4KN7X 1KYWA 2L54A 4KMUX 3BJOA 2DFIA 2V1XA 1BJAA 3DQVC 2ZJ2A 2Q2EA 4A12A 3DKWA 4LFUA 6PAXA 1FBUA 4EGZA 2VT2A 1O57A 3OOPA 3MZYA 3REOA 3CDHA 5IT9Z 2QQ9A 4ZZDA 2FU4A 4G7HF 3I58A 1HBXG 2L3DA 4M73A 1YIOA 5J8CA 3FF5A 3QU6A 1OYYA 3FMQA 4PGHA 1SD4A 4EVIA 3M9AA 5K5OA 4FHTA 3P7NA 3F8BA 4M6YA 2GWRA 2FOKA 1ZYRF 4KA4A 3QOPA 5H20A 2W84A 2C6YA 4LLLA 3BZ6A 1U5TB 1K7AA 3RTRA 1R1TA 2MBFA 3Q9SA 4IVNA 2Z3YA 1YO5C 2NNNA 2VODA 2UXXA 5HLHA 3COAC 2IJLA 2RC4A 4G94A 4WXCA 2PG4A 5JI6A 1XD7A 2D1VA 1KQ9A 1O7FA 4H0EA 3KP7A 4A2UA 1ZARA 2EB7A 3CUOA 3H3UA 5BQTA 4PZJA 3CO7C 1MDMA 4ENMA 3RKWA 1KU9A 4WXHA 1PDNC 5F6FA 1Z7UA 2KJBA 4GYGA 4CHUA 3GUDA 3CO6C 2A68F 4LMYA 1IF1A 2BV6A 5ILVA 1I6XA 5D5WB 3HIFA 5IT9K 4L9NA 1O3QA 4NHJA 1SAXA 3VEPA 1K79A 5CVUA 2EFQA 3JAMK 2H6BA 2WC2A 5BOXA 2JPCA 3TO6A 2AXLA 4A5NA 1G3WA 2O3FA 1C0WA 2VC0A 2R3SA 3C18A 3JW4A 4XBFA 4A6EA 2JT1A 3C3WA 1W4MA 2XIGA 1J7KA 3CUQC 2GZWA 1CGPA 2FE3A 5E18F 2F5FA 2F2EA 1H0MA 3IHUA 4I0AA 4RAYA 4CZZA 2XAHA 2DLLA 2QQBA 4WX9A 3GZ6A 1ZAOA 2STWA 4KUMA 5LEJA 1TBXA 1LDDA 1LEBA 1STZA 5EEGA 5D6EA 4YFXF 3D5LA 3M1EA 2VE9A 3FZVA 3E6CC 4HF1A 1MKMA 1BM9A 4WXDA 1XN7A 3WE3A 4KT5C 3DEUA 4EM2A 2OBPA 1SD5A 4XSZF 2QLZA 2XAFA 1O3SA 2FMLA 5LHIA 2DK8A 2X0LA 2W57A 3R6SA 2XASA 5ILUA 3I53A 3L09A 2HGCA 4KFCA 1R5GA 1YLFA 1CF7A 2HZTA 1S8NA 1EH7A 2ZNZA 2DU9A 1U3EM 4HX8A 4G7OF 2EK5A 1IXCA 2A6HF 4P55A 5DCMB 2HS5A 2W24A 1QZYA 4N0BA 3MEXA 2PLYA 3H92A 2OQRA 1ON1A 4ZZLA 5ICGA 4ENNA 1LDKB 5BPIA 3K1PA 2HEOA 3MWMA 4KYWA 2L4MA 1T2KA 3GF2A 5DUIA 4I01A 1IN4A 5A2QZ 3ZP5A 1P4AA 3RYPA 1RNLA 3FXRA 1Q1HA 2RKHA 3ZMTA 1QZZA 4A6DA 2RDPA 5EEHA 4XLPF 3F21A 2V79A 2RN7A 1V4RA 2ESNA 3RKYA 1P2FA 4MQ9F 4IHTA 4CGZA 3KP3A 2FEZA 1FLIA 4Q47A 2GXGA 1XCBA 3KE2A 3ZMZA 4U0VA 2VBWA 4YIFA 4EJVA 1U5TC 4DNCA 4MEXF 4AD9A 5BMZA 1CF7B 2VC1A 3IWFA 2PN6A 1R5HA 5TRDA 1XMAA 1X3UA 1IN8A 2P7CB 3WTWC 4CXFA 3WTVC 3NQOA 1FP2A 2PFBA 4AWXB 4BQAA 2FXAA 1YYVA 2DPUA 1YG2A 4S04A 3F22A 5F64A 2FNPA 4JK1X 3K1MA 3PFIA 1OR7A 4LLGF 5DV5A 3G73A 4KMFA 2J5OA 1HKSA 3MFKA 3L9FA 3CUQA 4A0XA 2O03A 2PEXA 1OPCA 4U0YA 3L2CA 2MC3A 5HLIA 2Z99A 3JTHA 2ISZA 2EV5A 3J80Z 2ELHA 3F6OA 2QBYA 1H9GA 2XKPA 2J5PA 3IC7A 2Q8KA 1Z1DA 4L0YB 4ZYDA 2HYGD 1AOYA 1FT9A 4UUVA 4HBLA 5ICCA 1LEAA 2XHKA 2ISYA 2ZNYA 4L9VA 3HYIA 2COMA 2ESHA 4RGUA 3T8RA 5L3BA 3GVAA 2MLGA 2ZMEA 4G9YA 3PQKA 3F8FA 3P9KA 1JGSA 2LKPA 2D45A 1GXQA 1QPMA 3BPVA 1O7LA 1FY7A 2L01A 2M45A 2Z5UA 1IXSB 3L7WA 3LQRA 3WTXC 3LA3A 1YTYA 4FT8A 4HZFA 3CLOA 3K0LA 3VFZA 2XRNA 3GEZA 5BS6A 1UHWA 1D3YA 4ESJA 1I1GA 4HDVA 1F9NA 2ETHA 2Y48A 4PGGA 2GXBA 3SZPA 1NHAA 3VODA 4MHGA 2QBYB 1WSUA 5KK1A 2MD5A 4L5IA 4I0BA 2EFWA 3TDZC 2ZXJA 4HV5A 1TQPA 3E5QA 4HV6A 4YFNF 2HFHA 3BP8A 2ZCWA 1D8JA 3TQNA 4P9FA 4XSXF 4CO8A 2EA2A 1USSA 2Y0MA 3DV8A 2H94A 1KU7A 3BY6A 1B6AA 1KYZA 3FXUA 3RJPA 3EYIA 5E8GA 1E2XA 3V4GA 3NEUA 4U7DA 2Q0OA 3F72A 3DP7A 2HYFA 1AWCA 1BC7C 1WKMA 2YPRA 1EH6A 2DW4A 1PP8F 1MJAA 5E17F 1Z05A 5J6XA 3R0AA 1B9MA 4RB3C 3DPLC 1LNWA 2EWNA 3RYRA 5J8FA 1S7AA 1FSHA 3KEQA 1WI9A 4KN4X 4M72A 3R60A 4A0YA 3QRFF 5HOOA 1LQ1A 1FOKA 3ZN1A 2M30A 1QNTA 1YW8A 3I64A 5LGNA 2CYYA 2QWWA 1HW5A 2K7LA 2M5WA 3FXQA 1L0OC 3MQ0A 1ZRFA 1ZHFA 2CW0F 4B8XA 5E1ZB 2YX7A 3W6JB 1YFHA 2UWMA 2EV0A 4L18B 3BJ6A 3K2ZA 5L3FA 4M9SA 5D6FA 2YU3A 4WWCA 3MZHA 4P9UA 1OKRA 3WU0A 4KIFA 4HAMA 4KIGA 2G9WA 3ELKA 1ZN2A 2E7XA 2P6SA 2A69F 1YS6A 2OA4A 2D2WA 3E6DA 4OMZA 2RGVA 1IN5A 2EA4A 2FBKA 4RAZA 2YR2A 3HHHA 2GQQA 1JE8A 3R0JA 1RUNA 1IN6A 3C1DA 1P4XA 2JSCA 1LJ9A 2P5LC 3DPTA 3ZPLA 4Y17A 1P6RA 1BN5A 1B59A 3V7RA 2P6TA 2P4WA 1U6GA 3EQLF 1I1SA 1SFUA 4O6JA 1FYKA 5AIQA 2QUFA 1W7PA 2ZBKA 3LFKA 2EFPA 2A07F 1LDJA 1ZLJA 3O2PE 1S29A 4AVPA 1XDSA 2FSWA 1HQCA 2K86A 5LGTA 1MGTA 1UFMA 1H9TA 5DCMA 3HSFA 1FBSA 3BJAA 1S6LA 3TO9A 3LAPA 3V7CA 1FZPB 2H27A 4BAYA 3LA2A 1ZG5A 1ZRCA 2EFNA 1USTA 4LB6B 1MJ9A 1HW2A 3SQNA 1SMYF 2A6EF 1P4WA 1S7OA 3GFJA 1FNNA 2UZKA 3LWFA 1IW7F 2XAJA 3V8KA 1O3RA 3HRMA 3HUGA 3GFLA 5ICFA 3I5UA 2VBZA 3P9IA 3U1DA 1J75A 3N4MA 2M8EA 4B09A 2BGCA 1ULYA 5E8IA 1I5ZA 5JHUA 4LLNA 4S05A 4HX7A 5L3EA 1IZ1A 5CLSA 1R00A 4LJZF 2XVCA 4JQFA 2EV6A 2DTRA 1W7PB 2ZKZA 3RIRA 1HSTA 4UVCA 2CWEA 2QVOA 1IUYA 2HKOA 2JZYA 1KQ0A 1I27A 1XSXA 2OAZA 3F8NA 2EJRA 3ISPA 3GW2A 4PCQA 2F5DA 5HDKA 2QM3A 3J81Z 4GO1A 2BYVE 2KRFA 4M71A 3HRSA 1KGSA 3QAHA 3RPQA 2F5EA 3RKXA 2KIFA 4ON0A 1R22A 1G6NA 1B4AA 4ASNA 3CJNA 4N9IA 1Y0UA 1V3FA 5FO5A 3IRQA 4YFKF 3GFIA 5BPDA 3T5XA 2PMUA 1R1VA 4UXNA 3KP6A 3L00A 1K6OA 3E6MA 1Z6TA 3EDPA 1RUOA 1HXDA 4I7HA 3FWEA 1MJBA 2OD5A 2ACJA 3ROUA 2HOEA 1D8KA 3ABUA 3EETA 2HTJA 1VTNC 3M8EA 4I2OA 2UXNA 3KEOA 1IRGA 2R7FA 1BI3A 1G3TA 2XAQA 2DO7A 5ILSA 1ZGAA 4CDGA 1OYIA 4UVBA 3HOTA 4YG2F 2FRHA 2VXZA 5TJJA 2LNBA 3O6BB 3KLNA 3E5UA 1WQ2A 5E1WA 2B0LA 1F4KA 5D5VB 5FLXZ 4EM1A 4MNUA 4HQMA 1T98A 1Z91A 2V1UA 4ZYGA 2LDUA 1QQIA 1SMTA 4Q4ZF 5L3DA 5D8KB 2P5KA 2XROA 4R8HA 3B02A 3LSTA 2HDCA 2IT0A 3R4KA 1D5VA 1E17A 3JTGA 5CVIA 2ZO4A 1GHCA 5DD8A 2CG4A 1WRJA 5FD6A 5LHHA 4IJAA 2VBYA 2A5YB 4GGGA 3F8MA 1G4DA 3QP6A 3ECOA 4OINF 3SFZA 3GYHX 1B1BA 2E7WA 2HR3A 4MTEA 4R1HA 4HW0A 4IXAA 4HA8A 1EV7A 2GIVA 2E1CA 5A2QK 2KIMA 2MH2A 3HTUA 3T8TA 4AIJA 4WCGA 4UV9A 4BH9A 5JFRA 3LQQA 1YW9A 3HOSA 5LHGA 2FA5A 2G7HA 1R58A 4HDUA 1U78A 2MLKA 2NRAC 3ML6A 4IRIA 3WU1B 2O61A 3ZMUA 2NS0A 2LF7A 2G7UA 1GXPA 4HLYA 5L3GA 4IF4A 2R7DA 4EMSA 4BHCA 3HRUA 4HLXA 4LK1F 1FWZA 4EJWA 3KCCA 2RV8A 4EJUA 4G6QA 2FF4A 1J5YA 1LB2A 3WG9A 2VOPA 4U88A 2BE5F 3I54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V9V A;  5L3C A;  3ABT A;  1REP C;  3ZMD A;  3WTS C;  4EJO A;  2GA1 A;  1BI1 A;  1FSE A;  5JVT A;  4MQV A;  4LG0 A;  1U8R A;  3PQJ A;  3EUH A;  2CGP A;  1IXR C;  3F6V A;  2PJP A;  2QEN A;  4M9X A;  2TDX A;  1Z6R A;  2STT A;  2MA3 A;  2OZU A;  5JR3 A;  3FHZ A;  5F1R A;  4OU0 A;  3GX4 X;  1F1Z A;  2DQL A;  3WTZ A;  1U2W A;  4RB0 A;  4ETS A;  3J80 K;  5HS9 A;  4DQ2 A;  4D0P A;  1ZH5 A;  4U0W A;  3WGI A;  4I98 B;  1BOA A;  3IL2 A;  1TNT A;  1YS7 A;  1G3S A;  2PMH A;  2IA1 A;  3RPU A;  2M1B A;  1J59 A;  5K5Q A;  2K02 A;  3GFM A;  3ERE D;  3WTT C;  1WWX A;  1QGP A;  5FFX A;  1UHM A;  2HQR A;  4RGR A;  2ZFW A;  1TW2 A;  5ED4 A;  3EYY A;  1KQ8 A;  5ERI A;  4FX4 A;  1KA8 A;  3ZQ7 A;  5FFZ A;  5FD5 A;  2QZ8 A;  3NRV A;  1QBJ A;  1OYW A;  2D1H A;  5HDN A;  4IRH A;  5HS8 A;  4L9T A;  4LG0 B;  3M8F A;  5CVV A;  2W85 A;  4N9H A;  1R36 A;  2O0Y A;  1T39 A;  4Z2Y A;  1O3T A;  4QLC U;  3D0S A;  2NYX A;  3JAM Z;  3HTS B;  5FB2 A;  4TV7 A;  5CVR A;  1DUX C;  1XB4 A;  2XGX A;  3FX3 A;  2RVC A;  3HHG A;  4MEY F;  4RGX A;  2AS5 F;  2DAO A;  3I59 A;  3V8L A;  1BI0 A;  2F5C A;  2GA2 A;  4EM0 B;  5AON A;  2DBB A;  4LK0 F;  4I02 A;  4XRF A;  2Z33 A;  4M9Z A;  1ZRD A;  2VT3 A;  5E20 A;  4KDP A;  1YW7 A;  5AIP A;  2X4H A;  2ADU A;  1G3Y A;  3DFG A;  1IAW A;  3CTA A;  3Q9V A;  3LAJ A;  1KU3 A;  2XUB A;  3QPH A;  2K4B A;  3KFW X;  1BIB A;  1BI2 A;  2H09 A;  3WE2 A;  4OMY A;  1XGO A;  1TQI A;  3KP5 A;  3ECH A;  3AAF A;  4HQE A;  2MH9 A;  2RQP A;  3TO7 A;  2WV0 A;  2PQ8 A;  3BDD A;  2IA0 A;  1FYL A;  2M87 A;  4KIC A;  1RIO H;  4CYD A;  5ICE A;  2CQK A;  2VBX A;  4NQW A;  2K27 A;  3SXY A;  1Z9C A;  4NB5 A;  5D8L B;  5KVR A;  4HX4 A;  3U9G A;  3I59 B;  3T1B A;  2IVM A;  2FBI A;  2DQR A;  5H6Q A;  1B9N A;  4KNY A;  5DDG A;  3LA7 A;  4WF2 A;  1PUE E;  3IRR A;  5HLG A;  3BWG A;  3GWZ A;  1DDN A;  3DXJ F;  2IPQ X;  4GXO A;  4GYI A;  3IKV A;  2OZ6 A;  4BXU A;  4L5J A;  2OU2 A;  4IHS A;  1XGS A;  3WTU C;  5LEK A;  3N97 A;  1F5T A;  1TNS A;  2BEO A;  5HVQ C;  2W25 A;  5H6R A;  3WTY C;  1HSJ A;  2FMY A;  3JSP A;  4GCV A;  1FC3 A;  1FBQ A;  4ESF A;  2IP2 A;  3I4P A;  4OIO F;  1IRF A;  3BOQ A;  2KIU A;  3OV8 A;  3QPT A;  4G7Z F;  1PP7 U;  3JSO A;  4O5V A;  1RI7 A;  3FMS A;  3SHF A;  3MCZ A;  1MZB A;  1FX7 A;  1BIA A;  3VB2 A;  2HTS A;  1MDM B;  2V6C A;  1JXS A;  4BNC A;  2OQG A;  4OIR F;  1ODD A;  5DYM A;  5LGU A;  1TW3 A;  5D4R A;  1IN7 A;  4Y15 A;  4ZYE A;  3G3Z A;  2VN2 A;  2P5V A;  3B73 A;  3E5X A;  2YSR A;  2L02 A;  5HDG A;  2IW5 A;  4ENJ A;  1QO0 D;  2VE8 A;  1RZ4 A;  3ULQ B;  2EFO A;  2V1D A;  4EGY A;  4G8X A;  1A04 A;  3KZZ A;  2CFX A;  4FX0 A;  2VOO A;  4L0Z B;  3KLO A;  4OOI A;  2GAU A;  3TOA A;  3TOB A;  3O3K A;  2XAG A;  1K78 A;  1R7J A;  3ZMV A;  4OIQ F;  2A61 A;  3WOD F;  1UCR A;  5D5U B;  4EQQ A;  2RNJ A;  3RDI A;  1XGN A;  2CO5 A;  2NNY A;  1ZG3 A;  3ZMS A;  3HSR A;  2HKX A;  4ZYH A;  1LVA A;  4U7B A;  4PDK A;  3Q5F A;  5K5R A;  1XMK A;  4HF2 A;  2P8T A;  2P7V B;  4LD5 A;  3ZN0 A;  1HKQ A;  4ENK A;  4I09 A;  4EJT A;  3F23 A;  1SFX A;  1J2X A;  1OMI A;  5CJ9 A;  2K4J A;  3T0Y A;  5DUK A;  3GXO A;  5E1X A;  2Y75 A;  1EH8 A;  2LSO A;  1T6S A;  3QU3 A;  4G6D A;  4F7Z A;  1TQM A;  4BHP A;  4CIC A;  1MD0 A;  4P96 A;  3HSE A;  4P5O A;  1W5T A;  4KIB A;  2JTV A;  1K78 B;  3V7S A;  4Q5S F;  4L9J A;  4RB1 A;  1ZG1 A;  2FQ3 A;  4HF0 A;  5LRR A;  2JPB A;  5IT3 A;  4E70 A;  2L4A A;  1GVJ A;  3SZT A;  4QWQ A;  5DD4 A;  3H3Z A;  5HS7 A;  2YX4 A;  3K1N A;  2KJC A;  5FGM A;  4A5M A;  2E1N A;  2DPD A;  5CYV A;  4XLN F;  3J81 K;  4HYE A;  1DP7 P;  3I71 A;  1J0R A;  3IKT A;  2HQN A;  1J9I A;  2H6C A;  3F8C A;  1SD6 A;  3FMR A;  4M74 A;  5LLQ A;  3KET A;  1R23 A;  3MAJ A;  4AIK A;  2CSO A;  5LRS A;  1S3J A;  4LGW A;  3W6K B;  4O3M A;  3BRO A;  1P92 A;  3RI4 A;  2WWY A;  2A3S A;  1YQA A;  3TGN A;  4UV8 A;  4EV0 A;  4M6X A;  4ZH4 F;  2BBY A;  1XGM A;  2FBH A;  2HWV A;  3M7G A;  1ZLK A;  3C7J A;  3R61 A;  1TTY A;  1BC8 C;  4LB5 A;  4ESB A;  4IPA A;  4A0Z A;  3BPX A;  5DEQ A;  2KKO A;  3GLX A;  4OIP F;  3FM5 A;  1FPQ A;  1UB9 A;  3DF8 A;  4HOB A;  4UVA A;  1ON2 A;  2PBI A;  3F3X A;  1FP1 D;  1ONV A;  3E3V A;  4MGR A;  3K69 A;  1R1U A;  1ZRE A;  4IRG A;  5FLX K;  4BYY A;  1L3L A;  4RGS A;  1SD7 A;  2DI3 A;  3E6B A;  4Y13 A;  2VON A;  3GO5 A;  2XV4 S;  4YII A;  2XKO A;  3CUQ B;  3HRT A;  2O8X A;  3KZY A;  5D4S A;  3TKY A;  3P9C A;  2PI0 A;  3VOE A;  3KP2 A;  3S2W A;  4UHT A;  1DPU A;  1FYM A;  5LBQ A;  2DT5 A;  2Z9O A;  3KP4 A;  1TLH B;  3E97 A;  4MTD A;  1XSD A;  4BHB A;  3U2R A;  4Q48 A;  2NAZ A;  3K9T A;  2IA2 A;  5K1Y A;  1XCV A;  5CVJ A;  1JHF A;  3I0T A;  4UNO A;  1T0F A;  3FM3 A;  4JBA A;  3WGH A;  1W7P D;  1DPR A;  1KU2 A;  1T38 A;  1BBY A;  2FNA A;  3IWZ A;  2QQA A;  2IRF G;  1HW1 A;  1W5S A;  3GZ5 A;  5D5X B;  2LF8 A;  1XSV A;  2DK5 A;  1JHH A;  3QP5 A;  1U5T A;  4RS8 A;  3TDU C;  1HKT A;  1XDU A;  5DCF A;  2O6G E;  4AIH A;  4RB2 C;  3J7A O;  1SFE A;  3WGG A;  2JRT A;  4WK8 F;  2ZME B;  1ZGJ A;  2QYO A;  4R79 A;  4K2E A;  2WTE A;  3V8J A;  4KN7 X;  1KYW A;  2L54 A;  4KMU X;  3BJO A;  2DFI A;  2V1X A;  1BJA A;  3DQV C;  2ZJ2 A;  2Q2E A;  4A12 A;  3DKW A;  4LFU A;  6PAX A;  1FBU A;  4EGZ A;  2VT2 A;  1O57 A;  3OOP A;  3MZY A;  3REO A;  3CDH A;  5IT9 Z;  2QQ9 A;  4ZZD A;  2FU4 A;  4G7H F;  3I58 A;  1HBX G;  2L3D A;  4M73 A;  1YIO A;  5J8C A;  3FF5 A;  3QU6 A;  1OYY A;  3FMQ A;  4PGH A;  1SD4 A;  4EVI A;  3M9A A;  5K5O A;  4FHT A;  3P7N A;  3F8B A;  4M6Y A;  2GWR A;  2FOK A;  1ZYR F;  4KA4 A;  3QOP A;  5H20 A;  2W84 A;  2C6Y A;  4LLL A;  3BZ6 A;  1U5T B;  1K7A A;  3RTR A;  1R1T A;  2MBF A;  3Q9S A;  4IVN A;  2Z3Y A;  1YO5 C;  2NNN A;  2VOD A;  2UXX A;  5HLH A;  3COA C;  2IJL A;  2RC4 A;  4G94 A;  4WXC A;  2PG4 A;  5JI6 A;  1XD7 A;  2D1V A;  1KQ9 A;  1O7F A;  4H0E A;  3KP7 A;  4A2U A;  1ZAR A;  2EB7 A;  3CUO A;  3H3U A;  5BQT A;  4PZJ A;  3CO7 C;  1MDM A;  4ENM A;  3RKW A;  1KU9 A;  4WXH A;  1PDN C;  5F6F A;  1Z7U A;  2KJB A;  4GYG A;  4CHU A;  3GUD A;  3CO6 C;  2A68 F;  4LMY A;  1IF1 A;  2BV6 A;  5ILV A;  1I6X A;  5D5W B;  3HIF A;  5IT9 K;  4L9N A;  1O3Q A;  4NHJ A;  1SAX A;  3VEP A;  1K79 A;  5CVU A;  2EFQ A;  3JAM K;  2H6B A;  2WC2 A;  5BOX A;  2JPC A;  3TO6 A;  2AXL A;  4A5N A;  1G3W A;  2O3F A;  1C0W A;  2VC0 A;  2R3S A;  3C18 A;  3JW4 A;  4XBF A;  4A6E A;  2JT1 A;  3C3W A;  1W4M A;  2XIG A;  1J7K A;  3CUQ C;  2GZW A;  1CGP A;  2FE3 A;  5E18 F;  2F5F A;  2F2E A;  1H0M A;  3IHU A;  4I0A A;  4RAY A;  4CZZ A;  2XAH A;  2DLL A;  2QQB A;  4WX9 A;  3GZ6 A;  1ZAO A;  2STW A;  4KUM A;  5LEJ A;  1TBX A;  1LDD A;  1LEB A;  1STZ A;  5EEG A;  5D6E A;  4YFX F;  3D5L A;  3M1E A;  2VE9 A;  3FZV A;  3E6C C;  4HF1 A;  1MKM A;  1BM9 A;  4WXD A;  1XN7 A;  3WE3 A;  4KT5 C;  3DEU A;  4EM2 A;  2OBP A;  1SD5 A;  4XSZ F;  2QLZ A;  2XAF A;  1O3S A;  2FML A;  5LHI A;  2DK8 A;  2X0L A;  2W57 A;  3R6S A;  2XAS A;  5ILU A;  3I53 A;  3L09 A;  2HGC A;  4KFC A;  1R5G A;  1YLF A;  1CF7 A;  2HZT A;  1S8N A;  1EH7 A;  2ZNZ A;  2DU9 A;  1U3E M;  4HX8 A;  4G7O F;  2EK5 A;  1IXC A;  2A6H F;  4P55 A;  5DCM B;  2HS5 A;  2W24 A;  1QZY A;  4N0B A;  3MEX A;  2PLY A;  3H92 A;  2OQR A;  1ON1 A;  4ZZL A;  5ICG A;  4ENN A;  1LDK B;  5BPI A;  3K1P A;  2HEO A;  3MWM A;  4KYW A;  2L4M A;  1T2K A;  3GF2 A;  5DUI A;  4I01 A;  1IN4 A;  5A2Q Z;  3ZP5 A;  1P4A A;  3RYP A;  1RNL A;  3FXR A;  1Q1H A;  2RKH A;  3ZMT A;  1QZZ A;  4A6D A;  2RDP A;  5EEH A;  4XLP F;  3F21 A;  2V79 A;  2RN7 A;  1V4R A;  2ESN A;  3RKY A;  1P2F A;  4MQ9 F;  4IHT A;  4CGZ A;  3KP3 A;  2FEZ A;  1FLI A;  4Q47 A;  2GXG A;  1XCB A;  3KE2 A;  3ZMZ A;  4U0V A;  2VBW A;  4YIF A;  4EJV A;  1U5T C;  4DNC A;  4MEX F;  4AD9 A;  5BMZ A;  1CF7 B;  2VC1 A;  3IWF A;  2PN6 A;  1R5H A;  5TRD A;  1XMA A;  1X3U A;  1IN8 A;  2P7C B;  3WTW C;  4CXF A;  3WTV C;  3NQO A;  1FP2 A;  2PFB A;  4AWX B;  4BQA A;  2FXA A;  1YYV A;  2DPU A;  1YG2 A;  4S04 A;  3F22 A;  5F64 A;  2FNP A;  4JK1 X;  3K1M A;  3PFI A;  1OR7 A;  4LLG F;  5DV5 A;  3G73 A;  4KMF A;  2J5O A;  1HKS A;  3MFK A;  3L9F A;  3CUQ A;  4A0X A;  2O03 A;  2PEX A;  1OPC A;  4U0Y A;  3L2C A;  2MC3 A;  5HLI A;  2Z99 A;  3JTH A;  2ISZ A;  2EV5 A;  3J80 Z;  2ELH A;  3F6O A;  2QBY A;  1H9G A;  2XKP A;  2J5P A;  3IC7 A;  2Q8K A;  1Z1D A;  4L0Y B;  4ZYD A;  2HYG D;  1AOY A;  1FT9 A;  4UUV A;  4HBL A;  5ICC A;  1LEA A;  2XHK A;  2ISY A;  2ZNY A;  4L9V A;  3HYI A;  2COM A;  2ESH A;  4RGU A;  3T8R A;  5L3B A;  3GVA A;  2MLG A;  2ZME A;  4G9Y A;  3PQK A;  3F8F A;  3P9K A;  1JGS A;  2LKP A;  2D45 A;  1GXQ A;  1QPM A;  3BPV A;  1O7L A;  1FY7 A;  2L01 A;  2M45 A;  2Z5U A;  1IXS B;  3L7W A;  3LQR A;  3WTX C;  3LA3 A;  1YTY A;  4FT8 A;  4HZF A;  3CLO A;  3K0L A;  3VFZ A;  2XRN A;  3GEZ A;  5BS6 A;  1UHW A;  1D3Y A;  4ESJ A;  1I1G A;  4HDV A;  1F9N A;  2ETH A;  2Y48 A;  4PGG A;  2GXB A;  3SZP A;  1NHA A;  3VOD A;  4MHG A;  2QBY B;  1WSU A;  5KK1 A;  2MD5 A;  4L5I A;  4I0B A;  2EFW A;  3TDZ C;  2ZXJ A;  4HV5 A;  1TQP A;  3E5Q A;  4HV6 A;  4YFN F;  2HFH A;  3BP8 A;  2ZCW A;  1D8J A;  3TQN A;  4P9F A;  4XSX F;  4CO8 A;  2EA2 A;  1USS A;  2Y0M A;  3DV8 A;  2H94 A;  1KU7 A;  3BY6 A;  1B6A A;  1KYZ A;  3FXU A;  3RJP A;  3EYI A;  5E8G A;  1E2X A;  3V4G A;  3NEU A;  4U7D A;  2Q0O A;  3F72 A;  3DP7 A;  2HYF A;  1AWC A;  1BC7 C;  1WKM A;  2YPR A;  1EH6 A;  2DW4 A;  1PP8 F;  1MJA A;  5E17 F;  1Z05 A;  5J6X A;  3R0A A;  1B9M A;  4RB3 C;  3DPL C;  1LNW A;  2EWN A;  3RYR A;  5J8F A;  1S7A A;  1FSH A;  3KEQ A;  1WI9 A;  4KN4 X;  4M72 A;  3R60 A;  4A0Y A;  3QRF F;  5HOO A;  1LQ1 A;  1FOK A;  3ZN1 A;  2M30 A;  1QNT A;  1YW8 A;  3I64 A;  5LGN A;  2CYY A;  2QWW A;  1HW5 A;  2K7L A;  2M5W A;  3FXQ A;  1L0O C;  3MQ0 A;  1ZRF A;  1ZHF A;  2CW0 F;  4B8X A;  5E1Z B;  2YX7 A;  3W6J B;  1YFH A;  2UWM A;  2EV0 A;  4L18 B;  3BJ6 A;  3K2Z A;  5L3F A;  4M9S A;  5D6F A;  2YU3 A;  4WWC A;  3MZH A;  4P9U A;  1OKR A;  3WU0 A;  4KIF A;  4HAM A;  4KIG A;  2G9W A;  3ELK A;  1ZN2 A;  2E7X A;  2P6S A;  2A69 F;  1YS6 A;  2OA4 A;  2D2W A;  3E6D A;  4OMZ A;  2RGV A;  1IN5 A;  2EA4 A;  2FBK A;  4RAZ A;  2YR2 A;  3HHH A;  2GQQ A;  1JE8 A;  3R0J A;  1RUN A;  1IN6 A;  3C1D A;  1P4X A;  2JSC A;  1LJ9 A;  2P5L C;  3DPT A;  3ZPL A;  4Y17 A;  1P6R A;  1BN5 A;  1B59 A;  3V7R A;  2P6T A;  2P4W A;  1U6G A;  3EQL F;  1I1S A;  1SFU A;  4O6J A;  1FYK A;  5AIQ A;  2QUF A;  1W7P A;  2ZBK A;  3LFK A;  2EFP A;  2A07 F;  1LDJ A;  1ZLJ A;  3O2P E;  1S29 A;  4AVP A;  1XDS A;  2FSW A;  1HQC A;  2K86 A;  5LGT A;  1MGT A;  1UFM A;  1H9T A;  5DCM A;  3HSF A;  1FBS A;  3BJA A;  1S6L A;  3TO9 A;  3LAP A;  3V7C A;  1FZP B;  2H27 A;  4BAY A;  3LA2 A;  1ZG5 A;  1ZRC A;  2EFN A;  1UST A;  4LB6 B;  1MJ9 A;  1HW2 A;  3SQN A;  1SMY F;  2A6E F;  1P4W A;  1S7O A;  3GFJ A;  1FNN A;  2UZK A;  3LWF A;  1IW7 F;  2XAJ A;  3V8K A;  1O3R A;  3HRM A;  3HUG A;  3GFL A;  5ICF A;  3I5U A;  2VBZ A;  3P9I A;  3U1D A;  1J75 A;  3N4M A;  2M8E A;  4B09 A;  2BGC A;  1ULY A;  5E8I A;  1I5Z A;  5JHU A;  4LLN A;  4S05 A;  4HX7 A;  5L3E A;  1IZ1 A;  5CLS A;  1R00 A;  4LJZ F;  2XVC A;  4JQF A;  2EV6 A;  2DTR A;  1W7P B;  2ZKZ A;  3RIR A;  1HST A;  4UVC A;  2CWE A;  2QVO A;  1IUY A;  2HKO A;  2JZY A;  1KQ0 A;  1I27 A;  1XSX A;  2OAZ A;  3F8N A;  2EJR A;  3ISP A;  3GW2 A;  4PCQ A;  2F5D A;  5HDK A;  2QM3 A;  3J81 Z;  4GO1 A;  2BYV E;  2KRF A;  4M71 A;  3HRS A;  1KGS A;  3QAH A;  3RPQ A;  2F5E A;  3RKX A;  2KIF A;  4ON0 A;  1R22 A;  1G6N A;  1B4A A;  4ASN A;  3CJN A;  4N9I A;  1Y0U A;  1V3F A;  5FO5 A;  3IRQ A;  4YFK F;  3GFI A;  5BPD A;  3T5X A;  2PMU A;  1R1V A;  4UXN A;  3KP6 A;  3L00 A;  1K6O A;  3E6M A;  1Z6T A;  3EDP A;  1RUO A;  1HXD A;  4I7H A;  3FWE A;  1MJB A;  2OD5 A;  2ACJ A;  3ROU A;  2HOE A;  1D8K A;  3ABU A;  3EET A;  2HTJ A;  1VTN C;  3M8E A;  4I2O A;  2UXN A;  3KEO A;  1IRG A;  2R7F A;  1BI3 A;  1G3T A;  2XAQ A;  2DO7 A;  5ILS A;  1ZGA A;  4CDG A;  1OYI A;  4UVB A;  3HOT A;  4YG2 F;  2FRH A;  2VXZ A;  5TJJ A;  2LNB A;  3O6B B;  3KLN A;  3E5U A;  1WQ2 A;  5E1W A;  2B0L A;  1F4K A;  5D5V B;  5FLX Z;  4EM1 A;  4MNU A;  4HQM A;  1T98 A;  1Z91 A;  2V1U A;  4ZYG A;  2LDU A;  1QQI A;  1SMT A;  4Q4Z F;  5L3D A;  5D8K B;  2P5K A;  2XRO A;  4R8H A;  3B02 A;  3LST A;  2HDC A;  2IT0 A;  3R4K A;  1D5V A;  1E17 A;  3JTG A;  5CVI A;  2ZO4 A;  1GHC A;  5DD8 A;  2CG4 A;  1WRJ A;  5FD6 A;  5LHH A;  4IJA A;  2VBY A;  2A5Y B;  4GGG A;  3F8M A;  1G4D A;  3QP6 A;  3ECO A;  4OIN F;  3SFZ A;  3GYH X;  1B1B A;  2E7W A;  2HR3 A;  4MTE A;  4R1H A;  4HW0 A;  4IXA A;  4HA8 A;  1EV7 A;  2GIV A;  2E1C A;  5A2Q K;  2KIM A;  2MH2 A;  3HTU A;  3T8T A;  4AIJ A;  4WCG A;  4UV9 A;  4BH9 A;  5JFR A;  3LQQ A;  1YW9 A;  3HOS A;  5LHG A;  2FA5 A;  2G7H A;  1R58 A;  4HDU A;  1U78 A;  2MLK A;  2NRA C;  3ML6 A;  4IRI A;  3WU1 B;  2O61 A;  3ZMU A;  2NS0 A;  2LF7 A;  2G7U A;  1GXP A;  4HLY A;  5L3G A;  4IF4 A;  2R7D A;  4EMS A;  4BHC A;  3HRU A;  4HLX A;  4LK1 F;  1FWZ A;  4EJW A;  3KCC A;  2RV8 A;  4EJU A;  4G6Q A;  2FF4 A;  1J5Y A;  1LB2 A;  3WG9 A;  2VOP A;  4U88 A;  2BE5 F;  3I54 A; 
#chains in the Genus database with same CATH topology
 2V9V A;  5L3C A;  3ABT A;  1REP C;  2KRC A;  3ZMD A;  3WTS C;  4EJO A;  2GA1 A;  4NNJ A;  2VUM J;  2OTJ I;  1BI1 A;  1FSE A;  2MG4 A;  4OWR B;  5B5E C;  5JVT A;  4MQV A;  4DYC A;  3VWB A;  3H3V K;  1TWH J;  3WHB A;  4LG0 A;  3SEZ A;  1U8R A;  2AQE A;  3PQJ A;  1DP3 A;  2VPR A;  3EUH A;  2CGP A;  1IXR C;  3F6V A;  4ZJZ A;  2W7N A;  2QEN A;  4M9X A;  2PJP A;  3L2V A;  3SJM A;  2TDX A;  1D5Y A;  1Z6R A;  1ZQ3 P;  3KPH A;  1HDP A;  2STT A;  2MA3 A;  5F08 A;  4BXX J;  4XKW A;  1WPK A;  2OZU A;  4II2 A;  5JR3 A;  3FHZ A;  1WJF A;  4IHY A;  5F1R A;  4OU0 A;  4GDF A;  3GX4 X;  1F1Z A;  2DQL A;  2OJE D;  3WTZ A;  4U87 A;  3TL4 X;  2LFB A;  1LFP A;  1U2W A;  1Z77 A;  2R92 J;  4RB0 A;  4ETS A;  2CV1 A;  2IXS A;  3I3L A;  3J80 K;  3DBH B;  5HS9 A;  4DQ2 A;  5FRO A;  2HOS A;  4D0P A;  1ZH5 A;  3BR3 A;  2HXO A;  4FET A;  4U0W A;  3WGI A;  4I98 B;  3KYC B;  5JHF A;  2QF7 A;  4B3A A;  1BOA A;  3IL2 A;  1TNT A;  1V54 H;  1YS7 A;  2BY1 A;  1G3S A;  3S1N J;  2M35 A;  2PMH A;  3H5N A;  1A5J A;  4BXF A;  2IA1 A;  3RPU A;  2H8R A;  2M1B A;  3IH2 A;  2WAF A;  3FKJ A;  2DDB A;  1J59 A;  1ZR2 A;  5K5Q A;  2K02 A;  2DA5 A;  5LFA A;  3GFM A;  3DBL B;  4BDZ A;  2R7S A;  3ERE D;  3MVP A;  3WTT C;  1WWX A;  1QGP A;  2DA3 A;  5FFX A;  3CME I;  3CJT B;  2XF7 A;  2V7F A;  4CCO A;  1UHM A;  2HQR A;  3FXM A;  2M8G X;  4RGR A;  2ZFW A;  1TW2 A;  3OYN A;  3I4N J;  5J3L A;  5ED4 A;  3AKZ A;  3EYY A;  1KQ8 A;  5ERI A;  4FX4 A;  1UG2 A;  4CCK A;  1KA8 A;  1UHS A;  3ZQ7 A;  5FFZ A;  5FD5 A;  2QZ8 A;  3NRV A;  4FCY A;  1A36 A;  2ELK A;  4J00 A;  1OYW A;  2KRH A;  3D5S C;  1QBJ A;  2W4S A;  2D1H A;  5HDN A;  4IRH A;  5HS8 A;  4L9T A;  4LG0 B;  3M8F A;  5CVV A;  1MMG A;  2W85 A;  4N9H A;  4IHW A;  1R36 A;  2L0K A;  2O0Y A;  1T39 A;  1EKE A;  2OV7 A;  4Z2Y A;  2ME0 A;  2WBM A;  3LOC A;  5J1R A;  5EG0 B;  3JRD A;  1O3T A;  4QLC U;  1TWA J;  3D0S A;  3OYL A;  3G6E I;  4BBR J;  1FTT A;  2L5Q A;  2NYX A;  1Y56 A;  5B1A H;  3Q0V A;  3JAM Z;  3HTS B;  5FB2 A;  4TV7 A;  5CVR A;  1DUX C;  1XB4 A;  2XGX A;  3FX3 A;  3ASO H;  4D7M A;  2RVC A;  3HHG A;  4MEY F;  1V5F A;  4RGX A;  2AS5 F;  1BR4 A;  2DAO A;  3I59 A;  3V8L A;  2D5V A;  4DBR A;  1IDY A;  3CCV I;  4YEJ A;  1BI0 A;  2F5C A;  2GA2 A;  2CQX A;  4EM0 B;  1JTX A;  2DBB A;  5AON A;  4M3E A;  3OR1 C;  2A5W A;  5F04 A;  2HVQ A;  4LK0 F;  1JTY A;  4I02 A;  3S14 J;  1W0U A;  4XRF A;  2Z33 A;  4XN3 A;  4M9Z A;  1ZRD A;  2VT3 A;  5E20 A;  1KZH A;  4KDP A;  4PJM A;  3IAM 2;  1YW7 A;  1A6I A;  5B66 C;  1RQ6 A;  3OYH A;  1JKO C;  3K10 A;  5AIP A;  2X4H A;  3GTJ J;  1AKH A;  2ADU A;  2W82 A;  2ECB A;  1G3Y A;  4ZYA A;  1UEL B;  4I99 C;  3DFG A;  1SVM A;  1SC7 A;  2FUG 2;  3PUF A;  2BOL A;  3ESW B;  1JKP C;  1IAW A;  3CTA A;  3Q9V A;  2GIZ A;  3LAJ A;  1KU3 A;  3W6V A;  1V55 H;  3PO2 J;  1DU6 A;  1VQM I;  4A3L J;  4XQF A;  2XUB A;  3QPH A;  1VQ4 I;  2K4B A;  2IBD A;  2WA0 A;  4PJN A;  3DTI A;  4OAY A;  3KZI C;  2R5Z A;  3KFW X;  2A05 A;  1IC8 A;  5KNL A;  1BIB A;  1RR7 A;  2QGU A;  1BI2 A;  4JX6 A;  1FIA A;  2H09 A;  4BJ6 C;  1ITY A;  2K5C A;  3WE2 A;  4OMY A;  2E71 A;  1XGO A;  3LSP A;  2QSH X;  1TQI A;  3KP5 A;  4BE0 A;  3ECH A;  2Y30 A;  5FKK A;  2NXN B;  3AAF A;  2MH9 A;  2RQP A;  3D5R C;  3TO7 A;  5M3M J;  2WV0 A;  4HQE A;  2PQ8 A;  3BDD A;  4LOC A;  1R4M B;  2IA0 A;  5FLM J;  3K4C A;  4E7S A;  4DYQ A;  5GAE J;  1FYL A;  2M87 A;  4KIC A;  1RIO H;  2VKV A;  3E7L A;  4CYD A;  1TT5 B;  5ICE A;  2CQK A;  2VBX A;  4NQW A;  2K27 A;  1AHD P;  3SXY A;  1Z9C A;  1SFK A;  4RA2 A;  2CUZ A;  2HYJ A;  2DCE A;  2O5R A;  2E2J J;  1LFB A;  3ZCO A;  4NB5 A;  2NOG A;  2QKL B;  5D8L B;  3BR5 A;  5KVR A;  1BR1 A;  4HX4 A;  3U9G A;  2X6W A;  3I59 B;  1WJC A;  3T1B A;  2IVM A;  5EDN A;  2FBI A;  2DQR A;  5H6Q A;  1B9N A;  4KNY A;  4M3B A;  2GXA A;  5DDG A;  3LA7 A;  4WF2 A;  3QYE A;  3LL7 A;  1PUE E;  4Y33 A;  5HLG A;  3IRR A;  3BWG A;  3GWZ A;  1YJ9 I;  2QCO A;  3LMM A;  1DDN A;  2R7X A;  1XTA A;  2IGN A;  3DXJ F;  2ME6 A;  1X1C A;  2IPQ X;  4GXO A;  4GYI A;  4BBS J;  4BQQ A;  3LSM A;  3IKV A;  2OZ6 A;  4BXU A;  2Z16 A;  2GOM A;  4L5J A;  2OU2 A;  4IHS A;  1XGS A;  2MD0 A;  2DJN A;  3WTU C;  9ANT A;  5J1Y A;  5LEK A;  1NH3 A;  2X9D A;  5EF6 A;  4XOR A;  3N97 A;  4D7N A;  1F5T A;  2MFZ A;  3JRA A;  1TNS A;  5FKN A;  1VQK I;  4IKF A;  2BEO A;  5HVQ C;  3MKZ A;  2W25 A;  5H6R A;  3WTY C;  1A35 A;  1HSJ A;  2FMY A;  3JSP A;  3HL2 A;  2E1O A;  2LVS A;  2R7O A;  4GCV A;  3SDB A;  3S3O A;  5FRM A;  1FC3 A;  1FBQ A;  4ESF A;  1N78 A;  2IP2 A;  3I4P A;  2M0C A;  4OIO F;  1IRF A;  3BOQ A;  2KIU A;  3OV8 A;  5IP6 A;  3QPT A;  4G7Z F;  3M07 A;  1PP7 U;  4MLO A;  3JSO A;  2FOW A;  4O5V A;  2R5Z B;  1RI7 A;  4B48 A;  2BVM A;  1FMV A;  3OYG A;  3FMS A;  3SHF A;  3MCZ A;  1MZB A;  1FX7 A;  1E0E A;  2VXD A;  1BIA A;  3VB2 A;  2HTS A;  4BU2 A;  2V6C A;  1MDM B;  1JXS A;  4ANJ A;  4BNC A;  3H9Q A;  2OQG A;  4OIR F;  1ODD A;  5DYM A;  5LGU A;  2JA5 J;  1TW3 A;  5D4R A;  3AG4 H;  4A3B J;  1IN7 A;  4Y15 A;  4ZYE A;  3G3Z A;  2KIQ A;  2MGQ A;  4HNU A;  1W5C C;  1G59 A;  2VN2 A;  2QA4 I;  2P5V A;  4BE2 A;  2Y0S N;  2IS2 A;  3B73 A;  2K9L A;  3E5X A;  2YSR A;  2L02 A;  3W2W A;  1RRJ A;  5HDG A;  2IW5 A;  4ENJ A;  1QO0 D;  2VE8 A;  4RAG A;  2KZG A;  2JJ7 A;  1RZ4 A;  3ULQ B;  2EFO A;  2FD5 A;  2V1D A;  4EGY A;  4G8X A;  1A04 A;  3KZZ A;  2CFX A;  3J80 R;  4FX0 A;  3BTI A;  3KEY A;  4L0Z B;  2L9N A;  2VOO A;  3KLO A;  4OOI A;  4XOT A;  2GAU A;  3TOA A;  3TOB A;  1NG7 A;  3O3K A;  3MMY B;  2XAG A;  2TCT A;  3BG9 A;  1K78 A;  3W2A A;  2DDA A;  2XPU A;  1R7J A;  3TP0 A;  3ZMV A;  4OIQ F;  4UUS A;  2XGC A;  2A61 A;  3WOD F;  1UCR A;  5D5U B;  3ZQI A;  4EQQ A;  2VL8 A;  4IX7 A;  2RNJ A;  3RDI A;  1XGN A;  2CO5 A;  2OUM A;  5F0C A;  2NNY A;  2X1C A;  1ZG3 A;  3Q3S A;  3ZMS A;  4RBO A;  4A3J J;  3PUB A;  4Y4R A;  3HSR A;  1SFO J;  2HKX A;  4ZYH A;  1LVA A;  2K9Q A;  2JN6 A;  1QHG A;  1YE9 A;  2VAS A;  3S3N A;  4XKV A;  2HU9 A;  1YJW I;  1K61 A;  4X0G A;  2LY9 A;  4PDK A;  3WHC A;  4U7B A;  2V6E A;  1OCC H;  3Q5F A;  2K9M A;  4EAT A;  5K5R A;  3K70 D;  1XMK A;  4HF2 A;  3ZGK A;  5IPA A;  2P8T A;  1Y6I A;  2P7V B;  2XPV A;  3A4C A;  4LD5 A;  4XRS G;  5IP9 J;  2XC7 A;  2CH0 A;  1P9Q C;  1VI0 A;  2COB A;  5E79 C;  3ZN0 A;  1X19 A;  1DU0 A;  1HKQ A;  1FOY A;  4ENK A;  3EUH C;  4I09 A;  5E3N A;  4EJT A;  3F23 A;  1SFX A;  1J2X A;  2CJJ A;  1OCP A;  1OMI A;  5IYC J;  1X1A A;  5KCM A;  5CJ9 A;  3HEF A;  2LY1 A;  1OQY A;  1PVE A;  2K4J A;  3T0Y A;  3DCF A;  3C2B A;  4F3Q A;  1T0F C;  5DUK A;  2V26 A;  4UB6 C;  4B44 A;  1ETW A;  3GXO A;  4C9Y A;  1YRN A;  1QVT A;  2JMW A;  2GBY A;  5E1X A;  1T95 A;  1X1D A;  3JCU C;  3HDD A;  1VF9 A;  4BUP A;  1R9T J;  2Y75 A;  2W48 A;  1EH8 A;  3GME A;  4PFP A;  2LSO A;  1T6S A;  3QU3 A;  4G6D A;  5CQE A;  1TQM A;  4F7Z A;  2OCE A;  4BHP A;  3W3C A;  4BQO A;  4CIC A;  1N75 A;  1MD0 A;  4P96 A;  2P0T A;  3S1M J;  1VQP I;  3HSE A;  4P5O A;  1W5T A;  2EZL A;  2M34 A;  2W1O A;  4KIB A;  4IZZ A;  2E1M B;  2M9H A;  2JTV A;  1K78 B;  1IDZ A;  1B8I A;  3BCA A;  1ORK A;  3CC7 I;  3S17 J;  3V7S A;  4Q5S F;  4L9J A;  2XPW A;  4RB1 A;  1WHU A;  2HXI A;  4XK4 A;  1ZG1 A;  1FJL A;  2FQ3 A;  4HF0 A;  4PK4 A;  2K85 A;  2CV2 A;  1UZC A;  5LRR A;  2JPB A;  5IT3 A;  5KAI C;  3CCY A;  2QEX I;  1JUP A;  4E70 A;  3HM5 A;  2L4A A;  1GVJ A;  3SZT A;  3OYK A;  3AG2 H;  4QWQ A;  5DD4 A;  5IYB J;  3H3Z A;  5HS7 A;  1BW5 A;  1Z3Y A;  2YX4 A;  2H1L A;  3K1N A;  2KJC A;  5FGM A;  1WJ5 A;  1JT0 A;  4A5M A;  2E1N A;  2DPD A;  4HRI A;  5CYV A;  4XLN F;  2L2O A;  1TC3 C;  3J81 K;  4HYE A;  1DP7 P;  3I71 A;  5IY5 H;  2E36 A;  1J0R A;  2EIK H;  2AQF A;  3OYE A;  3IKT A;  2HQN A;  2VQG A;  1J9I A;  4ABZ A;  2H6C A;  2EBI A;  3F8C A;  3S15 J;  1SD6 A;  3FMR A;  2JVH A;  3DEE A;  4M74 A;  2DA2 A;  5LLQ A;  3KET A;  1R23 A;  3GTQ J;  3MAJ A;  4AIK A;  3VYT B;  2NVQ J;  5EGO A;  2Y0S A;  2F5V A;  1T33 A;  4FE4 A;  2CSO A;  3ABL H;  2X6X A;  5LRS A;  1VND A;  1S3J A;  3IH3 A;  4LGW A;  2WAE A;  3W6K B;  3OYF A;  4O3M A;  3BC8 A;  3BRO A;  4JOM A;  1YRN B;  3W2V A;  4ZDP A;  1P92 A;  2N8G A;  2DMN A;  3RI4 A;  1R49 A;  3CQZ J;  1ERD A;  2WWY A;  2A3S A;  1IO2 A;  1YQA A;  4RM3 A;  3TGN A;  3RKQ A;  1OCO H;  4UV8 A;  2F4O B;  2R7Q A;  4EV0 A;  4M6X A;  2Z2S B;  4ZH4 F;  2BBY A;  1XGM A;  2FBH A;  2HWV A;  3HGY A;  4E7Z A;  3M7G A;  3FXJ A;  2YS9 A;  2AHQ A;  1MNE A;  3JRH A;  2DTZ A;  1ZLK A;  3V42 A;  3C7J A;  5M5W J;  2OPT A;  3R61 A;  1TTY A;  2DFE A;  1BC8 C;  1B8I B;  2KPM A;  4LB5 A;  4ESB A;  3DKX A;  4IPA A;  4A0Z A;  1MBE A;  3BPX A;  4S0H B;  5HLT A;  5DEQ A;  2V9P A;  2KKO A;  3DPU A;  3GLX A;  3OSF A;  1IRX A;  3RSN A;  4OIP F;  3FM5 A;  3OL3 A;  1VQ8 I;  1FPQ A;  1UB9 A;  3DF8 A;  3A01 A;  4XN0 A;  4HOB A;  4UVA A;  3PL8 A;  1XX5 A;  3FBN B;  1ON2 A;  2PBI A;  3F3X A;  4NC6 A;  3I56 I;  1JJ6 C;  1BJZ A;  1FP1 D;  4I76 A;  1ONV A;  2ICW G;  4BEH B;  3E3V A;  4MGR A;  3CDI A;  3K69 A;  3JRG A;  1R1U A;  5K7F A;  1FTZ A;  3C2G A;  1JT6 A;  5IOY A;  4BS9 A;  4XR6 A;  1VQN I;  4XM3 A;  4C2U A;  1ZRE A;  4IRG A;  5FLX K;  4BYY A;  1Y1V J;  1L3L A;  2CW7 A;  5F0H A;  4RGS A;  4HST A;  2VKD A;  1SD7 A;  2DI3 A;  3E6B A;  4Y13 A;  4BKX A;  2VON A;  3GO5 A;  2XV4 S;  4YII A;  2XKO A;  3CUQ B;  3HRT A;  2O8X A;  2R7T A;  3KZY A;  5D4S A;  3TKY A;  3P9C A;  3HOV J;  4IEJ A;  4X1E A;  2PI0 A;  3VOE A;  2BW3 A;  3KP2 A;  3S2W A;  4UHT A;  1DPU A;  1PUF A;  1FYM A;  5LBQ A;  2MYS A;  1NK2 P;  2MUN A;  3G1L A;  2DT5 A;  5EGO B;  2Z9O A;  3KP4 A;  1TLH B;  3PNY A;  4IOC F;  2NOJ B;  3E97 A;  4MTD A;  5EG0 A;  3OS1 A;  1FOW A;  1XSD A;  4BHB A;  1X1P A;  3U2R A;  2VB6 A;  4Q48 A;  4DGW B;  2NAZ A;  3BG6 A;  3K9T A;  2IA2 A;  3JRC A;  5K1Y A;  4LG3 A;  3DTK A;  3CMA I;  3QOD A;  3AG3 H;  1HA8 A;  1XCV A;  1H88 C;  1WZ2 A;  2R7Z J;  5CVJ A;  1JHF A;  3GZN B;  3K4L A;  3I0T A;  3B6A A;  4UNO A;  5HNH A;  1T0F A;  2EQR A;  2KL4 A;  3FM3 A;  4JBA A;  2W00 A;  1JKR C;  3WGH A;  1W7P D;  5E3O A;  1DPR A;  1KU2 A;  4XKB A;  3BTC A;  2CQN A;  2KMU A;  4PSW A;  1T38 A;  1BBY A;  2FNA A;  3K4M A;  3IWZ A;  2QQA A;  2IRF G;  3CDL A;  1HW1 A;  1W5S A;  2VQC A;  3GZ5 A;  3I4M J;  2KP6 A;  3LSK A;  5D5X B;  2LF8 A;  5J4V A;  4B47 A;  3AFH A;  3G1O A;  1XSV A;  2DK5 A;  1JHH A;  3QP5 A;  1U5T A;  4RS8 A;  2MZ4 A;  3TDU C;  1YOV B;  5K7Z A;  1HKT A;  4X6A J;  2DA4 A;  1XDU A;  4HEA 2;  5DCF A;  2O6G E;  4AIH A;  5GAH J;  4RB2 C;  1SFE A;  3J7A O;  3WGG A;  4YIR X;  2JRT A;  4WK8 F;  2ZME B;  1ZGJ A;  2R7U A;  2IGO A;  4L5E A;  3A01 B;  2QYO A;  4R79 A;  4K2E A;  2WTE A;  3TED A;  4AU7 A;  3V8J A;  3K2A A;  2M2E A;  2XAU A;  4KN7 X;  2I8D A;  3QOE A;  1KYW A;  2L54 A;  4KMU X;  3L2U A;  4FE7 A;  3BJO A;  2DFI A;  1D1A A;  2DJI A;  2V1X A;  3UNG C;  4CYC B;  1GDT A;  1BJA A;  1OIS A;  3CCS I;  1QVU A;  3DQV C;  2ZJ2 A;  4CCL A;  3CCR I;  2Q2E A;  4XOP A;  3DKW A;  4A12 A;  4LFU A;  2KFD A;  4D9J A;  6PAX A;  1FBU A;  4EGZ A;  3CC2 I;  1HF0 A;  2R7V A;  2X98 A;  4XRS A;  2VT2 A;  4J19 A;  1O57 A;  3BQZ A;  3OOP A;  3MZY A;  3REO A;  4RLQ A;  2DMU A;  2JA7 J;  3S16 J;  3CDH A;  2LG4 A;  1T56 A;  3VSL A;  5IT9 Z;  3CD6 I;  2BW3 B;  2QQ9 A;  1PUF B;  3NWS A;  3CCQ I;  4A3G J;  4ZZD A;  2FU4 A;  2BHZ A;  4G7H F;  3I58 A;  1OFC X;  1HBX G;  2L3D A;  4M73 A;  1YIO A;  5J8C A;  3A02 A;  3FF5 A;  3QU6 A;  5TIS C;  1OYY A;  3FMQ A;  4PGH A;  3HXL A;  4DBQ A;  4H4K C;  2JQ7 A;  4V19 K;  2E1M C;  2DOE A;  2Q1Z B;  3A2K A;  3OYB A;  2R0Q C;  3OS2 A;  1SD4 A;  3S8P A;  1TP4 A;  2EZH A;  1WFX A;  4IHX A;  4EVI A;  1QRY A;  2BY0 A;  1JUM A;  1HC8 A;  3M9A A;  4FHT A;  5K5O A;  3P7N A;  3F8B A;  4M6Y A;  2GWR A;  2FOK A;  1JI8 A;  5GPA A;  1ZYR F;  4KA4 A;  2CUF A;  1XPX A;  4BL0 B;  1D1C A;  4DYR A;  3CCJ I;  1DGW Y;  3X2Q H;  1B72 A;  3QOP A;  5E3L A;  2BHY A;  5H20 A;  4A3I J;  3VPR A;  3JR9 A;  5GPC A;  2W84 A;  1U0J A;  2C6Y A;  4XON A;  4LLL A;  2IS4 A;  3BZ6 A;  1U5T B;  1K7A A;  4A3C J;  3RTR A;  1R1T A;  2MBF A;  2IGM A;  3Q9S A;  4IVN A;  2Z3Y A;  4ZDL A;  1YO5 C;  2NNN A;  1OCT C;  2VOD A;  2UXX A;  5HLH A;  1GUU A;  2E60 A;  3QPL A;  1AA7 A;  3COA C;  1WCM J;  2F6C A;  2IJL A;  2RC4 A;  4G94 A;  2LH9 A;  4BAC A;  4WXC A;  2JUC A;  2PG4 A;  2HI3 A;  4IQ4 A;  4RLF A;  5KHD A;  5JI6 A;  1XD7 A;  1X4P A;  1ZK8 A;  3GTM J;  4XRM A;  4DJA A;  1RET A;  3G71 I;  2D1V A;  2DA6 A;  1KQ9 A;  1O7F A;  3HGG A;  1Z3X A;  4H0E A;  3J81 R;  3IP4 B;  5GAG J;  3M3Y J;  3KP7 A;  4A2U A;  2Q2E B;  1ZAR A;  2EB7 A;  2EIM H;  3CUO A;  4MFE A;  1ETK A;  3HJE A;  3U1K A;  2WB1 A;  3H3U A;  5BQT A;  3OOU A;  4E7K A;  4PZJ A;  3CO7 C;  3O8G A;  2O9L A;  2LRE A;  4PJ0 C;  1MDM A;  4ENM A;  3RKW A;  2MW8 A;  1KU9 A;  4WXH A;  1PDN C;  3GTP J;  5A2Q R;  2LD5 A;  4B43 A;  5F6F A;  1Z7U A;  2KJB A;  2LTP A;  4ZC3 A;  4GYG A;  1BW6 A;  4CHU A;  3GUD A;  4HPQ A;  1YJN I;  3BT9 A;  3CO6 C;  2A68 F;  3J7Y J;  1M1E B;  3TW7 A;  1LKX A;  4LMY A;  1IF1 A;  2EPF A;  2H8W A;  1FIP A;  3OR2 C;  2BV6 A;  2V9K A;  1R5I D;  1I6X A;  5ILV A;  5D5W B;  3HIF A;  5IT9 K;  2ECC A;  4L9N A;  4M3D A;  4B4C A;  3OYD A;  4HNV A;  4RMN A;  4C30 A;  1Y8R B;  1O3Q A;  4FTH A;  1K4S A;  1JGG A;  4NHJ A;  1N25 A;  3CJQ B;  1SAX A;  2IAI A;  1I39 A;  3VEP A;  1B72 B;  1K79 A;  4PUS A;  5CVU A;  3VYU B;  2L7F P;  4BGD A;  2EFQ A;  5B3S H;  4XNF A;  3JAM K;  2H6B A;  1VQ5 I;  3GTK J;  1EF4 A;  2WC2 A;  3PFY A;  3DU5 A;  5BOX A;  1OR7 C;  2JPC A;  3TO6 A;  2XSJ C;  2CW8 A;  4DOZ A;  2AXL A;  4A5N A;  1G3W A;  2O3F A;  2F48 A;  1C0W A;  2VC0 A;  1PYV A;  3E0J B;  3BZC A;  2R3S A;  3C18 A;  4NC8 A;  1J09 A;  3JW4 A;  4XBF A;  4A6E A;  4BJ5 C;  2JT1 A;  3C3W A;  1VQL I;  1W4M A;  2NS7 A;  1R71 A;  2XIG A;  2LRD A;  1IJW C;  1J7K A;  3CUQ C;  2LKX A;  1D0Y A;  1E3H A;  2GZW A;  4QSH A;  1CGP A;  2FE3 A;  5E18 F;  2F5F A;  1JJ8 C;  1MMN A;  2F2E A;  1H0M A;  3IHU A;  2DN0 A;  4I0A A;  4RAY A;  1WGX A;  3BTL A;  4CZZ A;  2XAH A;  4F91 B;  1W36 C;  2DLL A;  2QQB A;  4WX9 A;  3FIS A;  1XS9 A;  2HOT A;  3GZ6 A;  3QWL A;  2XF5 A;  1ZAO A;  2STW A;  4KUM A;  4DZJ A;  4W97 A;  1GVD A;  5LEJ A;  1ZTR A;  1TBX A;  2EIN H;  2JUG A;  3HOX J;  1LDD A;  2HVR A;  3WG7 H;  4XLC A;  4Y7N J;  1STZ A;  5EEG A;  1LEB A;  5D6E A;  3TBI A;  4YFX F;  3D5L A;  1BOB A;  2TRT A;  4F55 A;  1X2M A;  1RC9 A;  3M1E A;  4XLA A;  2DOA A;  3CCM I;  2UUZ A;  3FZV A;  2VE9 A;  3E6C C;  2CUJ A;  4HF1 A;  3HOW J;  1MKM A;  1BM9 A;  4WXD A;  2HPM A;  2L9V A;  1XN7 A;  3WE3 A;  4A3D J;  4KT5 C;  4CCM A;  1NTC A;  3ABK H;  3FBI B;  3DEU A;  4EM2 A;  3A1Y A;  2OBP A;  4KIT B;  1G2H A;  1DGR M;  1SD5 A;  5FLV A;  2WAQ A;  4XSZ F;  1YX5 A;  4E7L A;  4BY7 J;  5EJC A;  2QLZ A;  2XAF A;  1O3S A;  1VFC A;  2FML A;  5LHI A;  2DK8 A;  1GV2 A;  2LYC A;  2W57 A;  2X0L A;  2X51 A;  2GLO A;  3KX2 A;  3R6S A;  3QYB A;  2XSD C;  1P7I A;  2FJ1 A;  3GLL A;  2QSG X;  2XAS A;  5ILU A;  3I53 A;  4UUT A;  3L09 A;  1Y8Q B;  2HGC A;  4KFC A;  1KON A;  1R5G A;  2CRG A;  1YLF A;  3HBL A;  4KT6 A;  3ZQF A;  4DW6 A;  3SEQ A;  1CF7 A;  2Y2Z A;  2Y9Z A;  2HZT A;  4D5F A;  2EH3 A;  2ZME C;  3AL0 B;  1S8N A;  1EH7 A;  2ZNZ A;  2DU9 A;  3CC4 I;  3ONQ A;  4NUB A;  2Y31 A;  1U3E M;  1YIT I;  4HX8 A;  5GTH C;  4JP0 A;  2EK5 A;  3S2D J;  1IXC A;  4G7O F;  4CZC A;  4LIT A;  3MZ8 A;  1VQO I;  2A6H F;  5FJ8 J;  4P55 A;  3CP8 A;  5DCM B;  3HPG A;  3ZXS A;  4C3H J;  2HS5 A;  2W24 A;  3S3M A;  3FK7 A;  1FMW A;  1QZY A;  1MBK A;  2HPI A;  4N0B A;  3MEX A;  3OYA A;  2PLY A;  3H92 A;  3F0C A;  2EZI A;  4YEL A;  2OQR A;  2IS1 A;  1ON1 A;  2MAB A;  4ZZL A;  2ZJP F;  1WJA A;  2K9N A;  4HG2 A;  5ICG A;  4ENN A;  2KIS A;  4AC0 A;  1LDK B;  3HOU J;  5BPI A;  3K1P A;  1U9O A;  2HEO A;  2LMD A;  3J7A Y;  1QA6 A;  3MWM A;  4KYW A;  3OSG A;  4NC7 A;  5IYD J;  2L4M A;  1T2K A;  2K9S A;  1Z21 A;  3GF2 A;  2LK2 A;  5DUI A;  4I01 A;  2JWT A;  2ZC2 A;  1IN4 A;  5A2Q Z;  3F9K A;  3ZP5 A;  2ZJQ F;  1P4A A;  3RYP A;  1RNL A;  3FXR A;  2K3F A;  2LC2 A;  1Q1H A;  3IH4 A;  2JK3 A;  2JA2 A;  3H9J A;  2RKH A;  3HUG B;  3ZMT A;  1QZZ A;  4A6D A;  2RDP A;  3GCM A;  2CV0 A;  5EEH A;  4XLP F;  2ZXI A;  1OLT A;  3F21 A;  2V79 A;  2M4G A;  1V4R A;  2F4M B;  2RN7 A;  2ESN A;  3RKY A;  1P2F A;  3GTL J;  1V5E A;  4MQ9 F;  4EEF G;  4IHT A;  3BG7 A;  4CGZ A;  3KP3 A;  2FEZ A;  3H5R A;  3ZOB A;  3CCE I;  1TWF J;  1FLI A;  4Q47 A;  3K4K A;  1WJE A;  2OC6 A;  1GLN A;  2GXG A;  1XCB A;  3KE2 A;  3CMM A;  3ZMZ A;  3H0G J;  3M8J A;  3M4O J;  1MW7 A;  4G12 A;  4U0V A;  2VBW A;  4YIF A;  4EJV A;  1U5T C;  4DNC A;  4MEX F;  1BR2 A;  2KT0 A;  4MIM A;  4AD9 A;  1OJL A;  2V1N A;  3L2Q A;  5BMZ A;  1CF7 B;  2VC1 A;  3VDX A;  4A3M J;  3IWF A;  2PN6 A;  1R5H A;  5TRD A;  1XMA A;  1X3U A;  1IN8 A;  2P7C B;  1HOM A;  4LIV A;  3WTW C;  4CXF A;  1MMA A;  3WTV C;  3NQO A;  1FP2 A;  4ZTJ A;  1TL8 A;  2PFB A;  2E19 A;  4AWX B;  3G4S I;  4BQA A;  1R6R A;  3FKI J;  2FXA A;  2VJI A;  2VJJ A;  3H9G A;  1NK3 P;  1YYV A;  2DPU A;  4RM2 A;  4QPO A;  1MH4 A;  3RPU D;  1S9H A;  1YG2 A;  1LPQ A;  4S04 A;  1WI3 A;  2CS3 A;  1WVR A;  4BEH A;  3F22 A;  5F64 A;  2FNP A;  4JK1 X;  3K1M A;  4B1R A;  3PFI A;  1WJD A;  1Z0X A;  1OR7 A;  2DYS H;  2R5Y A;  3PIP F;  3RZD J;  2Z1D A;  1SVL A;  2LR8 A;  4LLG F;  2AO9 A;  2JRM A;  2M0M A;  4E7J A;  5DV5 A;  3G73 A;  4W1U A;  4KMF A;  4P1W A;  3PSF A;  5CKT A;  2J5O A;  1HKS A;  3MFK A;  3L9F A;  3CUQ A;  4A0X A;  1ETO A;  3BLY A;  4MO7 A;  3BZK A;  3Q0W A;  5CQG A;  2X6Y A;  1YX3 A;  2O03 A;  3FHN A;  2PEX A;  3FK6 A;  4KIS A;  5DM6 F;  1OPC A;  4U0Y A;  2E2H J;  1T8I A;  2CUE A;  3L2C A;  2E35 A;  2ZB9 A;  2MC3 A;  2EIL H;  3CJR B;  3HKZ A;  5HLI A;  2Z99 A;  1QHH D;  3DBR B;  3JTH A;  2ISZ A;  2EV5 A;  3FDY A;  3J80 Z;  2ELH A;  3F6O A;  5LD2 C;  2R7R A;  3ASN H;  2QBY A;  1H9G A;  3BR2 A;  1JKQ C;  1Y1W J;  2XKP A;  3MN2 A;  2LLK A;  1EA3 A;  2J5P A;  3IC7 A;  2Q8K A;  2XDV A;  3PM1 A;  1IGN A;  5JLX A;  1Z1D A;  4IL6 C;  4N4N B;  4L0Y B;  3BG5 A;  4ZYD A;  4OAZ A;  1DQU A;  2HYG D;  1AOY A;  1FT9 A;  1MH3 A;  4UUV A;  4HBL A;  4A3F J;  5ICC A;  2DA7 A;  1Y0N A;  1LUJ B;  1LEA A;  2X1D A;  2XHK A;  2ISY A;  2ZNY A;  3PNV A;  4L9V A;  3HYI A;  5DS9 A;  5C3E J;  2DOF A;  2COM A;  2ESH A;  3B6C A;  1SEU A;  1QU3 A;  3BR6 A;  2ID6 A;  2V4J C;  3SDG A;  3OYJ A;  4RGU A;  3T8R A;  5L3B A;  1IV8 A;  3GVA A;  3PO3 J;  2MLG A;  2WAD A;  1MBJ A;  2ZME A;  2ZXW H;  2HVS A;  5FRN A;  1X3Z B;  3I55 I;  4G9Y A;  3PQK A;  4XMY A;  1MSE C;  2UV1 A;  3F8F A;  4BY1 J;  4XLH A;  3P9K A;  1JGS A;  2LKP A;  2D45 A;  2CMP A;  2R5Y B;  4CYC A;  3ZQL A;  1GXQ A;  1APL C;  1ETY A;  3HB9 A;  1X4O A;  2AXT C;  3BPV A;  1QPM A;  1O7L A;  1EJ9 A;  2M45 A;  1FY7 A;  2FQ4 A;  2L01 A;  2Z5U A;  2VKE A;  1IXS B;  3L7W A;  3QYF A;  3MKY B;  3J7Z I;  1O4X A;  5J47 A;  3LSH A;  3LQR A;  3WTX C;  3LA3 A;  3PSI A;  1YTY A;  2JA8 J;  3TP3 A;  2I10 A;  4FT8 A;  4HZF A;  5KAF C;  3DKY A;  3CLO A;  1AU7 A;  3K4J A;  5HNF A;  2E34 A;  3K0L A;  3VFZ A;  4M3G A;  2XRN A;  3GEZ A;  3CMY A;  5BS6 A;  1UHW A;  2BY2 A;  3MKL A;  4JYK A;  1D3Y A;  1D0X A;  4PFO A;  1ZGW A;  4A3K J;  4ESJ A;  1I1G A;  4HDV A;  1F9N A;  2ETH A;  2Y48 A;  1POG A;  5F27 A;  1LE8 B;  2HDW A;  2WB1 N;  2DMQ A;  4PGG A;  4YRV A;  3GBG A;  3CLQ A;  2GXB A;  5C44 J;  3SZP A;  3OYM A;  1NHA A;  5H2F C;  3VOD A;  1YI2 I;  4MHG A;  2QBY B;  3AL0 C;  3K6G A;  1WSU A;  5KK1 A;  3WU2 C;  2MD5 A;  4CUG A;  2DT6 A;  4L5I A;  2BXZ A;  2E5Z A;  4I0B A;  2EFW A;  2IS6 A;  3BQY A;  1W0T A;  3TDZ C;  2LBF A;  2LY2 A;  2ZXJ A;  4HV5 A;  1TQP A;  3TMO A;  3E5Q A;  2DYR H;  4HV6 A;  2BY3 A;  4YFN F;  2HFH A;  3BP8 A;  3VYS B;  3LSG A;  1RKT A;  4QIW N;  1TWG J;  1F43 A;  1HDD C;  2NVT J;  2ZCW A;  1D8J A;  3TQN A;  4P9F A;  2CU7 A;  3BR1 A;  2HZD A;  4XSX F;  2DOD A;  4CCN A;  4CO8 A;  2VQL A;  2EA2 A;  3G2B A;  1USS A;  3A0B C;  2Y0M A;  1H89 C;  3DV8 A;  1ZR4 A;  2H94 A;  1KU7 A;  1S72 I;  3BY6 A;  5DM7 F;  4UB8 C;  1B6A A;  4JX5 A;  3H36 A;  4IQJ A;  1KYZ A;  3HZJ A;  3FXU A;  4PJJ A;  3RJP A;  3EYI A;  5E8G A;  1E2X A;  4AYB A;  3V4G A;  3NEU A;  4G6T B;  4U7D A;  2PMZ A;  1MSF C;  3VSK A;  2Q0O A;  3F72 A;  3DP7 A;  1MBF A;  1W1W E;  2HYF A;  5HOD A;  4F93 B;  3SFI A;  3PJR A;  3A52 A;  3A0H C;  1AWC A;  1H8A C;  1N77 A;  1BC7 C;  1WKM A;  2YPR A;  1EH6 A;  1Z67 A;  2DW4 A;  1PP8 F;  1WH7 A;  2MC4 A;  1RKW A;  2VPL A;  1MJA A;  4GFB A;  5E17 F;  2QQ8 A;  3QQA A;  1LFU P;  2EIJ H;  3N05 A;  1Z05 A;  5J6X A;  3R0A A;  1B9M A;  1Y39 A;  3A03 A;  4RB3 C;  3DPL C;  1TT0 A;  1LNW A;  2EWN A;  3RYR A;  5J8F A;  1S7A A;  2FX0 A;  2XGD A;  1FSH A;  3UKG A;  3KEQ A;  2WY7 Q;  1WJB A;  1WI9 A;  4KN4 X;  4IHV A;  4M72 A;  4AUX A;  3R60 A;  3I9V 2;  4A0Y A;  3QRF F;  3UR3 C;  5HOO A;  1LQ1 A;  1FOK A;  3GTG J;  1ETX A;  3ZN1 A;  2M30 A;  4F52 A;  1QNT A;  1YW8 A;  4GRI A;  3I64 A;  2NVU B;  5LGN A;  3OIO A;  2CYY A;  2JA6 J;  2QWW A;  2DFH A;  1ETQ A;  1HW5 A;  2LBF B;  2WAQ N;  3OY9 A;  1E3O C;  2K7L A;  2M5W A;  3FXQ A;  1L0O C;  3MQ0 A;  5B1B H;  4CA0 A;  1ZRF A;  4D5C A;  1BA5 A;  3ZR8 X;  2ZSI B;  2DMP A;  3MD2 A;  1I3Q J;  1ZHF A;  1S7E A;  3L1P A;  4KJZ A;  2CW0 F;  3K4B A;  3U21 A;  4UY8 I;  4B8X A;  1A31 A;  5E1Z B;  2ZFU A;  2QSF X;  2YX7 A;  3H5A A;  3W6J B;  2QKM B;  4F92 B;  5C4J J;  1YFH A;  2UWM A;  2EV0 A;  5GTI C;  1XG1 A;  3DLL F;  2DFF A;  1PJR A;  1SVO A;  1VQ9 I;  3BJ6 A;  3FIW A;  2CFO A;  3K2Z A;  5L3F A;  4L18 B;  4M9S A;  4M3F A;  5D6F A;  2Y69 H;  1ACI A;  1P7J A;  2YU3 A;  4WWC A;  3EPZ A;  3OIQ A;  3MKW B;  5TGT A;  1SAN A;  1ZEL A;  2KQR A;  3MZH A;  2IEK A;  4XIC A;  4P9U A;  1OKR A;  3LFU A;  2DMT A;  3WU0 A;  4KIF A;  2K40 A;  1UMQ A;  4HAM A;  4KIG A;  4FAS D;  1T08 B;  2G9W A;  4XID A;  3ELK A;  3FXO A;  3JRI A;  1ZN2 A;  4A93 J;  1QZE A;  1IG7 A;  2E7X A;  2P6S A;  2X48 A;  2A69 F;  1YS6 A;  2OA4 A;  2D2W A;  3E6D A;  4OMZ A;  4RAF A;  2RGV A;  1IN5 A;  2EA4 A;  2G0E A;  3EUK L;  2FBK A;  3OS0 A;  2X6O A;  4ZDO A;  2IGK A;  4RAZ A;  1ETV A;  3AG1 H;  5F1J A;  1Q1V A;  2HQ5 A;  2YR2 A;  3HHH A;  1X2N A;  4E6K G;  2GQQ A;  2LOO A;  3RQI A;  1JE8 A;  2NS8 A;  3R0J A;  2A6T A;  1RUN A;  3H0D A;  4BJT A;  1IN6 A;  3C1D A;  3EUA A;  4QPQ A;  1TZL A;  2OCC H;  1P4X A;  5EZG A;  2JSC A;  4CSW A;  1LJ9 A;  1IUF A;  2P5L C;  2EZK A;  3K4N A;  3DPT A;  1FOX A;  4II3 A;  3ZPL A;  4J01 A;  4Y17 A;  4AVZ A;  1P6R A;  1X3W B;  5EEA A;  1FEX A;  1BN5 A;  2XB0 X;  1B59 A;  3V7R A;  2P6T A;  2P4W A;  1U6G A;  3EQL F;  1I1S A;  1SFU A;  4FQG A;  3VYR B;  4O6J A;  1FYK A;  3BTJ A;  2HDD A;  5AIQ A;  2QUF A;  2M3A A;  4HNT A;  3L2R A;  1W7P A;  1CQT A;  2ZBK A;  3LFK A;  4XLF A;  1RPW A;  2EFP A;  2A07 F;  2M7A A;  2H1K A;  1LDJ A;  4PSX A;  1ZLJ A;  3O2P E;  3ERM A;  2GM4 A;  1S29 A;  4AVP A;  1XDS A;  2FSW A;  3IAS 2;  1I50 J;  1HQC A;  2K86 A;  3OWT A;  5LGT A;  1LVK A;  1MGT A;  2JVG A;  2RQQ A;  1UFM A;  1H9T A;  4V2F A;  5DCM A;  3HSF A;  3RQ4 A;  1FBS A;  1R4N B;  2OF7 A;  3BJA A;  1S6L A;  3DLA A;  3TO9 A;  3FXK A;  4N4O B;  3LAP A;  3V7C A;  1FZP B;  2H27 A;  4BAY A;  1QPI A;  2P81 A;  2MVT A;  2BXY A;  3LA2 A;  4Y52 J;  5C4X J;  1ZG5 A;  3ABM H;  2R7W A;  1U9N A;  1ZRC A;  4C2T A;  2EFN A;  1UST A;  3BCB A;  3KYD B;  2K3P A;  4LB6 B;  2KDO A;  2KLO A;  3H35 A;  3ZQQ A;  4A69 C;  1MJ9 A;  3ZRG A;  3JRE A;  3K7A J;  1AKH B;  1HW2 A;  3SQN A;  4BE1 A;  1SMY F;  3LSR A;  5FLX R;  2R4G A;  2A6E F;  4C3J J;  1P4W A;  1S7O A;  3GFJ A;  4QTR A;  2WV1 A;  1VQ7 I;  2ZSH B;  1FNN A;  2UZK A;  4E7I A;  4E7H A;  2PX9 A;  3HOY J;  3LWF A;  1IW7 F;  2XAJ A;  2LP0 A;  3NAU A;  2ID3 A;  5JVG F;  4LIU A;  3V8K A;  1O3R A;  3HRM A;  3H1C A;  3HUG A;  3GFL A;  1ZKG A;  3C2H A;  1W36 D;  5ICF A;  5DTD A;  3I5U A;  3D1N I;  3NAR A;  2VBZ A;  3P9I A;  3U1D A;  1TWC J;  3M1C A;  1J75 A;  3N4M A;  2M8E A;  3BG3 A;  4B09 A;  2BGC A;  4ITV A;  1D1B A;  1ULY A;  5E8I A;  2RNG A;  4AM3 A;  3RZO J;  1YHQ I;  1XC5 A;  1I5Z A;  5JHU A;  2PJR A;  4LLN A;  4S05 A;  1A6Q A;  4XL9 A;  3HKZ N;  2I5U A;  4HX7 A;  4A3E J;  5L3E A;  1IZ1 A;  5CLS A;  1X1B A;  1MMS A;  1R00 A;  4LJZ F;  3SZG A;  2XVC A;  4JQF A;  2EV6 A;  4NQW B;  1JUS A;  2HOA A;  2DTR A;  1W7P B;  2L7K A;  2ZKZ A;  4DIQ A;  2BVL A;  3RIR A;  1HST A;  4UVC A;  2CWE A;  2QVO A;  4PJL A;  3IUO A;  2KHM A;  5M3F J;  1IUY A;  2HKO A;  2JZY A;  1KQ0 A;  3ZQG A;  4B3X A;  1I27 A;  1K4T A;  1Z7L A;  3HPH A;  3CZ6 A;  2ELJ A;  3P5J A;  4D1Q A;  5GAD J;  2X1E A;  1XSX A;  4AID A;  2OAZ A;  3F8N A;  2KDZ A;  2EJR A;  3ISP A;  2VJ4 A;  3GW2 A;  2NVX J;  3J7A W;  5F0F A;  4PCQ A;  2F5D A;  3K70 C;  2YU9 J;  5HDK A;  2XRL A;  2QM3 A;  3J81 Z;  2O7O A;  4GO1 A;  2BYV E;  1MND A;  2KRF A;  4M71 A;  3HRS A;  1KGS A;  3QAH A;  3RPQ A;  2F5E A;  3RKX A;  4BQN A;  4NDL A;  2LKS A;  4XLE A;  2M7B A;  2KIF A;  4ON0 A;  1R22 A;  5BNG A;  1G6N A;  1B4A A;  4ASN A;  3CJN A;  2X85 A;  4N9I A;  1Y0U A;  2E2I J;  2OTL I;  1V3F A;  5FO5 A;  3IRQ A;  4YFK F;  3GFI A;  5BPD A;  3T5X A;  2PMU A;  1R1V A;  4UXN A;  4BDY A;  2L7M P;  2R93 J;  3KP6 A;  3L00 A;  1K6O A;  5K7H A;  3L2W A;  3KYL A;  3S2H J;  1VZ0 A;  3E6M A;  1Z6T A;  3S32 A;  3SYT A;  3EDP A;  3HOZ J;  4RDU A;  3ZQC A;  1HLV A;  1RUO A;  1HXD A;  4I7H A;  1MNM C;  3FWE A;  5FKL A;  1MJB A;  2OD5 A;  5CPR B;  2ACJ A;  3ROU A;  3OIP A;  3S1R J;  2HOE A;  1GT0 C;  1OCR H;  5JLW A;  1D8K A;  3ABU A;  1MBG A;  5E3M A;  1ENH A;  3EET A;  2HTJ A;  2P0W A;  1XMX A;  3M8E A;  4M6V A;  1VTN C;  1RR8 C;  2PJR B;  4I2O A;  2UXN A;  3KEO A;  1IRG A;  2R7F A;  1BI3 A;  3CF2 A;  1G3T A;  2XAQ A;  4V2G A;  2DO7 A;  3CP2 A;  1RES A;  5ILS A;  1ZGA A;  3OL4 A;  4CDG A;  3E1S A;  4XKC A;  1OYI A;  4FIS A;  1MBH A;  4UVB A;  2XB5 A;  5J40 A;  3HOT A;  3PNT A;  4YG2 F;  2FRH A;  2VXZ A;  5TJJ A;  4NBQ A;  2LNB A;  1BL0 A;  2VI6 A;  1SAU A;  3O6B B;  5FKM A;  4CH7 A;  5J1U A;  1VQ6 I;  3KLN A;  3E5U A;  1WQ2 A;  2F4I A;  5E1W A;  2B0L A;  1F4K A;  3S1Q J;  2E5N A;  2L9R A;  1E3P A;  4UUS B;  5D5V B;  5FLX Z;  4EM1 A;  1HCR A;  4MNU A;  4ZTF A;  5M5Y J;  4HQM A;  4IO9 F;  2VJ5 A;  3G1M A;  1T98 A;  3CES A;  2BZT A;  1I6H J;  1Z91 A;  2V1U A;  2B7E A;  4ZYG A;  2LDU A;  2CQ7 A;  1QQI A;  1SMT A;  4Z6Y A;  4Q4Z F;  2HNH A;  2B9S A;  2JSP A;  3RCO A;  5L3D A;  2RRE A;  4HSR A;  5D8K B;  2HQA A;  2P5K A;  3NWT A;  2XRO A;  4IOA F;  4R8H A;  3B02 A;  3O8H A;  4DZP A;  3LST A;  4AYB N;  2WY8 Q;  5M5X J;  2HDC A;  2IT0 A;  3DTE A;  3R4K A;  1D5V A;  1E17 A;  3JTG A;  5CVI A;  3Q0U A;  2PMZ N;  2ZO4 A;  5DD8 A;  1GHC A;  2CG4 A;  1WRJ A;  3DWL E;  5FD6 A;  5LHH A;  4IJA A;  4C3I J;  3FXL A;  2VBY A;  5IP7 J;  2O8K A;  2A5Y B;  3HC7 A;  4GGG A;  1WH5 A;  3F8M A;  3OYC A;  2ZJR F;  2KZV A;  1G4D A;  5FKO A;  3TW6 A;  3QP6 A;  3ECO A;  4OIN F;  1LE8 A;  3ZQH A;  3SFZ A;  1D0Z A;  1G8X A;  1B1B A;  3S93 A;  3GYH X;  2E7W A;  2HR3 A;  4MTE A;  5J4Y A;  1UG0 A;  4R1H A;  1UJ8 A;  4HW0 A;  4MFD A;  4IXA A;  1MIJ A;  2MSY A;  3DU6 A;  4HA8 A;  1EV7 A;  2GIV A;  2E1C A;  3GTO J;  3JRB A;  1K83 J;  5A2Q K;  2KIM A;  2MH2 A;  3HTU A;  2YUS A;  2CQQ A;  5EZH A;  1F36 A;  1MMD A;  2RAE A;  3T8T A;  4AIJ A;  5IT9 R;  3QPS A;  4WCG A;  4UV9 A;  3KIO A;  4BH9 A;  1V5G A;  4E4H A;  5JFR A;  2VQH A;  3LQQ A;  4CCJ A;  1YW9 A;  3HOS A;  5EYR A;  5LHG A;  1I3A A;  2FA5 A;  2GOX B;  2G7H A;  1R58 A;  3JAM R;  4HDU A;  1K6Y A;  1U78 A;  1IRZ A;  1OCZ H;  2NVY J;  2L7Z A;  3JRF A;  4JX4 A;  1S5L C;  2DT7 B;  2MLK A;  3CCU I;  3OMY A;  1X58 A;  2NRA C;  3ML6 A;  1NG6 A;  4IRI A;  5GP9 A;  3WU1 B;  2O61 A;  3IV5 A;  3BR0 A;  3ZMU A;  3LNQ A;  2XF6 A;  2NS0 A;  2Y9Y A;  2VLA A;  2ZXH A;  2B63 J;  3CCL I;  2LF7 A;  3HG9 A;  4C2M J;  2VIX A;  5IOZ A;  4I6Z A;  3LSJ A;  2G7U A;  1U8B A;  2DXI A;  2M4K A;  1YIJ I;  1GV5 A;  1GXP A;  4HLY A;  3CF5 F;  4Y3O A;  5L3G A;  4IF4 A;  2R7D A;  4EMS A;  2L9S A;  4BHC A;  3HRU A;  1IV6 A;  4HLX A;  2XGE A;  4LK1 F;  1FWZ A;  3OYI A;  4EJW A;  3KCC A;  3PIO F;  2RV8 A;  2VKH A;  2DA1 A;  4EJU A;  1UAA A;  3LSI A;  3DEW A;  4G6Q A;  2FF4 A;  1J5Y A;  1LB2 A;  3WG9 A;  2VOP A;  4U88 A;  2BE5 F;  3I54 A; 
#chains in the Genus database with same CATH homology
 2V9V A;  5L3C A;  3ABT A;  1REP C;  3ZMD A;  3WTS C;  4EJO A;  2GA1 A;  1BI1 A;  1FSE A;  5JVT A;  4MQV A;  4LG0 A;  1U8R A;  3PQJ A;  3EUH A;  2CGP A;  1IXR C;  3F6V A;  2PJP A;  2QEN A;  4M9X A;  2TDX A;  1Z6R A;  2STT A;  2MA3 A;  2OZU A;  5JR3 A;  3FHZ A;  5F1R A;  4OU0 A;  3GX4 X;  1F1Z A;  2DQL A;  3WTZ A;  1U2W A;  4RB0 A;  4ETS A;  3J80 K;  5HS9 A;  4DQ2 A;  4D0P A;  1ZH5 A;  4U0W A;  3WGI A;  4I98 B;  1BOA A;  3IL2 A;  1TNT A;  1YS7 A;  1G3S A;  2PMH A;  2IA1 A;  3RPU A;  2M1B A;  1J59 A;  5K5Q A;  2K02 A;  3GFM A;  3ERE D;  3WTT C;  1WWX A;  1QGP A;  5FFX A;  1UHM A;  2HQR A;  4RGR A;  2ZFW A;  1TW2 A;  5ED4 A;  3EYY A;  1KQ8 A;  5ERI A;  4FX4 A;  1KA8 A;  3ZQ7 A;  5FFZ A;  5FD5 A;  2QZ8 A;  3NRV A;  1QBJ A;  1OYW A;  2D1H A;  5HDN A;  4IRH A;  5HS8 A;  4L9T A;  4LG0 B;  3M8F A;  5CVV A;  2W85 A;  4N9H A;  1R36 A;  2O0Y A;  1T39 A;  4Z2Y A;  1O3T A;  4QLC U;  3D0S A;  2NYX A;  3JAM Z;  3HTS B;  5FB2 A;  4TV7 A;  5CVR A;  1DUX C;  1XB4 A;  2XGX A;  3FX3 A;  2RVC A;  3HHG A;  4MEY F;  4RGX A;  2AS5 F;  2DAO A;  3I59 A;  3V8L A;  1BI0 A;  2F5C A;  2GA2 A;  4EM0 B;  5AON A;  2DBB A;  4LK0 F;  4I02 A;  4XRF A;  2Z33 A;  4M9Z A;  1ZRD A;  2VT3 A;  5E20 A;  4KDP A;  1YW7 A;  5AIP A;  2X4H A;  2ADU A;  1G3Y A;  3DFG A;  1IAW A;  3CTA A;  3Q9V A;  3LAJ A;  1KU3 A;  2XUB A;  3QPH A;  2K4B A;  3KFW X;  1BIB A;  1BI2 A;  2H09 A;  3WE2 A;  4OMY A;  1XGO A;  1TQI A;  3KP5 A;  3ECH A;  3AAF A;  4HQE A;  2MH9 A;  2RQP A;  3TO7 A;  2WV0 A;  2PQ8 A;  3BDD A;  2IA0 A;  1FYL A;  2M87 A;  4KIC A;  1RIO H;  4CYD A;  5ICE A;  2CQK A;  2VBX A;  4NQW A;  2K27 A;  3SXY A;  1Z9C A;  4NB5 A;  5D8L B;  5KVR A;  4HX4 A;  3U9G A;  3I59 B;  3T1B A;  2IVM A;  2FBI A;  2DQR A;  5H6Q A;  1B9N A;  4KNY A;  5DDG A;  3LA7 A;  4WF2 A;  1PUE E;  3IRR A;  5HLG A;  3BWG A;  3GWZ A;  1DDN A;  3DXJ F;  2IPQ X;  4GXO A;  4GYI A;  3IKV A;  2OZ6 A;  4BXU A;  4L5J A;  2OU2 A;  4IHS A;  1XGS A;  3WTU C;  5LEK A;  3N97 A;  1F5T A;  1TNS A;  2BEO A;  5HVQ C;  2W25 A;  5H6R A;  3WTY C;  1HSJ A;  2FMY A;  3JSP A;  4GCV A;  1FC3 A;  1FBQ A;  4ESF A;  2IP2 A;  3I4P A;  4OIO F;  1IRF A;  3BOQ A;  2KIU A;  3OV8 A;  3QPT A;  4G7Z F;  1PP7 U;  3JSO A;  4O5V A;  1RI7 A;  3FMS A;  3SHF A;  3MCZ A;  1MZB A;  1FX7 A;  1BIA A;  3VB2 A;  2HTS A;  1MDM B;  2V6C A;  1JXS A;  4BNC A;  2OQG A;  4OIR F;  1ODD A;  5DYM A;  5LGU A;  1TW3 A;  5D4R A;  1IN7 A;  4Y15 A;  4ZYE A;  3G3Z A;  2VN2 A;  2P5V A;  3B73 A;  3E5X A;  2YSR A;  2L02 A;  5HDG A;  2IW5 A;  4ENJ A;  1QO0 D;  2VE8 A;  1RZ4 A;  3ULQ B;  2EFO A;  2V1D A;  4EGY A;  4G8X A;  1A04 A;  3KZZ A;  2CFX A;  4FX0 A;  2VOO A;  4L0Z B;  3KLO A;  4OOI A;  2GAU A;  3TOA A;  3TOB A;  3O3K A;  2XAG A;  1K78 A;  1R7J A;  3ZMV A;  4OIQ F;  2A61 A;  3WOD F;  1UCR A;  5D5U B;  4EQQ A;  2RNJ A;  3RDI A;  1XGN A;  2CO5 A;  2NNY A;  1ZG3 A;  3ZMS A;  3HSR A;  2HKX A;  4ZYH A;  1LVA A;  4U7B A;  4PDK A;  3Q5F A;  5K5R A;  1XMK A;  4HF2 A;  2P8T A;  2P7V B;  4LD5 A;  3ZN0 A;  1HKQ A;  4ENK A;  4I09 A;  4EJT A;  3F23 A;  1SFX A;  1J2X A;  1OMI A;  5CJ9 A;  2K4J A;  3T0Y A;  5DUK A;  3GXO A;  5E1X A;  2Y75 A;  1EH8 A;  2LSO A;  1T6S A;  3QU3 A;  4G6D A;  4F7Z A;  1TQM A;  4BHP A;  4CIC A;  1MD0 A;  4P96 A;  3HSE A;  4P5O A;  1W5T A;  4KIB A;  2JTV A;  1K78 B;  3V7S A;  4Q5S F;  4L9J A;  4RB1 A;  1ZG1 A;  2FQ3 A;  4HF0 A;  5LRR A;  2JPB A;  5IT3 A;  4E70 A;  2L4A A;  1GVJ A;  3SZT A;  4QWQ A;  5DD4 A;  3H3Z A;  5HS7 A;  2YX4 A;  3K1N A;  2KJC A;  5FGM A;  4A5M A;  2E1N A;  2DPD A;  5CYV A;  4XLN F;  3J81 K;  4HYE A;  1DP7 P;  3I71 A;  1J0R A;  3IKT A;  2HQN A;  1J9I A;  2H6C A;  3F8C A;  1SD6 A;  3FMR A;  4M74 A;  5LLQ A;  3KET A;  1R23 A;  3MAJ A;  4AIK A;  2CSO A;  5LRS A;  1S3J A;  4LGW A;  3W6K B;  4O3M A;  3BRO A;  1P92 A;  3RI4 A;  2WWY A;  2A3S A;  1YQA A;  3TGN A;  4UV8 A;  4EV0 A;  4M6X A;  4ZH4 F;  2BBY A;  1XGM A;  2FBH A;  2HWV A;  3M7G A;  1ZLK A;  3C7J A;  3R61 A;  1TTY A;  1BC8 C;  4LB5 A;  4ESB A;  4IPA A;  4A0Z A;  3BPX A;  5DEQ A;  2KKO A;  3GLX A;  4OIP F;  3FM5 A;  1FPQ A;  1UB9 A;  3DF8 A;  4HOB A;  4UVA A;  1ON2 A;  2PBI A;  3F3X A;  1FP1 D;  1ONV A;  3E3V A;  4MGR A;  3K69 A;  1R1U A;  1ZRE A;  4IRG A;  5FLX K;  4BYY A;  1L3L A;  4RGS A;  1SD7 A;  2DI3 A;  3E6B A;  4Y13 A;  2VON A;  3GO5 A;  2XV4 S;  4YII A;  2XKO A;  3CUQ B;  3HRT A;  2O8X A;  3KZY A;  5D4S A;  3TKY A;  3P9C A;  2PI0 A;  3VOE A;  3KP2 A;  3S2W A;  4UHT A;  1DPU A;  1FYM A;  5LBQ A;  2DT5 A;  2Z9O A;  3KP4 A;  1TLH B;  3E97 A;  4MTD A;  1XSD A;  4BHB A;  3U2R A;  4Q48 A;  2NAZ A;  3K9T A;  2IA2 A;  5K1Y A;  1XCV A;  5CVJ A;  1JHF A;  3I0T A;  4UNO A;  1T0F A;  3FM3 A;  4JBA A;  3WGH A;  1W7P D;  1DPR A;  1KU2 A;  1T38 A;  1BBY A;  2FNA A;  3IWZ A;  2QQA A;  2IRF G;  1HW1 A;  1W5S A;  3GZ5 A;  5D5X B;  2LF8 A;  1XSV A;  2DK5 A;  1JHH A;  3QP5 A;  1U5T A;  4RS8 A;  3TDU C;  1HKT A;  1XDU A;  5DCF A;  2O6G E;  4AIH A;  4RB2 C;  3J7A O;  1SFE A;  3WGG A;  2JRT A;  4WK8 F;  2ZME B;  1ZGJ A;  2QYO A;  4R79 A;  4K2E A;  2WTE A;  3V8J A;  4KN7 X;  1KYW A;  2L54 A;  4KMU X;  3BJO A;  2DFI A;  2V1X A;  1BJA A;  3DQV C;  2ZJ2 A;  2Q2E A;  4A12 A;  3DKW A;  4LFU A;  6PAX A;  1FBU A;  4EGZ A;  2VT2 A;  1O57 A;  3OOP A;  3MZY A;  3REO A;  3CDH A;  5IT9 Z;  2QQ9 A;  4ZZD A;  2FU4 A;  4G7H F;  3I58 A;  1HBX G;  2L3D A;  4M73 A;  1YIO A;  5J8C A;  3FF5 A;  3QU6 A;  1OYY A;  3FMQ A;  4PGH A;  1SD4 A;  4EVI A;  3M9A A;  5K5O A;  4FHT A;  3P7N A;  3F8B A;  4M6Y A;  2GWR A;  2FOK A;  1ZYR F;  4KA4 A;  3QOP A;  5H20 A;  2W84 A;  2C6Y A;  4LLL A;  3BZ6 A;  1U5T B;  1K7A A;  3RTR A;  1R1T A;  2MBF A;  3Q9S A;  4IVN A;  2Z3Y A;  1YO5 C;  2NNN A;  2VOD A;  2UXX A;  5HLH A;  3COA C;  2IJL A;  2RC4 A;  4G94 A;  4WXC A;  2PG4 A;  5JI6 A;  1XD7 A;  2D1V A;  1KQ9 A;  1O7F A;  4H0E A;  3KP7 A;  4A2U A;  1ZAR A;  2EB7 A;  3CUO A;  3H3U A;  5BQT A;  4PZJ A;  3CO7 C;  1MDM A;  4ENM A;  3RKW A;  1KU9 A;  4WXH A;  1PDN C;  5F6F A;  1Z7U A;  2KJB A;  4GYG A;  4CHU A;  3GUD A;  3CO6 C;  2A68 F;  4LMY A;  1IF1 A;  2BV6 A;  5ILV A;  1I6X A;  5D5W B;  3HIF A;  5IT9 K;  4L9N A;  1O3Q A;  4NHJ A;  1SAX A;  3VEP A;  1K79 A;  5CVU A;  2EFQ A;  3JAM K;  2H6B A;  2WC2 A;  5BOX A;  2JPC A;  3TO6 A;  2AXL A;  4A5N A;  1G3W A;  2O3F A;  1C0W A;  2VC0 A;  2R3S A;  3C18 A;  3JW4 A;  4XBF A;  4A6E A;  2JT1 A;  3C3W A;  1W4M A;  2XIG A;  1J7K A;  3CUQ C;  2GZW A;  1CGP A;  2FE3 A;  5E18 F;  2F5F A;  2F2E A;  1H0M A;  3IHU A;  4I0A A;  4RAY A;  4CZZ A;  2XAH A;  2DLL A;  2QQB A;  4WX9 A;  3GZ6 A;  1ZAO A;  2STW A;  4KUM A;  5LEJ A;  1TBX A;  1LDD A;  1LEB A;  1STZ A;  5EEG A;  5D6E A;  4YFX F;  3D5L A;  3M1E A;  2VE9 A;  3FZV A;  3E6C C;  4HF1 A;  1MKM A;  1BM9 A;  4WXD A;  1XN7 A;  3WE3 A;  4KT5 C;  3DEU A;  4EM2 A;  2OBP A;  1SD5 A;  4XSZ F;  2QLZ A;  2XAF A;  1O3S A;  2FML A;  5LHI A;  2DK8 A;  2X0L A;  2W57 A;  3R6S A;  2XAS A;  5ILU A;  3I53 A;  3L09 A;  2HGC A;  4KFC A;  1R5G A;  1YLF A;  1CF7 A;  2HZT A;  1S8N A;  1EH7 A;  2ZNZ A;  2DU9 A;  1U3E M;  4HX8 A;  4G7O F;  2EK5 A;  1IXC A;  2A6H F;  4P55 A;  5DCM B;  2HS5 A;  2W24 A;  1QZY A;  4N0B A;  3MEX A;  2PLY A;  3H92 A;  2OQR A;  1ON1 A;  4ZZL A;  5ICG A;  4ENN A;  1LDK B;  5BPI A;  3K1P A;  2HEO A;  3MWM A;  4KYW A;  2L4M A;  1T2K A;  3GF2 A;  5DUI A;  4I01 A;  1IN4 A;  5A2Q Z;  3ZP5 A;  1P4A A;  3RYP A;  1RNL A;  3FXR A;  1Q1H A;  2RKH A;  3ZMT A;  1QZZ A;  4A6D A;  2RDP A;  5EEH A;  4XLP F;  3F21 A;  2V79 A;  2RN7 A;  1V4R A;  2ESN A;  3RKY A;  1P2F A;  4MQ9 F;  4IHT A;  4CGZ A;  3KP3 A;  2FEZ A;  1FLI A;  4Q47 A;  2GXG A;  1XCB A;  3KE2 A;  3ZMZ A;  4U0V A;  2VBW A;  4YIF A;  4EJV A;  1U5T C;  4DNC A;  4MEX F;  4AD9 A;  5BMZ A;  1CF7 B;  2VC1 A;  3IWF A;  2PN6 A;  1R5H A;  5TRD A;  1XMA A;  1X3U A;  1IN8 A;  2P7C B;  3WTW C;  4CXF A;  3WTV C;  3NQO A;  1FP2 A;  2PFB A;  4AWX B;  4BQA A;  2FXA A;  1YYV A;  2DPU A;  1YG2 A;  4S04 A;  3F22 A;  5F64 A;  2FNP A;  4JK1 X;  3K1M A;  3PFI A;  1OR7 A;  4LLG F;  5DV5 A;  3G73 A;  4KMF A;  2J5O A;  1HKS A;  3MFK A;  3L9F A;  3CUQ A;  4A0X A;  2O03 A;  2PEX A;  1OPC A;  4U0Y A;  3L2C A;  2MC3 A;  5HLI A;  2Z99 A;  3JTH A;  2ISZ A;  2EV5 A;  3J80 Z;  2ELH A;  3F6O A;  2QBY A;  1H9G A;  2XKP A;  2J5P A;  3IC7 A;  2Q8K A;  1Z1D A;  4L0Y B;  4ZYD A;  2HYG D;  1AOY A;  1FT9 A;  4UUV A;  4HBL A;  5ICC A;  1LEA A;  2XHK A;  2ISY A;  2ZNY A;  4L9V A;  3HYI A;  2COM A;  2ESH A;  4RGU A;  3T8R A;  5L3B A;  3GVA A;  2MLG A;  2ZME A;  4G9Y A;  3PQK A;  3F8F A;  3P9K A;  1JGS A;  2LKP A;  2D45 A;  1GXQ A;  1QPM A;  3BPV A;  1O7L A;  1FY7 A;  2L01 A;  2M45 A;  2Z5U A;  1IXS B;  3L7W A;  3LQR A;  3WTX C;  3LA3 A;  1YTY A;  4FT8 A;  4HZF A;  3CLO A;  3K0L A;  3VFZ A;  2XRN A;  3GEZ A;  5BS6 A;  1UHW A;  1D3Y A;  4ESJ A;  1I1G A;  4HDV A;  1F9N A;  2ETH A;  2Y48 A;  4PGG A;  2GXB A;  3SZP A;  1NHA A;  3VOD A;  4MHG A;  2QBY B;  1WSU A;  5KK1 A;  2MD5 A;  4L5I A;  4I0B A;  2EFW A;  3TDZ C;  2ZXJ A;  4HV5 A;  1TQP A;  3E5Q A;  4HV6 A;  4YFN F;  2HFH A;  3BP8 A;  2ZCW A;  1D8J A;  3TQN A;  4P9F A;  4XSX F;  4CO8 A;  2EA2 A;  1USS A;  2Y0M A;  3DV8 A;  2H94 A;  1KU7 A;  3BY6 A;  1B6A A;  1KYZ A;  3FXU A;  3RJP A;  3EYI A;  5E8G A;  1E2X A;  3V4G A;  3NEU A;  4U7D A;  2Q0O A;  3F72 A;  3DP7 A;  2HYF A;  1AWC A;  1BC7 C;  1WKM A;  2YPR A;  1EH6 A;  2DW4 A;  1PP8 F;  1MJA A;  5E17 F;  1Z05 A;  5J6X A;  3R0A A;  1B9M A;  4RB3 C;  3DPL C;  1LNW A;  2EWN A;  3RYR A;  5J8F A;  1S7A A;  1FSH A;  3KEQ A;  1WI9 A;  4KN4 X;  4M72 A;  3R60 A;  4A0Y A;  3QRF F;  5HOO A;  1LQ1 A;  1FOK A;  3ZN1 A;  2M30 A;  1QNT A;  1YW8 A;  3I64 A;  5LGN A;  2CYY A;  2QWW A;  1HW5 A;  2K7L A;  2M5W A;  3FXQ A;  1L0O C;  3MQ0 A;  1ZRF A;  1ZHF A;  2CW0 F;  4B8X A;  5E1Z B;  2YX7 A;  3W6J B;  1YFH A;  2UWM A;  2EV0 A;  4L18 B;  3BJ6 A;  3K2Z A;  5L3F A;  4M9S A;  5D6F A;  2YU3 A;  4WWC A;  3MZH A;  4P9U A;  1OKR A;  3WU0 A;  4KIF A;  4HAM A;  4KIG A;  2G9W A;  3ELK A;  1ZN2 A;  2E7X A;  2P6S A;  2A69 F;  1YS6 A;  2OA4 A;  2D2W A;  3E6D A;  4OMZ A;  2RGV A;  1IN5 A;  2EA4 A;  2FBK A;  4RAZ A;  2YR2 A;  3HHH A;  2GQQ A;  1JE8 A;  3R0J A;  1RUN A;  1IN6 A;  3C1D A;  1P4X A;  2JSC A;  1LJ9 A;  2P5L C;  3DPT A;  3ZPL A;  4Y17 A;  1P6R A;  1BN5 A;  1B59 A;  3V7R A;  2P6T A;  2P4W A;  1U6G A;  3EQL F;  1I1S A;  1SFU A;  4O6J A;  1FYK A;  5AIQ A;  2QUF A;  1W7P A;  2ZBK A;  3LFK A;  2EFP A;  2A07 F;  1LDJ A;  1ZLJ A;  3O2P E;  1S29 A;  4AVP A;  1XDS A;  2FSW A;  1HQC A;  2K86 A;  5LGT A;  1MGT A;  1UFM A;  1H9T A;  5DCM A;  3HSF A;  1FBS A;  3BJA A;  1S6L A;  3TO9 A;  3LAP A;  3V7C A;  1FZP B;  2H27 A;  4BAY A;  3LA2 A;  1ZG5 A;  1ZRC A;  2EFN A;  1UST A;  4LB6 B;  1MJ9 A;  1HW2 A;  3SQN A;  1SMY F;  2A6E F;  1P4W A;  1S7O A;  3GFJ A;  1FNN A;  2UZK A;  3LWF A;  1IW7 F;  2XAJ A;  3V8K A;  1O3R A;  3HRM A;  3HUG A;  3GFL A;  5ICF A;  3I5U A;  2VBZ A;  3P9I A;  3U1D A;  1J75 A;  3N4M A;  2M8E A;  4B09 A;  2BGC A;  1ULY A;  5E8I A;  1I5Z A;  5JHU A;  4LLN A;  4S05 A;  4HX7 A;  5L3E A;  1IZ1 A;  5CLS A;  1R00 A;  4LJZ F;  2XVC A;  4JQF A;  2EV6 A;  2DTR A;  1W7P B;  2ZKZ A;  3RIR A;  1HST A;  4UVC A;  2CWE A;  2QVO A;  1IUY A;  2HKO A;  2JZY A;  1KQ0 A;  1I27 A;  1XSX A;  2OAZ A;  3F8N A;  2EJR A;  3ISP A;  3GW2 A;  4PCQ A;  2F5D A;  5HDK A;  2QM3 A;  3J81 Z;  4GO1 A;  2BYV E;  2KRF A;  4M71 A;  3HRS A;  1KGS A;  3QAH A;  3RPQ A;  2F5E A;  3RKX A;  2KIF A;  4ON0 A;  1R22 A;  1G6N A;  1B4A A;  4ASN A;  3CJN A;  4N9I A;  1Y0U A;  1V3F A;  5FO5 A;  3IRQ A;  4YFK F;  3GFI A;  5BPD A;  3T5X A;  2PMU A;  1R1V A;  4UXN A;  3KP6 A;  3L00 A;  1K6O A;  3E6M A;  1Z6T A;  3EDP A;  1RUO A;  1HXD A;  4I7H A;  3FWE A;  1MJB A;  2OD5 A;  2ACJ A;  3ROU A;  2HOE A;  1D8K A;  3ABU A;  3EET A;  2HTJ A;  1VTN C;  3M8E A;  4I2O A;  2UXN A;  3KEO A;  1IRG A;  2R7F A;  1BI3 A;  1G3T A;  2XAQ A;  2DO7 A;  5ILS A;  1ZGA A;  4CDG A;  1OYI A;  4UVB A;  3HOT A;  4YG2 F;  2FRH A;  2VXZ A;  5TJJ A;  2LNB A;  3O6B B;  3KLN A;  3E5U A;  1WQ2 A;  5E1W A;  2B0L A;  1F4K A;  5D5V B;  5FLX Z;  4EM1 A;  4MNU A;  4HQM A;  1T98 A;  1Z91 A;  2V1U A;  4ZYG A;  2LDU A;  1QQI A;  1SMT A;  4Q4Z F;  5L3D A;  5D8K B;  2P5K A;  2XRO A;  4R8H A;  3B02 A;  3LST A;  2HDC A;  2IT0 A;  3R4K A;  1D5V A;  1E17 A;  3JTG A;  5CVI A;  2ZO4 A;  1GHC A;  5DD8 A;  2CG4 A;  1WRJ A;  5FD6 A;  5LHH A;  4IJA A;  2VBY A;  2A5Y B;  4GGG A;  3F8M A;  1G4D A;  3QP6 A;  3ECO A;  4OIN F;  3SFZ A;  3GYH X;  1B1B A;  2E7W A;  2HR3 A;  4MTE A;  4R1H A;  4HW0 A;  4IXA A;  4HA8 A;  1EV7 A;  2GIV A;  2E1C A;  5A2Q K;  2KIM A;  2MH2 A;  3HTU A;  3T8T A;  4AIJ A;  4WCG A;  4UV9 A;  4BH9 A;  5JFR A;  3LQQ A;  1YW9 A;  3HOS A;  5LHG A;  2FA5 A;  2G7H A;  1R58 A;  4HDU A;  1U78 A;  2MLK A;  2NRA C;  3ML6 A;  4IRI A;  3WU1 B;  2O61 A;  3ZMU A;  2NS0 A;  2LF7 A;  2G7U A;  1GXP A;  4HLY A;  5L3G A;  4IF4 A;  2R7D A;  4EMS A;  4BHC A;  3HRU A;  4HLX A;  4LK1 F;  1FWZ A;  4EJW A;  3KCC A;  2RV8 A;  4EJU A;  4G6Q A;  2FF4 A;  1J5Y A;  1LB2 A;  3WG9 A;  2VOP A;  4U88 A;  2BE5 F;  3I54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...