2EV6A

Bacillus subtilis manganese transport regulator (mntr) bound to zinc
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
136
structure length
136
Chain Sequence
b'PSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEHHLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKKTEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator mntR
publication title Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 53
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ev6A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 2ev6A02
3T1BA 2DPUA 2QBYB 4ZYDA 3F22A 2KIUA 2R7FA 4ZZDA 4O6JA 2HR3A 1BJAA 2HWVA 1FYLA 3ERED 2YX7A 4JBAA 1BI1A 2XAGA 3H3UA 1O57A 2V79A 2ESHA 1U2WA 2Y75A 2O6GE 2ZXJA 1E2XA 1CF7B 2X0LA 1LDKB 5FFZA 2E1NA 2VE8A 3GFIA 1X3UA 2JTVA 4KUMA 3WGHA 2EFWA 4RGXA 1F9NA 3FX3A 2QLZA 4IVNA 5E18F 4MEXF 3GYHX 3HTUA 5D8KB 4ETSA 2IPQX 5FLXZ 2O3FA 1XMAA 2RVCA 2M1BA 1T0FA 4M9SA 5F1RA 1IRFA 4HF1A 3BJOA 5L3BA 3DKWA 5JFRA 5K1YA 5DCMB 2A6HF 3EYIA 4YFXF 2BYVE 3CJNA 2DO7A 2WV0A 1EH6A 5DUKA 5L3GA 3ECOA 1UCRA 4RAZA 2D45A 1HKQA 4KFCA 2VE9A 2CWEA 2ESNA 2VOPA 1FNNA 4IF4A 1PP8F 2GZWA 2DFIA 3IKVA 4G8XA 1ZG1A 1NHAA 5E1ZB 4WF2A 2Z9OA 1WRJA 2VT3A 3F8CA 5H6QA 1JXSA 1FSEA 5HOOA 4KYWA 1W5TA 1G3SA 3ZMUA 2RQPA 5D4SA 1ZAOA 4A5NA 2OA4A 4RGRA 1IN5A 3FXQA 5D4RA 2FE3A 1XGMA 5LLQA 1J75A 1ZH5A 4HQMA 1UB9A 1ZHFA 4XRFA 1F4KA 4P9UA 2O8XA 3QAHA 3O6BB 5K5RA 3O3KA 5A2QK 3MAJA 2RV8A 3KE2A 2HYGD 4EV0A 2E7WA 3QOPA 2JSCA 2VBWA 4A0XA 3M1EA 3QP5A 1USTA 4EJTA 3H92A 2QQAA 3FMRA 3RPQA 3RPUA 3J81K 2QWWA 4O5VA 1XD7A 1QPMA 4PZJA 1FBQA 2IA0A 4S05A 3D0SA 5DUIA 4HX8A 3F8MA 3B73A 3TQNA 2A07F 1L3LA 4NB5A 2CGPA 3F6VA 1R1UA 4QLCU 1KU3A 5J6XA 1EH8A 5ILUA 3W6JB 2RC4A 2KIFA 1SFEA 2NNYA 4GXOA 2YPRA 2F5EA 1IXSB 4CYDA 2L3DA 2FRHA 4Q47A 2ZO4A 4KIFA 3JTGA 1KQ0A 3E6CC 2XGXA 4HV5A 4XLNF 4HOBA 4BHPA 4EM2A 3LAPA 4UV9A 1HW1A 3V8KA 3E97A 1TLHB 2H6CA 1VTNC 1MKMA 4KIBA 3MWMA 5BPIA 3QU6A 2EFNA 3F8NA 1O3QA 2JRTA 5LHIA 2EK5A 5TRDA 5H6RA 1BOAA 1FP2A 3S2WA 1UHMA 4XBFA 3C18A 3R60A 4S04A 2IT0A 2YR2A 3KEQA 3ZMDA 4RAYA 4L9TA 1EH7A 1QGPA 3MFKA 2CG4A 2V1UA 3BPXA 1YG2A 4YG2F 4NHJA 5CVRA 1Z1DA 4FX4A 1ZRDA 2MD5A 2JZYA 3ZMVA 1TTYA 1IN4A 1B4AA 3BJ6A 5ILSA 1JHFA 4H0EA 4RS8A 2FEZA 4KNYA 2GWRA 4RB1A 4LK1F 4UVBA 3ZQ7A 1GXQA 1LEAA 4EJWA 2VOOA 4Y15A 4WCGA 4KA4A 3K69A 2GA2A 1K6OA 3QU3A 1KGSA 1I27A 1OYWA 2DTRA 3VOEA 4M74A 3V7SA 2GA1A 4I98B 1ZRFA 1CF7A 4CICA 3JSOA 4IHTA 5D8LB 4OIOF 3MEXA 5AIPA 3RJPA 1FYKA 4A6DA 2J5OA 2XKPA 4O3MA 3HSEA 2A68F 1B6AA 2K4JA 3I4PA 1ZLKA 1Z05A 4Q48A 1R5HA 3VFZA 1J7KA 1G6NA 1P4XA 4ASNA 4DQ2A 4HDVA 1ON1A 1R00A 2BBYA 2GAUA 3CDHA 2IA1A 3SZPA 3HRTA 1ZG3A 2HZTA 3BY6A 3JAMZ 2XVCA 1D8KA 1S8NA 2VONA 4G9YA 4PGHA 3P9IA 1XDSA 1QZYA 2XV4S 5E20A 1DP7P 2M30A 1I6XA 5BPDA 2UZKA 2ACJA 2NNNA 2IJLA 1BI0A 1MZBA 5CVUA 5H20A 3VODA 4EQQA 4TV7A 4BHCA 3GXOA 5E8GA 3VB2A 5CYVA 1XDUA 2O61A 4OIPF 2NAZA 2ZNYA 4M73A 1UFMA 5HVQC 2L54A 5JR3A 1R7JA 4L9JA 3ZN1A 4BH9A 2UXNA 5AONA 1XSVA 1FSHA 1K7AA 2H27A 3FWEA 1MDMB 2W24A 2CQKA 5FB2A 1S3JA 3KP7A 3C1DA 1G3YA 2K7LA 2DAOA 1OMIA 2LSOA 2G7UA 4BHBA 1HBXG 3DFGA 4FX0A 3MCZA 3QPHA 4UVCA 1FYMA 3RYPA 4I2OA 1A04A 1K79A 3HHGA 1H0MA 3JW4A 5FD5A 4M6YA 2G7HA 5D5WB 1MJ9A 2G9WA 5DD4A 1ZLJA 2QUFA 3Q5FA 4ENJA 4U0VA 4CHUA 2PG4A 4B8XA 4HF2A 1ON2A 4HX7A 2XAQA 1KYWA 2JPCA 5FFXA 3T8RA 1KU2A 1RZ4A 1KYZA 2XIGA 1STZA 2L4MA 5D5XB 4DNCA 3IL2A 4L9NA 4RB2C 4HLYA 2B0LA 3QP6A 1LJ9A 3Q9VA 5LHHA 4Q5SF 2Z3YA 5DEQA 1TW3A 1W7PD 5HLHA 3WTWC 1W7PA 4LLLA 1OR7A 1P4AA 3IRRA 2PBIA 1I5ZA 1R36A 2EV0A 3TDZC 3EYYA 3ABUA 2IA2A 1RI7A 4OMZA 4A2UA 1FC3A 2DU9A 1QQIA 2V1XA 3WE3A 1IN6A 4HBLA 1UHWA 2A69F 1ZARA 1BIAA 2P5KA 2FA5A 3TO6A 4LG0B 2VBYA 2PJPA 1DPRA 1HXDA 2ZMEA 4EJUA 3GFJA 1B9NA 3I53A 3KP5A 3GEZA 2P7VB 2FMYA 1YW9A 1Z7UA 3ROUA 1YO5C 1XMKA 5FO5A 4L18B 4NQWA 5DCFA 1BI3A 3I59B 4Y17A 2EWNA 3F8BA 3KZZA 2RGVA 2EFOA 1FLIA 3R0AA 1B59A 3DEUA 3IHUA 4L5IA 3QRFF 3C3WA 1QO0D 3O2PE 3W6KB 3HRMA 1F1ZA 4ZH4F 5LRSA 2FOKA 2VBXA 4I0AA 5BQTA 3GF2A 5HLGA 1YQAA 3HOTA 2HOEA 4MQ9F 4GYGA 4GCVA 2Z5UA 1XN7A 3JTHA 1ULYA 5FGMA 3Q9SA 2JPBA 4BAYA 4IXAA 4HQEA 2ZKZA 4GYIA 5J8FA 3EUHA 3NEUA 2VC0A 3WTXC 1SD4A 1AOYA 3DP7A 5FLXK 4XSXF 3E3VA 2MBFA 3ABTA 1PP7U 1XB4A 3HYIA 4FHTA 4F7ZA 1ODDA 3KP6A 1HQCA 2EFPA 4FT8A 3C7JA 1U6GA 1LVAA 3CUQA 2KIMA 1E17A 1L0OC 2F5DA 4MHGA 2PLYA 3GZ6A 1RUOA 1R23A 4I01A 4ESJA 1O3RA 1WSUA 2IRFG 1S7OA 3U1DA 3BPVA 2DK5A 2OZUA 2FBKA 3REOA 4LMYA 5L3DA 1LNWA 2K86A 1S6LA 4EGYA 2D2WA 3L00A 1RUNA 3I0TA 2P7CB 3F8FA 1B1BA 1H9GA 1IXRC 3BROA 4YIIA 3LA3A 5L3FA 4EMSA 5HLIA 4LLNA 3NRVA 2P5LC 1T39A 3ML6A 1V4RA 2VXZA 4G7HF 1HSJA 4U88A 4IRIA 2PN6A 1IZ1A 3GVAA 3FMQA 3KP2A 3J80K 1OYIA 2J5PA 3ULQB 4HZFA 3B02A 5ICFA 3BOQA 3P7NA 1YS6A 4L0ZB 4AD9A 4AIJA 2ETHA 2V6CA 1B9MA 4KMUX 3KETA 2JT1A 3VEPA 4ESFA 4E70A 5BOXA 4LGWA 2QYOA 4WXHA 2DLLA 3K2ZA 2PMUA 3F6OA 3WTVC 4MQVA 4R1HA 1YFHA 1KQ8A 1PDNC 4WWCA 2XKOA 3ISPA 2FF4A 5AIQA 4EJOA 4LK0F 4KICA 3WU1B 3KCCA 2ZBKA 1KU7A 1W5SA 3SHFA 3HSRA 3WTTC 4WX9A 3DXJF 1G3WA 1CGPA 4G6QA 2XHKA 3ZMZA 4BQAA 3ZMSA 1WKMA 4I0BA 2HEOA 1ZGJA 4BNCA 2EV5A 2XAHA 1FOKA 3HUGA 3LFKA 3V7CA 4LFUA 2E7XA 4UUVA 4A0YA 1K78B 1U3EM 3WGGA 1ZRCA 1U5TA 4OMYA 3P9KA 2XRNA 5CJ9A 2HKOA 2HGCA 1F5TA 2QBYA 2IVMA 2BV6A 3MQ0A 2CSOA 3G73A 3V8JA 3K1NA 2ADUA 3I5UA 4U7BA 2CW0F 4WK8F 4ENNA 2QENA 2P6SA 3KLNA 2DT5A 2MH9A 2PMHA 3K0LA 1J59A 3GFMA 2ZFWA 3QPTA 3EETA 3E6BA 4N9IA 5BMZA 3WG9A 3M8EA 3CTAA 5DV5A 2CO5A 3TGNA 2LF7A 5IT9K 2CYYA 1R1TA 4L9VA 4MNUA 3E6MA 4IHSA 2LNBA 3ZP5A 4R79A 1JE8A 3V7RA 1FBUA 2L01A 4K2EA 1Z91A 1WQ2A 3KP3A 3TDUC 4M9XA 5E1WA 1YLFA 1XSDA 4UXNA 1XGOA 2Z99A 3NQOA 2EV6A 1P6RA 2DBBA 4EGZA 5DCMA 3RTRA 1ZGAA 4YIFA 2A6EF 2ZJ2A 2P8TA 2QZ8A 4M9ZA 5HS7A 2QQ9A 2Z33A 1BI2A 2IW5A 5L3CA 4KDPA 5E17F 1KU9A 1DDNA 2HQNA 5ERIA 4D0PA 2Y48A 2BEOA 3IRQA 2LKPA 1OKRA 5E8IA 3ELKA 3E5XA 4OU0A 2PI0A 4QWQA 2PQ8A 2QQBA 2RNJA 1QBJA 1Z6RA 2W84A 2A5YB 2AS5F 2W57A 4MEYF 4BXUA 2D1HA 1OPCA 2DPDA 3WTZA 3FM3A 1YW8A 3HHHA 5L3EA 2GXGA 4L5JA 2D1VA 1C0WA 2WTEA 2A61A 3BWGA 1T6SA 1Z9CA 1TW2A 5TJJA 3GFLA 1YW7A 4ENKA 3JAMK 3CLOA 1BC8C 3DQVC 5LEKA 4G6DA 4HA8A 4LLGF 2H94A 2ISZA 3E5QA 1DUXC 3GLXA 2R3SA 4B09A 1IXCA 1GXPA 2X4HA 2L02A 4KN4X 3EQLF 2OU2A 4LD5A 4P55A 5JHUA 3K9TA 1BIBA 4G7ZF 4P9FA 3TOBA 1JGSA 2H09A 4CZZA 3K1PA 2V1DA 2Q2EA 2H6BA 4MTDA 3RI4A 4UHTA 4MGRA 3T8TA 5LEJA 2ZNZA 3FXRA 1FPQA 2F2EA 3BDDA 4HAMA 2RKHA 3L9FA 2F5FA 1SFUA 2M87A 1XCVA 2MC3A 2STTA 2V9VA 3BZ6A 4P5OA 1J2XA 4A0ZA 1USSA 4A6EA 1T2KA 3HRSA 3LA2A 1LQ1A 2OZ6A 4WXCA 3WU0A 2DQRA 3RKWA 2CFXA 1TBXA 3K1MA 4OIRF 1FZPB 4KT5C 3M8FA 3HIFA 2P4WA 3T0YA 2NS0A 3V8LA 4KN7X 3I54A 4Q4ZF 1R58A 1IW7F 4CO8A 1T38A 1XGNA 5IT3A 1YTYA 4YFKF 1BM9A 2LDUA 2HTSA 2OQRA 4ZYHA 2KKOA 3LSTA 2M45A 2RDPA 4WXDA 3DPTA 4AWXB 3M9AA 4IRGA 2W85A 2DW4A 4HYEA 2KJBA 2IP2A 2COMA 2HDCA 3WTYC 3BJAA 2TDXA 2LF8A 5A2QZ 3JSPA 5HDNA 1J5YA 3H3ZA 2FU4A 1MGTA 2EA4A 3D5LA 1K78A 2EFQA 4KMFA 2F5CA 4HLXA 1I1GA 3GWZA 3KP4A 3J81Z 5D6FA 2PEXA 3L2CA 4AIKA 3TKYA 1TNTA 2ISYA 5CVVA 2Y0MA 1AWCA 4HW0A 4MTEA 2O0YA 1TQPA 4N0BA 1QZZA 1MD0A 1RNLA 1G4DA 4HX4A 1IRGA 3KZYA 3P9CA 2MA3A 3GW2A 3EDPA 5CVIA 1O7FA 3LA7A 2VN2A 5D5VB 3LQQA 2E1CA 2UWMA 1XGSA 4ZYEA 4HV6A 2AXLA 4JQFA 3ECHA 3CUQC 1W4MA 2HTJA 1H9TA 3CO7C 5FD6A 5F6FA 4UV8A 3J80Z 5ILVA 5KK1A 3LAJA 5ICEA 4PCQA 2K27A 1IF1A 2FMLA 4AIHA 2YX4A 2GQQA 4EM0B 1REPC 5ICGA 3E5UA 3F72A 1HSTA 5ICCA 2GXBA 1YS7A 3IC7A 3WGIA 4G7OF 2QM3A 5BS6A 2FSWA 4G94A 2MLGA 2HFHA 4CGZA 2M5WA 5CVJA 3LWFA 3N97A 4JK1X 1FX7A 3N4MA 1YYVA 5LGUA 5E1XA 4OINF 1TQIA 2YU3A 3I58A 4U0YA 2QVOA 2HKXA 3E6DA 2OAZA 3RKXA 3ZMTA 5F64A 1I1SA 4RGUA 4EVIA 2VBZA 2OBPA 2VC1A 3TO9A 1LB2A 4LB6B 1MDMA 2ZCWA 3ZN0A 1Z6TA 1GVJA 3R4KA 4RB3C 4HDUA 4XLPF 3F23A 2XAJA 1LEBA 1LDDA 1SD6A 4IRHA 1W7PB 5D5UB 1YIOA 2XUBA 2K02A 2R7DA 4U0WA 2P5VA 5HS8A 2WC2A 4ZYGA 5K5OA 1XCBA 2Q8KA 5DD8A 3COAC 1KQ9A 4EM1A 2W25A 1O3SA 2L4AA 1G3TA 1D3YA 4ESBA 1DPUA 2RN7A 2OQGA 5CLSA 1BBYA 1SD7A 1IUYA 5HDGA 1MJAA 5D6EA 1D5VA 2ZMEB 3WTUC 1U8RA 2FNAA 1KA8A 3G3ZA 1U5TC 3L7WA 4IJAA 3PFIA 3GX4X 1Q1HA 1SAXA 2EJRA 5IT9Z 1XSXA 4YFNF 1JHHA 4M6XA 2ELHA 3GZ5A 3IWZA 1FBSA 4A5MA 3HOSA 1P2FA 1RIOH 5LGTA 1J0RA 1O3TA 4ENMA 2FBIA 3U9GA 2FXAA 2HYFA 3CUOA 2KRFA 5EEGA 2HS5A 2NRAC 3R0JA 1T98A 4CDGA 3CO6C 5LBQA 4M72A 1P4WA 3BP8A 3GUDA 2DK8A 3SQNA 1SMTA 3MZYA 3SZTA 1BC7C 1ZREA 3U2RA 1WI9A 3RDIA 3DF8A 4HF0A 4R8HA 4PDKA 3T5XA 1QNTA 3DV8A 4ZZLA 3WTSC 3TOAA 1V3FA 1U78A 4GO1A 4BYYA 3IWFA 2XASA 4P96A 4LG0A 3PQJA 4I02A 4M71A 3RIRA 4L0YB 1SFXA 3J7AO 3DPLC 1SD5A 6PAXA 2KJCA 1ZG5A 3CUQB 1IN7A 1OYYA 1S7AA 3FZVA 3I59A 3LQRA 5K5QA 1R1VA 4Y13A 3L09A 3HTSB 3FF5A 1ZYRF 2K4BA 3KEOA 2UXXA 1IAWA 1S29A 1LDJA 3RKYA 3SFZA 2BGCA 3MZHA 4KIGA 4XSZF 2NYXA 3F21A 3V4GA 4UNOA 4UVAA 2GIVA 2O03A 5LRRA 5LHGA 2M8EA 2HQRA 3KLOA 3IKTA 2XAFA 5DYMA 2STWA 1MJBA 4A12A 3WODF 2YSRA 3GO5A 3RYRA 3FXUA 4I09A 2FBHA 1P92A 4N9HA 2MLKA 1FT9A 1HKSA 3ZPLA 4OOIA 2DQLA 2EA2A 2Q0OA 2A3SA 1HW5A 3OOPA 1FY7A 1IN8A 4GGGA 2FQ3A 2C6YA 3F3XA 1R22A 5HS9A 1PUEE 5LGNA 3FHZA 4LB5A 1TNSA 1WWXA 3FMSA 5DDGA 2WWYA 1R5GA 3PQKA 3HRUA 3AAFA 4PGGA 1O7LA 3OV8A 5HDKA 1FP1D 1ZN2A 1FWZA 2PFBA 1SMYF 4CXFA 2BE5F 3M7GA 1Y0UA 3SXYA 3WE2A 1D8JA 4IPAA 4U7DA 3R61A 2XROA 4Z2YA 2EB7A 2OD5A 5JI6A 4ON0A 3FM5A 4I7HA 4OIQF 2VODA 1BN5A 1EV7A 4RB0A 5J8CA 2DI3A 4EJVA 1GHCA 4RGSA 3TO7A 1HW2A 5EEHA 2MH2A 1J9IA 5KVRA 3I64A 1HKTA 3HSFA 3I71A 1ONVA 3R6SA 1TQMA 2FNPA 2P6TA 2VT2A 4LJZF 3KFWX 1U5TB 4AVPA 5JVTA 5ED4A
chains in the Genus database with same CATH superfamily
3FBNB 3T1BA 2DPUA 3BQYA 2QBYB 2X1EA 3TP3A 3G2BA 4ZTFA 1VQPI 3J7AY 4BGDA 4ZYDA 3J7ZI 3IAS2 1YI2I 1Z77A 3F22A 3JR9A 4A3LJ 3DEEA 4AVZA 1HDPA 3M8JA 2BY1A 2KIUA 2R7FA 4ZZDA 4O6JA 2HR3A 1BJAA 2HWVA 1FYLA 3ERED 2YX7A 2DMNA 1FMWA 2M4KA 4JBAA 3OOUA 4XKVA 1QZEA 1BI1A 2XAGA 3KX2A 3M3YJ 3IH3A 3H3UA 1O57A 2V79A 2B7EA 3I55I 1X2MA 4XN3A 5A2QR 2ESHA 1U2WA 2Y75A 1Q1VA 2ZXJA 3FIWA 2O6GE 1E2XA 1CF7B 1OCZH 2X0LA 1LDKB 5FFZA 3WHCA 5EG0B 2LKSA 1T8IA 2E1NA 3AG3H 3HEFA 2VE8A 3CCSI 3PL8A 2X85A 1YX5A 3GFIA 4EEFG 1I3QJ 4IQ4A 1X3UA 2JTVA 4KUMA 1H88C 3WGHA 2EFWA 4FISA 4RGXA 1F9NA 3FX3A 2QLZA 3FXJA 4IVNA 1UMQA 5E18F 4MEXF 1PUFA 3GYHX 3J81R 3HTUA 1K61A 3DTIA 5D8KB 4ETSA 2IPQX 5FLXZ 2O3FA 1XMAA 2RVCA 2M1BA 2GLOA 1T0FA 4M9SA 5F1RA 1IRFA 1YIJI 4HF1A 3BJOA 5L3BA 2HI3A 2W82A 1E3OC 3MKZA 2X48A 3DKWA 5JFRA 4UB8C 1LPQA 2XF6A 3TMOA 1ACIA 5K1YA 2M7BA 1LFBA 5DCMB 5E3NA 2A6HF 3HOWJ 1BOBA 4CCJA 2JA5J 3CLQA 3EYIA 4YFXF 2BYVE 3CJNA 3GLLA 1GLNA 2DO7A 1JGGA 2WV0A 2XB5A 1EH6A 5DUKA 2KPMA 5L3GA 1ZTRA 3ECOA 1UCRA 4RAZA 2D45A 1HKQA 3VYUB 5JLXA 3K4BA 2VKDA 2M35A 4KFCA 2VE9A 3NARA 1WJDA 4XN0A 1DQUA 2CWEA 2L9SA 2ESNA 2VOPA 3OR1C 1FNNA 3CCVI 4IF4A 3UNGC 1PP8F 2GZWA 2DFIA 3IKVA 4G8XA 2AQEA 1ZG1A 3S1MJ 1TT5B 1NHAA 1OLTA 5E1ZB 4XLEA 4C2TA 2DA4A 4E7IA 1EA3A 2L2OA 2QKMB 4WF2A 2Z9OA 5KAIC 2W48A 1ETYA 2P0WA 1WRJA 1WZ2A 2VT3A 3BR2A 3F8CA 5H6QA 3PUFA 4PSXA 1JXSA 1FSEA 3MKYB 5HOOA 4KYWA 1W5TA 1G3SA 4W1UA 3ZMUA 2EIMH 2RQPA 5D4SA 1ZAOA 4A5NA 1SFOJ 2OA4A 4RGRA 4DYCA 1IN5A 3I4NJ 3FXQA 5D4RA 2FE3A 1XGMA 3H5AA 5LLQA 1J75A 1ZH5A 4HQMA 1Z67A 1UB9A 5J47A 1ZHFA 4XRFA 1F4KA 4P9UA 2O8XA 3QAHA 1B8IA 3O6BB 5K5RA 3O3KA 2EPFA 2R7QA 5A2QK 3MAJA 2RV8A 3ABMH 5B3SH 4D1QA 1AA7A 3Q3SA 3KE2A 1AHDP 2HYGD 4EV0A 4RMNA 1W36D 1T95A 2E7WA 3QOPA 2JSCA 4A3FJ 2VBWA 4A0XA 5F04A 1OISA 3QWLA 3K7AJ 1Z3YA 3M1EA 3QP5A 1USTA 4EJTA 3H92A 2QQAA 3FMRA 3RPUD 3RPQA 2H8WA 1RPWA 3RPUA 4A3GJ 2ECCA 4I99C 3J81K 4QTRA 2E2IJ 2QWWA 4O5VA 1XD7A 1QPMA 4PZJA 2V4JC 3CP8A 2FOWA 1FBQA 2IA0A 2X51A 2I5UA 4S05A 3D0SA 1ITYA 5IP7J 5DUIA 4HX8A 3F8MA 2KMUA 3B73A 5EGOA 3TQNA 2X1CA 3K70C 2A07F 1L3LA 4XKCA 2VQHA 1MBJA 2PJRA 4NB5A 2CGPA 4AUXA 1BL0A 3F6VA 1R1UA 4QLCU 4FTHA 4F55A 3K70D 1KU3A 5J6XA 1EH8A 5ILUA 3W6JB 1GV5A 2RC4A 2KIFA 1SFEA 2NNYA 4GXOA 2YPRA 2F5EA 1IXSB 4FQGA 2L3DA 5DTDA 4V2FA 4CYDA 1GDTA 2R92J 2FRHA 3K10A 4Q47A 2ZO4A 4KIFA 3JTGA 1KQ0A 2Q2EB 3E6CC 2BVLA 2XGXA 3C2GA 3NWSA 4HV5A 4XLNF 2R7RA 3DTKA 4Y7NJ 4HOBA 2ZSIB 4BHPA 1N78A 1MBKA 1WH7A 4EM2A 2A5WA 2M8GX 3BR1A 3LAPA 4UV9A 1D0ZA 5FKOA 1HW1A 3TW7A 3V8KA 3E97A 1TLHB 2H6CA 3LMMA 3V42A 1TWFJ 1VTNC 1MKMA 4Y33A 4IHYA 1E3PA 3S2HJ 4KIBA 2MG4A 3KYDB 2LREA 3MWMA 3QU6A 5BPIA 2EFNA 2B9SA 3F8NA 2NS7A 5E3OA 1O3QA 3GTGJ 3CMMA 1S5LC 2JRTA 3NWTA 5LHIA 2EK5A 2MYSA 5TRDA 2M9HA 1FTTA 3DCFA 3BR3A 5H6RA 1T56A 1KONA 1BOAA 3LL7A 4QSHA 5GP9A 1FP2A 1JJ8C 3S2WA 3GMEA 3BZKA 4BE0A 3OSFA 1UHMA 1FIPA 2L0KA 2F6CA 4XBFA 2DDBA 3C18A 3R60A 4S04A 1IV6A 2VQGA 1AKHB 2F4IA 1Y1WJ 1SANA 2IT0A 4N4NB 2YR2A 3KEQA 3ZMDA 4RAYA 4L9TA 1EH7A 1QGPA 2DFFA 3MFKA 2M7AA 2CG4A 1MMDA 3FXLA 3BCBA 4ZC3A 2V1UA 3BPXA 2ID3A 4HG2A 1YG2A 4YG2F 4NHJA 5CVRA 3HKZN 3FKIJ 1Z1DA 4FX4A 1ZRDA 4C2MJ 2MD5A 2O5RA 2JZYA 3FXKA 3ZMVA 2HXOA 1SC7A 1TTYA 2UV1A 1YJ9I 3PJRA 1RKWA 1IN4A 2V9PA 2DA1A 3L2RA 1B4AA 3BJ6A 3AG1H 2X9DA 1BR4A 3S32A 5ILSA 4E7SA 1YHQI 1JHFA 4OAZA 2XF5A 4H0EA 2PX9A 4JP0A 1U9NA 4RS8A 2FEZA 5C3EJ 4KNYA 3ZQQA 2GWRA 4RB1A 4CYCA 3CESA 3BC8A 4LK1F 3ZQGA 4UVBA 4E7ZA 3I4MJ 2OC6A 3ZQ7A 1GXQA 2VJ5A 2L9RA 5F27A 2WA0A 2ICWG 2VXDA 1IRZA 3J7YJ 1LEAA 4EJWA 2VOOA 2I10A 4E7HA 4Y15A 4WCGA 4PSWA 4V19K 1WJCA 2K9LA 4KA4A 2R7SA 2HPMA 3K69A 2GA2A 1K6OA 3QU3A 2QA4I 1KGSA 4BDYA 2R5ZB 1I27A 2XRLA 1IG7A 1I3AA 2CV2A 4A93J 3B6AA 1A31A 5GAGJ 1OYWA 3LNQA 2IXSA 2DTRA 2RREA 2COBA 3SZGA 3VOEA 4M74A 5FKKA 3V7SA 4U87A 4II3A 1BJZA 1MW7A 4BKXA 3JRGA 1ETWA 2GA1A 4ZJZA 4I98B 2OF7A 4XRMA 1ZRFA 1CF7A 4CICA 1ETKA 1BA5A 1XC5A 3LSKA 1MBHA 5M3MJ 3JSOA 1NH3A 3BTCA 2DDAA 2AO9A 4IHTA 3ASOH 1JKPC 5D8LB 4OIOF 1EKEA 2NVUB 3MEXA 5AIPA 3RJPA 3I9V2 1FYKA 3TEDA 3TW6A 3H9QA 4A6DA 2J5OA 2XKPA 1QVTA 1TWGJ 1B72A 4O3MA 3FK7A 3HSEA 5F08A 2EH3A 2A68F 1B6AA 2K4JA 4BY1J 3I4PA 1ZLKA 4BJ5C 1Z05A 4Q48A 1R5HA 3VFZA 5B66C 1J7KA 1G6NA 1P4XA 4AU7A 1K83J 3VWBA 4ASNA 4DQ2A 4XICA 1LFUP 4HDVA 4IO9F 4BQOA 1ON1A 1R00A 2BBYA 2IGOA 1PJRA 2GAUA 3CDHA 2IA1A 3SZPA 2E5NA 3HRTA 5IP9J 1ZG3A 3BY6A 2HZTA 4PK4A 3JAMZ 5DM6F 2XVCA 4IZZA 3RZOJ 1K4TA 1D8KA 1S8NA 3H1CA 4G9YA 2VONA 4PGHA 1TT0A 1W1WE 3VYSB 2BHYA 3MN2A 3P9IA 4C30A 3ABKH 1XDSA 1VQ5I 1QZYA 2XV4S 5E20A 2K40A 1DP7P 2M30A 3KPHA 1I6XA 1R9TJ 5BPDA 2DFHA 1X1PA 2UZKA 2ACJA 2DMPA 2NNNA 5KHDA 2IJLA 1BI0A 3VYTB 1OJLA 3AL0C 1MZBA 1MNMC 2DA3A 4BBRJ 5E79C 5CVUA 2KT0A 3FHNA 5H20A 1HA8A 3K4NA 3VODA 1ZKGA 4EQQA 2OTJI 4TV7A 5HNHA 2QSFX 4BHCA 3GXOA 2H1KA 5E8GA 3VB2A 5CYVA 1X1AA 1XDUA 2O61A 3SEQA 2DXIA 4OIPF 4PJMA 2NAZA 2VJJA 2ZNYA 4M73A 2KP6A 3MKWB 1UFMA 5HVQC 2L54A 1V5FA 1R7JA 5JR3A 2Z16A 1HF0A 4L9JA 3ZN1A 3HGGA 3VDXA 4BH9A 2CQQA 3FXOA 2IAIA 2UXNA 5AONA 4IHXA 1XSVA 2L7MP 1FSHA 1TWHJ 3GCMA 1K7AA 2H27A 3FWEA 4NC7A 1MDMB 2W24A 5KNLA 2CQKA 5FB2A 2W7NA 1S3JA 3CF5F 2VJIA 3GTPJ 1X4PA 3CP2A 3KP7A 3CMEI 4IHWA 3C1DA 3S3MA 2XB0X 4QPQA 3H35A 3OYCA 1G3YA 2K7LA 1V54H 4BU2A 3G6EI 2DAOA 4F3QA 1OMIA 2R5YB 2K3FA 5CQEA 2CW8A 5J40A 3A01B 2LYCA 1MH4A 2LSOA 4YRVA 2G7UA 1V5EA 2BOLA 1OFCX 3FXMA 3Q0WA 4RDUA 2DA7A 1Y0NA 3CF2A 4BHBA 1VZ0A 1FMVA 1HBXG 3BT9A 3DFGA 4IOAF 4FX0A 4IEJA 3MCZA 3QPHA 4UVCA 1SFKA 5IYBJ 1FYMA 3RYPA 5DM7F 1Z3XA 3HPHA 1V55H 4I2OA 2WY7Q 1A04A 1K79A 3HHGA 1UG2A 2L9NA 3JW4A 1H0MA 3OIPA 5FD5A 4M6YA 2G7HA 5D5WB 2MW8A 2DYSH 4J01A 1MJ9A 4CCNA 2X6YA 2G9WA 3HOXJ 2WAQN 5DD4A 3MD2A 1ZLJA 4GDFA 2QUFA 2JSPA 2LY9A 2JA6J 4W97A 3HGYA 4YEJA 3Q5FA 4ENJA 1WFXA 4U0VA 1QU3A 4CHUA 1BW5A 1A36A 4C3JJ 2PG4A 4B8XA 4HF2A 1ON2A 3MVPA 4HX7A 3PSIA 2L5QA 2XAQA 1KYWA 1J09A 2JPCA 3CDLA 1DP3A 3D5RC 1VI0A 5FFXA 3T8RA 2EINH 1KU2A 1RZ4A 1WH5A 3KYLA 1UJ8A 2A6TA 5GTIC 3K2AA 4JX4A 5EF6A 1KYZA 1LUJB 3W3CA 2XIGA 2RAEA 3X2QH 1STZA 2CUFA 4BE1A 3L2WA 2F4MB 4X0GA 2L4MA 5D5XB 4DNCA 1VNDA 4IHVA 4LIVA 4BL0B 3IL2A 4L9NA 3MMYB 3GTLJ 2R7OA 3N05A 4RB2C 4HLYA 4BQQA 2B0LA 3QP6A 1LJ9A 2JMWA 3Q9VA 2K3PA 5IP6A 5GPCA 3LSHA 1F36A 5LHHA 1M1EB 2M0MA 2Z3YA 5DEQA 4Q5SF 1TW3A 2Y0SA 1W7PD 5HLHA 3SDGA 3WTWC 1W7PA 4LLLA 2LRDA 1K6YA 1OR7A 1P4AA 3IRRA 2PBIA 1I5ZA 2P0TA 1WPKA 5FLXR 1R36A 2EV0A 2MD0A 2XDVA 3C2HA 3EYYA 3TDZC 1WJBA 3OYKA 3ABUA 2ELKA 2IA2A 2HVRA 2X1DA 4AIDA 2VQCA 1RI7A 3CCJI 4OMZA 4A2UA 1RESA 1FC3A 2DU9A 1QQIA 2YS9A 3ZQCA 1HC8A 2KDOA 2BW3B 2V1XA 3WE3A 3U21A 5IOYA 1AKHA 1IN6A 4AYBA 4KITB 3KYCB 1JKRC 2MC4A 2XSJC 4HBLA 2E35A 4B48A 1UHWA 1WJEA 2VB6A 1ZR2A 4XL9A 3TL4X 1T0FC 3CCEI 2A69F 1RKTA 2HQAA 1ZARA 1BIAA 2P5KA 2FA5A 3TO6A 4LG0B 2VBYA 1X1BA 3AFHA 2PJPA 2IS1A 3OYAA 1DPRA 3DTEA 1QHGA 2WBMA 1HXDA 2ZMEA 3KZIC 4EJUA 2E19A 4BUPA 3CJRB 3GFJA 1U9OA 4BY7J 1B9NA 1LKXA 3I53A 3KP5A 3PIOF 1VQLI 3GEZA 5FKNA 2P7VB 1ZGWA 2MGQA 4C3HJ 2FMYA 1YW9A 1Z7UA 3DBRB 4XOPA 3D5SC 2BXYA 3ROUA 1YO5C 1LE8B 2EZIA 1XMKA 3HOYJ 5FO5A 4L18B 4BEHB 3BR5A 4NQWA 2EBIA 3DEWA 4RBOA 2XAUA 5DCFA 4B44A 2Z1DA 3OWTA 1BI3A 3I59B 4Y17A 2EWNA 3F8BA 3PFYA 3KZZA 2RGVA 2EFOA 1FLIA 3M4OJ 3GTKJ 3R0AA 1B59A 3DEUA 3IHUA 4L5IA 2V1NA 1ZK8A 3QRFF 3C3WA 1QO0D 4M3GA 3O2PE 3ONQA 3W6KB 3HRMA 1JUSA 4YIRX 4NC8A 2DA2A 1F1ZA 3NAUA 1T33A 4ZH4F 5LRSA 3WG7H 1VQOI 2FOKA 2VBXA 1EF4A 2GXAA 1X58A 4I0AA 4BDZA 5BQTA 3GF2A 1IC8A 2F5VA 2VIXA 5HLGA 1DU0A 1YQAA 2E71A 3HOTA 2HOEA 4MQ9F 3J80R 4GYGA 3S14J 1OCOH 4GCVA 2Z5UA 1R4NB 3QYFA 4FE4A 2LBFB 1XN7A 3JTHA 1ULYA 4CZCA 5FGMA 3Q9SA 3O8HA 2JPBA 4BAYA 4IXAA 4CH7A 4HQEA 2ZKZA 4GYIA 1WJAA 4J19A 2LP0A 3AL0B 5J8FA 1HLVA 5F1JA 3EUHA 4I76A 3NEUA 2VC0A 5FJ8J 3D1NI 3WTXC 2NXNB 1SD4A 1AOYA 3DP7A 1DGWY 3OYDA 5EDNA 4XSXF 5FLXK 3E3VA 4XM3A 2K9MA 1W36C 2MBFA 2QF7A 1HDDC 3OY9A 3ABTA 1PP7U 1XB4A 3HYIA 3HXLA 4BE2A 3BG9A 2QKLB 2PMZA 1TC3C 3CC2I 1JUPA 4FHTA 1RQ6A 4F7ZA 2JA7J 3LOCA 1ODDA 3KP6A 1S72I 1HQCA 2EFPA 1LVKA 1Z7LA 3I3LA 1S9HA 4FT8A 3C7JA 3H0GJ 1U6GA 1LVAA 2L7FP 3CUQA 4DIQA 2KIMA 3BG6A 2KIQA 1G2HA 2NS8A 2W4SA 1E17A 4X1EA 1L0OC 2F5DA 4MHGA 2PLYA 3GZ6A 3IAM2 5J1RA 3ZQLA 1RUOA 4FE7A 1R23A 4XKBA 4I01A 2IS4A 1D0YA 4ESJA 1O3RA 2MUNA 4B1RA 1WSUA 2EIJH 2IRFG 4A3JJ 4DYRA 1S7OA 4M3BA 3U1DA 1YRNB 3BPVA 2DK5A 2OZUA 3PIPF 2LY1A 2FBKA 3REOA 5F0FA 4LMYA 5L3DA 1LNWA 2LH9A 3GTQJ 2K86A 1S6LA 3A03A 1SVMA 4EGYA 1KZHA 3H9JA 3S8PA 2D2WA 2ZXWH 3L00A 2AQFA 1RUNA 1Y8QB 3JCUC 3HG9A 3I0TA 1UG0A 5LD2C 1JT0A 2P7CB 3F8FA 1B1BA 1QPIA 2CQXA 1WI3A 3M07A 1H9GA 1IXRC 1XX5A 3EUAA 5LFAA 3BROA 5GADJ 4YIIA 3IUOA 2M0CA 2IS2A 3LA3A 5L3FA 2ECBA 2M3AA 2P81A 4EMSA 5HLIA 4LLNA 4CUGA 3NRVA 2P5LC 1T39A 3ML6A 3JRIA 5K7ZA 1V4RA 2DYRH 2VXZA 5TISC 4HNVA 1WCMJ 4G7HF 1W0UA 1HSJA 4U88A 4IRIA 4BXXJ 2VI6A 4A3DJ 2PN6A 1IZ1A 3GVAA 1JTXA 3FMQA 3KP2A 2JRMA 3J80K 4IX7A 2O9LA 2QGUA 4PJJA 1XTAA 3OYEA 2XC7A 1OYIA 4D5CA 2J5PA 3ULQB 4HZFA 3B02A 5JLWA 4XLCA 5ICFA 3K4JA 1G8XA 1IRXA 4XLFA 3BOQA 3P7NA 1IDYA 1YS6A 1NTCA 2R7VA 4L0ZB 4HEA2 4AD9A 4AIJA 2IS6A 2ETHA 2V6CA 1B9MA 4KMUX 2WAEA 3KETA 2HDWA 2JT1A 3BG5A 3QPLA 3VEPA 4HSTA 4ESFA 4XRSA 4E70A 1G59A 3W2AA 5BOXA 4LGWA 1D0XA 2QYOA 4WXHA 4BQNA 2DLLA 2CRGA 1IV8A 2Y69H 3K2ZA 5IT9R 4LITA 1F43A 2PMUA 3F6OA 5HODA 3WTVC 3K4LA 4MQVA 4R1HA 1YFHA 1KQ8A 1RRJA 1HOMA 2LOOA 1PDNC 4PJNA 4WWCA 1X3WB 2VPRA 2JN6A 4KJZA 4L5EA 2XKOA 3ISPA 2FF4A 5AIQA 4EJOA 1N25A 1D1AA 4LK0F 3QQAA 4KICA 3WU1B 2IGNA 1MIJA 3KCCA 2ZBKA 1TWAJ 4Y3OA 1KU7A 1VQ7I 1CQTA 1W5SA 1H8AC 3SHFA 4GRIA 3HSRA 3WTTC 1VQ8I 5FRNA 4NNJA 2OV7A 1I50J 3ZGKA 4WX9A 2WY8Q 2HQ5A 3DXJF 1G3WA 5B1BH 1CGPA 2K9SA 4G6QA 2XHKA 3ZMZA 4BQAA 1PUFB 3LSIA 3ZMSA 3JRDA 1YOVB 3BTJA 3CD6I 1WKMA 2KQRA 4I0BA 2HEOA 1ZGJA 2EZLA 4BJ6C 4BNCA 3H5RA 2XPUA 2LMDA 2EV5A 3PM1A 2XAHA 1FOKA 1FTZA 2OCCH 3HUGA 4EATA 1MNDA 3LFKA 3V7CA 4UUSA 4LFUA 2BY0A 4F52A 1GUUA 2E7XA 3HZJA 3CZ6A 4A0YA 4UUVA 1K78B 1U3EM 3WGGA 1ZRCA 1U5TA 2HDDA 5H2FC 4OMYA 3P9KA 3QPSA 2XRNA 5CJ9A 1RC9A 2HKOA 2R7WA 3CCYA 2HGCA 1F5TA 2NVTJ 2QBYA 2IVMA 3LSRA 2BV6A 3MQ0A 1MSFC 3L2QA 2CSOA 3G73A 2QQ8A 4B43A 3V8JA 2F48A 5J4VA 2NOGA 3K1NA 2ZXIA 2X6OA 1Y1VJ 2ADUA 3I5UA 1ERDA 5HLTA 4U7BA 2CW0F 4WK8F 4D5FA 4NUBA 3BZCA 1IGNA 4ENNA 4PFOA 2QENA 4CSWA 2P6SA 3KLNA 2ZJRF 2DT5A 2MH9A 2PMHA 2CH0A 2OJED 2Y31A 3K0LA 5JVGF 2V26A 4F92B 1O4XA 2N8GA 1J59A 3GFMA 1VFCA 3PO3J 2LG4A 3BTLA 3CMYA 2ZFWA 3QPTA 2VKEA 3EETA 3F9KA 5EG0A 3E6BA 4N9IA 5BMZA 3WG9A 3KEYA 3S1QJ 3M8EA 4AYBN 5GAEJ 4BBSJ 3GZNB 2X98A 3CTAA 1JKQC 5DV5A 2CO5A 3TGNA 2LF7A 5IT9K 2DA6A 1WHUA 2CYYA 3LFUA 5J1YA 1A5JA 2JUGA 1R1TA 3HC7A 1NK3P 4L9VA 4MNUA 1MSEC 4A3EJ 2R93J 3E6MA 4IHSA 1B8IB 2LNBA 3S1NJ 3ZP5A 4R79A 1JE8A 3V7RA 4KISA 1ETQA 1FBUA 2K9QA 3K6GA 2L01A 4K2EA 1Z91A 1WQ2A 1MBEA 3KP3A 2BZTA 3LSJA 2CMPA 2CUZA 2Y9YA 3TDUC 1JKOC 4M9XA 3OYFA 4MIMA 5E1WA 1YLFA 5K7HA 3DBHB 1XSDA 4UXNA 3HOVJ 1HCRA 1XGOA 2Z99A 5EEAA 5IY5H 1X19A 1D1BA 3NQOA 2EV6A 3S17J 1P6RA 2DBBA 4EGZA 4XR6A 1YX3A 2QCOA 2DOAA 2VQLA 5DCMA 4RAFA 1XMXA 2JVGA 4KT6A 3RTRA 1ZGAA 4YIFA 2A6EF 2ZJ2A 4BEHA 2P8TA 2QZ8A 2GOMA 4M9ZA 4MFDA 5HS7A 5J1UA 1R49A 2GBYA 2QQ9A 2Z33A 2NVQJ 2YU9J 1BI2A 2ZXHA 2IW5A 5L3CA 3HOZJ 2DTZA 3OYLA 4KDPA 5E17F 1KU9A 4OWRB 3CJTB 3OYGA 1DDNA 2HQNA 3DLAA 5ERIA 5EGOB 3QYEA 1VQMI 4D0PA 2Y48A 2DOFA 1ETVA 2O8KA 2BEOA 3H36A 2PJRB 3IRQA 1MBGA 3TBIA 1SVOA 3HL2A 3HOUJ 3CCRI 2LKPA 2CU7A 1OKRA 2DODA 5E8IA 3ELKA 5GAHJ 4ZDLA 3DKYA 3E5XA 3VSLA 4OU0A 1ZQ3P 2PI0A 4QWQA 2PQ8A 3DLLF 2QQBA 5FKLA 2RNJA 4XNFA 1U8BA 1QBJA 1JI8A 1Z6RA 4RAGA 3A4CA 3S2DJ 2W84A 2XGDA 2A5YB 4LG3A 1ENHA 1ZELA 3F0CA 2AS5F 2W57A 4MEYF 5CPRB 3PO2J 1OCPA 1W5CC 1TP4A 4BXUA 2D1HA 4II2A 4Z6YA 1OPCA 2DPDA 1P7IA 3WTZA 1VQ9I 3FM3A 1YW8A 3HHHA 3ZCOA 4E7KA 3FISA 2DT7B 3S15J 5L3EA 1VQNI 3L1PA 2JJ7A 2XSDC 2GXGA 4L5JA 2D1VA 1QA6A 1C0WA 2WTEA 2A61A 2AXTC 3BWGA 2K9NA 2DJNA 4PJLA 1T6SA 1IJWC 1Z9CA 1TW2A 4XMYA 5TJJA 2LVSA 4MO7A 3GFLA 3RZDJ 1YW7A 4H4KC 2L7KA 4ENKA 3JAMK 3BR6A 3CLOA 4IKFA 2M2EA 3UKGA 1FOXA 4RLFA 1BC8C 1X1DA 2F4OB 1X2NA 3DQVC 5LEKA 2W00A 4G6DA 4HA8A 2M4GA 2ZSHB 4LLGF 4DOZA 4QIWN 4A3BJ 2EQRA 2HVQA 3LSGA 2KDZA 3B6CA 2H94A 2ISZA 2FUG2 4J00A 3E5QA 1R5ID 4DBQA 2I8DA 2FX0A 4C3IJ 1DUXC 2VLAA 3GLXA 2R3SA 3HKZA 4B09A 1IXCA 2KISA 3L2UA 1GXPA 2X4HA 3E7LA 3PUBA 2L02A 4KN4X 3EQLF 2OU2A 4LD5A 4P55A 5JHUA 3K9TA 4Y4RA 1BIBA 4P9FA 4G7ZF 3TOBA 1JGSA 2H09A 4CZZA 3K1PA 1QRYA 1A6IA 3CCMI 5M5XJ 2V1DA 2Q2EA 3ZQFA 2DCEA 1WGXA 2H6BA 4XOTA 4MTDA 3RI4A 4UHTA 4MGRA 3T8TA 3JRCA 1APLC 5LEJA 2ZNZA 2IEKA 3FXRA 1FPQA 2F2EA 3BDDA 3JREA 2MABA 1MBFA 1SVLA 2RKHA 4HAMA 5CKTA 3OYBA 1DU6A 3L9FA 2F5FA 1SFUA 4CYCB 2M87A 1XCVA 2MC3A 2M34A 2STTA 1OR7C 2HOAA 2X6WA 3JRHA 2V9VA 4B3AA 3BZ6A 1PYVA 3A0HC 3K4KA 1IDZA 5EZGA 4MFEA 4P5OA 2E60A 1J2XA 3DU5A 4CCOA 4A0ZA 1GVDA 2OPTA 1USSA 4A6EA 1T2KA 3HRSA 3FKJA 3LA2A 1LQ1A 2OZ6A 4A3KJ 4WXCA 3WU0A 2DQRA 3RKWA 3A2KA 2EILH 2CFXA 2K5CA 3OMYA 5TGTA 4HNTA 1TBXA 3BLYA 3K1MA 5C44J 1X4OA 5IPAA 2CFOA 1RR7A 4OIRF 1FZPB 4KT5C 3M8FA 1JJ6C 9ANTA 4LOCA 2QEXI 2HYJA 3BR0A 3HIFA 2P4WA 2E34A 3CQZJ 3T0YA 3S16J 5IYCJ 4XLHA 4S0HB 2NS0A 5GTHC 3V8LA 4KN7X 2ZC2A 3I54A 4Q4ZF 1FJLA 2DT6A 3HJEA 3OYHA 1R58A 1MNEA 2ZMEC 2H1LA 2Y30A 3DU6A 1XPXA 2KHMA 2K85A 1IW7F 1UHSA 4CO8A 5J4YA 2G0EA 1T38A 2WADA 4M3EA 1XGNA 5IT3A 1YTYA 4YFKF 4JOMA 1BM9A 3ASNH 2Z2SB 2LDUA 3DWLE 4G6TB 5IOZA 1UELB 2HTSA 2OQRA 4ZYHA 2KKOA 3LSTA 2M45A 2RDPA 3SJMA 4WXDA 3DPTA 4AWXB 1B72B 1R4MB 2KL4A 3M9AA 4IRGA 2W85A 2DW4A 4HYEA 5M5WJ 2KJBA 2LR8A 4D7NA 1BW6A 1BR2A 2COMA 2IP2A 4JYKA 2HDCA 2ZJQF 1WJFA 3WTYC 1TWCJ 3BJAA 5FLMJ 3K4CA 2E1MC 3ZRGA 2TDXA 2LF8A 5A2QZ 3W2VA 3HPGA 3JSPA 3S3NA 2CQ7A 1DGRM 5HDNA 1BR1A 1J5YA 1H89C 3QYBA 5EYRA 3GTOJ 2X6XA 3GTMJ 1Y6IA 3H3ZA 4BJTA 3HDDA 2FU4A 1MGTA 2EA4A 2JK3A 3D5LA 3E1SA 4PUSA 3RCOA 1Y39A 1K78A 2EFQA 5B1AH 3JRBA 4GFBA 4KMFA 2ID6A 3K4MA 2F5CA 4HLXA 3OIOA 1I1GA 2IGKA 3GWZA 3KP4A 3J81Z 5D6FA 2PEXA 3L2CA 4V2GA 4AIKA 3TKYA 1TNTA 4F93B 2ISYA 5CVVA 2Y0MA 1AWCA 4HW0A 4MTEA 2O0YA 5M3FJ 3OIQA 4IOCF 1TQPA 1Z0XA 4N0BA 2R5ZA 4MLOA 2CV1A 1SEUA 1QZZA 1MD0A 1RNLA 1U0JA 2RQQA 2Y2ZA 2CJJA 3EUHC 1R6RA 5C4JJ 1G4DA 2KFDA 2V7FA 2XPVA 2E5ZA 2R4GA 4HX4A 1IRGA 3KZYA 1OCCH 3P9CA 2CUJA 1A6QA 1I39A 2MA3A 3GW2A 3EDPA 1POGA 2KRHA 5CVIA 1LFPA 4XKWA 3VYRB 1O7FA 3LA7A 2VN2A 2KRCA 1UZCA 5D5VB 2RNGA 3LQQA 4XIDA 2E1CA 4HSRA 2UWMA 1XGSA 2EZKA 3SFIA 1YE9A 2OCEA 4B4CA 4ZYEA 2WV1A 4HV6A 2AXLA 3H3VK 4CCLA 4JQFA 3ECHA 3CUQC 2LLKA 3CC4I 4AM3A 1W4MA 2HTJA 1H9TA 3SYTA 3CO7C 1W0TA 2MZ4A 2XPWA 5FD6A 4FASD 3AG4H 1V5GA 5F6FA 4DBRA 4UV8A 3GTJJ 3J80Z 4HRIA 1I6HJ 2BY2A 4HPQA 3A1YA 5F0HA 5ILVA 5KK1A 3CC7I 3LAJA 5ICEA 2XF7A 4PCQA 2K27A 5B5EC 1IF1A 2FMLA 4AIHA 2CV0A 2YX4A 2GQQA 4EM0B 1REPC 1YJWI 2LD5A 4DYQA 5ICGA 5E3MA 2ZFUA 3E5UA 3F72A 1HSTA 5ICCA 2FJ1A 2GXBA 3S93A 4RM3A 3VPRA 4A69C 1YS7A 4XONA 5F0CA 1ORKA 2ME6A 2TRTA 3IC7A 3WGIA 4G7OF 1RETA 2QM3A 5BS6A 2FSWA 2WB1A 3CJQB 4G94A 3Q0VA 2MLGA 2HFHA 2ELJA 4B3XA 5FKMA 2L9VA 2WAQA 2QSHX 4CGZA 2M5WA 5CVJA 3LWFA 2GM4A 1GT0C 3N97A 4JK1X 3MKLA 1ZR4A 4CCMA 1FX7A 2LFBA 3G4SI 4D9JA 3N4MA 2VUMJ 2LK2A 1YYVA 4AC0A 5LGUA 4XORA 5E1XA 1MH3A 4OINF 4IQJA 1TQIA 1MMSA 2YU3A 4N4OB 1OQYA 3I58A 4U0YA 2QVOA 2HKXA 3E6DA 2BY3A 2OAZA 3RKXA 3ZMTA 5F64A 4Y52J 3HM5A 2E2HJ 2HOTA 3ERMA 3G1LA 2L7ZA 2DMTA 3ZOBA 2NVYJ 1I1SA 4RGUA 4ZYAA 1P7JA 4EVIA 4X6AJ 5IYDJ 4QPOA 2VBZA 2OBPA 2VC1A 3TO9A 3AKZA 1LB2A 4LB6B 4JX6A 1FOWA 4ZDOA 1MDMA 1K4SA 3KIOA 2ZCWA 3ZN0A 3H0DA 1Z6TA 2OUMA 1GVJA 2R7ZJ 3R4KA 4RB3C 4HDUA 2IBDA 4BACA 4XLPF 2EZHA 2TCTA 3F23A 3IH4A 1MMGA 2R5YA 2XAJA 1XS9A 1LEBA 1LDDA 1SD6A 2HU9A 1W7PB 4IRHA 4E6KG 5D5UB 1YIOA 3A01A 3CCLI 2XUBA 3WU2C 5BNGA 2H8RA 3MZ8A 1WVRA 1EJ9A 3WHBA 2KZVA 2FQ4A 2K02A 3IH2A 2R7DA 4U0WA 1VQ6I 2P5VA 3OYNA 3PNYA 5HS8A 2UUZA 3OYIA 2WC2A 4ZYGA 5K5OA 1XCBA 2Q8KA 3FDYA 4PJ0C 3DBLB 5KCMA 5DD8A 3COAC 4F91B 1KQ9A 1YJNI 4EM1A 2VJ4A 2W25A 3OS0A 2L4AA 1O3SA 3A52A 2R7TA 2O7OA 1G3TA 1D3YA 4ESBA 4UY8I 1DPUA 2RN7A 5KAFC 2HPIA 2OQGA 5CLSA 1BBYA 1SD7A 3DPUA 4DW6A 4RLQA 2QSGX 3BG3A 1PVEA 3EUKL 4IL6C 4BXFA 2LTPA 1IUYA 5HDGA 3C2BA 1MJAA 5D6EA 1D5VA 2ZMEB 4E4HA 3AG2H 3IP4B 3WTUC 1U8RA 4YELA 5EJCA 1Z21A 3HBLA 4A3MJ 2FNAA 3OL3A 2BHZA 2IGMA 4UUTA 1KA8A 3G3ZA 1U5TC 3L7WA 4IJAA 3PFIA 3GX4X 1Q1HA 1SAXA 2EJRA 5IT9Z 4E7LA 1Y56A 1XSXA 2HVSA 3GBGA 3SEZA 4YFNF 3U1KA 1JHHA 3PNTA 4M6XA 2FD5A 4NQWB 2JVHA 3G71I 4C2UA 2ELHA 3GZ5A 3IWZA 1FBSA 4A5MA 2Q1ZB 3HOSA 2LKXA 2DOEA 1P2FA 1RIOH 2VPLA 4ANJA 5LGTA 4B47A 3OS2A 1J0RA 1MMNA 1O3TA 4ENMA 2FBIA 3U9GA 2E1MB 2FXAA 2HYFA 1SAUA 1AU7A 1UAAA 3CUOA 2KRFA 5EEGA 4RM2A 2AHQA 2LY2A 4HNUA 1A35A 2Y0SN 2HS5A 4M3FA 3RSNA 2NRAC 1XG1A 1T98A 3R0JA 4CDGA 1QHHD 3BG7A 3CO6C 3S1RJ 1P9QC 4DGWB 5LBQA 4M72A 1WJ5A 1P4WA 2HNHA 3BP8A 2DK8A 3GUDA 3SQNA 4DZPA 1N75A 1SMTA 3MZYA 3G1MA 3SZTA 1BC7C 4ABZA 1ZREA 3U2RA 1WI9A 4UB6C 5GPAA 2DA5A 5FLVA 3RDIA 5EZHA 4JX5A 2BW3A 2CS3A 3DF8A 4HF0A 2GIZA 3PSFA 3JAMR 4R8HA 4PDKA 5FROA 3T5XA 1S7EA 1NG7A 1QNTA 3DV8A 3H9GA 3M1CA 1JUMA 1TL8A 4ZZLA 3P5JA 4DZJA 3WTSC 3DKXA 3IV5A 3TOAA 1V3FA 1U78A 4CA0A 4GO1A 4ZDPA 4BYYA 4NC6A 3IWFA 2MVTA 2XASA 5DS9A 4P96A 4LG0A 4A3IJ 3FK6A 3PQJA 2XGEA 4I02A 4M71A 3RIRA 1IO2A 1YITI 4L0YB 2CW7A 3OR2C 1D5YA 1JT6A 1VF9A 2D5VA 4ITVA 4M3DA 1SFXA 3RQ4A 3J7AO 3W6VA 3DPLC 1LE8A 3LSPA 1SD5A 2V9KA 6PAXA 2KJCA 1ZG5A 3CUQB 3O8GA 1IN7A 1OYYA 1S7AA 2MSYA 5JHFA 3JRAA 3FZVA 3I59A 2W1OA 1T08B 3LQRA 5K5QA 5FRMA 2R7XA 1R1VA 2V6EA 4Y13A 3L09A 2CQNA 3HTSB 3FF5A 4CCKA 1ZYRF 2GOXB 5C4XJ 2K4BA 3KEOA 1FOYA 2UXXA 1IAWA 2JQ7A 3HB9A 1S29A 3ZQHA 1LDJA 3RKYA 3SFZA 3PNVA 2BGCA 3MZHA 4KIGA 4XSZF 1E0EA 2HOSA 2NYXA 4ZTJA 1MMAA 3F21A 1FEXA 3V4GA 4FCYA 4UNOA 4RA2A 4UVAA 2GIVA 2O03A 1FIAA 5LRRA 3SDBA 2WAFA 5LHGA 2KZGA 2LBFA 2HQRA 2M8EA 3KLOA 2XAFA 5DYMA 3IKTA 2STWA 2CUEA 2ME0A 1MJBA 1Y8RB 4A12A 1ETOA 3WODF 2YSRA 2DN0A 3GO5A 2JWTA 4G12A 3RYRA 1VQ4I 4XLAA 2ZB9A 3QOEA 3OYJA 4E7JA 3CCQI 3FXUA 4I09A 2NVXJ 2FBHA 1N77A 1P92A 4N9HA 2MLKA 3BTIA 1FT9A 1HKSA 3FBIB 3ZPLA 4OOIA 2DQLA 1VQKI 4LIUA 3G1OA 2EA2A 2Q0OA 2A3SA 4I6ZA 1QVUA 3OS1A 1HW5A 3OOPA 1FY7A 1IN8A 4GGGA 2FQ3A 3CMAI 2C6YA 3F3XA 1R22A 5HS9A 3TP0A 1PUEE 5LGNA 2BXZA 2JA8J 3FHZA 4LB5A 4DJAA 4XQFA 2OTLI 2PMZN 2BVMA 1TNSA 1WWXA 2LC2A 1OCTC 2NOJB 1X1CA 3FMSA 5DDGA 2E36A 1R5GA 2VKHA 2WWYA 5K7FA 2DMQA 2R0QC 2Y9ZA 3A02A 3PQKA 1JTYA 3HRUA 4XK4A 3AAFA 4PGGA 1O7LA 3OV8A 3VSKA 5HDKA 3QODA 4BS9A 1FP1D 1ZN2A 4C9YA 3I56I 1NG6A 1FWZA 1X3ZB 3J7AW 4P1WA 1GV2A 4PFPA 2PFBA 1E3HA 2A05A 3E0JB 4OAYA 1SMYF 4CXFA 2R7UA 2BE5F 3M7GA 4FETA 1Y0UA 3SXYA 1OCRH 3WE2A 1D8JA 4IPAA 4U7DA 2HXIA 3R61A 2HZDA 5HNFA 3Q0UA 2XROA 2XGCA 4Z2YA 1YRNA 2YUSA 3ABLH 4NDLA 1RR8C 2EB7A 3RQIA 2E1OA 2OD5A 3W2WA 3BQZA 5JI6A 1R71A 3L2VA 2B63J 4ON0A 3CDIA 3FM5A 4I7HA 2JUCA 4OIQF 5J3LA 2WB1N 3BCAA 2VODA 2DFEA 1BN5A 3ZQIA 4M6VA 3A0BC 1NK2P 4A3CJ 1EV7A 4RB0A 3ESWB 1TZLA 3ZR8X 5J8CA 2VASA 2DI3A 3OL4A 4EJVA 4RGSA 1GHCA 2VL8A 1D1CA 1ETXA 2JA2A 3RKQA 2MFZA 3TO7A 1HW2A 3LSMA 4XRSG 5EEHA 3H5NA 3JRFA 2DJIA 2MH2A 3OSGA 1J9IA 5KVRA 2KLOA 3EPZA 5E3LA 2DMUA 3HUGB 3I64A 3UR3C 1HKTA 3HSFA 4UUSB 3CCUI 3I71A 1ONVA 2ZJPF 2EIKH 5M5YJ 3R6SA 3OYMA 1TQMA 2FNPA 2VKVA 1IUFA 2E2JJ 2P6TA 2VT2A 4NBQA 3ZXSA 4LJZF 4D7MA 3KFWX 1U5TB 4AVPA 3S3OA 5JVTA 5CQGA 5ED4A
chains in the Genus database with same CATH topology
3T1BA 2DPUA 2QBYB 4ZYDA 3F22A 2KIUA 2R7FA 4ZZDA 4O6JA 2HR3A 1BJAA 2HWVA 1FYLA 3ERED 2YX7A 4JBAA 1BI1A 2XAGA 3H3UA 1O57A 2V79A 2ESHA 1U2WA 2Y75A 2O6GE 2ZXJA 1E2XA 1CF7B 2X0LA 1LDKB 5FFZA 2E1NA 2VE8A 3GFIA 1X3UA 2JTVA 4KUMA 3WGHA 2EFWA 4RGXA 1F9NA 3FX3A 2QLZA 4IVNA 5E18F 4MEXF 3GYHX 3HTUA 5D8KB 4ETSA 2IPQX 5FLXZ 2O3FA 1XMAA 2RVCA 2M1BA 1T0FA 4M9SA 5F1RA 1IRFA 4HF1A 3BJOA 5L3BA 3DKWA 5JFRA 5K1YA 5DCMB 2A6HF 3EYIA 4YFXF 2BYVE 3CJNA 2DO7A 2WV0A 1EH6A 5DUKA 5L3GA 3ECOA 1UCRA 4RAZA 2D45A 1HKQA 4KFCA 2VE9A 2CWEA 2ESNA 2VOPA 1FNNA 4IF4A 1PP8F 2GZWA 2DFIA 3IKVA 4G8XA 1ZG1A 1NHAA 5E1ZB 4WF2A 2Z9OA 1WRJA 2VT3A 3F8CA 5H6QA 1JXSA 1FSEA 5HOOA 4KYWA 1W5TA 1G3SA 3ZMUA 2RQPA 5D4SA 1ZAOA 4A5NA 2OA4A 4RGRA 1IN5A 3FXQA 5D4RA 2FE3A 1XGMA 5LLQA 1J75A 1ZH5A 4HQMA 1UB9A 1ZHFA 4XRFA 1F4KA 4P9UA 2O8XA 3QAHA 3O6BB 5K5RA 3O3KA 5A2QK 3MAJA 2RV8A 3KE2A 2HYGD 4EV0A 2E7WA 3QOPA 2JSCA 2VBWA 4A0XA 3M1EA 3QP5A 1USTA 4EJTA 3H92A 2QQAA 3FMRA 3RPQA 3RPUA 3J81K 2QWWA 4O5VA 1XD7A 1QPMA 4PZJA 1FBQA 2IA0A 4S05A 3D0SA 5DUIA 4HX8A 3F8MA 3B73A 3TQNA 2A07F 1L3LA 4NB5A 2CGPA 3F6VA 1R1UA 4QLCU 1KU3A 5J6XA 1EH8A 5ILUA 3W6JB 2RC4A 2KIFA 1SFEA 2NNYA 4GXOA 2YPRA 2F5EA 1IXSB 4CYDA 2L3DA 2FRHA 4Q47A 2ZO4A 4KIFA 3JTGA 1KQ0A 3E6CC 2XGXA 4HV5A 4XLNF 4HOBA 4BHPA 4EM2A 3LAPA 4UV9A 1HW1A 3V8KA 3E97A 1TLHB 2H6CA 1VTNC 1MKMA 4KIBA 3MWMA 5BPIA 3QU6A 2EFNA 3F8NA 1O3QA 2JRTA 5LHIA 2EK5A 5TRDA 5H6RA 1BOAA 1FP2A 3S2WA 1UHMA 4XBFA 3C18A 3R60A 4S04A 2IT0A 2YR2A 3KEQA 3ZMDA 4RAYA 4L9TA 1EH7A 1QGPA 3MFKA 2CG4A 2V1UA 3BPXA 1YG2A 4YG2F 4NHJA 5CVRA 1Z1DA 4FX4A 1ZRDA 2MD5A 2JZYA 3ZMVA 1TTYA 1IN4A 1B4AA 3BJ6A 5ILSA 1JHFA 4H0EA 4RS8A 2FEZA 4KNYA 2GWRA 4RB1A 4LK1F 4UVBA 3ZQ7A 1GXQA 1LEAA 4EJWA 2VOOA 4Y15A 4WCGA 4KA4A 3K69A 2GA2A 1K6OA 3QU3A 1KGSA 1I27A 1OYWA 2DTRA 3VOEA 4M74A 3V7SA 2GA1A 4I98B 1ZRFA 1CF7A 4CICA 3JSOA 4IHTA 5D8LB 4OIOF 3MEXA 5AIPA 3RJPA 1FYKA 4A6DA 2J5OA 2XKPA 4O3MA 3HSEA 2A68F 1B6AA 2K4JA 3I4PA 1ZLKA 1Z05A 4Q48A 1R5HA 3VFZA 1J7KA 1G6NA 1P4XA 4ASNA 4DQ2A 4HDVA 1ON1A 1R00A 2BBYA 2GAUA 3CDHA 2IA1A 3SZPA 3HRTA 1ZG3A 2HZTA 3BY6A 3JAMZ 2XVCA 1D8KA 1S8NA 2VONA 4G9YA 4PGHA 3P9IA 1XDSA 1QZYA 2XV4S 5E20A 1DP7P 2M30A 1I6XA 5BPDA 2UZKA 2ACJA 2NNNA 2IJLA 1BI0A 1MZBA 5CVUA 5H20A 3VODA 4EQQA 4TV7A 4BHCA 3GXOA 5E8GA 3VB2A 5CYVA 1XDUA 2O61A 4OIPF 2NAZA 2ZNYA 4M73A 1UFMA 5HVQC 2L54A 5JR3A 1R7JA 4L9JA 3ZN1A 4BH9A 2UXNA 5AONA 1XSVA 1FSHA 1K7AA 2H27A 3FWEA 1MDMB 2W24A 2CQKA 5FB2A 1S3JA 3KP7A 3C1DA 1G3YA 2K7LA 2DAOA 1OMIA 2LSOA 2G7UA 4BHBA 1HBXG 3DFGA 4FX0A 3MCZA 3QPHA 4UVCA 1FYMA 3RYPA 4I2OA 1A04A 1K79A 3HHGA 1H0MA 3JW4A 5FD5A 4M6YA 2G7HA 5D5WB 1MJ9A 2G9WA 5DD4A 1ZLJA 2QUFA 3Q5FA 4ENJA 4U0VA 4CHUA 2PG4A 4B8XA 4HF2A 1ON2A 4HX7A 2XAQA 1KYWA 2JPCA 5FFXA 3T8RA 1KU2A 1RZ4A 1KYZA 2XIGA 1STZA 2L4MA 5D5XB 4DNCA 3IL2A 4L9NA 4RB2C 4HLYA 2B0LA 3QP6A 1LJ9A 3Q9VA 5LHHA 4Q5SF 2Z3YA 5DEQA 1TW3A 1W7PD 5HLHA 3WTWC 1W7PA 4LLLA 1OR7A 1P4AA 3IRRA 2PBIA 1I5ZA 1R36A 2EV0A 3TDZC 3EYYA 3ABUA 2IA2A 1RI7A 4OMZA 4A2UA 1FC3A 2DU9A 1QQIA 2V1XA 3WE3A 1IN6A 4HBLA 1UHWA 2A69F 1ZARA 1BIAA 2P5KA 2FA5A 3TO6A 4LG0B 2VBYA 2PJPA 1DPRA 1HXDA 2ZMEA 4EJUA 3GFJA 1B9NA 3I53A 3KP5A 3GEZA 2P7VB 2FMYA 1YW9A 1Z7UA 3ROUA 1YO5C 1XMKA 5FO5A 4L18B 4NQWA 5DCFA 1BI3A 3I59B 4Y17A 2EWNA 3F8BA 3KZZA 2RGVA 2EFOA 1FLIA 3R0AA 1B59A 3DEUA 3IHUA 4L5IA 3QRFF 3C3WA 1QO0D 3O2PE 3W6KB 3HRMA 1F1ZA 4ZH4F 5LRSA 2FOKA 2VBXA 4I0AA 5BQTA 3GF2A 5HLGA 1YQAA 3HOTA 2HOEA 4MQ9F 4GYGA 4GCVA 2Z5UA 1XN7A 3JTHA 1ULYA 5FGMA 3Q9SA 2JPBA 4BAYA 4IXAA 4HQEA 2ZKZA 4GYIA 5J8FA 3EUHA 3NEUA 2VC0A 3WTXC 1SD4A 1AOYA 3DP7A 5FLXK 4XSXF 3E3VA 2MBFA 3ABTA 1PP7U 1XB4A 3HYIA 4FHTA 4F7ZA 1ODDA 3KP6A 1HQCA 2EFPA 4FT8A 3C7JA 1U6GA 1LVAA 3CUQA 2KIMA 1E17A 1L0OC 2F5DA 4MHGA 2PLYA 3GZ6A 1RUOA 1R23A 4I01A 4ESJA 1O3RA 1WSUA 2IRFG 1S7OA 3U1DA 3BPVA 2DK5A 2OZUA 2FBKA 3REOA 4LMYA 5L3DA 1LNWA 2K86A 1S6LA 4EGYA 2D2WA 3L00A 1RUNA 3I0TA 2P7CB 3F8FA 1B1BA 1H9GA 1IXRC 3BROA 4YIIA 3LA3A 5L3FA 4EMSA 5HLIA 4LLNA 3NRVA 2P5LC 1T39A 3ML6A 1V4RA 2VXZA 4G7HF 1HSJA 4U88A 4IRIA 2PN6A 1IZ1A 3GVAA 3FMQA 3KP2A 3J80K 1OYIA 2J5PA 3ULQB 4HZFA 3B02A 5ICFA 3BOQA 3P7NA 1YS6A 4L0ZB 4AD9A 4AIJA 2ETHA 2V6CA 1B9MA 4KMUX 3KETA 2JT1A 3VEPA 4ESFA 4E70A 5BOXA 4LGWA 2QYOA 4WXHA 2DLLA 3K2ZA 2PMUA 3F6OA 3WTVC 4MQVA 4R1HA 1YFHA 1KQ8A 1PDNC 4WWCA 2XKOA 3ISPA 2FF4A 5AIQA 4EJOA 4LK0F 4KICA 3WU1B 3KCCA 2ZBKA 1KU7A 1W5SA 3SHFA 3HSRA 3WTTC 4WX9A 3DXJF 1G3WA 1CGPA 4G6QA 2XHKA 3ZMZA 4BQAA 3ZMSA 1WKMA 4I0BA 2HEOA 1ZGJA 4BNCA 2EV5A 2XAHA 1FOKA 3HUGA 3LFKA 3V7CA 4LFUA 2E7XA 4UUVA 4A0YA 1K78B 1U3EM 3WGGA 1ZRCA 1U5TA 4OMYA 3P9KA 2XRNA 5CJ9A 2HKOA 2HGCA 1F5TA 2QBYA 2IVMA 2BV6A 3MQ0A 2CSOA 3G73A 3V8JA 3K1NA 2ADUA 3I5UA 4U7BA 2CW0F 4WK8F 4ENNA 2QENA 2P6SA 3KLNA 2DT5A 2MH9A 2PMHA 3K0LA 1J59A 3GFMA 2ZFWA 3QPTA 3EETA 3E6BA 4N9IA 5BMZA 3WG9A 3M8EA 3CTAA 5DV5A 2CO5A 3TGNA 2LF7A 5IT9K 2CYYA 1R1TA 4L9VA 4MNUA 3E6MA 4IHSA 2LNBA 3ZP5A 4R79A 1JE8A 3V7RA 1FBUA 2L01A 4K2EA 1Z91A 1WQ2A 3KP3A 3TDUC 4M9XA 5E1WA 1YLFA 1XSDA 4UXNA 1XGOA 2Z99A 3NQOA 2EV6A 1P6RA 2DBBA 4EGZA 5DCMA 3RTRA 1ZGAA 4YIFA 2A6EF 2ZJ2A 2P8TA 2QZ8A 4M9ZA 5HS7A 2QQ9A 2Z33A 1BI2A 2IW5A 5L3CA 4KDPA 5E17F 1KU9A 1DDNA 2HQNA 5ERIA 4D0PA 2Y48A 2BEOA 3IRQA 2LKPA 1OKRA 5E8IA 3ELKA 3E5XA 4OU0A 2PI0A 4QWQA 2PQ8A 2QQBA 2RNJA 1QBJA 1Z6RA 2W84A 2A5YB 2AS5F 2W57A 4MEYF 4BXUA 2D1HA 1OPCA 2DPDA 3WTZA 3FM3A 1YW8A 3HHHA 5L3EA 2GXGA 4L5JA 2D1VA 1C0WA 2WTEA 2A61A 3BWGA 1T6SA 1Z9CA 1TW2A 5TJJA 3GFLA 1YW7A 4ENKA 3JAMK 3CLOA 1BC8C 3DQVC 5LEKA 4G6DA 4HA8A 4LLGF 2H94A 2ISZA 3E5QA 1DUXC 3GLXA 2R3SA 4B09A 1IXCA 1GXPA 2X4HA 2L02A 4KN4X 3EQLF 2OU2A 4LD5A 4P55A 5JHUA 3K9TA 1BIBA 4G7ZF 4P9FA 3TOBA 1JGSA 2H09A 4CZZA 3K1PA 2V1DA 2Q2EA 2H6BA 4MTDA 3RI4A 4UHTA 4MGRA 3T8TA 5LEJA 2ZNZA 3FXRA 1FPQA 2F2EA 3BDDA 4HAMA 2RKHA 3L9FA 2F5FA 1SFUA 2M87A 1XCVA 2MC3A 2STTA 2V9VA 3BZ6A 4P5OA 1J2XA 4A0ZA 1USSA 4A6EA 1T2KA 3HRSA 3LA2A 1LQ1A 2OZ6A 4WXCA 3WU0A 2DQRA 3RKWA 2CFXA 1TBXA 3K1MA 4OIRF 1FZPB 4KT5C 3M8FA 3HIFA 2P4WA 3T0YA 2NS0A 3V8LA 4KN7X 3I54A 4Q4ZF 1R58A 1IW7F 4CO8A 1T38A 1XGNA 5IT3A 1YTYA 4YFKF 1BM9A 2LDUA 2HTSA 2OQRA 4ZYHA 2KKOA 3LSTA 2M45A 2RDPA 4WXDA 3DPTA 4AWXB 3M9AA 4IRGA 2W85A 2DW4A 4HYEA 2KJBA 2IP2A 2COMA 2HDCA 3WTYC 3BJAA 2TDXA 2LF8A 5A2QZ 3JSPA 5HDNA 1J5YA 3H3ZA 2FU4A 1MGTA 2EA4A 3D5LA 1K78A 2EFQA 4KMFA 2F5CA 4HLXA 1I1GA 3GWZA 3KP4A 3J81Z 5D6FA 2PEXA 3L2CA 4AIKA 3TKYA 1TNTA 2ISYA 5CVVA 2Y0MA 1AWCA 4HW0A 4MTEA 2O0YA 1TQPA 4N0BA 1QZZA 1MD0A 1RNLA 1G4DA 4HX4A 1IRGA 3KZYA 3P9CA 2MA3A 3GW2A 3EDPA 5CVIA 1O7FA 3LA7A 2VN2A 5D5VB 3LQQA 2E1CA 2UWMA 1XGSA 4ZYEA 4HV6A 2AXLA 4JQFA 3ECHA 3CUQC 1W4MA 2HTJA 1H9TA 3CO7C 5FD6A 5F6FA 4UV8A 3J80Z 5ILVA 5KK1A 3LAJA 5ICEA 4PCQA 2K27A 1IF1A 2FMLA 4AIHA 2YX4A 2GQQA 4EM0B 1REPC 5ICGA 3E5UA 3F72A 1HSTA 5ICCA 2GXBA 1YS7A 3IC7A 3WGIA 4G7OF 2QM3A 5BS6A 2FSWA 4G94A 2MLGA 2HFHA 4CGZA 2M5WA 5CVJA 3LWFA 3N97A 4JK1X 1FX7A 3N4MA 1YYVA 5LGUA 5E1XA 4OINF 1TQIA 2YU3A 3I58A 4U0YA 2QVOA 2HKXA 3E6DA 2OAZA 3RKXA 3ZMTA 5F64A 1I1SA 4RGUA 4EVIA 2VBZA 2OBPA 2VC1A 3TO9A 1LB2A 4LB6B 1MDMA 2ZCWA 3ZN0A 1Z6TA 1GVJA 3R4KA 4RB3C 4HDUA 4XLPF 3F23A 2XAJA 1LEBA 1LDDA 1SD6A 4IRHA 1W7PB 5D5UB 1YIOA 2XUBA 2K02A 2R7DA 4U0WA 2P5VA 5HS8A 2WC2A 4ZYGA 5K5OA 1XCBA 2Q8KA 5DD8A 3COAC 1KQ9A 4EM1A 2W25A 1O3SA 2L4AA 1G3TA 1D3YA 4ESBA 1DPUA 2RN7A 2OQGA 5CLSA 1BBYA 1SD7A 1IUYA 5HDGA 1MJAA 5D6EA 1D5VA 2ZMEB 3WTUC 1U8RA 2FNAA 1KA8A 3G3ZA 1U5TC 3L7WA 4IJAA 3PFIA 3GX4X 1Q1HA 1SAXA 2EJRA 5IT9Z 1XSXA 4YFNF 1JHHA 4M6XA 2ELHA 3GZ5A 3IWZA 1FBSA 4A5MA 3HOSA 1P2FA 1RIOH 5LGTA 1J0RA 1O3TA 4ENMA 2FBIA 3U9GA 2FXAA 2HYFA 3CUOA 2KRFA 5EEGA 2HS5A 2NRAC 3R0JA 1T98A 4CDGA 3CO6C 5LBQA 4M72A 1P4WA 3BP8A 3GUDA 2DK8A 3SQNA 1SMTA 3MZYA 3SZTA 1BC7C 1ZREA 3U2RA 1WI9A 3RDIA 3DF8A 4HF0A 4R8HA 4PDKA 3T5XA 1QNTA 3DV8A 4ZZLA 3WTSC 3TOAA 1V3FA 1U78A 4GO1A 4BYYA 3IWFA 2XASA 4P96A 4LG0A 3PQJA 4I02A 4M71A 3RIRA 4L0YB 1SFXA 3J7AO 3DPLC 1SD5A 6PAXA 2KJCA 1ZG5A 3CUQB 1IN7A 1OYYA 1S7AA 3FZVA 3I59A 3LQRA 5K5QA 1R1VA 4Y13A 3L09A 3HTSB 3FF5A 1ZYRF 2K4BA 3KEOA 2UXXA 1IAWA 1S29A 1LDJA 3RKYA 3SFZA 2BGCA 3MZHA 4KIGA 4XSZF 2NYXA 3F21A 3V4GA 4UNOA 4UVAA 2GIVA 2O03A 5LRRA 5LHGA 2M8EA 2HQRA 3KLOA 3IKTA 2XAFA 5DYMA 2STWA 1MJBA 4A12A 3WODF 2YSRA 3GO5A 3RYRA 3FXUA 4I09A 2FBHA 1P92A 4N9HA 2MLKA 1FT9A 1HKSA 3ZPLA 4OOIA 2DQLA 2EA2A 2Q0OA 2A3SA 1HW5A 3OOPA 1FY7A 1IN8A 4GGGA 2FQ3A 2C6YA 3F3XA 1R22A 5HS9A 1PUEE 5LGNA 3FHZA 4LB5A 1TNSA 1WWXA 3FMSA 5DDGA 2WWYA 1R5GA 3PQKA 3HRUA 3AAFA 4PGGA 1O7LA 3OV8A 5HDKA 1FP1D 1ZN2A 1FWZA 2PFBA 1SMYF 4CXFA 2BE5F 3M7GA 1Y0UA 3SXYA 3WE2A 1D8JA 4IPAA 4U7DA 3R61A 2XROA 4Z2YA 2EB7A 2OD5A 5JI6A 4ON0A 3FM5A 4I7HA 4OIQF 2VODA 1BN5A 1EV7A 4RB0A 5J8CA 2DI3A 4EJVA 1GHCA 4RGSA 3TO7A 1HW2A 5EEHA 2MH2A 1J9IA 5KVRA 3I64A 1HKTA 3HSFA 3I71A 1ONVA 3R6SA 1TQMA 2FNPA 2P6TA 2VT2A 4LJZF 3KFWX 1U5TB 4AVPA 5JVTA 5ED4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1B A;  2DPU A;  2QBY B;  4ZYD A;  3F22 A;  2KIU A;  2R7F A;  4ZZD A;  4O6J A;  2HR3 A;  1BJA A;  2HWV A;  1FYL A;  3ERE D;  2YX7 A;  4JBA A;  1BI1 A;  2XAG A;  3H3U A;  1O57 A;  2V79 A;  2ESH A;  1U2W A;  2Y75 A;  2O6G E;  2ZXJ A;  1E2X A;  1CF7 B;  2X0L A;  1LDK B;  5FFZ A;  2E1N A;  2VE8 A;  3GFI A;  1X3U A;  2JTV A;  4KUM A;  3WGH A;  2EFW A;  4RGX A;  1F9N A;  3FX3 A;  2QLZ A;  4IVN A;  5E18 F;  4MEX F;  3GYH X;  3HTU A;  5D8K B;  4ETS A;  2IPQ X;  5FLX Z;  2O3F A;  1XMA A;  2RVC A;  2M1B A;  1T0F A;  4M9S A;  5F1R A;  1IRF A;  4HF1 A;  3BJO A;  5L3B A;  3DKW A;  5JFR A;  5K1Y A;  5DCM B;  2A6H F;  3EYI A;  4YFX F;  2BYV E;  3CJN A;  2DO7 A;  2WV0 A;  1EH6 A;  5DUK A;  5L3G A;  3ECO A;  1UCR A;  4RAZ A;  2D45 A;  1HKQ A;  4KFC A;  2VE9 A;  2CWE A;  2ESN A;  2VOP A;  1FNN A;  4IF4 A;  1PP8 F;  2GZW A;  2DFI A;  3IKV A;  4G8X A;  1ZG1 A;  1NHA A;  5E1Z B;  4WF2 A;  2Z9O A;  1WRJ A;  2VT3 A;  3F8C A;  5H6Q A;  1JXS A;  1FSE A;  5HOO A;  4KYW A;  1W5T A;  1G3S A;  3ZMU A;  2RQP A;  5D4S A;  1ZAO A;  4A5N A;  2OA4 A;  4RGR A;  1IN5 A;  3FXQ A;  5D4R A;  2FE3 A;  1XGM A;  5LLQ A;  1J75 A;  1ZH5 A;  4HQM A;  1UB9 A;  1ZHF A;  4XRF A;  1F4K A;  4P9U A;  2O8X A;  3QAH A;  3O6B B;  5K5R A;  3O3K A;  5A2Q K;  3MAJ A;  2RV8 A;  3KE2 A;  2HYG D;  4EV0 A;  2E7W A;  3QOP A;  2JSC A;  2VBW A;  4A0X A;  3M1E A;  3QP5 A;  1UST A;  4EJT A;  3H92 A;  2QQA A;  3FMR A;  3RPQ A;  3RPU A;  3J81 K;  2QWW A;  4O5V A;  1XD7 A;  1QPM A;  4PZJ A;  1FBQ A;  2IA0 A;  4S05 A;  3D0S A;  5DUI A;  4HX8 A;  3F8M A;  3B73 A;  3TQN A;  2A07 F;  1L3L A;  4NB5 A;  2CGP A;  3F6V A;  1R1U A;  4QLC U;  1KU3 A;  5J6X A;  1EH8 A;  5ILU A;  3W6J B;  2RC4 A;  2KIF A;  1SFE A;  2NNY A;  4GXO A;  2YPR A;  2F5E A;  1IXS B;  4CYD A;  2L3D A;  2FRH A;  4Q47 A;  2ZO4 A;  4KIF A;  3JTG A;  1KQ0 A;  3E6C C;  2XGX A;  4HV5 A;  4XLN F;  4HOB A;  4BHP A;  4EM2 A;  3LAP A;  4UV9 A;  1HW1 A;  3V8K A;  3E97 A;  1TLH B;  2H6C A;  1VTN C;  1MKM A;  4KIB A;  3MWM A;  5BPI A;  3QU6 A;  2EFN A;  3F8N A;  1O3Q A;  2JRT A;  5LHI A;  2EK5 A;  5TRD A;  5H6R A;  1BOA A;  1FP2 A;  3S2W A;  1UHM A;  4XBF A;  3C18 A;  3R60 A;  4S04 A;  2IT0 A;  2YR2 A;  3KEQ A;  3ZMD A;  4RAY A;  4L9T A;  1EH7 A;  1QGP A;  3MFK A;  2CG4 A;  2V1U A;  3BPX A;  1YG2 A;  4YG2 F;  4NHJ A;  5CVR A;  1Z1D A;  4FX4 A;  1ZRD A;  2MD5 A;  2JZY A;  3ZMV A;  1TTY A;  1IN4 A;  1B4A A;  3BJ6 A;  5ILS A;  1JHF A;  4H0E A;  4RS8 A;  2FEZ A;  4KNY A;  2GWR A;  4RB1 A;  4LK1 F;  4UVB A;  3ZQ7 A;  1GXQ A;  1LEA A;  4EJW A;  2VOO A;  4Y15 A;  4WCG A;  4KA4 A;  3K69 A;  2GA2 A;  1K6O A;  3QU3 A;  1KGS A;  1I27 A;  1OYW A;  2DTR A;  3VOE A;  4M74 A;  3V7S A;  2GA1 A;  4I98 B;  1ZRF A;  1CF7 A;  4CIC A;  3JSO A;  4IHT A;  5D8L B;  4OIO F;  3MEX A;  5AIP A;  3RJP A;  1FYK A;  4A6D A;  2J5O A;  2XKP A;  4O3M A;  3HSE A;  2A68 F;  1B6A A;  2K4J A;  3I4P A;  1ZLK A;  1Z05 A;  4Q48 A;  1R5H A;  3VFZ A;  1J7K A;  1G6N A;  1P4X A;  4ASN A;  4DQ2 A;  4HDV A;  1ON1 A;  1R00 A;  2BBY A;  2GAU A;  3CDH A;  2IA1 A;  3SZP A;  3HRT A;  1ZG3 A;  2HZT A;  3BY6 A;  3JAM Z;  2XVC A;  1D8K A;  1S8N A;  2VON A;  4G9Y A;  4PGH A;  3P9I A;  1XDS A;  1QZY A;  2XV4 S;  5E20 A;  1DP7 P;  2M30 A;  1I6X A;  5BPD A;  2UZK A;  2ACJ A;  2NNN A;  2IJL A;  1BI0 A;  1MZB A;  5CVU A;  5H20 A;  3VOD A;  4EQQ A;  4TV7 A;  4BHC A;  3GXO A;  5E8G A;  3VB2 A;  5CYV A;  1XDU A;  2O61 A;  4OIP F;  2NAZ A;  2ZNY A;  4M73 A;  1UFM A;  5HVQ C;  2L54 A;  5JR3 A;  1R7J A;  4L9J A;  3ZN1 A;  4BH9 A;  2UXN A;  5AON A;  1XSV A;  1FSH A;  1K7A A;  2H27 A;  3FWE A;  1MDM B;  2W24 A;  2CQK A;  5FB2 A;  1S3J A;  3KP7 A;  3C1D A;  1G3Y A;  2K7L A;  2DAO A;  1OMI A;  2LSO A;  2G7U A;  4BHB A;  1HBX G;  3DFG A;  4FX0 A;  3MCZ A;  3QPH A;  4UVC A;  1FYM A;  3RYP A;  4I2O A;  1A04 A;  1K79 A;  3HHG A;  1H0M A;  3JW4 A;  5FD5 A;  4M6Y A;  2G7H A;  5D5W B;  1MJ9 A;  2G9W A;  5DD4 A;  1ZLJ A;  2QUF A;  3Q5F A;  4ENJ A;  4U0V A;  4CHU A;  2PG4 A;  4B8X A;  4HF2 A;  1ON2 A;  4HX7 A;  2XAQ A;  1KYW A;  2JPC A;  5FFX A;  3T8R A;  1KU2 A;  1RZ4 A;  1KYZ A;  2XIG A;  1STZ A;  2L4M A;  5D5X B;  4DNC A;  3IL2 A;  4L9N A;  4RB2 C;  4HLY A;  2B0L A;  3QP6 A;  1LJ9 A;  3Q9V A;  5LHH A;  4Q5S F;  2Z3Y A;  5DEQ A;  1TW3 A;  1W7P D;  5HLH A;  3WTW C;  1W7P A;  4LLL A;  1OR7 A;  1P4A A;  3IRR A;  2PBI A;  1I5Z A;  1R36 A;  2EV0 A;  3TDZ C;  3EYY A;  3ABU A;  2IA2 A;  1RI7 A;  4OMZ A;  4A2U A;  1FC3 A;  2DU9 A;  1QQI A;  2V1X A;  3WE3 A;  1IN6 A;  4HBL A;  1UHW A;  2A69 F;  1ZAR A;  1BIA A;  2P5K A;  2FA5 A;  3TO6 A;  4LG0 B;  2VBY A;  2PJP A;  1DPR A;  1HXD A;  2ZME A;  4EJU A;  3GFJ A;  1B9N A;  3I53 A;  3KP5 A;  3GEZ A;  2P7V B;  2FMY A;  1YW9 A;  1Z7U A;  3ROU A;  1YO5 C;  1XMK A;  5FO5 A;  4L18 B;  4NQW A;  5DCF A;  1BI3 A;  3I59 B;  4Y17 A;  2EWN A;  3F8B A;  3KZZ A;  2RGV A;  2EFO A;  1FLI A;  3R0A A;  1B59 A;  3DEU A;  3IHU A;  4L5I A;  3QRF F;  3C3W A;  1QO0 D;  3O2P E;  3W6K B;  3HRM A;  1F1Z A;  4ZH4 F;  5LRS A;  2FOK A;  2VBX A;  4I0A A;  5BQT A;  3GF2 A;  5HLG A;  1YQA A;  3HOT A;  2HOE A;  4MQ9 F;  4GYG A;  4GCV A;  2Z5U A;  1XN7 A;  3JTH A;  1ULY A;  5FGM A;  3Q9S A;  2JPB A;  4BAY A;  4IXA A;  4HQE A;  2ZKZ A;  4GYI A;  5J8F A;  3EUH A;  3NEU A;  2VC0 A;  3WTX C;  1SD4 A;  1AOY A;  3DP7 A;  5FLX K;  4XSX F;  3E3V A;  2MBF A;  3ABT A;  1PP7 U;  1XB4 A;  3HYI A;  4FHT A;  4F7Z A;  1ODD A;  3KP6 A;  1HQC A;  2EFP A;  4FT8 A;  3C7J A;  1U6G A;  1LVA A;  3CUQ A;  2KIM A;  1E17 A;  1L0O C;  2F5D A;  4MHG A;  2PLY A;  3GZ6 A;  1RUO A;  1R23 A;  4I01 A;  4ESJ A;  1O3R A;  1WSU A;  2IRF G;  1S7O A;  3U1D A;  3BPV A;  2DK5 A;  2OZU A;  2FBK A;  3REO A;  4LMY A;  5L3D A;  1LNW A;  2K86 A;  1S6L A;  4EGY A;  2D2W A;  3L00 A;  1RUN A;  3I0T A;  2P7C B;  3F8F A;  1B1B A;  1H9G A;  1IXR C;  3BRO A;  4YII A;  3LA3 A;  5L3F A;  4EMS A;  5HLI A;  4LLN A;  3NRV A;  2P5L C;  1T39 A;  3ML6 A;  1V4R A;  2VXZ A;  4G7H F;  1HSJ A;  4U88 A;  4IRI A;  2PN6 A;  1IZ1 A;  3GVA A;  3FMQ A;  3KP2 A;  3J80 K;  1OYI A;  2J5P A;  3ULQ B;  4HZF A;  3B02 A;  5ICF A;  3BOQ A;  3P7N A;  1YS6 A;  4L0Z B;  4AD9 A;  4AIJ A;  2ETH A;  2V6C A;  1B9M A;  4KMU X;  3KET A;  2JT1 A;  3VEP A;  4ESF A;  4E70 A;  5BOX A;  4LGW A;  2QYO A;  4WXH A;  2DLL A;  3K2Z A;  2PMU A;  3F6O A;  3WTV C;  4MQV A;  4R1H A;  1YFH A;  1KQ8 A;  1PDN C;  4WWC A;  2XKO A;  3ISP A;  2FF4 A;  5AIQ A;  4EJO A;  4LK0 F;  4KIC A;  3WU1 B;  3KCC A;  2ZBK A;  1KU7 A;  1W5S A;  3SHF A;  3HSR A;  3WTT C;  4WX9 A;  3DXJ F;  1G3W A;  1CGP A;  4G6Q A;  2XHK A;  3ZMZ A;  4BQA A;  3ZMS A;  1WKM A;  4I0B A;  2HEO A;  1ZGJ A;  4BNC A;  2EV5 A;  2XAH A;  1FOK A;  3HUG A;  3LFK A;  3V7C A;  4LFU A;  2E7X A;  4UUV A;  4A0Y A;  1K78 B;  1U3E M;  3WGG A;  1ZRC A;  1U5T A;  4OMY A;  3P9K A;  2XRN A;  5CJ9 A;  2HKO A;  2HGC A;  1F5T A;  2QBY A;  2IVM A;  2BV6 A;  3MQ0 A;  2CSO A;  3G73 A;  3V8J A;  3K1N A;  2ADU A;  3I5U A;  4U7B A;  2CW0 F;  4WK8 F;  4ENN A;  2QEN A;  2P6S A;  3KLN A;  2DT5 A;  2MH9 A;  2PMH A;  3K0L A;  1J59 A;  3GFM A;  2ZFW A;  3QPT A;  3EET A;  3E6B A;  4N9I A;  5BMZ A;  3WG9 A;  3M8E A;  3CTA A;  5DV5 A;  2CO5 A;  3TGN A;  2LF7 A;  5IT9 K;  2CYY A;  1R1T A;  4L9V A;  4MNU A;  3E6M A;  4IHS A;  2LNB A;  3ZP5 A;  4R79 A;  1JE8 A;  3V7R A;  1FBU A;  2L01 A;  4K2E A;  1Z91 A;  1WQ2 A;  3KP3 A;  3TDU C;  4M9X A;  5E1W A;  1YLF A;  1XSD A;  4UXN A;  1XGO A;  2Z99 A;  3NQO A;  2EV6 A;  1P6R A;  2DBB A;  4EGZ A;  5DCM A;  3RTR A;  1ZGA A;  4YIF A;  2A6E F;  2ZJ2 A;  2P8T A;  2QZ8 A;  4M9Z A;  5HS7 A;  2QQ9 A;  2Z33 A;  1BI2 A;  2IW5 A;  5L3C A;  4KDP A;  5E17 F;  1KU9 A;  1DDN A;  2HQN A;  5ERI A;  4D0P A;  2Y48 A;  2BEO A;  3IRQ A;  2LKP A;  1OKR A;  5E8I A;  3ELK A;  3E5X A;  4OU0 A;  2PI0 A;  4QWQ A;  2PQ8 A;  2QQB A;  2RNJ A;  1QBJ A;  1Z6R A;  2W84 A;  2A5Y B;  2AS5 F;  2W57 A;  4MEY F;  4BXU A;  2D1H A;  1OPC A;  2DPD A;  3WTZ A;  3FM3 A;  1YW8 A;  3HHH A;  5L3E A;  2GXG A;  4L5J A;  2D1V A;  1C0W A;  2WTE A;  2A61 A;  3BWG A;  1T6S A;  1Z9C A;  1TW2 A;  5TJJ A;  3GFL A;  1YW7 A;  4ENK A;  3JAM K;  3CLO A;  1BC8 C;  3DQV C;  5LEK A;  4G6D A;  4HA8 A;  4LLG F;  2H94 A;  2ISZ A;  3E5Q A;  1DUX C;  3GLX A;  2R3S A;  4B09 A;  1IXC A;  1GXP A;  2X4H A;  2L02 A;  4KN4 X;  3EQL F;  2OU2 A;  4LD5 A;  4P55 A;  5JHU A;  3K9T A;  1BIB A;  4G7Z F;  4P9F A;  3TOB A;  1JGS A;  2H09 A;  4CZZ A;  3K1P A;  2V1D A;  2Q2E A;  2H6B A;  4MTD A;  3RI4 A;  4UHT A;  4MGR A;  3T8T A;  5LEJ A;  2ZNZ A;  3FXR A;  1FPQ A;  2F2E A;  3BDD A;  4HAM A;  2RKH A;  3L9F A;  2F5F A;  1SFU A;  2M87 A;  1XCV A;  2MC3 A;  2STT A;  2V9V A;  3BZ6 A;  4P5O A;  1J2X A;  4A0Z A;  1USS A;  4A6E A;  1T2K A;  3HRS A;  3LA2 A;  1LQ1 A;  2OZ6 A;  4WXC A;  3WU0 A;  2DQR A;  3RKW A;  2CFX A;  1TBX A;  3K1M A;  4OIR F;  1FZP B;  4KT5 C;  3M8F A;  3HIF A;  2P4W A;  3T0Y A;  2NS0 A;  3V8L A;  4KN7 X;  3I54 A;  4Q4Z F;  1R58 A;  1IW7 F;  4CO8 A;  1T38 A;  1XGN A;  5IT3 A;  1YTY A;  4YFK F;  1BM9 A;  2LDU A;  2HTS A;  2OQR A;  4ZYH A;  2KKO A;  3LST A;  2M45 A;  2RDP A;  4WXD A;  3DPT A;  4AWX B;  3M9A A;  4IRG A;  2W85 A;  2DW4 A;  4HYE A;  2KJB A;  2IP2 A;  2COM A;  2HDC A;  3WTY C;  3BJA A;  2TDX A;  2LF8 A;  5A2Q Z;  3JSP A;  5HDN A;  1J5Y A;  3H3Z A;  2FU4 A;  1MGT A;  2EA4 A;  3D5L A;  1K78 A;  2EFQ A;  4KMF A;  2F5C A;  4HLX A;  1I1G A;  3GWZ A;  3KP4 A;  3J81 Z;  5D6F A;  2PEX A;  3L2C A;  4AIK A;  3TKY A;  1TNT A;  2ISY A;  5CVV A;  2Y0M A;  1AWC A;  4HW0 A;  4MTE A;  2O0Y A;  1TQP A;  4N0B A;  1QZZ A;  1MD0 A;  1RNL A;  1G4D A;  4HX4 A;  1IRG A;  3KZY A;  3P9C A;  2MA3 A;  3GW2 A;  3EDP A;  5CVI A;  1O7F A;  3LA7 A;  2VN2 A;  5D5V B;  3LQQ A;  2E1C A;  2UWM A;  1XGS A;  4ZYE A;  4HV6 A;  2AXL A;  4JQF A;  3ECH A;  3CUQ C;  1W4M A;  2HTJ A;  1H9T A;  3CO7 C;  5FD6 A;  5F6F A;  4UV8 A;  3J80 Z;  5ILV A;  5KK1 A;  3LAJ A;  5ICE A;  4PCQ A;  2K27 A;  1IF1 A;  2FML A;  4AIH A;  2YX4 A;  2GQQ A;  4EM0 B;  1REP C;  5ICG A;  3E5U A;  3F72 A;  1HST A;  5ICC A;  2GXB A;  1YS7 A;  3IC7 A;  3WGI A;  4G7O F;  2QM3 A;  5BS6 A;  2FSW A;  4G94 A;  2MLG A;  2HFH A;  4CGZ A;  2M5W A;  5CVJ A;  3LWF A;  3N97 A;  4JK1 X;  1FX7 A;  3N4M A;  1YYV A;  5LGU A;  5E1X A;  4OIN F;  1TQI A;  2YU3 A;  3I58 A;  4U0Y A;  2QVO A;  2HKX A;  3E6D A;  2OAZ A;  3RKX A;  3ZMT A;  5F64 A;  1I1S A;  4RGU A;  4EVI A;  2VBZ A;  2OBP A;  2VC1 A;  3TO9 A;  1LB2 A;  4LB6 B;  1MDM A;  2ZCW A;  3ZN0 A;  1Z6T A;  1GVJ A;  3R4K A;  4RB3 C;  4HDU A;  4XLP F;  3F23 A;  2XAJ A;  1LEB A;  1LDD A;  1SD6 A;  4IRH A;  1W7P B;  5D5U B;  1YIO A;  2XUB A;  2K02 A;  2R7D A;  4U0W A;  2P5V A;  5HS8 A;  2WC2 A;  4ZYG A;  5K5O A;  1XCB A;  2Q8K A;  5DD8 A;  3COA C;  1KQ9 A;  4EM1 A;  2W25 A;  1O3S A;  2L4A A;  1G3T A;  1D3Y A;  4ESB A;  1DPU A;  2RN7 A;  2OQG A;  5CLS A;  1BBY A;  1SD7 A;  1IUY A;  5HDG A;  1MJA A;  5D6E A;  1D5V A;  2ZME B;  3WTU C;  1U8R A;  2FNA A;  1KA8 A;  3G3Z A;  1U5T C;  3L7W A;  4IJA A;  3PFI A;  3GX4 X;  1Q1H A;  1SAX A;  2EJR A;  5IT9 Z;  1XSX A;  4YFN F;  1JHH A;  4M6X A;  2ELH A;  3GZ5 A;  3IWZ A;  1FBS A;  4A5M A;  3HOS A;  1P2F A;  1RIO H;  5LGT A;  1J0R A;  1O3T A;  4ENM A;  2FBI A;  3U9G A;  2FXA A;  2HYF A;  3CUO A;  2KRF A;  5EEG A;  2HS5 A;  2NRA C;  3R0J A;  1T98 A;  4CDG A;  3CO6 C;  5LBQ A;  4M72 A;  1P4W A;  3BP8 A;  3GUD A;  2DK8 A;  3SQN A;  1SMT A;  3MZY A;  3SZT A;  1BC7 C;  1ZRE A;  3U2R A;  1WI9 A;  3RDI A;  3DF8 A;  4HF0 A;  4R8H A;  4PDK A;  3T5X A;  1QNT A;  3DV8 A;  4ZZL A;  3WTS C;  3TOA A;  1V3F A;  1U78 A;  4GO1 A;  4BYY A;  3IWF A;  2XAS A;  4P96 A;  4LG0 A;  3PQJ A;  4I02 A;  4M71 A;  3RIR A;  4L0Y B;  1SFX A;  3J7A O;  3DPL C;  1SD5 A;  6PAX A;  2KJC A;  1ZG5 A;  3CUQ B;  1IN7 A;  1OYY A;  1S7A A;  3FZV A;  3I59 A;  3LQR A;  5K5Q A;  1R1V A;  4Y13 A;  3L09 A;  3HTS B;  3FF5 A;  1ZYR F;  2K4B A;  3KEO A;  2UXX A;  1IAW A;  1S29 A;  1LDJ A;  3RKY A;  3SFZ A;  2BGC A;  3MZH A;  4KIG A;  4XSZ F;  2NYX A;  3F21 A;  3V4G A;  4UNO A;  4UVA A;  2GIV A;  2O03 A;  5LRR A;  5LHG A;  2M8E A;  2HQR A;  3KLO A;  3IKT A;  2XAF A;  5DYM A;  2STW A;  1MJB A;  4A12 A;  3WOD F;  2YSR A;  3GO5 A;  3RYR A;  3FXU A;  4I09 A;  2FBH A;  1P92 A;  4N9H A;  2MLK A;  1FT9 A;  1HKS A;  3ZPL A;  4OOI A;  2DQL A;  2EA2 A;  2Q0O A;  2A3S A;  1HW5 A;  3OOP A;  1FY7 A;  1IN8 A;  4GGG A;  2FQ3 A;  2C6Y A;  3F3X A;  1R22 A;  5HS9 A;  1PUE E;  5LGN A;  3FHZ A;  4LB5 A;  1TNS A;  1WWX A;  3FMS A;  5DDG A;  2WWY A;  1R5G A;  3PQK A;  3HRU A;  3AAF A;  4PGG A;  1O7L A;  3OV8 A;  5HDK A;  1FP1 D;  1ZN2 A;  1FWZ A;  2PFB A;  1SMY F;  4CXF A;  2BE5 F;  3M7G A;  1Y0U A;  3SXY A;  3WE2 A;  1D8J A;  4IPA A;  4U7D A;  3R61 A;  2XRO A;  4Z2Y A;  2EB7 A;  2OD5 A;  5JI6 A;  4ON0 A;  3FM5 A;  4I7H A;  4OIQ F;  2VOD A;  1BN5 A;  1EV7 A;  4RB0 A;  5J8C A;  2DI3 A;  4EJV A;  1GHC A;  4RGS A;  3TO7 A;  1HW2 A;  5EEH A;  2MH2 A;  1J9I A;  5KVR A;  3I64 A;  1HKT A;  3HSF A;  3I71 A;  1ONV A;  3R6S A;  1TQM A;  2FNP A;  2P6T A;  2VT2 A;  4LJZ F;  3KFW X;  1U5T B;  4AVP A;  5JVT A;  5ED4 A; 
#chains in the Genus database with same CATH topology
 3FBN B;  3T1B A;  2DPU A;  3BQY A;  2QBY B;  2X1E A;  3TP3 A;  3G2B A;  4ZTF A;  1VQP I;  3J7A Y;  4BGD A;  4ZYD A;  3J7Z I;  3IAS 2;  1YI2 I;  1Z77 A;  3F22 A;  3JR9 A;  4A3L J;  3DEE A;  4AVZ A;  1HDP A;  3M8J A;  2BY1 A;  2KIU A;  2R7F A;  4ZZD A;  4O6J A;  2HR3 A;  1BJA A;  2HWV A;  1FYL A;  3ERE D;  2YX7 A;  2DMN A;  1FMW A;  2M4K A;  4JBA A;  3OOU A;  4XKV A;  1QZE A;  1BI1 A;  2XAG A;  3KX2 A;  3M3Y J;  3IH3 A;  3H3U A;  1O57 A;  2V79 A;  2B7E A;  3I55 I;  1X2M A;  4XN3 A;  5A2Q R;  2ESH A;  1U2W A;  2Y75 A;  1Q1V A;  2ZXJ A;  3FIW A;  2O6G E;  1E2X A;  1CF7 B;  1OCZ H;  2X0L A;  1LDK B;  5FFZ A;  3WHC A;  5EG0 B;  2LKS A;  1T8I A;  2E1N A;  3AG3 H;  3HEF A;  2VE8 A;  3CCS I;  3PL8 A;  2X85 A;  1YX5 A;  3GFI A;  4EEF G;  1I3Q J;  4IQ4 A;  1X3U A;  2JTV A;  4KUM A;  1H88 C;  3WGH A;  2EFW A;  4FIS A;  4RGX A;  1F9N A;  3FX3 A;  2QLZ A;  3FXJ A;  4IVN A;  1UMQ A;  5E18 F;  4MEX F;  1PUF A;  3GYH X;  3J81 R;  3HTU A;  1K61 A;  3DTI A;  5D8K B;  4ETS A;  2IPQ X;  5FLX Z;  2O3F A;  1XMA A;  2RVC A;  2M1B A;  2GLO A;  1T0F A;  4M9S A;  5F1R A;  1IRF A;  1YIJ I;  4HF1 A;  3BJO A;  5L3B A;  2HI3 A;  2W82 A;  1E3O C;  3MKZ A;  2X48 A;  3DKW A;  5JFR A;  4UB8 C;  1LPQ A;  2XF6 A;  3TMO A;  1ACI A;  5K1Y A;  2M7B A;  1LFB A;  5DCM B;  5E3N A;  2A6H F;  3HOW J;  1BOB A;  4CCJ A;  2JA5 J;  3CLQ A;  3EYI A;  4YFX F;  2BYV E;  3CJN A;  3GLL A;  1GLN A;  2DO7 A;  1JGG A;  2WV0 A;  2XB5 A;  1EH6 A;  5DUK A;  2KPM A;  5L3G A;  1ZTR A;  3ECO A;  1UCR A;  4RAZ A;  2D45 A;  1HKQ A;  3VYU B;  5JLX A;  3K4B A;  2VKD A;  2M35 A;  4KFC A;  2VE9 A;  3NAR A;  1WJD A;  4XN0 A;  1DQU A;  2CWE A;  2L9S A;  2ESN A;  2VOP A;  3OR1 C;  1FNN A;  3CCV I;  4IF4 A;  3UNG C;  1PP8 F;  2GZW A;  2DFI A;  3IKV A;  4G8X A;  2AQE A;  1ZG1 A;  3S1M J;  1TT5 B;  1NHA A;  1OLT A;  5E1Z B;  4XLE A;  4C2T A;  2DA4 A;  4E7I A;  1EA3 A;  2L2O A;  2QKM B;  4WF2 A;  2Z9O A;  5KAI C;  2W48 A;  1ETY A;  2P0W A;  1WRJ A;  1WZ2 A;  2VT3 A;  3BR2 A;  3F8C A;  5H6Q A;  3PUF A;  4PSX A;  1JXS A;  1FSE A;  3MKY B;  5HOO A;  4KYW A;  1W5T A;  1G3S A;  4W1U A;  3ZMU A;  2EIM H;  2RQP A;  5D4S A;  1ZAO A;  4A5N A;  1SFO J;  2OA4 A;  4RGR A;  4DYC A;  1IN5 A;  3I4N J;  3FXQ A;  5D4R A;  2FE3 A;  1XGM A;  3H5A A;  5LLQ A;  1J75 A;  1ZH5 A;  4HQM A;  1Z67 A;  1UB9 A;  5J47 A;  1ZHF A;  4XRF A;  1F4K A;  4P9U A;  2O8X A;  3QAH A;  1B8I A;  3O6B B;  5K5R A;  3O3K A;  2EPF A;  2R7Q A;  5A2Q K;  3MAJ A;  2RV8 A;  3ABM H;  5B3S H;  4D1Q A;  1AA7 A;  3Q3S A;  3KE2 A;  1AHD P;  2HYG D;  4EV0 A;  4RMN A;  1W36 D;  1T95 A;  2E7W A;  3QOP A;  2JSC A;  4A3F J;  2VBW A;  4A0X A;  5F04 A;  1OIS A;  3QWL A;  3K7A J;  1Z3Y A;  3M1E A;  3QP5 A;  1UST A;  4EJT A;  3H92 A;  2QQA A;  3FMR A;  3RPU D;  3RPQ A;  2H8W A;  1RPW A;  3RPU A;  4A3G J;  2ECC A;  4I99 C;  3J81 K;  4QTR A;  2E2I J;  2QWW A;  4O5V A;  1XD7 A;  1QPM A;  4PZJ A;  2V4J C;  3CP8 A;  2FOW A;  1FBQ A;  2IA0 A;  2X51 A;  2I5U A;  4S05 A;  3D0S A;  1ITY A;  5IP7 J;  5DUI A;  4HX8 A;  3F8M A;  2KMU A;  3B73 A;  5EGO A;  3TQN A;  2X1C A;  3K70 C;  2A07 F;  1L3L A;  4XKC A;  2VQH A;  1MBJ A;  2PJR A;  4NB5 A;  2CGP A;  4AUX A;  1BL0 A;  3F6V A;  1R1U A;  4QLC U;  4FTH A;  4F55 A;  3K70 D;  1KU3 A;  5J6X A;  1EH8 A;  5ILU A;  3W6J B;  1GV5 A;  2RC4 A;  2KIF A;  1SFE A;  2NNY A;  4GXO A;  2YPR A;  2F5E A;  1IXS B;  4FQG A;  2L3D A;  5DTD A;  4V2F A;  4CYD A;  1GDT A;  2R92 J;  2FRH A;  3K10 A;  4Q47 A;  2ZO4 A;  4KIF A;  3JTG A;  1KQ0 A;  2Q2E B;  3E6C C;  2BVL A;  2XGX A;  3C2G A;  3NWS A;  4HV5 A;  4XLN F;  2R7R A;  3DTK A;  4Y7N J;  4HOB A;  2ZSI B;  4BHP A;  1N78 A;  1MBK A;  1WH7 A;  4EM2 A;  2A5W A;  2M8G X;  3BR1 A;  3LAP A;  4UV9 A;  1D0Z A;  5FKO A;  1HW1 A;  3TW7 A;  3V8K A;  3E97 A;  1TLH B;  2H6C A;  3LMM A;  3V42 A;  1TWF J;  1VTN C;  1MKM A;  4Y33 A;  4IHY A;  1E3P A;  3S2H J;  4KIB A;  2MG4 A;  3KYD B;  2LRE A;  3MWM A;  3QU6 A;  5BPI A;  2EFN A;  2B9S A;  3F8N A;  2NS7 A;  5E3O A;  1O3Q A;  3GTG J;  3CMM A;  1S5L C;  2JRT A;  3NWT A;  5LHI A;  2EK5 A;  2MYS A;  5TRD A;  2M9H A;  1FTT A;  3DCF A;  3BR3 A;  5H6R A;  1T56 A;  1KON A;  1BOA A;  3LL7 A;  4QSH A;  5GP9 A;  1FP2 A;  1JJ8 C;  3S2W A;  3GME A;  3BZK A;  4BE0 A;  3OSF A;  1UHM A;  1FIP A;  2L0K A;  2F6C A;  4XBF A;  2DDB A;  3C18 A;  3R60 A;  4S04 A;  1IV6 A;  2VQG A;  1AKH B;  2F4I A;  1Y1W J;  1SAN A;  2IT0 A;  4N4N B;  2YR2 A;  3KEQ A;  3ZMD A;  4RAY A;  4L9T A;  1EH7 A;  1QGP A;  2DFF A;  3MFK A;  2M7A A;  2CG4 A;  1MMD A;  3FXL A;  3BCB A;  4ZC3 A;  2V1U A;  3BPX A;  2ID3 A;  4HG2 A;  1YG2 A;  4YG2 F;  4NHJ A;  5CVR A;  3HKZ N;  3FKI J;  1Z1D A;  4FX4 A;  1ZRD A;  4C2M J;  2MD5 A;  2O5R A;  2JZY A;  3FXK A;  3ZMV A;  2HXO A;  1SC7 A;  1TTY A;  2UV1 A;  1YJ9 I;  3PJR A;  1RKW A;  1IN4 A;  2V9P A;  2DA1 A;  3L2R A;  1B4A A;  3BJ6 A;  3AG1 H;  2X9D A;  1BR4 A;  3S32 A;  5ILS A;  4E7S A;  1YHQ I;  1JHF A;  4OAZ A;  2XF5 A;  4H0E A;  2PX9 A;  4JP0 A;  1U9N A;  4RS8 A;  2FEZ A;  5C3E J;  4KNY A;  3ZQQ A;  2GWR A;  4RB1 A;  4CYC A;  3CES A;  3BC8 A;  4LK1 F;  3ZQG A;  4UVB A;  4E7Z A;  3I4M J;  2OC6 A;  3ZQ7 A;  1GXQ A;  2VJ5 A;  2L9R A;  5F27 A;  2WA0 A;  2ICW G;  2VXD A;  1IRZ A;  3J7Y J;  1LEA A;  4EJW A;  2VOO A;  2I10 A;  4E7H A;  4Y15 A;  4WCG A;  4PSW A;  4V19 K;  1WJC A;  2K9L A;  4KA4 A;  2R7S A;  2HPM A;  3K69 A;  2GA2 A;  1K6O A;  3QU3 A;  2QA4 I;  1KGS A;  4BDY A;  2R5Z B;  1I27 A;  2XRL A;  1IG7 A;  1I3A A;  2CV2 A;  4A93 J;  3B6A A;  1A31 A;  5GAG J;  1OYW A;  3LNQ A;  2IXS A;  2DTR A;  2RRE A;  2COB A;  3SZG A;  3VOE A;  4M74 A;  5FKK A;  3V7S A;  4U87 A;  4II3 A;  1BJZ A;  1MW7 A;  4BKX A;  3JRG A;  1ETW A;  2GA1 A;  4ZJZ A;  4I98 B;  2OF7 A;  4XRM A;  1ZRF A;  1CF7 A;  4CIC A;  1ETK A;  1BA5 A;  1XC5 A;  3LSK A;  1MBH A;  5M3M J;  3JSO A;  1NH3 A;  3BTC A;  2DDA A;  2AO9 A;  4IHT A;  3ASO H;  1JKP C;  5D8L B;  4OIO F;  1EKE A;  2NVU B;  3MEX A;  5AIP A;  3RJP A;  3I9V 2;  1FYK A;  3TED A;  3TW6 A;  3H9Q A;  4A6D A;  2J5O A;  2XKP A;  1QVT A;  1TWG J;  1B72 A;  4O3M A;  3FK7 A;  3HSE A;  5F08 A;  2EH3 A;  2A68 F;  1B6A A;  2K4J A;  4BY1 J;  3I4P A;  1ZLK A;  4BJ5 C;  1Z05 A;  4Q48 A;  1R5H A;  3VFZ A;  5B66 C;  1J7K A;  1G6N A;  1P4X A;  4AU7 A;  1K83 J;  3VWB A;  4ASN A;  4DQ2 A;  4XIC A;  1LFU P;  4HDV A;  4IO9 F;  4BQO A;  1ON1 A;  1R00 A;  2BBY A;  2IGO A;  1PJR A;  2GAU A;  3CDH A;  2IA1 A;  3SZP A;  2E5N A;  3HRT A;  5IP9 J;  1ZG3 A;  3BY6 A;  2HZT A;  4PK4 A;  3JAM Z;  5DM6 F;  2XVC A;  4IZZ A;  3RZO J;  1K4T A;  1D8K A;  1S8N A;  3H1C A;  4G9Y A;  2VON A;  4PGH A;  1TT0 A;  1W1W E;  3VYS B;  2BHY A;  3MN2 A;  3P9I A;  4C30 A;  3ABK H;  1XDS A;  1VQ5 I;  1QZY A;  2XV4 S;  5E20 A;  2K40 A;  1DP7 P;  2M30 A;  3KPH A;  1I6X A;  1R9T J;  5BPD A;  2DFH A;  1X1P A;  2UZK A;  2ACJ A;  2DMP A;  2NNN A;  5KHD A;  2IJL A;  1BI0 A;  3VYT B;  1OJL A;  3AL0 C;  1MZB A;  1MNM C;  2DA3 A;  4BBR J;  5E79 C;  5CVU A;  2KT0 A;  3FHN A;  5H20 A;  1HA8 A;  3K4N A;  3VOD A;  1ZKG A;  4EQQ A;  2OTJ I;  4TV7 A;  5HNH A;  2QSF X;  4BHC A;  3GXO A;  2H1K A;  5E8G A;  3VB2 A;  5CYV A;  1X1A A;  1XDU A;  2O61 A;  3SEQ A;  2DXI A;  4OIP F;  4PJM A;  2NAZ A;  2VJJ A;  2ZNY A;  4M73 A;  2KP6 A;  3MKW B;  1UFM A;  5HVQ C;  2L54 A;  1V5F A;  1R7J A;  5JR3 A;  2Z16 A;  1HF0 A;  4L9J A;  3ZN1 A;  3HGG A;  3VDX A;  4BH9 A;  2CQQ A;  3FXO A;  2IAI A;  2UXN A;  5AON A;  4IHX A;  1XSV A;  2L7M P;  1FSH A;  1TWH J;  3GCM A;  1K7A A;  2H27 A;  3FWE A;  4NC7 A;  1MDM B;  2W24 A;  5KNL A;  2CQK A;  5FB2 A;  2W7N A;  1S3J A;  3CF5 F;  2VJI A;  3GTP J;  1X4P A;  3CP2 A;  3KP7 A;  3CME I;  4IHW A;  3C1D A;  3S3M A;  2XB0 X;  4QPQ A;  3H35 A;  3OYC A;  1G3Y A;  2K7L A;  1V54 H;  4BU2 A;  3G6E I;  2DAO A;  4F3Q A;  1OMI A;  2R5Y B;  2K3F A;  5CQE A;  2CW8 A;  5J40 A;  3A01 B;  2LYC A;  1MH4 A;  2LSO A;  4YRV A;  2G7U A;  1V5E A;  2BOL A;  1OFC X;  3FXM A;  3Q0W A;  4RDU A;  2DA7 A;  1Y0N A;  3CF2 A;  4BHB A;  1VZ0 A;  1FMV A;  1HBX G;  3BT9 A;  3DFG A;  4IOA F;  4FX0 A;  4IEJ A;  3MCZ A;  3QPH A;  4UVC A;  1SFK A;  5IYB J;  1FYM A;  3RYP A;  5DM7 F;  1Z3X A;  3HPH A;  1V55 H;  4I2O A;  2WY7 Q;  1A04 A;  1K79 A;  3HHG A;  1UG2 A;  2L9N A;  3JW4 A;  1H0M A;  3OIP A;  5FD5 A;  4M6Y A;  2G7H A;  5D5W B;  2MW8 A;  2DYS H;  4J01 A;  1MJ9 A;  4CCN A;  2X6Y A;  2G9W A;  3HOX J;  2WAQ N;  5DD4 A;  3MD2 A;  1ZLJ A;  4GDF A;  2QUF A;  2JSP A;  2LY9 A;  2JA6 J;  4W97 A;  3HGY A;  4YEJ A;  3Q5F A;  4ENJ A;  1WFX A;  4U0V A;  1QU3 A;  4CHU A;  1BW5 A;  1A36 A;  4C3J J;  2PG4 A;  4B8X A;  4HF2 A;  1ON2 A;  3MVP A;  4HX7 A;  3PSI A;  2L5Q A;  2XAQ A;  1KYW A;  1J09 A;  2JPC A;  3CDL A;  1DP3 A;  3D5R C;  1VI0 A;  5FFX A;  3T8R A;  2EIN H;  1KU2 A;  1RZ4 A;  1WH5 A;  3KYL A;  1UJ8 A;  2A6T A;  5GTI C;  3K2A A;  4JX4 A;  5EF6 A;  1KYZ A;  1LUJ B;  3W3C A;  2XIG A;  2RAE A;  3X2Q H;  1STZ A;  2CUF A;  4BE1 A;  3L2W A;  2F4M B;  4X0G A;  2L4M A;  5D5X B;  4DNC A;  1VND A;  4IHV A;  4LIV A;  4BL0 B;  3IL2 A;  4L9N A;  3MMY B;  3GTL J;  2R7O A;  3N05 A;  4RB2 C;  4HLY A;  4BQQ A;  2B0L A;  3QP6 A;  1LJ9 A;  2JMW A;  3Q9V A;  2K3P A;  5IP6 A;  5GPC A;  3LSH A;  1F36 A;  5LHH A;  1M1E B;  2M0M A;  2Z3Y A;  5DEQ A;  4Q5S F;  1TW3 A;  2Y0S A;  1W7P D;  5HLH A;  3SDG A;  3WTW C;  1W7P A;  4LLL A;  2LRD A;  1K6Y A;  1OR7 A;  1P4A A;  3IRR A;  2PBI A;  1I5Z A;  2P0T A;  1WPK A;  5FLX R;  1R36 A;  2EV0 A;  2MD0 A;  2XDV A;  3C2H A;  3EYY A;  3TDZ C;  1WJB A;  3OYK A;  3ABU A;  2ELK A;  2IA2 A;  2HVR A;  2X1D A;  4AID A;  2VQC A;  1RI7 A;  3CCJ I;  4OMZ A;  4A2U A;  1RES A;  1FC3 A;  2DU9 A;  1QQI A;  2YS9 A;  3ZQC A;  1HC8 A;  2KDO A;  2BW3 B;  2V1X A;  3WE3 A;  3U21 A;  5IOY A;  1AKH A;  1IN6 A;  4AYB A;  4KIT B;  3KYC B;  1JKR C;  2MC4 A;  2XSJ C;  4HBL A;  2E35 A;  4B48 A;  1UHW A;  1WJE A;  2VB6 A;  1ZR2 A;  4XL9 A;  3TL4 X;  1T0F C;  3CCE I;  2A69 F;  1RKT A;  2HQA A;  1ZAR A;  1BIA A;  2P5K A;  2FA5 A;  3TO6 A;  4LG0 B;  2VBY A;  1X1B A;  3AFH A;  2PJP A;  2IS1 A;  3OYA A;  1DPR A;  3DTE A;  1QHG A;  2WBM A;  1HXD A;  2ZME A;  3KZI C;  4EJU A;  2E19 A;  4BUP A;  3CJR B;  3GFJ A;  1U9O A;  4BY7 J;  1B9N A;  1LKX A;  3I53 A;  3KP5 A;  3PIO F;  1VQL I;  3GEZ A;  5FKN A;  2P7V B;  1ZGW A;  2MGQ A;  4C3H J;  2FMY A;  1YW9 A;  1Z7U A;  3DBR B;  4XOP A;  3D5S C;  2BXY A;  3ROU A;  1YO5 C;  1LE8 B;  2EZI A;  1XMK A;  3HOY J;  5FO5 A;  4L18 B;  4BEH B;  3BR5 A;  4NQW A;  2EBI A;  3DEW A;  4RBO A;  2XAU A;  5DCF A;  4B44 A;  2Z1D A;  3OWT A;  1BI3 A;  3I59 B;  4Y17 A;  2EWN A;  3F8B A;  3PFY A;  3KZZ A;  2RGV A;  2EFO A;  1FLI A;  3M4O J;  3GTK J;  3R0A A;  1B59 A;  3DEU A;  3IHU A;  4L5I A;  2V1N A;  1ZK8 A;  3QRF F;  3C3W A;  1QO0 D;  4M3G A;  3O2P E;  3ONQ A;  3W6K B;  3HRM A;  1JUS A;  4YIR X;  4NC8 A;  2DA2 A;  1F1Z A;  3NAU A;  1T33 A;  4ZH4 F;  5LRS A;  3WG7 H;  1VQO I;  2FOK A;  2VBX A;  1EF4 A;  2GXA A;  1X58 A;  4I0A A;  4BDZ A;  5BQT A;  3GF2 A;  1IC8 A;  2F5V A;  2VIX A;  5HLG A;  1DU0 A;  1YQA A;  2E71 A;  3HOT A;  2HOE A;  4MQ9 F;  3J80 R;  4GYG A;  3S14 J;  1OCO H;  4GCV A;  2Z5U A;  1R4N B;  3QYF A;  4FE4 A;  2LBF B;  1XN7 A;  3JTH A;  1ULY A;  4CZC A;  5FGM A;  3Q9S A;  3O8H A;  2JPB A;  4BAY A;  4IXA A;  4CH7 A;  4HQE A;  2ZKZ A;  4GYI A;  1WJA A;  4J19 A;  2LP0 A;  3AL0 B;  5J8F A;  1HLV A;  5F1J A;  3EUH A;  4I76 A;  3NEU A;  2VC0 A;  5FJ8 J;  3D1N I;  3WTX C;  2NXN B;  1SD4 A;  1AOY A;  3DP7 A;  1DGW Y;  3OYD A;  5EDN A;  4XSX F;  5FLX K;  3E3V A;  4XM3 A;  2K9M A;  1W36 C;  2MBF A;  2QF7 A;  1HDD C;  3OY9 A;  3ABT A;  1PP7 U;  1XB4 A;  3HYI A;  3HXL A;  4BE2 A;  3BG9 A;  2QKL B;  2PMZ A;  1TC3 C;  3CC2 I;  1JUP A;  4FHT A;  1RQ6 A;  4F7Z A;  2JA7 J;  3LOC A;  1ODD A;  3KP6 A;  1S72 I;  1HQC A;  2EFP A;  1LVK A;  1Z7L A;  3I3L A;  1S9H A;  4FT8 A;  3C7J A;  3H0G J;  1U6G A;  1LVA A;  2L7F P;  3CUQ A;  4DIQ A;  2KIM A;  3BG6 A;  2KIQ A;  1G2H A;  2NS8 A;  2W4S A;  1E17 A;  4X1E A;  1L0O C;  2F5D A;  4MHG A;  2PLY A;  3GZ6 A;  3IAM 2;  5J1R A;  3ZQL A;  1RUO A;  4FE7 A;  1R23 A;  4XKB A;  4I01 A;  2IS4 A;  1D0Y A;  4ESJ A;  1O3R A;  2MUN A;  4B1R A;  1WSU A;  2EIJ H;  2IRF G;  4A3J J;  4DYR A;  1S7O A;  4M3B A;  3U1D A;  1YRN B;  3BPV A;  2DK5 A;  2OZU A;  3PIP F;  2LY1 A;  2FBK A;  3REO A;  5F0F A;  4LMY A;  5L3D A;  1LNW A;  2LH9 A;  3GTQ J;  2K86 A;  1S6L A;  3A03 A;  1SVM A;  4EGY A;  1KZH A;  3H9J A;  3S8P A;  2D2W A;  2ZXW H;  3L00 A;  2AQF A;  1RUN A;  1Y8Q B;  3JCU C;  3HG9 A;  3I0T A;  1UG0 A;  5LD2 C;  1JT0 A;  2P7C B;  3F8F A;  1B1B A;  1QPI A;  2CQX A;  1WI3 A;  3M07 A;  1H9G A;  1IXR C;  1XX5 A;  3EUA A;  5LFA A;  3BRO A;  5GAD J;  4YII A;  3IUO A;  2M0C A;  2IS2 A;  3LA3 A;  5L3F A;  2ECB A;  2M3A A;  2P81 A;  4EMS A;  5HLI A;  4LLN A;  4CUG A;  3NRV A;  2P5L C;  1T39 A;  3ML6 A;  3JRI A;  5K7Z A;  1V4R A;  2DYR H;  2VXZ A;  5TIS C;  4HNV A;  1WCM J;  4G7H F;  1W0U A;  1HSJ A;  4U88 A;  4IRI A;  4BXX J;  2VI6 A;  4A3D J;  2PN6 A;  1IZ1 A;  3GVA A;  1JTX A;  3FMQ A;  3KP2 A;  2JRM A;  3J80 K;  4IX7 A;  2O9L A;  2QGU A;  4PJJ A;  1XTA A;  3OYE A;  2XC7 A;  1OYI A;  4D5C A;  2J5P A;  3ULQ B;  4HZF A;  3B02 A;  5JLW A;  4XLC A;  5ICF A;  3K4J A;  1G8X A;  1IRX A;  4XLF A;  3BOQ A;  3P7N A;  1IDY A;  1YS6 A;  1NTC A;  2R7V A;  4L0Z B;  4HEA 2;  4AD9 A;  4AIJ A;  2IS6 A;  2ETH A;  2V6C A;  1B9M A;  4KMU X;  2WAE A;  3KET A;  2HDW A;  2JT1 A;  3BG5 A;  3QPL A;  3VEP A;  4HST A;  4ESF A;  4XRS A;  4E70 A;  1G59 A;  3W2A A;  5BOX A;  4LGW A;  1D0X A;  2QYO A;  4WXH A;  4BQN A;  2DLL A;  2CRG A;  1IV8 A;  2Y69 H;  3K2Z A;  5IT9 R;  4LIT A;  1F43 A;  2PMU A;  3F6O A;  5HOD A;  3WTV C;  3K4L A;  4MQV A;  4R1H A;  1YFH A;  1KQ8 A;  1RRJ A;  1HOM A;  2LOO A;  1PDN C;  4PJN A;  4WWC A;  1X3W B;  2VPR A;  2JN6 A;  4KJZ A;  4L5E A;  2XKO A;  3ISP A;  2FF4 A;  5AIQ A;  4EJO A;  1N25 A;  1D1A A;  4LK0 F;  3QQA A;  4KIC A;  3WU1 B;  2IGN A;  1MIJ A;  3KCC A;  2ZBK A;  1TWA J;  4Y3O A;  1KU7 A;  1VQ7 I;  1CQT A;  1W5S A;  1H8A C;  3SHF A;  4GRI A;  3HSR A;  3WTT C;  1VQ8 I;  5FRN A;  4NNJ A;  2OV7 A;  1I50 J;  3ZGK A;  4WX9 A;  2WY8 Q;  2HQ5 A;  3DXJ F;  1G3W A;  5B1B H;  1CGP A;  2K9S A;  4G6Q A;  2XHK A;  3ZMZ A;  4BQA A;  1PUF B;  3LSI A;  3ZMS A;  3JRD A;  1YOV B;  3BTJ A;  3CD6 I;  1WKM A;  2KQR A;  4I0B A;  2HEO A;  1ZGJ A;  2EZL A;  4BJ6 C;  4BNC A;  3H5R A;  2XPU A;  2LMD A;  2EV5 A;  3PM1 A;  2XAH A;  1FOK A;  1FTZ A;  2OCC H;  3HUG A;  4EAT A;  1MND A;  3LFK A;  3V7C A;  4UUS A;  4LFU A;  2BY0 A;  4F52 A;  1GUU A;  2E7X A;  3HZJ A;  3CZ6 A;  4A0Y A;  4UUV A;  1K78 B;  1U3E M;  3WGG A;  1ZRC A;  1U5T A;  2HDD A;  5H2F C;  4OMY A;  3P9K A;  3QPS A;  2XRN A;  5CJ9 A;  1RC9 A;  2HKO A;  2R7W A;  3CCY A;  2HGC A;  1F5T A;  2NVT J;  2QBY A;  2IVM A;  3LSR A;  2BV6 A;  3MQ0 A;  1MSF C;  3L2Q A;  2CSO A;  3G73 A;  2QQ8 A;  4B43 A;  3V8J A;  2F48 A;  5J4V A;  2NOG A;  3K1N A;  2ZXI A;  2X6O A;  1Y1V J;  2ADU A;  3I5U A;  1ERD A;  5HLT A;  4U7B A;  2CW0 F;  4WK8 F;  4D5F A;  4NUB A;  3BZC A;  1IGN A;  4ENN A;  4PFO A;  2QEN A;  4CSW A;  2P6S A;  3KLN A;  2ZJR F;  2DT5 A;  2MH9 A;  2PMH A;  2CH0 A;  2OJE D;  2Y31 A;  3K0L A;  5JVG F;  2V26 A;  4F92 B;  1O4X A;  2N8G A;  1J59 A;  3GFM A;  1VFC A;  3PO3 J;  2LG4 A;  3BTL A;  3CMY A;  2ZFW A;  3QPT A;  2VKE A;  3EET A;  3F9K A;  5EG0 A;  3E6B A;  4N9I A;  5BMZ A;  3WG9 A;  3KEY A;  3S1Q J;  3M8E A;  4AYB N;  5GAE J;  4BBS J;  3GZN B;  2X98 A;  3CTA A;  1JKQ C;  5DV5 A;  2CO5 A;  3TGN A;  2LF7 A;  5IT9 K;  2DA6 A;  1WHU A;  2CYY A;  3LFU A;  5J1Y A;  1A5J A;  2JUG A;  1R1T A;  3HC7 A;  1NK3 P;  4L9V A;  4MNU A;  1MSE C;  4A3E J;  2R93 J;  3E6M A;  4IHS A;  1B8I B;  2LNB A;  3S1N J;  3ZP5 A;  4R79 A;  1JE8 A;  3V7R A;  4KIS A;  1ETQ A;  1FBU A;  2K9Q A;  3K6G A;  2L01 A;  4K2E A;  1Z91 A;  1WQ2 A;  1MBE A;  3KP3 A;  2BZT A;  3LSJ A;  2CMP A;  2CUZ A;  2Y9Y A;  3TDU C;  1JKO C;  4M9X A;  3OYF A;  4MIM A;  5E1W A;  1YLF A;  5K7H A;  3DBH B;  1XSD A;  4UXN A;  3HOV J;  1HCR A;  1XGO A;  2Z99 A;  5EEA A;  5IY5 H;  1X19 A;  1D1B A;  3NQO A;  2EV6 A;  3S17 J;  1P6R A;  2DBB A;  4EGZ A;  4XR6 A;  1YX3 A;  2QCO A;  2DOA A;  2VQL A;  5DCM A;  4RAF A;  1XMX A;  2JVG A;  4KT6 A;  3RTR A;  1ZGA A;  4YIF A;  2A6E F;  2ZJ2 A;  4BEH A;  2P8T A;  2QZ8 A;  2GOM A;  4M9Z A;  4MFD A;  5HS7 A;  5J1U A;  1R49 A;  2GBY A;  2QQ9 A;  2Z33 A;  2NVQ J;  2YU9 J;  1BI2 A;  2ZXH A;  2IW5 A;  5L3C A;  3HOZ J;  2DTZ A;  3OYL A;  4KDP A;  5E17 F;  1KU9 A;  4OWR B;  3CJT B;  3OYG A;  1DDN A;  2HQN A;  3DLA A;  5ERI A;  5EGO B;  3QYE A;  1VQM I;  4D0P A;  2Y48 A;  2DOF A;  1ETV A;  2O8K A;  2BEO A;  3H36 A;  2PJR B;  3IRQ A;  1MBG A;  3TBI A;  1SVO A;  3HL2 A;  3HOU J;  3CCR I;  2LKP A;  2CU7 A;  1OKR A;  2DOD A;  5E8I A;  3ELK A;  5GAH J;  4ZDL A;  3DKY A;  3E5X A;  3VSL A;  4OU0 A;  1ZQ3 P;  2PI0 A;  4QWQ A;  2PQ8 A;  3DLL F;  2QQB A;  5FKL A;  2RNJ A;  4XNF A;  1U8B A;  1QBJ A;  1JI8 A;  1Z6R A;  4RAG A;  3A4C A;  3S2D J;  2W84 A;  2XGD A;  2A5Y B;  4LG3 A;  1ENH A;  1ZEL A;  3F0C A;  2AS5 F;  2W57 A;  4MEY F;  5CPR B;  3PO2 J;  1OCP A;  1W5C C;  1TP4 A;  4BXU A;  2D1H A;  4II2 A;  4Z6Y A;  1OPC A;  2DPD A;  1P7I A;  3WTZ A;  1VQ9 I;  3FM3 A;  1YW8 A;  3HHH A;  3ZCO A;  4E7K A;  3FIS A;  2DT7 B;  3S15 J;  5L3E A;  1VQN I;  3L1P A;  2JJ7 A;  2XSD C;  2GXG A;  4L5J A;  2D1V A;  1QA6 A;  1C0W A;  2WTE A;  2A61 A;  2AXT C;  3BWG A;  2K9N A;  2DJN A;  4PJL A;  1T6S A;  1IJW C;  1Z9C A;  1TW2 A;  4XMY A;  5TJJ A;  2LVS A;  4MO7 A;  3GFL A;  3RZD J;  1YW7 A;  4H4K C;  2L7K A;  4ENK A;  3JAM K;  3BR6 A;  3CLO A;  4IKF A;  2M2E A;  3UKG A;  1FOX A;  4RLF A;  1BC8 C;  1X1D A;  2F4O B;  1X2N A;  3DQV C;  5LEK A;  2W00 A;  4G6D A;  4HA8 A;  2M4G A;  2ZSH B;  4LLG F;  4DOZ A;  4QIW N;  4A3B J;  2EQR A;  2HVQ A;  3LSG A;  2KDZ A;  3B6C A;  2H94 A;  2ISZ A;  2FUG 2;  4J00 A;  3E5Q A;  1R5I D;  4DBQ A;  2I8D A;  2FX0 A;  4C3I J;  1DUX C;  2VLA A;  3GLX A;  2R3S A;  3HKZ A;  4B09 A;  1IXC A;  2KIS A;  3L2U A;  1GXP A;  2X4H A;  3E7L A;  3PUB A;  2L02 A;  4KN4 X;  3EQL F;  2OU2 A;  4LD5 A;  4P55 A;  5JHU A;  3K9T A;  4Y4R A;  1BIB A;  4P9F A;  4G7Z F;  3TOB A;  1JGS A;  2H09 A;  4CZZ A;  3K1P A;  1QRY A;  1A6I A;  3CCM I;  5M5X J;  2V1D A;  2Q2E A;  3ZQF A;  2DCE A;  1WGX A;  2H6B A;  4XOT A;  4MTD A;  3RI4 A;  4UHT A;  4MGR A;  3T8T A;  3JRC A;  1APL C;  5LEJ A;  2ZNZ A;  2IEK A;  3FXR A;  1FPQ A;  2F2E A;  3BDD A;  3JRE A;  2MAB A;  1MBF A;  1SVL A;  2RKH A;  4HAM A;  5CKT A;  3OYB A;  1DU6 A;  3L9F A;  2F5F A;  1SFU A;  4CYC B;  2M87 A;  1XCV A;  2MC3 A;  2M34 A;  2STT A;  1OR7 C;  2HOA A;  2X6W A;  3JRH A;  2V9V A;  4B3A A;  3BZ6 A;  1PYV A;  3A0H C;  3K4K A;  1IDZ A;  5EZG A;  4MFE A;  4P5O A;  2E60 A;  1J2X A;  3DU5 A;  4CCO A;  4A0Z A;  1GVD A;  2OPT A;  1USS A;  4A6E A;  1T2K A;  3HRS A;  3FKJ A;  3LA2 A;  1LQ1 A;  2OZ6 A;  4A3K J;  4WXC A;  3WU0 A;  2DQR A;  3RKW A;  3A2K A;  2EIL H;  2CFX A;  2K5C A;  3OMY A;  5TGT A;  4HNT A;  1TBX A;  3BLY A;  3K1M A;  5C44 J;  1X4O A;  5IPA A;  2CFO A;  1RR7 A;  4OIR F;  1FZP B;  4KT5 C;  3M8F A;  1JJ6 C;  9ANT A;  4LOC A;  2QEX I;  2HYJ A;  3BR0 A;  3HIF A;  2P4W A;  2E34 A;  3CQZ J;  3T0Y A;  3S16 J;  5IYC J;  4XLH A;  4S0H B;  2NS0 A;  5GTH C;  3V8L A;  4KN7 X;  2ZC2 A;  3I54 A;  4Q4Z F;  1FJL A;  2DT6 A;  3HJE A;  3OYH A;  1R58 A;  1MNE A;  2ZME C;  2H1L A;  2Y30 A;  3DU6 A;  1XPX A;  2KHM A;  2K85 A;  1IW7 F;  1UHS A;  4CO8 A;  5J4Y A;  2G0E A;  1T38 A;  2WAD A;  4M3E A;  1XGN A;  5IT3 A;  1YTY A;  4YFK F;  4JOM A;  1BM9 A;  3ASN H;  2Z2S B;  2LDU A;  3DWL E;  4G6T B;  5IOZ A;  1UEL B;  2HTS A;  2OQR A;  4ZYH A;  2KKO A;  3LST A;  2M45 A;  2RDP A;  3SJM A;  4WXD A;  3DPT A;  4AWX B;  1B72 B;  1R4M B;  2KL4 A;  3M9A A;  4IRG A;  2W85 A;  2DW4 A;  4HYE A;  5M5W J;  2KJB A;  2LR8 A;  4D7N A;  1BW6 A;  1BR2 A;  2COM A;  2IP2 A;  4JYK A;  2HDC A;  2ZJQ F;  1WJF A;  3WTY C;  1TWC J;  3BJA A;  5FLM J;  3K4C A;  2E1M C;  3ZRG A;  2TDX A;  2LF8 A;  5A2Q Z;  3W2V A;  3HPG A;  3JSP A;  3S3N A;  2CQ7 A;  1DGR M;  5HDN A;  1BR1 A;  1J5Y A;  1H89 C;  3QYB A;  5EYR A;  3GTO J;  2X6X A;  3GTM J;  1Y6I A;  3H3Z A;  4BJT A;  3HDD A;  2FU4 A;  1MGT A;  2EA4 A;  2JK3 A;  3D5L A;  3E1S A;  4PUS A;  3RCO A;  1Y39 A;  1K78 A;  2EFQ A;  5B1A H;  3JRB A;  4GFB A;  4KMF A;  2ID6 A;  3K4M A;  2F5C A;  4HLX A;  3OIO A;  1I1G A;  2IGK A;  3GWZ A;  3KP4 A;  3J81 Z;  5D6F A;  2PEX A;  3L2C A;  4V2G A;  4AIK A;  3TKY A;  1TNT A;  4F93 B;  2ISY A;  5CVV A;  2Y0M A;  1AWC A;  4HW0 A;  4MTE A;  2O0Y A;  5M3F J;  3OIQ A;  4IOC F;  1TQP A;  1Z0X A;  4N0B A;  2R5Z A;  4MLO A;  2CV1 A;  1SEU A;  1QZZ A;  1MD0 A;  1RNL A;  1U0J A;  2RQQ A;  2Y2Z A;  2CJJ A;  3EUH C;  1R6R A;  5C4J J;  1G4D A;  2KFD A;  2V7F A;  2XPV A;  2E5Z A;  2R4G A;  4HX4 A;  1IRG A;  3KZY A;  1OCC H;  3P9C A;  2CUJ A;  1A6Q A;  1I39 A;  2MA3 A;  3GW2 A;  3EDP A;  1POG A;  2KRH A;  5CVI A;  1LFP A;  4XKW A;  3VYR B;  1O7F A;  3LA7 A;  2VN2 A;  2KRC A;  1UZC A;  5D5V B;  2RNG A;  3LQQ A;  4XID A;  2E1C A;  4HSR A;  2UWM A;  1XGS A;  2EZK A;  3SFI A;  1YE9 A;  2OCE A;  4B4C A;  4ZYE A;  2WV1 A;  4HV6 A;  2AXL A;  3H3V K;  4CCL A;  4JQF A;  3ECH A;  3CUQ C;  2LLK A;  3CC4 I;  4AM3 A;  1W4M A;  2HTJ A;  1H9T A;  3SYT A;  3CO7 C;  1W0T A;  2MZ4 A;  2XPW A;  5FD6 A;  4FAS D;  3AG4 H;  1V5G A;  5F6F A;  4DBR A;  4UV8 A;  3GTJ J;  3J80 Z;  4HRI A;  1I6H J;  2BY2 A;  4HPQ A;  3A1Y A;  5F0H A;  5ILV A;  5KK1 A;  3CC7 I;  3LAJ A;  5ICE A;  2XF7 A;  4PCQ A;  2K27 A;  5B5E C;  1IF1 A;  2FML A;  4AIH A;  2CV0 A;  2YX4 A;  2GQQ A;  4EM0 B;  1REP C;  1YJW I;  2LD5 A;  4DYQ A;  5ICG A;  5E3M A;  2ZFU A;  3E5U A;  3F72 A;  1HST A;  5ICC A;  2FJ1 A;  2GXB A;  3S93 A;  4RM3 A;  3VPR A;  4A69 C;  1YS7 A;  4XON A;  5F0C A;  1ORK A;  2ME6 A;  2TRT A;  3IC7 A;  3WGI A;  4G7O F;  1RET A;  2QM3 A;  5BS6 A;  2FSW A;  2WB1 A;  3CJQ B;  4G94 A;  3Q0V A;  2MLG A;  2HFH A;  2ELJ A;  4B3X A;  5FKM A;  2L9V A;  2WAQ A;  2QSH X;  4CGZ A;  2M5W A;  5CVJ A;  3LWF A;  2GM4 A;  1GT0 C;  3N97 A;  4JK1 X;  3MKL A;  1ZR4 A;  4CCM A;  1FX7 A;  2LFB A;  3G4S I;  4D9J A;  3N4M A;  2VUM J;  2LK2 A;  1YYV A;  4AC0 A;  5LGU A;  4XOR A;  5E1X A;  1MH3 A;  4OIN F;  4IQJ A;  1TQI A;  1MMS A;  2YU3 A;  4N4O B;  1OQY A;  3I58 A;  4U0Y A;  2QVO A;  2HKX A;  3E6D A;  2BY3 A;  2OAZ A;  3RKX A;  3ZMT A;  5F64 A;  4Y52 J;  3HM5 A;  2E2H J;  2HOT A;  3ERM A;  3G1L A;  2L7Z A;  2DMT A;  3ZOB A;  2NVY J;  1I1S A;  4RGU A;  4ZYA A;  1P7J A;  4EVI A;  4X6A J;  5IYD J;  4QPO A;  2VBZ A;  2OBP A;  2VC1 A;  3TO9 A;  3AKZ A;  1LB2 A;  4LB6 B;  4JX6 A;  1FOW A;  4ZDO A;  1MDM A;  1K4S A;  3KIO A;  2ZCW A;  3ZN0 A;  3H0D A;  1Z6T A;  2OUM A;  1GVJ A;  2R7Z J;  3R4K A;  4RB3 C;  4HDU A;  2IBD A;  4BAC A;  4XLP F;  2EZH A;  2TCT A;  3F23 A;  3IH4 A;  1MMG A;  2R5Y A;  2XAJ A;  1XS9 A;  1LEB A;  1LDD A;  1SD6 A;  2HU9 A;  1W7P B;  4IRH A;  4E6K G;  5D5U B;  1YIO A;  3A01 A;  3CCL I;  2XUB A;  3WU2 C;  5BNG A;  2H8R A;  3MZ8 A;  1WVR A;  1EJ9 A;  3WHB A;  2KZV A;  2FQ4 A;  2K02 A;  3IH2 A;  2R7D A;  4U0W A;  1VQ6 I;  2P5V A;  3OYN A;  3PNY A;  5HS8 A;  2UUZ A;  3OYI A;  2WC2 A;  4ZYG A;  5K5O A;  1XCB A;  2Q8K A;  3FDY A;  4PJ0 C;  3DBL B;  5KCM A;  5DD8 A;  3COA C;  4F91 B;  1KQ9 A;  1YJN I;  4EM1 A;  2VJ4 A;  2W25 A;  3OS0 A;  2L4A A;  1O3S A;  3A52 A;  2R7T A;  2O7O A;  1G3T A;  1D3Y A;  4ESB A;  4UY8 I;  1DPU A;  2RN7 A;  5KAF C;  2HPI A;  2OQG A;  5CLS A;  1BBY A;  1SD7 A;  3DPU A;  4DW6 A;  4RLQ A;  2QSG X;  3BG3 A;  1PVE A;  3EUK L;  4IL6 C;  4BXF A;  2LTP A;  1IUY A;  5HDG A;  3C2B A;  1MJA A;  5D6E A;  1D5V A;  2ZME B;  4E4H A;  3AG2 H;  3IP4 B;  3WTU C;  1U8R A;  4YEL A;  5EJC A;  1Z21 A;  3HBL A;  4A3M J;  2FNA A;  3OL3 A;  2BHZ A;  2IGM A;  4UUT A;  1KA8 A;  3G3Z A;  1U5T C;  3L7W A;  4IJA A;  3PFI A;  3GX4 X;  1Q1H A;  1SAX A;  2EJR A;  5IT9 Z;  4E7L A;  1Y56 A;  1XSX A;  2HVS A;  3GBG A;  3SEZ A;  4YFN F;  3U1K A;  1JHH A;  3PNT A;  4M6X A;  2FD5 A;  4NQW B;  2JVH A;  3G71 I;  4C2U A;  2ELH A;  3GZ5 A;  3IWZ A;  1FBS A;  4A5M A;  2Q1Z B;  3HOS A;  2LKX A;  2DOE A;  1P2F A;  1RIO H;  2VPL A;  4ANJ A;  5LGT A;  4B47 A;  3OS2 A;  1J0R A;  1MMN A;  1O3T A;  4ENM A;  2FBI A;  3U9G A;  2E1M B;  2FXA A;  2HYF A;  1SAU A;  1AU7 A;  1UAA A;  3CUO A;  2KRF A;  5EEG A;  4RM2 A;  2AHQ A;  2LY2 A;  4HNU A;  1A35 A;  2Y0S N;  2HS5 A;  4M3F A;  3RSN A;  2NRA C;  1XG1 A;  1T98 A;  3R0J A;  4CDG A;  1QHH D;  3BG7 A;  3CO6 C;  3S1R J;  1P9Q C;  4DGW B;  5LBQ A;  4M72 A;  1WJ5 A;  1P4W A;  2HNH A;  3BP8 A;  2DK8 A;  3GUD A;  3SQN A;  4DZP A;  1N75 A;  1SMT A;  3MZY A;  3G1M A;  3SZT A;  1BC7 C;  4ABZ A;  1ZRE A;  3U2R A;  1WI9 A;  4UB6 C;  5GPA A;  2DA5 A;  5FLV A;  3RDI A;  5EZH A;  4JX5 A;  2BW3 A;  2CS3 A;  3DF8 A;  4HF0 A;  2GIZ A;  3PSF A;  3JAM R;  4R8H A;  4PDK A;  5FRO A;  3T5X A;  1S7E A;  1NG7 A;  1QNT A;  3DV8 A;  3H9G A;  3M1C A;  1JUM A;  1TL8 A;  4ZZL A;  3P5J A;  4DZJ A;  3WTS C;  3DKX A;  3IV5 A;  3TOA A;  1V3F A;  1U78 A;  4CA0 A;  4GO1 A;  4ZDP A;  4BYY A;  4NC6 A;  3IWF A;  2MVT A;  2XAS A;  5DS9 A;  4P96 A;  4LG0 A;  4A3I J;  3FK6 A;  3PQJ A;  2XGE A;  4I02 A;  4M71 A;  3RIR A;  1IO2 A;  1YIT I;  4L0Y B;  2CW7 A;  3OR2 C;  1D5Y A;  1JT6 A;  1VF9 A;  2D5V A;  4ITV A;  4M3D A;  1SFX A;  3RQ4 A;  3J7A O;  3W6V A;  3DPL C;  1LE8 A;  3LSP A;  1SD5 A;  2V9K A;  6PAX A;  2KJC A;  1ZG5 A;  3CUQ B;  3O8G A;  1IN7 A;  1OYY A;  1S7A A;  2MSY A;  5JHF A;  3JRA A;  3FZV A;  3I59 A;  2W1O A;  1T08 B;  3LQR A;  5K5Q A;  5FRM A;  2R7X A;  1R1V A;  2V6E A;  4Y13 A;  3L09 A;  2CQN A;  3HTS B;  3FF5 A;  4CCK A;  1ZYR F;  2GOX B;  5C4X J;  2K4B A;  3KEO A;  1FOY A;  2UXX A;  1IAW A;  2JQ7 A;  3HB9 A;  1S29 A;  3ZQH A;  1LDJ A;  3RKY A;  3SFZ A;  3PNV A;  2BGC A;  3MZH A;  4KIG A;  4XSZ F;  1E0E A;  2HOS A;  2NYX A;  4ZTJ A;  1MMA A;  3F21 A;  1FEX A;  3V4G A;  4FCY A;  4UNO A;  4RA2 A;  4UVA A;  2GIV A;  2O03 A;  1FIA A;  5LRR A;  3SDB A;  2WAF A;  5LHG A;  2KZG A;  2LBF A;  2HQR A;  2M8E A;  3KLO A;  2XAF A;  5DYM A;  3IKT A;  2STW A;  2CUE A;  2ME0 A;  1MJB A;  1Y8R B;  4A12 A;  1ETO A;  3WOD F;  2YSR A;  2DN0 A;  3GO5 A;  2JWT A;  4G12 A;  3RYR A;  1VQ4 I;  4XLA A;  2ZB9 A;  3QOE A;  3OYJ A;  4E7J A;  3CCQ I;  3FXU A;  4I09 A;  2NVX J;  2FBH A;  1N77 A;  1P92 A;  4N9H A;  2MLK A;  3BTI A;  1FT9 A;  1HKS A;  3FBI B;  3ZPL A;  4OOI A;  2DQL A;  1VQK I;  4LIU A;  3G1O A;  2EA2 A;  2Q0O A;  2A3S A;  4I6Z A;  1QVU A;  3OS1 A;  1HW5 A;  3OOP A;  1FY7 A;  1IN8 A;  4GGG A;  2FQ3 A;  3CMA I;  2C6Y A;  3F3X A;  1R22 A;  5HS9 A;  3TP0 A;  1PUE E;  5LGN A;  2BXZ A;  2JA8 J;  3FHZ A;  4LB5 A;  4DJA A;  4XQF A;  2OTL I;  2PMZ N;  2BVM A;  1TNS A;  1WWX A;  2LC2 A;  1OCT C;  2NOJ B;  1X1C A;  3FMS A;  5DDG A;  2E36 A;  1R5G A;  2VKH A;  2WWY A;  5K7F A;  2DMQ A;  2R0Q C;  2Y9Z A;  3A02 A;  3PQK A;  1JTY A;  3HRU A;  4XK4 A;  3AAF A;  4PGG A;  1O7L A;  3OV8 A;  3VSK A;  5HDK A;  3QOD A;  4BS9 A;  1FP1 D;  1ZN2 A;  4C9Y A;  3I56 I;  1NG6 A;  1FWZ A;  1X3Z B;  3J7A W;  4P1W A;  1GV2 A;  4PFP A;  2PFB A;  1E3H A;  2A05 A;  3E0J B;  4OAY A;  1SMY F;  4CXF A;  2R7U A;  2BE5 F;  3M7G A;  4FET A;  1Y0U A;  3SXY A;  1OCR H;  3WE2 A;  1D8J A;  4IPA A;  4U7D A;  2HXI A;  3R61 A;  2HZD A;  5HNF A;  3Q0U A;  2XRO A;  2XGC A;  4Z2Y A;  1YRN A;  2YUS A;  3ABL H;  4NDL A;  1RR8 C;  2EB7 A;  3RQI A;  2E1O A;  2OD5 A;  3W2W A;  3BQZ A;  5JI6 A;  1R71 A;  3L2V A;  2B63 J;  4ON0 A;  3CDI A;  3FM5 A;  4I7H A;  2JUC A;  4OIQ F;  5J3L A;  2WB1 N;  3BCA A;  2VOD A;  2DFE A;  1BN5 A;  3ZQI A;  4M6V A;  3A0B C;  1NK2 P;  4A3C J;  1EV7 A;  4RB0 A;  3ESW B;  1TZL A;  3ZR8 X;  5J8C A;  2VAS A;  2DI3 A;  3OL4 A;  4EJV A;  4RGS A;  1GHC A;  2VL8 A;  1D1C A;  1ETX A;  2JA2 A;  3RKQ A;  2MFZ A;  3TO7 A;  1HW2 A;  3LSM A;  4XRS G;  5EEH A;  3H5N A;  3JRF A;  2DJI A;  2MH2 A;  3OSG A;  1J9I A;  5KVR A;  2KLO A;  3EPZ A;  5E3L A;  2DMU A;  3HUG B;  3I64 A;  3UR3 C;  1HKT A;  3HSF A;  4UUS B;  3CCU I;  3I71 A;  1ONV A;  2ZJP F;  2EIK H;  5M5Y J;  3R6S A;  3OYM A;  1TQM A;  2FNP A;  2VKV A;  1IUF A;  2E2J J;  2P6T A;  2VT2 A;  4NBQ A;  3ZXS A;  4LJZ F;  4D7M A;  3KFW X;  1U5T B;  4AVP A;  3S3O A;  5JVT A;  5CQG A;  5ED4 A; 
#chains in the Genus database with same CATH homology
 3T1B A;  2DPU A;  2QBY B;  4ZYD A;  3F22 A;  2KIU A;  2R7F A;  4ZZD A;  4O6J A;  2HR3 A;  1BJA A;  2HWV A;  1FYL A;  3ERE D;  2YX7 A;  4JBA A;  1BI1 A;  2XAG A;  3H3U A;  1O57 A;  2V79 A;  2ESH A;  1U2W A;  2Y75 A;  2O6G E;  2ZXJ A;  1E2X A;  1CF7 B;  2X0L A;  1LDK B;  5FFZ A;  2E1N A;  2VE8 A;  3GFI A;  1X3U A;  2JTV A;  4KUM A;  3WGH A;  2EFW A;  4RGX A;  1F9N A;  3FX3 A;  2QLZ A;  4IVN A;  5E18 F;  4MEX F;  3GYH X;  3HTU A;  5D8K B;  4ETS A;  2IPQ X;  5FLX Z;  2O3F A;  1XMA A;  2RVC A;  2M1B A;  1T0F A;  4M9S A;  5F1R A;  1IRF A;  4HF1 A;  3BJO A;  5L3B A;  3DKW A;  5JFR A;  5K1Y A;  5DCM B;  2A6H F;  3EYI A;  4YFX F;  2BYV E;  3CJN A;  2DO7 A;  2WV0 A;  1EH6 A;  5DUK A;  5L3G A;  3ECO A;  1UCR A;  4RAZ A;  2D45 A;  1HKQ A;  4KFC A;  2VE9 A;  2CWE A;  2ESN A;  2VOP A;  1FNN A;  4IF4 A;  1PP8 F;  2GZW A;  2DFI A;  3IKV A;  4G8X A;  1ZG1 A;  1NHA A;  5E1Z B;  4WF2 A;  2Z9O A;  1WRJ A;  2VT3 A;  3F8C A;  5H6Q A;  1JXS A;  1FSE A;  5HOO A;  4KYW A;  1W5T A;  1G3S A;  3ZMU A;  2RQP A;  5D4S A;  1ZAO A;  4A5N A;  2OA4 A;  4RGR A;  1IN5 A;  3FXQ A;  5D4R A;  2FE3 A;  1XGM A;  5LLQ A;  1J75 A;  1ZH5 A;  4HQM A;  1UB9 A;  1ZHF A;  4XRF A;  1F4K A;  4P9U A;  2O8X A;  3QAH A;  3O6B B;  5K5R A;  3O3K A;  5A2Q K;  3MAJ A;  2RV8 A;  3KE2 A;  2HYG D;  4EV0 A;  2E7W A;  3QOP A;  2JSC A;  2VBW A;  4A0X A;  3M1E A;  3QP5 A;  1UST A;  4EJT A;  3H92 A;  2QQA A;  3FMR A;  3RPQ A;  3RPU A;  3J81 K;  2QWW A;  4O5V A;  1XD7 A;  1QPM A;  4PZJ A;  1FBQ A;  2IA0 A;  4S05 A;  3D0S A;  5DUI A;  4HX8 A;  3F8M A;  3B73 A;  3TQN A;  2A07 F;  1L3L A;  4NB5 A;  2CGP A;  3F6V A;  1R1U A;  4QLC U;  1KU3 A;  5J6X A;  1EH8 A;  5ILU A;  3W6J B;  2RC4 A;  2KIF A;  1SFE A;  2NNY A;  4GXO A;  2YPR A;  2F5E A;  1IXS B;  4CYD A;  2L3D A;  2FRH A;  4Q47 A;  2ZO4 A;  4KIF A;  3JTG A;  1KQ0 A;  3E6C C;  2XGX A;  4HV5 A;  4XLN F;  4HOB A;  4BHP A;  4EM2 A;  3LAP A;  4UV9 A;  1HW1 A;  3V8K A;  3E97 A;  1TLH B;  2H6C A;  1VTN C;  1MKM A;  4KIB A;  3MWM A;  5BPI A;  3QU6 A;  2EFN A;  3F8N A;  1O3Q A;  2JRT A;  5LHI A;  2EK5 A;  5TRD A;  5H6R A;  1BOA A;  1FP2 A;  3S2W A;  1UHM A;  4XBF A;  3C18 A;  3R60 A;  4S04 A;  2IT0 A;  2YR2 A;  3KEQ A;  3ZMD A;  4RAY A;  4L9T A;  1EH7 A;  1QGP A;  3MFK A;  2CG4 A;  2V1U A;  3BPX A;  1YG2 A;  4YG2 F;  4NHJ A;  5CVR A;  1Z1D A;  4FX4 A;  1ZRD A;  2MD5 A;  2JZY A;  3ZMV A;  1TTY A;  1IN4 A;  1B4A A;  3BJ6 A;  5ILS A;  1JHF A;  4H0E A;  4RS8 A;  2FEZ A;  4KNY A;  2GWR A;  4RB1 A;  4LK1 F;  4UVB A;  3ZQ7 A;  1GXQ A;  1LEA A;  4EJW A;  2VOO A;  4Y15 A;  4WCG A;  4KA4 A;  3K69 A;  2GA2 A;  1K6O A;  3QU3 A;  1KGS A;  1I27 A;  1OYW A;  2DTR A;  3VOE A;  4M74 A;  3V7S A;  2GA1 A;  4I98 B;  1ZRF A;  1CF7 A;  4CIC A;  3JSO A;  4IHT A;  5D8L B;  4OIO F;  3MEX A;  5AIP A;  3RJP A;  1FYK A;  4A6D A;  2J5O A;  2XKP A;  4O3M A;  3HSE A;  2A68 F;  1B6A A;  2K4J A;  3I4P A;  1ZLK A;  1Z05 A;  4Q48 A;  1R5H A;  3VFZ A;  1J7K A;  1G6N A;  1P4X A;  4ASN A;  4DQ2 A;  4HDV A;  1ON1 A;  1R00 A;  2BBY A;  2GAU A;  3CDH A;  2IA1 A;  3SZP A;  3HRT A;  1ZG3 A;  2HZT A;  3BY6 A;  3JAM Z;  2XVC A;  1D8K A;  1S8N A;  2VON A;  4G9Y A;  4PGH A;  3P9I A;  1XDS A;  1QZY A;  2XV4 S;  5E20 A;  1DP7 P;  2M30 A;  1I6X A;  5BPD A;  2UZK A;  2ACJ A;  2NNN A;  2IJL A;  1BI0 A;  1MZB A;  5CVU A;  5H20 A;  3VOD A;  4EQQ A;  4TV7 A;  4BHC A;  3GXO A;  5E8G A;  3VB2 A;  5CYV A;  1XDU A;  2O61 A;  4OIP F;  2NAZ A;  2ZNY A;  4M73 A;  1UFM A;  5HVQ C;  2L54 A;  5JR3 A;  1R7J A;  4L9J A;  3ZN1 A;  4BH9 A;  2UXN A;  5AON A;  1XSV A;  1FSH A;  1K7A A;  2H27 A;  3FWE A;  1MDM B;  2W24 A;  2CQK A;  5FB2 A;  1S3J A;  3KP7 A;  3C1D A;  1G3Y A;  2K7L A;  2DAO A;  1OMI A;  2LSO A;  2G7U A;  4BHB A;  1HBX G;  3DFG A;  4FX0 A;  3MCZ A;  3QPH A;  4UVC A;  1FYM A;  3RYP A;  4I2O A;  1A04 A;  1K79 A;  3HHG A;  1H0M A;  3JW4 A;  5FD5 A;  4M6Y A;  2G7H A;  5D5W B;  1MJ9 A;  2G9W A;  5DD4 A;  1ZLJ A;  2QUF A;  3Q5F A;  4ENJ A;  4U0V A;  4CHU A;  2PG4 A;  4B8X A;  4HF2 A;  1ON2 A;  4HX7 A;  2XAQ A;  1KYW A;  2JPC A;  5FFX A;  3T8R A;  1KU2 A;  1RZ4 A;  1KYZ A;  2XIG A;  1STZ A;  2L4M A;  5D5X B;  4DNC A;  3IL2 A;  4L9N A;  4RB2 C;  4HLY A;  2B0L A;  3QP6 A;  1LJ9 A;  3Q9V A;  5LHH A;  4Q5S F;  2Z3Y A;  5DEQ A;  1TW3 A;  1W7P D;  5HLH A;  3WTW C;  1W7P A;  4LLL A;  1OR7 A;  1P4A A;  3IRR A;  2PBI A;  1I5Z A;  1R36 A;  2EV0 A;  3TDZ C;  3EYY A;  3ABU A;  2IA2 A;  1RI7 A;  4OMZ A;  4A2U A;  1FC3 A;  2DU9 A;  1QQI A;  2V1X A;  3WE3 A;  1IN6 A;  4HBL A;  1UHW A;  2A69 F;  1ZAR A;  1BIA A;  2P5K A;  2FA5 A;  3TO6 A;  4LG0 B;  2VBY A;  2PJP A;  1DPR A;  1HXD A;  2ZME A;  4EJU A;  3GFJ A;  1B9N A;  3I53 A;  3KP5 A;  3GEZ A;  2P7V B;  2FMY A;  1YW9 A;  1Z7U A;  3ROU A;  1YO5 C;  1XMK A;  5FO5 A;  4L18 B;  4NQW A;  5DCF A;  1BI3 A;  3I59 B;  4Y17 A;  2EWN A;  3F8B A;  3KZZ A;  2RGV A;  2EFO A;  1FLI A;  3R0A A;  1B59 A;  3DEU A;  3IHU A;  4L5I A;  3QRF F;  3C3W A;  1QO0 D;  3O2P E;  3W6K B;  3HRM A;  1F1Z A;  4ZH4 F;  5LRS A;  2FOK A;  2VBX A;  4I0A A;  5BQT A;  3GF2 A;  5HLG A;  1YQA A;  3HOT A;  2HOE A;  4MQ9 F;  4GYG A;  4GCV A;  2Z5U A;  1XN7 A;  3JTH A;  1ULY A;  5FGM A;  3Q9S A;  2JPB A;  4BAY A;  4IXA A;  4HQE A;  2ZKZ A;  4GYI A;  5J8F A;  3EUH A;  3NEU A;  2VC0 A;  3WTX C;  1SD4 A;  1AOY A;  3DP7 A;  5FLX K;  4XSX F;  3E3V A;  2MBF A;  3ABT A;  1PP7 U;  1XB4 A;  3HYI A;  4FHT A;  4F7Z A;  1ODD A;  3KP6 A;  1HQC A;  2EFP A;  4FT8 A;  3C7J A;  1U6G A;  1LVA A;  3CUQ A;  2KIM A;  1E17 A;  1L0O C;  2F5D A;  4MHG A;  2PLY A;  3GZ6 A;  1RUO A;  1R23 A;  4I01 A;  4ESJ A;  1O3R A;  1WSU A;  2IRF G;  1S7O A;  3U1D A;  3BPV A;  2DK5 A;  2OZU A;  2FBK A;  3REO A;  4LMY A;  5L3D A;  1LNW A;  2K86 A;  1S6L A;  4EGY A;  2D2W A;  3L00 A;  1RUN A;  3I0T A;  2P7C B;  3F8F A;  1B1B A;  1H9G A;  1IXR C;  3BRO A;  4YII A;  3LA3 A;  5L3F A;  4EMS A;  5HLI A;  4LLN A;  3NRV A;  2P5L C;  1T39 A;  3ML6 A;  1V4R A;  2VXZ A;  4G7H F;  1HSJ A;  4U88 A;  4IRI A;  2PN6 A;  1IZ1 A;  3GVA A;  3FMQ A;  3KP2 A;  3J80 K;  1OYI A;  2J5P A;  3ULQ B;  4HZF A;  3B02 A;  5ICF A;  3BOQ A;  3P7N A;  1YS6 A;  4L0Z B;  4AD9 A;  4AIJ A;  2ETH A;  2V6C A;  1B9M A;  4KMU X;  3KET A;  2JT1 A;  3VEP A;  4ESF A;  4E70 A;  5BOX A;  4LGW A;  2QYO A;  4WXH A;  2DLL A;  3K2Z A;  2PMU A;  3F6O A;  3WTV C;  4MQV A;  4R1H A;  1YFH A;  1KQ8 A;  1PDN C;  4WWC A;  2XKO A;  3ISP A;  2FF4 A;  5AIQ A;  4EJO A;  4LK0 F;  4KIC A;  3WU1 B;  3KCC A;  2ZBK A;  1KU7 A;  1W5S A;  3SHF A;  3HSR A;  3WTT C;  4WX9 A;  3DXJ F;  1G3W A;  1CGP A;  4G6Q A;  2XHK A;  3ZMZ A;  4BQA A;  3ZMS A;  1WKM A;  4I0B A;  2HEO A;  1ZGJ A;  4BNC A;  2EV5 A;  2XAH A;  1FOK A;  3HUG A;  3LFK A;  3V7C A;  4LFU A;  2E7X A;  4UUV A;  4A0Y A;  1K78 B;  1U3E M;  3WGG A;  1ZRC A;  1U5T A;  4OMY A;  3P9K A;  2XRN A;  5CJ9 A;  2HKO A;  2HGC A;  1F5T A;  2QBY A;  2IVM A;  2BV6 A;  3MQ0 A;  2CSO A;  3G73 A;  3V8J A;  3K1N A;  2ADU A;  3I5U A;  4U7B A;  2CW0 F;  4WK8 F;  4ENN A;  2QEN A;  2P6S A;  3KLN A;  2DT5 A;  2MH9 A;  2PMH A;  3K0L A;  1J59 A;  3GFM A;  2ZFW A;  3QPT A;  3EET A;  3E6B A;  4N9I A;  5BMZ A;  3WG9 A;  3M8E A;  3CTA A;  5DV5 A;  2CO5 A;  3TGN A;  2LF7 A;  5IT9 K;  2CYY A;  1R1T A;  4L9V A;  4MNU A;  3E6M A;  4IHS A;  2LNB A;  3ZP5 A;  4R79 A;  1JE8 A;  3V7R A;  1FBU A;  2L01 A;  4K2E A;  1Z91 A;  1WQ2 A;  3KP3 A;  3TDU C;  4M9X A;  5E1W A;  1YLF A;  1XSD A;  4UXN A;  1XGO A;  2Z99 A;  3NQO A;  2EV6 A;  1P6R A;  2DBB A;  4EGZ A;  5DCM A;  3RTR A;  1ZGA A;  4YIF A;  2A6E F;  2ZJ2 A;  2P8T A;  2QZ8 A;  4M9Z A;  5HS7 A;  2QQ9 A;  2Z33 A;  1BI2 A;  2IW5 A;  5L3C A;  4KDP A;  5E17 F;  1KU9 A;  1DDN A;  2HQN A;  5ERI A;  4D0P A;  2Y48 A;  2BEO A;  3IRQ A;  2LKP A;  1OKR A;  5E8I A;  3ELK A;  3E5X A;  4OU0 A;  2PI0 A;  4QWQ A;  2PQ8 A;  2QQB A;  2RNJ A;  1QBJ A;  1Z6R A;  2W84 A;  2A5Y B;  2AS5 F;  2W57 A;  4MEY F;  4BXU A;  2D1H A;  1OPC A;  2DPD A;  3WTZ A;  3FM3 A;  1YW8 A;  3HHH A;  5L3E A;  2GXG A;  4L5J A;  2D1V A;  1C0W A;  2WTE A;  2A61 A;  3BWG A;  1T6S A;  1Z9C A;  1TW2 A;  5TJJ A;  3GFL A;  1YW7 A;  4ENK A;  3JAM K;  3CLO A;  1BC8 C;  3DQV C;  5LEK A;  4G6D A;  4HA8 A;  4LLG F;  2H94 A;  2ISZ A;  3E5Q A;  1DUX C;  3GLX A;  2R3S A;  4B09 A;  1IXC A;  1GXP A;  2X4H A;  2L02 A;  4KN4 X;  3EQL F;  2OU2 A;  4LD5 A;  4P55 A;  5JHU A;  3K9T A;  1BIB A;  4G7Z F;  4P9F A;  3TOB A;  1JGS A;  2H09 A;  4CZZ A;  3K1P A;  2V1D A;  2Q2E A;  2H6B A;  4MTD A;  3RI4 A;  4UHT A;  4MGR A;  3T8T A;  5LEJ A;  2ZNZ A;  3FXR A;  1FPQ A;  2F2E A;  3BDD A;  4HAM A;  2RKH A;  3L9F A;  2F5F A;  1SFU A;  2M87 A;  1XCV A;  2MC3 A;  2STT A;  2V9V A;  3BZ6 A;  4P5O A;  1J2X A;  4A0Z A;  1USS A;  4A6E A;  1T2K A;  3HRS A;  3LA2 A;  1LQ1 A;  2OZ6 A;  4WXC A;  3WU0 A;  2DQR A;  3RKW A;  2CFX A;  1TBX A;  3K1M A;  4OIR F;  1FZP B;  4KT5 C;  3M8F A;  3HIF A;  2P4W A;  3T0Y A;  2NS0 A;  3V8L A;  4KN7 X;  3I54 A;  4Q4Z F;  1R58 A;  1IW7 F;  4CO8 A;  1T38 A;  1XGN A;  5IT3 A;  1YTY A;  4YFK F;  1BM9 A;  2LDU A;  2HTS A;  2OQR A;  4ZYH A;  2KKO A;  3LST A;  2M45 A;  2RDP A;  4WXD A;  3DPT A;  4AWX B;  3M9A A;  4IRG A;  2W85 A;  2DW4 A;  4HYE A;  2KJB A;  2IP2 A;  2COM A;  2HDC A;  3WTY C;  3BJA A;  2TDX A;  2LF8 A;  5A2Q Z;  3JSP A;  5HDN A;  1J5Y A;  3H3Z A;  2FU4 A;  1MGT A;  2EA4 A;  3D5L A;  1K78 A;  2EFQ A;  4KMF A;  2F5C A;  4HLX A;  1I1G A;  3GWZ A;  3KP4 A;  3J81 Z;  5D6F A;  2PEX A;  3L2C A;  4AIK A;  3TKY A;  1TNT A;  2ISY A;  5CVV A;  2Y0M A;  1AWC A;  4HW0 A;  4MTE A;  2O0Y A;  1TQP A;  4N0B A;  1QZZ A;  1MD0 A;  1RNL A;  1G4D A;  4HX4 A;  1IRG A;  3KZY A;  3P9C A;  2MA3 A;  3GW2 A;  3EDP A;  5CVI A;  1O7F A;  3LA7 A;  2VN2 A;  5D5V B;  3LQQ A;  2E1C A;  2UWM A;  1XGS A;  4ZYE A;  4HV6 A;  2AXL A;  4JQF A;  3ECH A;  3CUQ C;  1W4M A;  2HTJ A;  1H9T A;  3CO7 C;  5FD6 A;  5F6F A;  4UV8 A;  3J80 Z;  5ILV A;  5KK1 A;  3LAJ A;  5ICE A;  4PCQ A;  2K27 A;  1IF1 A;  2FML A;  4AIH A;  2YX4 A;  2GQQ A;  4EM0 B;  1REP C;  5ICG A;  3E5U A;  3F72 A;  1HST A;  5ICC A;  2GXB A;  1YS7 A;  3IC7 A;  3WGI A;  4G7O F;  2QM3 A;  5BS6 A;  2FSW A;  4G94 A;  2MLG A;  2HFH A;  4CGZ A;  2M5W A;  5CVJ A;  3LWF A;  3N97 A;  4JK1 X;  1FX7 A;  3N4M A;  1YYV A;  5LGU A;  5E1X A;  4OIN F;  1TQI A;  2YU3 A;  3I58 A;  4U0Y A;  2QVO A;  2HKX A;  3E6D A;  2OAZ A;  3RKX A;  3ZMT A;  5F64 A;  1I1S A;  4RGU A;  4EVI A;  2VBZ A;  2OBP A;  2VC1 A;  3TO9 A;  1LB2 A;  4LB6 B;  1MDM A;  2ZCW A;  3ZN0 A;  1Z6T A;  1GVJ A;  3R4K A;  4RB3 C;  4HDU A;  4XLP F;  3F23 A;  2XAJ A;  1LEB A;  1LDD A;  1SD6 A;  4IRH A;  1W7P B;  5D5U B;  1YIO A;  2XUB A;  2K02 A;  2R7D A;  4U0W A;  2P5V A;  5HS8 A;  2WC2 A;  4ZYG A;  5K5O A;  1XCB A;  2Q8K A;  5DD8 A;  3COA C;  1KQ9 A;  4EM1 A;  2W25 A;  1O3S A;  2L4A A;  1G3T A;  1D3Y A;  4ESB A;  1DPU A;  2RN7 A;  2OQG A;  5CLS A;  1BBY A;  1SD7 A;  1IUY A;  5HDG A;  1MJA A;  5D6E A;  1D5V A;  2ZME B;  3WTU C;  1U8R A;  2FNA A;  1KA8 A;  3G3Z A;  1U5T C;  3L7W A;  4IJA A;  3PFI A;  3GX4 X;  1Q1H A;  1SAX A;  2EJR A;  5IT9 Z;  1XSX A;  4YFN F;  1JHH A;  4M6X A;  2ELH A;  3GZ5 A;  3IWZ A;  1FBS A;  4A5M A;  3HOS A;  1P2F A;  1RIO H;  5LGT A;  1J0R A;  1O3T A;  4ENM A;  2FBI A;  3U9G A;  2FXA A;  2HYF A;  3CUO A;  2KRF A;  5EEG A;  2HS5 A;  2NRA C;  3R0J A;  1T98 A;  4CDG A;  3CO6 C;  5LBQ A;  4M72 A;  1P4W A;  3BP8 A;  3GUD A;  2DK8 A;  3SQN A;  1SMT A;  3MZY A;  3SZT A;  1BC7 C;  1ZRE A;  3U2R A;  1WI9 A;  3RDI A;  3DF8 A;  4HF0 A;  4R8H A;  4PDK A;  3T5X A;  1QNT A;  3DV8 A;  4ZZL A;  3WTS C;  3TOA A;  1V3F A;  1U78 A;  4GO1 A;  4BYY A;  3IWF A;  2XAS A;  4P96 A;  4LG0 A;  3PQJ A;  4I02 A;  4M71 A;  3RIR A;  4L0Y B;  1SFX A;  3J7A O;  3DPL C;  1SD5 A;  6PAX A;  2KJC A;  1ZG5 A;  3CUQ B;  1IN7 A;  1OYY A;  1S7A A;  3FZV A;  3I59 A;  3LQR A;  5K5Q A;  1R1V A;  4Y13 A;  3L09 A;  3HTS B;  3FF5 A;  1ZYR F;  2K4B A;  3KEO A;  2UXX A;  1IAW A;  1S29 A;  1LDJ A;  3RKY A;  3SFZ A;  2BGC A;  3MZH A;  4KIG A;  4XSZ F;  2NYX A;  3F21 A;  3V4G A;  4UNO A;  4UVA A;  2GIV A;  2O03 A;  5LRR A;  5LHG A;  2M8E A;  2HQR A;  3KLO A;  3IKT A;  2XAF A;  5DYM A;  2STW A;  1MJB A;  4A12 A;  3WOD F;  2YSR A;  3GO5 A;  3RYR A;  3FXU A;  4I09 A;  2FBH A;  1P92 A;  4N9H A;  2MLK A;  1FT9 A;  1HKS A;  3ZPL A;  4OOI A;  2DQL A;  2EA2 A;  2Q0O A;  2A3S A;  1HW5 A;  3OOP A;  1FY7 A;  1IN8 A;  4GGG A;  2FQ3 A;  2C6Y A;  3F3X A;  1R22 A;  5HS9 A;  1PUE E;  5LGN A;  3FHZ A;  4LB5 A;  1TNS A;  1WWX A;  3FMS A;  5DDG A;  2WWY A;  1R5G A;  3PQK A;  3HRU A;  3AAF A;  4PGG A;  1O7L A;  3OV8 A;  5HDK A;  1FP1 D;  1ZN2 A;  1FWZ A;  2PFB A;  1SMY F;  4CXF A;  2BE5 F;  3M7G A;  1Y0U A;  3SXY A;  3WE2 A;  1D8J A;  4IPA A;  4U7D A;  3R61 A;  2XRO A;  4Z2Y A;  2EB7 A;  2OD5 A;  5JI6 A;  4ON0 A;  3FM5 A;  4I7H A;  4OIQ F;  2VOD A;  1BN5 A;  1EV7 A;  4RB0 A;  5J8C A;  2DI3 A;  4EJV A;  1GHC A;  4RGS A;  3TO7 A;  1HW2 A;  5EEH A;  2MH2 A;  1J9I A;  5KVR A;  3I64 A;  1HKT A;  3HSF A;  3I71 A;  1ONV A;  3R6S A;  1TQM A;  2FNP A;  2P6T A;  2VT2 A;  4LJZ F;  3KFW X;  1U5T B;  4AVP A;  5JVT A;  5ED4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...